(data stored in ACNUC7421 zone)

EMBL: CU468230

ID   CU468230; SV 2; circular; genomic DNA; STD; PRO; 3421954 BP.
XX
AC   CU468230;
XX
PR   Project:PRJNA13001;
XX
DT   26-FEB-2008 (Rel. 94, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Acinetobacter baumannii SDF, complete genome.
XX
KW   .
XX
OS   Acinetobacter baumannii SDF
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Moraxellaceae; Acinetobacter;
OC   Acinetobacter calcoaceticus/baumannii complex.
XX
RN   [1]
RP   1-3421954
RA   Genoscope - CEA;
RT   ;
RL   Submitted (25-FEB-2008) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-3421954
RX   DOI; 10.1371/journal.pone.0001805.
RX   PUBMED; 18350144.
RA   Vallenet D., Nordmann P., Barbe V., Poirel L., Mangenot S., Bataille E.,
RA   Dossat C., Gas S., Kreimeyer A., Lenoble P., Oztas S., Poulain J.,
RA   Segurens B., Robert C., Abergel C., Claverie J.-M., Raoult D., Medigue C.,
RA   Weissenbach J., Cruveiller S.;
RT   "Comparative analysis of Acinetobacters: three genomes for three
RT   lifestyles";
RL   PLoS One 3(3):e1805-e1805(2008).
XX
DR   MD5; 04842d5ef462ba724d299fd76ea4caa2.
DR   BioSample; SAMEA3138277.
DR   EnsemblGenomes-Gn; ABSDF0013.
DR   EnsemblGenomes-Gn; ABSDF0014.
DR   EnsemblGenomes-Gn; ABSDF0017.
DR   EnsemblGenomes-Gn; ABSDF0055.
DR   EnsemblGenomes-Gn; ABSDF0084.
DR   EnsemblGenomes-Gn; ABSDF0085.
DR   EnsemblGenomes-Gn; ABSDF0102.
DR   EnsemblGenomes-Gn; ABSDF0125.
DR   EnsemblGenomes-Gn; ABSDF0126.
DR   EnsemblGenomes-Gn; ABSDF0130.
DR   EnsemblGenomes-Gn; ABSDF0132.
DR   EnsemblGenomes-Gn; ABSDF0140.
DR   EnsemblGenomes-Gn; ABSDF0141.
DR   EnsemblGenomes-Gn; ABSDF0150.
DR   EnsemblGenomes-Gn; ABSDF0152.
DR   EnsemblGenomes-Gn; ABSDF0174.
DR   EnsemblGenomes-Gn; ABSDF0181.
DR   EnsemblGenomes-Gn; ABSDF0182.
DR   EnsemblGenomes-Gn; ABSDF0183.
DR   EnsemblGenomes-Gn; ABSDF0188.
DR   EnsemblGenomes-Gn; ABSDF0190.
DR   EnsemblGenomes-Gn; ABSDF0192.
DR   EnsemblGenomes-Gn; ABSDF0196.
DR   EnsemblGenomes-Gn; ABSDF0200.
DR   EnsemblGenomes-Gn; ABSDF0203.
DR   EnsemblGenomes-Gn; ABSDF0209.
DR   EnsemblGenomes-Gn; ABSDF0224.
DR   EnsemblGenomes-Gn; ABSDF0225.
DR   EnsemblGenomes-Gn; ABSDF0226.
DR   EnsemblGenomes-Gn; ABSDF0229.
DR   EnsemblGenomes-Gn; ABSDF0230.
DR   EnsemblGenomes-Gn; ABSDF0232.
DR   EnsemblGenomes-Gn; ABSDF0235.
DR   EnsemblGenomes-Gn; ABSDF0238.
DR   EnsemblGenomes-Gn; ABSDF0239.
DR   EnsemblGenomes-Gn; ABSDF0245.
DR   EnsemblGenomes-Gn; ABSDF0247.
DR   EnsemblGenomes-Gn; ABSDF0252.
DR   EnsemblGenomes-Gn; ABSDF0254.
DR   EnsemblGenomes-Gn; ABSDF0257.
DR   EnsemblGenomes-Gn; ABSDF0258.
DR   EnsemblGenomes-Gn; ABSDF0266.
DR   EnsemblGenomes-Gn; ABSDF0267.
DR   EnsemblGenomes-Gn; ABSDF0272.
DR   EnsemblGenomes-Gn; ABSDF0273.
DR   EnsemblGenomes-Gn; ABSDF0274.
DR   EnsemblGenomes-Gn; ABSDF0288.
DR   EnsemblGenomes-Gn; ABSDF0290.
DR   EnsemblGenomes-Gn; ABSDF0294.
DR   EnsemblGenomes-Gn; ABSDF0295.
DR   EnsemblGenomes-Gn; ABSDF0298.
DR   EnsemblGenomes-Gn; ABSDF0299.
DR   EnsemblGenomes-Gn; ABSDF0300.
DR   EnsemblGenomes-Gn; ABSDF0311.
DR   EnsemblGenomes-Gn; ABSDF0313.
DR   EnsemblGenomes-Gn; ABSDF0330.
DR   EnsemblGenomes-Gn; ABSDF0331.
DR   EnsemblGenomes-Gn; ABSDF0340.
DR   EnsemblGenomes-Gn; ABSDF0350.
DR   EnsemblGenomes-Gn; ABSDF0351.
DR   EnsemblGenomes-Gn; ABSDF0361.
DR   EnsemblGenomes-Gn; ABSDF0374.
DR   EnsemblGenomes-Gn; ABSDF0376.
DR   EnsemblGenomes-Gn; ABSDF0384.
DR   EnsemblGenomes-Gn; ABSDF0385.
DR   EnsemblGenomes-Gn; ABSDF0407.
DR   EnsemblGenomes-Gn; ABSDF0409.
DR   EnsemblGenomes-Gn; ABSDF0411.
DR   EnsemblGenomes-Gn; ABSDF0416.
DR   EnsemblGenomes-Gn; ABSDF0417.
DR   EnsemblGenomes-Gn; ABSDF0418.
DR   EnsemblGenomes-Gn; ABSDF0453.
DR   EnsemblGenomes-Gn; ABSDF0457.
DR   EnsemblGenomes-Gn; ABSDF0462.
DR   EnsemblGenomes-Gn; ABSDF0475.
DR   EnsemblGenomes-Gn; ABSDF0476.
DR   EnsemblGenomes-Gn; ABSDF0494.
DR   EnsemblGenomes-Gn; ABSDF0499.
DR   EnsemblGenomes-Gn; ABSDF0500.
DR   EnsemblGenomes-Gn; ABSDF0510.
DR   EnsemblGenomes-Gn; ABSDF0512.
DR   EnsemblGenomes-Gn; ABSDF0513.
DR   EnsemblGenomes-Gn; ABSDF0522.
DR   EnsemblGenomes-Gn; ABSDF0523.
DR   EnsemblGenomes-Gn; ABSDF0537.
DR   EnsemblGenomes-Gn; ABSDF0556.
DR   EnsemblGenomes-Gn; ABSDF0558.
DR   EnsemblGenomes-Gn; ABSDF0560.
DR   EnsemblGenomes-Gn; ABSDF0561.
DR   EnsemblGenomes-Gn; ABSDF0562.
DR   EnsemblGenomes-Gn; ABSDF0566.
DR   EnsemblGenomes-Gn; ABSDF0567.
DR   EnsemblGenomes-Gn; ABSDF0579.
DR   EnsemblGenomes-Gn; ABSDF0580.
DR   EnsemblGenomes-Gn; ABSDF0601.
DR   EnsemblGenomes-Gn; ABSDF0607.
DR   EnsemblGenomes-Gn; ABSDF0608.
DR   EnsemblGenomes-Gn; ABSDF0619.
DR   EnsemblGenomes-Gn; ABSDF0620.
DR   EnsemblGenomes-Gn; ABSDF0621.
DR   EnsemblGenomes-Gn; ABSDF0622.
DR   EnsemblGenomes-Gn; ABSDF0625.
DR   EnsemblGenomes-Gn; ABSDF0626.
DR   EnsemblGenomes-Gn; ABSDF0636.
DR   EnsemblGenomes-Gn; ABSDF0637.
DR   EnsemblGenomes-Gn; ABSDF0642.
DR   EnsemblGenomes-Gn; ABSDF0643.
DR   EnsemblGenomes-Gn; ABSDF0649.
DR   EnsemblGenomes-Gn; ABSDF0650.
DR   EnsemblGenomes-Gn; ABSDF0651.
DR   EnsemblGenomes-Gn; ABSDF0661.
DR   EnsemblGenomes-Gn; ABSDF0662.
DR   EnsemblGenomes-Gn; ABSDF0668.
DR   EnsemblGenomes-Gn; ABSDF0669.
DR   EnsemblGenomes-Gn; ABSDF0691.
DR   EnsemblGenomes-Gn; ABSDF0693.
DR   EnsemblGenomes-Gn; ABSDF0699.
DR   EnsemblGenomes-Gn; ABSDF0700.
DR   EnsemblGenomes-Gn; ABSDF0722.
DR   EnsemblGenomes-Gn; ABSDF0723.
DR   EnsemblGenomes-Gn; ABSDF0724.
DR   EnsemblGenomes-Gn; ABSDF0725.
DR   EnsemblGenomes-Gn; ABSDF0731.
DR   EnsemblGenomes-Gn; ABSDF0750.
DR   EnsemblGenomes-Gn; ABSDF0752.
DR   EnsemblGenomes-Gn; ABSDF0753.
DR   EnsemblGenomes-Gn; ABSDF0754.
DR   EnsemblGenomes-Gn; ABSDF0765.
DR   EnsemblGenomes-Gn; ABSDF0766.
DR   EnsemblGenomes-Gn; ABSDF0780.
DR   EnsemblGenomes-Gn; ABSDF0781.
DR   EnsemblGenomes-Gn; ABSDF0783.
DR   EnsemblGenomes-Gn; ABSDF0792.
DR   EnsemblGenomes-Gn; ABSDF0810.
DR   EnsemblGenomes-Gn; ABSDF0813.
DR   EnsemblGenomes-Gn; ABSDF0814.
DR   EnsemblGenomes-Gn; ABSDF0815.
DR   EnsemblGenomes-Gn; ABSDF0816.
DR   EnsemblGenomes-Gn; ABSDF0822.
DR   EnsemblGenomes-Gn; ABSDF0823.
DR   EnsemblGenomes-Gn; ABSDF0825.
DR   EnsemblGenomes-Gn; ABSDF0826.
DR   EnsemblGenomes-Gn; ABSDF0831.
DR   EnsemblGenomes-Gn; ABSDF0832.
DR   EnsemblGenomes-Gn; ABSDF0834.
DR   EnsemblGenomes-Gn; ABSDF0835.
DR   EnsemblGenomes-Gn; ABSDF0840.
DR   EnsemblGenomes-Gn; ABSDF0855.
DR   EnsemblGenomes-Gn; ABSDF0856.
DR   EnsemblGenomes-Gn; ABSDF0861.
DR   EnsemblGenomes-Gn; ABSDF0862.
DR   EnsemblGenomes-Gn; ABSDF0863.
DR   EnsemblGenomes-Gn; ABSDF0865.
DR   EnsemblGenomes-Gn; ABSDF0867.
DR   EnsemblGenomes-Gn; ABSDF0883.
DR   EnsemblGenomes-Gn; ABSDF0884.
DR   EnsemblGenomes-Gn; ABSDF0885.
DR   EnsemblGenomes-Gn; ABSDF0886.
DR   EnsemblGenomes-Gn; ABSDF0887.
DR   EnsemblGenomes-Gn; ABSDF0890.
DR   EnsemblGenomes-Gn; ABSDF0891.
DR   EnsemblGenomes-Gn; ABSDF0913.
DR   EnsemblGenomes-Gn; ABSDF0914.
DR   EnsemblGenomes-Gn; ABSDF0927.
DR   EnsemblGenomes-Gn; ABSDF0929.
DR   EnsemblGenomes-Gn; ABSDF0958.
DR   EnsemblGenomes-Gn; ABSDF0962.
DR   EnsemblGenomes-Gn; ABSDF0964.
DR   EnsemblGenomes-Gn; ABSDF0972.
DR   EnsemblGenomes-Gn; ABSDF0973.
DR   EnsemblGenomes-Gn; ABSDF0978.
DR   EnsemblGenomes-Gn; ABSDF0987.
DR   EnsemblGenomes-Gn; ABSDF0988.
DR   EnsemblGenomes-Gn; ABSDF0990.
DR   EnsemblGenomes-Gn; ABSDF0991.
DR   EnsemblGenomes-Gn; ABSDF1031.
DR   EnsemblGenomes-Gn; ABSDF1062.
DR   EnsemblGenomes-Gn; ABSDF1063.
DR   EnsemblGenomes-Gn; ABSDF1064.
DR   EnsemblGenomes-Gn; ABSDF1065.
DR   EnsemblGenomes-Gn; ABSDF1075.
DR   EnsemblGenomes-Gn; ABSDF1076.
DR   EnsemblGenomes-Gn; ABSDF1080.
DR   EnsemblGenomes-Gn; ABSDF1081.
DR   EnsemblGenomes-Gn; ABSDF1085.
DR   EnsemblGenomes-Gn; ABSDF1086.
DR   EnsemblGenomes-Gn; ABSDF1091.
DR   EnsemblGenomes-Gn; ABSDF1092.
DR   EnsemblGenomes-Gn; ABSDF1093.1.
DR   EnsemblGenomes-Gn; ABSDF1093.5.
DR   EnsemblGenomes-Gn; ABSDF1094.
DR   EnsemblGenomes-Gn; ABSDF1098.
DR   EnsemblGenomes-Gn; ABSDF1099.
DR   EnsemblGenomes-Gn; ABSDF1139.
DR   EnsemblGenomes-Gn; ABSDF1140.
DR   EnsemblGenomes-Gn; ABSDF1141.
DR   EnsemblGenomes-Gn; ABSDF1153.
DR   EnsemblGenomes-Gn; ABSDF1155.
DR   EnsemblGenomes-Gn; ABSDF1155.1.
DR   EnsemblGenomes-Gn; ABSDF1164.
DR   EnsemblGenomes-Gn; ABSDF1166.
DR   EnsemblGenomes-Gn; ABSDF1175.
DR   EnsemblGenomes-Gn; ABSDF1176.
DR   EnsemblGenomes-Gn; ABSDF1178.
DR   EnsemblGenomes-Gn; ABSDF1198.
DR   EnsemblGenomes-Gn; ABSDF1199.
DR   EnsemblGenomes-Gn; ABSDF1205.
DR   EnsemblGenomes-Gn; ABSDF1206.
DR   EnsemblGenomes-Gn; ABSDF1220.
DR   EnsemblGenomes-Gn; ABSDF1221.
DR   EnsemblGenomes-Gn; ABSDF1222.
DR   EnsemblGenomes-Gn; ABSDF1223.
DR   EnsemblGenomes-Gn; ABSDF1224.
DR   EnsemblGenomes-Gn; ABSDF1226.
DR   EnsemblGenomes-Gn; ABSDF1227.
DR   EnsemblGenomes-Gn; ABSDF1231.
DR   EnsemblGenomes-Gn; ABSDF1232.
DR   EnsemblGenomes-Gn; ABSDF1237.
DR   EnsemblGenomes-Gn; ABSDF1238.
DR   EnsemblGenomes-Gn; ABSDF1246.
DR   EnsemblGenomes-Gn; ABSDF1248.
DR   EnsemblGenomes-Gn; ABSDF1256.
DR   EnsemblGenomes-Gn; ABSDF1257.
DR   EnsemblGenomes-Gn; ABSDF1290.
DR   EnsemblGenomes-Gn; ABSDF1292.
DR   EnsemblGenomes-Gn; ABSDF1293.
DR   EnsemblGenomes-Gn; ABSDF1294.
DR   EnsemblGenomes-Gn; ABSDF1296.
DR   EnsemblGenomes-Gn; ABSDF1299.
DR   EnsemblGenomes-Gn; ABSDF1302.
DR   EnsemblGenomes-Gn; ABSDF1305.
DR   EnsemblGenomes-Gn; ABSDF1312.
DR   EnsemblGenomes-Gn; ABSDF1314.
DR   EnsemblGenomes-Gn; ABSDF1316.
DR   EnsemblGenomes-Gn; ABSDF1340.
DR   EnsemblGenomes-Gn; ABSDF1358.
DR   EnsemblGenomes-Gn; ABSDF1360.
DR   EnsemblGenomes-Gn; ABSDF1363.
DR   EnsemblGenomes-Gn; ABSDF1365.
DR   EnsemblGenomes-Gn; ABSDF1366.
DR   EnsemblGenomes-Gn; ABSDF1368.
DR   EnsemblGenomes-Gn; ABSDF1369.
DR   EnsemblGenomes-Gn; ABSDF1370.
DR   EnsemblGenomes-Gn; ABSDF1371.
DR   EnsemblGenomes-Gn; ABSDF1375.
DR   EnsemblGenomes-Gn; ABSDF1377.
DR   EnsemblGenomes-Gn; ABSDF1387.
DR   EnsemblGenomes-Gn; ABSDF1396.
DR   EnsemblGenomes-Gn; ABSDF1398.
DR   EnsemblGenomes-Gn; ABSDF1402.
DR   EnsemblGenomes-Gn; ABSDF1405.
DR   EnsemblGenomes-Gn; ABSDF1406.
DR   EnsemblGenomes-Gn; ABSDF1412.
DR   EnsemblGenomes-Gn; ABSDF1413.
DR   EnsemblGenomes-Gn; ABSDF1414.
DR   EnsemblGenomes-Gn; ABSDF1423.
DR   EnsemblGenomes-Gn; ABSDF1443.
DR   EnsemblGenomes-Gn; ABSDF1444.
DR   EnsemblGenomes-Gn; ABSDF1460.
DR   EnsemblGenomes-Gn; ABSDF1461.
DR   EnsemblGenomes-Gn; ABSDF1466.
DR   EnsemblGenomes-Gn; ABSDF1468.
DR   EnsemblGenomes-Gn; ABSDF1473.
DR   EnsemblGenomes-Gn; ABSDF1490.
DR   EnsemblGenomes-Gn; ABSDF1496.
DR   EnsemblGenomes-Gn; ABSDF1505.
DR   EnsemblGenomes-Gn; ABSDF1519.
DR   EnsemblGenomes-Gn; ABSDF1522.
DR   EnsemblGenomes-Gn; ABSDF1530.
DR   EnsemblGenomes-Gn; ABSDF1531.
DR   EnsemblGenomes-Gn; ABSDF1537.
DR   EnsemblGenomes-Gn; ABSDF1538.
DR   EnsemblGenomes-Gn; ABSDF1539.
DR   EnsemblGenomes-Gn; ABSDF1540.
DR   EnsemblGenomes-Gn; ABSDF1549.
DR   EnsemblGenomes-Gn; ABSDF1550.
DR   EnsemblGenomes-Gn; ABSDF1554.
DR   EnsemblGenomes-Gn; ABSDF1560.
DR   EnsemblGenomes-Gn; ABSDF1561.
DR   EnsemblGenomes-Gn; ABSDF1562.
DR   EnsemblGenomes-Gn; ABSDF1564.
DR   EnsemblGenomes-Gn; ABSDF1566.
DR   EnsemblGenomes-Gn; ABSDF1579.
DR   EnsemblGenomes-Gn; ABSDF1580.
DR   EnsemblGenomes-Gn; ABSDF1583.
DR   EnsemblGenomes-Gn; ABSDF1584.
DR   EnsemblGenomes-Gn; ABSDF1612.
DR   EnsemblGenomes-Gn; ABSDF1613.
DR   EnsemblGenomes-Gn; ABSDF1614.
DR   EnsemblGenomes-Gn; ABSDF1626.
DR   EnsemblGenomes-Gn; ABSDF1627.
DR   EnsemblGenomes-Gn; ABSDF1628.
DR   EnsemblGenomes-Gn; ABSDF1634.
DR   EnsemblGenomes-Gn; ABSDF1635.
DR   EnsemblGenomes-Gn; ABSDF1649.
DR   EnsemblGenomes-Gn; ABSDF1650.
DR   EnsemblGenomes-Gn; ABSDF1653.
DR   EnsemblGenomes-Gn; ABSDF1654.
DR   EnsemblGenomes-Gn; ABSDF1664.
DR   EnsemblGenomes-Gn; ABSDF1667.
DR   EnsemblGenomes-Gn; ABSDF1668.
DR   EnsemblGenomes-Gn; ABSDF1696.
DR   EnsemblGenomes-Gn; ABSDF1697.
DR   EnsemblGenomes-Gn; ABSDF1705.
DR   EnsemblGenomes-Gn; ABSDF1721.
DR   EnsemblGenomes-Gn; ABSDF1744.
DR   EnsemblGenomes-Gn; ABSDF1796.
DR   EnsemblGenomes-Gn; ABSDF1838.
DR   EnsemblGenomes-Gn; ABSDF1839.
DR   EnsemblGenomes-Gn; ABSDF1841.
DR   EnsemblGenomes-Gn; ABSDF1846.
DR   EnsemblGenomes-Gn; ABSDF1847.
DR   EnsemblGenomes-Gn; ABSDF1865.
DR   EnsemblGenomes-Gn; ABSDF1866.
DR   EnsemblGenomes-Gn; ABSDF1878.
DR   EnsemblGenomes-Gn; ABSDF1880.
DR   EnsemblGenomes-Gn; ABSDF1883.
DR   EnsemblGenomes-Gn; ABSDF1884.
DR   EnsemblGenomes-Gn; ABSDF1891.
DR   EnsemblGenomes-Gn; ABSDF1892.
DR   EnsemblGenomes-Gn; ABSDF1893.
DR   EnsemblGenomes-Gn; ABSDF1899.
DR   EnsemblGenomes-Gn; ABSDF1908.
DR   EnsemblGenomes-Gn; ABSDF1909.
DR   EnsemblGenomes-Gn; ABSDF1920.
DR   EnsemblGenomes-Gn; ABSDF1921.
DR   EnsemblGenomes-Gn; ABSDF1932.
DR   EnsemblGenomes-Gn; ABSDF1943.
DR   EnsemblGenomes-Gn; ABSDF1944.
DR   EnsemblGenomes-Gn; ABSDF1945.
DR   EnsemblGenomes-Gn; ABSDF1946.
DR   EnsemblGenomes-Gn; ABSDF1948.
DR   EnsemblGenomes-Gn; ABSDF1949.
DR   EnsemblGenomes-Gn; ABSDF1950.
DR   EnsemblGenomes-Gn; ABSDF1951.
DR   EnsemblGenomes-Gn; ABSDF1952.
DR   EnsemblGenomes-Gn; ABSDF1957.
DR   EnsemblGenomes-Gn; ABSDF1959.
DR   EnsemblGenomes-Gn; ABSDF1966.
DR   EnsemblGenomes-Gn; ABSDF1968.
DR   EnsemblGenomes-Gn; ABSDF1972.
DR   EnsemblGenomes-Gn; ABSDF1973.
DR   EnsemblGenomes-Gn; ABSDF1975.
DR   EnsemblGenomes-Gn; ABSDF1991.
DR   EnsemblGenomes-Gn; ABSDF2001.
DR   EnsemblGenomes-Gn; ABSDF2003.
DR   EnsemblGenomes-Gn; ABSDF2004.
DR   EnsemblGenomes-Gn; ABSDF2006.
DR   EnsemblGenomes-Gn; ABSDF2007.
DR   EnsemblGenomes-Gn; ABSDF2014.
DR   EnsemblGenomes-Gn; ABSDF2015.
DR   EnsemblGenomes-Gn; ABSDF2029.
DR   EnsemblGenomes-Gn; ABSDF2031.
DR   EnsemblGenomes-Gn; ABSDF2040.
DR   EnsemblGenomes-Gn; ABSDF2041.
DR   EnsemblGenomes-Gn; ABSDF2042.
DR   EnsemblGenomes-Gn; ABSDF2043.
DR   EnsemblGenomes-Gn; ABSDF2059.
DR   EnsemblGenomes-Gn; ABSDF2060.
DR   EnsemblGenomes-Gn; ABSDF2062.
DR   EnsemblGenomes-Gn; ABSDF2063.
DR   EnsemblGenomes-Gn; ABSDF2067.
DR   EnsemblGenomes-Gn; ABSDF2068.
DR   EnsemblGenomes-Gn; ABSDF2074.
DR   EnsemblGenomes-Gn; ABSDF2076.
DR   EnsemblGenomes-Gn; ABSDF2078.
DR   EnsemblGenomes-Gn; ABSDF2079.
DR   EnsemblGenomes-Gn; ABSDF2096.
DR   EnsemblGenomes-Gn; ABSDF2110.
DR   EnsemblGenomes-Gn; ABSDF2112.
DR   EnsemblGenomes-Gn; ABSDF2130.
DR   EnsemblGenomes-Gn; ABSDF2131.
DR   EnsemblGenomes-Gn; ABSDF2146.
DR   EnsemblGenomes-Gn; ABSDF2148.
DR   EnsemblGenomes-Gn; ABSDF2149.
DR   EnsemblGenomes-Gn; ABSDF2150.
DR   EnsemblGenomes-Gn; ABSDF2176.
DR   EnsemblGenomes-Gn; ABSDF2177.
DR   EnsemblGenomes-Gn; ABSDF2186.
DR   EnsemblGenomes-Gn; ABSDF2187.
DR   EnsemblGenomes-Gn; ABSDF2196.
DR   EnsemblGenomes-Gn; ABSDF2198.
DR   EnsemblGenomes-Gn; ABSDF2224.
DR   EnsemblGenomes-Gn; ABSDF2225.
DR   EnsemblGenomes-Gn; ABSDF2274.
DR   EnsemblGenomes-Gn; ABSDF2279.
DR   EnsemblGenomes-Gn; ABSDF2286.
DR   EnsemblGenomes-Gn; ABSDF2287.
DR   EnsemblGenomes-Gn; ABSDF2291.
DR   EnsemblGenomes-Gn; ABSDF2293.
DR   EnsemblGenomes-Gn; ABSDF2294.
DR   EnsemblGenomes-Gn; ABSDF2296.
DR   EnsemblGenomes-Gn; ABSDF2297.
DR   EnsemblGenomes-Gn; ABSDF2303.
DR   EnsemblGenomes-Gn; ABSDF2304.
DR   EnsemblGenomes-Gn; ABSDF2305.
DR   EnsemblGenomes-Gn; ABSDF2306.
DR   EnsemblGenomes-Gn; ABSDF2326.
DR   EnsemblGenomes-Gn; ABSDF2328.
DR   EnsemblGenomes-Gn; ABSDF2338.
DR   EnsemblGenomes-Gn; ABSDF2339.
DR   EnsemblGenomes-Gn; ABSDF2354.
DR   EnsemblGenomes-Gn; ABSDF2355.
DR   EnsemblGenomes-Gn; ABSDF2387.
DR   EnsemblGenomes-Gn; ABSDF2391.
DR   EnsemblGenomes-Gn; ABSDF2399.
DR   EnsemblGenomes-Gn; ABSDF2406.
DR   EnsemblGenomes-Gn; ABSDF2407.
DR   EnsemblGenomes-Gn; ABSDF2411.
DR   EnsemblGenomes-Gn; ABSDF2413.
DR   EnsemblGenomes-Gn; ABSDF2414.
DR   EnsemblGenomes-Gn; ABSDF2415.
DR   EnsemblGenomes-Gn; ABSDF2416.
DR   EnsemblGenomes-Gn; ABSDF2425.
DR   EnsemblGenomes-Gn; ABSDF2429.
DR   EnsemblGenomes-Gn; ABSDF2430.
DR   EnsemblGenomes-Gn; ABSDF2431.
DR   EnsemblGenomes-Gn; ABSDF2446.
DR   EnsemblGenomes-Gn; ABSDF2447.
DR   EnsemblGenomes-Gn; ABSDF2448.
DR   EnsemblGenomes-Gn; ABSDF2450.
DR   EnsemblGenomes-Gn; ABSDF2519.
DR   EnsemblGenomes-Gn; ABSDF2520.
DR   EnsemblGenomes-Gn; ABSDF2521.
DR   EnsemblGenomes-Gn; ABSDF2523.
DR   EnsemblGenomes-Gn; ABSDF2534.
DR   EnsemblGenomes-Gn; ABSDF2535.
DR   EnsemblGenomes-Gn; ABSDF2536.
DR   EnsemblGenomes-Gn; ABSDF2537.
DR   EnsemblGenomes-Gn; ABSDF2542.
DR   EnsemblGenomes-Gn; ABSDF2543.
DR   EnsemblGenomes-Gn; ABSDF2580.
DR   EnsemblGenomes-Gn; ABSDF2588.
DR   EnsemblGenomes-Gn; ABSDF2589.
DR   EnsemblGenomes-Gn; ABSDF2591.
DR   EnsemblGenomes-Gn; ABSDF2602.
DR   EnsemblGenomes-Gn; ABSDF2609.
DR   EnsemblGenomes-Gn; ABSDF2610.
DR   EnsemblGenomes-Gn; ABSDF2611.
DR   EnsemblGenomes-Gn; ABSDF2612.
DR   EnsemblGenomes-Gn; ABSDF2631.
DR   EnsemblGenomes-Gn; ABSDF2633.
DR   EnsemblGenomes-Gn; ABSDF2634.
DR   EnsemblGenomes-Gn; ABSDF2670.
DR   EnsemblGenomes-Gn; ABSDF2680.
DR   EnsemblGenomes-Gn; ABSDF2681.
DR   EnsemblGenomes-Gn; ABSDF2682.
DR   EnsemblGenomes-Gn; ABSDF2696.
DR   EnsemblGenomes-Gn; ABSDF2715.
DR   EnsemblGenomes-Gn; ABSDF2716.
DR   EnsemblGenomes-Gn; ABSDF2725.
DR   EnsemblGenomes-Gn; ABSDF2726.
DR   EnsemblGenomes-Gn; ABSDF2735.
DR   EnsemblGenomes-Gn; ABSDF2736.
DR   EnsemblGenomes-Gn; ABSDF2737.
DR   EnsemblGenomes-Gn; ABSDF2739.
DR   EnsemblGenomes-Gn; ABSDF2747.
DR   EnsemblGenomes-Gn; ABSDF2748.
DR   EnsemblGenomes-Gn; ABSDF2756.
DR   EnsemblGenomes-Gn; ABSDF2757.
DR   EnsemblGenomes-Gn; ABSDF2767.
DR   EnsemblGenomes-Gn; ABSDF2774.
DR   EnsemblGenomes-Gn; ABSDF2775.
DR   EnsemblGenomes-Gn; ABSDF2812.
DR   EnsemblGenomes-Gn; ABSDF2814.
DR   EnsemblGenomes-Gn; ABSDF2819.
DR   EnsemblGenomes-Gn; ABSDF2820.
DR   EnsemblGenomes-Gn; ABSDF2827.
DR   EnsemblGenomes-Gn; ABSDF2829.
DR   EnsemblGenomes-Gn; ABSDF2849.
DR   EnsemblGenomes-Gn; ABSDF2851.
DR   EnsemblGenomes-Gn; ABSDF2852.
DR   EnsemblGenomes-Gn; ABSDF2879.
DR   EnsemblGenomes-Gn; ABSDF2880.
DR   EnsemblGenomes-Gn; ABSDF2891.
DR   EnsemblGenomes-Gn; ABSDF2892.
DR   EnsemblGenomes-Gn; ABSDF2909.
DR   EnsemblGenomes-Gn; ABSDF2911.
DR   EnsemblGenomes-Gn; ABSDF2916.
DR   EnsemblGenomes-Gn; ABSDF2918.
DR   EnsemblGenomes-Gn; ABSDF2919.
DR   EnsemblGenomes-Gn; ABSDF2925.
DR   EnsemblGenomes-Gn; ABSDF2926.
DR   EnsemblGenomes-Gn; ABSDF2927.
DR   EnsemblGenomes-Gn; ABSDF2928.
DR   EnsemblGenomes-Gn; ABSDF2939.
DR   EnsemblGenomes-Gn; ABSDF2940.
DR   EnsemblGenomes-Gn; ABSDF2969.
DR   EnsemblGenomes-Gn; ABSDF2970.
DR   EnsemblGenomes-Gn; ABSDF2971.
DR   EnsemblGenomes-Gn; ABSDF2972.
DR   EnsemblGenomes-Gn; ABSDF2974.
DR   EnsemblGenomes-Gn; ABSDF3003.
DR   EnsemblGenomes-Gn; ABSDF3004.
DR   EnsemblGenomes-Gn; ABSDF3015.
DR   EnsemblGenomes-Gn; ABSDF3016.
DR   EnsemblGenomes-Gn; ABSDF3017.
DR   EnsemblGenomes-Gn; ABSDF3023.
DR   EnsemblGenomes-Gn; ABSDF3037.
DR   EnsemblGenomes-Gn; ABSDF3038.
DR   EnsemblGenomes-Gn; ABSDF3044.
DR   EnsemblGenomes-Gn; ABSDF3045.
DR   EnsemblGenomes-Gn; ABSDF3068.
DR   EnsemblGenomes-Gn; ABSDF3072.
DR   EnsemblGenomes-Gn; ABSDF3075.
DR   EnsemblGenomes-Gn; ABSDF3087.
DR   EnsemblGenomes-Gn; ABSDF3088.
DR   EnsemblGenomes-Gn; ABSDF3099.
DR   EnsemblGenomes-Gn; ABSDF3129.
DR   EnsemblGenomes-Gn; ABSDF3130.
DR   EnsemblGenomes-Gn; ABSDF3135.
DR   EnsemblGenomes-Gn; ABSDF3148.
DR   EnsemblGenomes-Gn; ABSDF3150.
DR   EnsemblGenomes-Gn; ABSDF3167.
DR   EnsemblGenomes-Gn; ABSDF3169.
DR   EnsemblGenomes-Gn; ABSDF3189.
DR   EnsemblGenomes-Gn; ABSDF3191.
DR   EnsemblGenomes-Gn; ABSDF3192.
DR   EnsemblGenomes-Gn; ABSDF3193.
DR   EnsemblGenomes-Gn; ABSDF3210.
DR   EnsemblGenomes-Gn; ABSDF3211.
DR   EnsemblGenomes-Gn; ABSDF3212.
DR   EnsemblGenomes-Gn; ABSDF3213.
DR   EnsemblGenomes-Gn; ABSDF3227.
DR   EnsemblGenomes-Gn; ABSDF3228.
DR   EnsemblGenomes-Gn; ABSDF3230.
DR   EnsemblGenomes-Gn; ABSDF3231.
DR   EnsemblGenomes-Gn; ABSDF3240.
DR   EnsemblGenomes-Gn; ABSDF3241.
DR   EnsemblGenomes-Gn; ABSDF3251.
DR   EnsemblGenomes-Gn; ABSDF3252.
DR   EnsemblGenomes-Gn; ABSDF3258.
DR   EnsemblGenomes-Gn; ABSDF3260.
DR   EnsemblGenomes-Gn; ABSDF3269.
DR   EnsemblGenomes-Gn; ABSDF3270.
DR   EnsemblGenomes-Gn; ABSDF3275.
DR   EnsemblGenomes-Gn; ABSDF3276.
DR   EnsemblGenomes-Gn; ABSDF3278.
DR   EnsemblGenomes-Gn; ABSDF3279.
DR   EnsemblGenomes-Gn; ABSDF3298.
DR   EnsemblGenomes-Gn; ABSDF3299.
DR   EnsemblGenomes-Gn; ABSDF3300.
DR   EnsemblGenomes-Gn; ABSDF3301.
DR   EnsemblGenomes-Gn; ABSDF3303.
DR   EnsemblGenomes-Gn; ABSDF3319.
DR   EnsemblGenomes-Gn; ABSDF3341.
DR   EnsemblGenomes-Gn; ABSDF3344.
DR   EnsemblGenomes-Gn; ABSDF3354.
DR   EnsemblGenomes-Gn; ABSDF3355.
DR   EnsemblGenomes-Gn; ABSDF3357.
DR   EnsemblGenomes-Gn; ABSDF3360.
DR   EnsemblGenomes-Gn; ABSDF3361.
DR   EnsemblGenomes-Gn; ABSDF3362.
DR   EnsemblGenomes-Gn; ABSDF3365.
DR   EnsemblGenomes-Gn; ABSDF3370.
DR   EnsemblGenomes-Gn; ABSDF3371.
DR   EnsemblGenomes-Gn; ABSDF3379.
DR   EnsemblGenomes-Gn; ABSDF3381.
DR   EnsemblGenomes-Gn; ABSDF3382.
DR   EnsemblGenomes-Gn; ABSDF3389.
DR   EnsemblGenomes-Gn; ABSDF3390.
DR   EnsemblGenomes-Gn; ABSDF3396.
DR   EnsemblGenomes-Gn; ABSDF3397.
DR   EnsemblGenomes-Gn; ABSDF3407.
DR   EnsemblGenomes-Gn; ABSDF3419.
DR   EnsemblGenomes-Gn; ABSDF3420.
DR   EnsemblGenomes-Gn; ABSDF3424.
DR   EnsemblGenomes-Gn; ABSDF3425.
DR   EnsemblGenomes-Gn; ABSDF3426.
DR   EnsemblGenomes-Gn; ABSDF3436.
DR   EnsemblGenomes-Gn; ABSDF3453.
DR   EnsemblGenomes-Gn; ABSDF3455.
DR   EnsemblGenomes-Gn; ABSDF3460.
DR   EnsemblGenomes-Gn; ABSDF3461.
DR   EnsemblGenomes-Gn; ABSDF3475.
DR   EnsemblGenomes-Gn; ABSDF3477.
DR   EnsemblGenomes-Gn; ABSDF3479.
DR   EnsemblGenomes-Gn; ABSDF3494.
DR   EnsemblGenomes-Gn; ABSDF3496.
DR   EnsemblGenomes-Gn; ABSDF3507.
DR   EnsemblGenomes-Gn; ABSDF3508.
DR   EnsemblGenomes-Gn; ABSDF3510.
DR   EnsemblGenomes-Gn; ABSDF3511.
DR   EnsemblGenomes-Gn; ABSDF3517.
DR   EnsemblGenomes-Gn; ABSDF3518.
DR   EnsemblGenomes-Gn; ABSDF3524.
DR   EnsemblGenomes-Gn; ABSDF3525.
DR   EnsemblGenomes-Gn; ABSDF3532.
DR   EnsemblGenomes-Gn; ABSDF3534.
DR   EnsemblGenomes-Gn; ABSDF3588.
DR   EnsemblGenomes-Gn; ABSDF3590.
DR   EnsemblGenomes-Gn; ABSDF3600.
DR   EnsemblGenomes-Gn; ABSDF3601.
DR   EnsemblGenomes-Gn; ABSDF3611.
DR   EnsemblGenomes-Gn; ABSDF3612.
DR   EnsemblGenomes-Gn; ABSDF3655.
DR   EnsemblGenomes-Gn; ABSDF3661.
DR   EnsemblGenomes-Gn; ABSDF3662.
DR   EnsemblGenomes-Gn; ABSDF_16S_1.
DR   EnsemblGenomes-Gn; ABSDF_16S_2.
DR   EnsemblGenomes-Gn; ABSDF_16S_3.
DR   EnsemblGenomes-Gn; ABSDF_16S_4.
DR   EnsemblGenomes-Gn; ABSDF_16S_5.
DR   EnsemblGenomes-Gn; ABSDF_23S_1.
DR   EnsemblGenomes-Gn; ABSDF_23S_2.
DR   EnsemblGenomes-Gn; ABSDF_23S_3.
DR   EnsemblGenomes-Gn; ABSDF_23S_4.
DR   EnsemblGenomes-Gn; ABSDF_23S_5.
DR   EnsemblGenomes-Gn; ABSDF_5S_1.
DR   EnsemblGenomes-Gn; ABSDF_5S_2.
DR   EnsemblGenomes-Gn; ABSDF_5S_3.
DR   EnsemblGenomes-Gn; ABSDF_5S_4.
DR   EnsemblGenomes-Gn; ABSDF_5S_5.
DR   EnsemblGenomes-Gn; ABSDF_misc_RNA_7.
DR   EnsemblGenomes-Gn; ABSDF_tRNA1.
DR   EnsemblGenomes-Gn; ABSDF_tRNA10.
DR   EnsemblGenomes-Gn; ABSDF_tRNA11.
DR   EnsemblGenomes-Gn; ABSDF_tRNA12.
DR   EnsemblGenomes-Gn; ABSDF_tRNA13.
DR   EnsemblGenomes-Gn; ABSDF_tRNA14.
DR   EnsemblGenomes-Gn; ABSDF_tRNA15.
DR   EnsemblGenomes-Gn; ABSDF_tRNA16.
DR   EnsemblGenomes-Gn; ABSDF_tRNA17.
DR   EnsemblGenomes-Gn; ABSDF_tRNA18.
DR   EnsemblGenomes-Gn; ABSDF_tRNA19.
DR   EnsemblGenomes-Gn; ABSDF_tRNA2.
DR   EnsemblGenomes-Gn; ABSDF_tRNA20.
DR   EnsemblGenomes-Gn; ABSDF_tRNA21.
DR   EnsemblGenomes-Gn; ABSDF_tRNA22.
DR   EnsemblGenomes-Gn; ABSDF_tRNA23.
DR   EnsemblGenomes-Gn; ABSDF_tRNA24.
DR   EnsemblGenomes-Gn; ABSDF_tRNA25.
DR   EnsemblGenomes-Gn; ABSDF_tRNA26.
DR   EnsemblGenomes-Gn; ABSDF_tRNA27.
DR   EnsemblGenomes-Gn; ABSDF_tRNA28.
DR   EnsemblGenomes-Gn; ABSDF_tRNA29.
DR   EnsemblGenomes-Gn; ABSDF_tRNA3.
DR   EnsemblGenomes-Gn; ABSDF_tRNA30.
DR   EnsemblGenomes-Gn; ABSDF_tRNA31.
DR   EnsemblGenomes-Gn; ABSDF_tRNA32.
DR   EnsemblGenomes-Gn; ABSDF_tRNA33.
DR   EnsemblGenomes-Gn; ABSDF_tRNA34.
DR   EnsemblGenomes-Gn; ABSDF_tRNA35.
DR   EnsemblGenomes-Gn; ABSDF_tRNA36.
DR   EnsemblGenomes-Gn; ABSDF_tRNA37.
DR   EnsemblGenomes-Gn; ABSDF_tRNA38.
DR   EnsemblGenomes-Gn; ABSDF_tRNA39.
DR   EnsemblGenomes-Gn; ABSDF_tRNA4.
DR   EnsemblGenomes-Gn; ABSDF_tRNA40.
DR   EnsemblGenomes-Gn; ABSDF_tRNA41.
DR   EnsemblGenomes-Gn; ABSDF_tRNA42.
DR   EnsemblGenomes-Gn; ABSDF_tRNA43.
DR   EnsemblGenomes-Gn; ABSDF_tRNA44.
DR   EnsemblGenomes-Gn; ABSDF_tRNA45.
DR   EnsemblGenomes-Gn; ABSDF_tRNA46.
DR   EnsemblGenomes-Gn; ABSDF_tRNA47.
DR   EnsemblGenomes-Gn; ABSDF_tRNA48.
DR   EnsemblGenomes-Gn; ABSDF_tRNA49.
DR   EnsemblGenomes-Gn; ABSDF_tRNA5.
DR   EnsemblGenomes-Gn; ABSDF_tRNA50.
DR   EnsemblGenomes-Gn; ABSDF_tRNA51.
DR   EnsemblGenomes-Gn; ABSDF_tRNA52.
DR   EnsemblGenomes-Gn; ABSDF_tRNA53.
DR   EnsemblGenomes-Gn; ABSDF_tRNA54.
DR   EnsemblGenomes-Gn; ABSDF_tRNA55.
DR   EnsemblGenomes-Gn; ABSDF_tRNA56.
DR   EnsemblGenomes-Gn; ABSDF_tRNA57.
DR   EnsemblGenomes-Gn; ABSDF_tRNA58.
DR   EnsemblGenomes-Gn; ABSDF_tRNA59.
DR   EnsemblGenomes-Gn; ABSDF_tRNA6.
DR   EnsemblGenomes-Gn; ABSDF_tRNA60.
DR   EnsemblGenomes-Gn; ABSDF_tRNA61.
DR   EnsemblGenomes-Gn; ABSDF_tRNA62.
DR   EnsemblGenomes-Gn; ABSDF_tRNA63.
DR   EnsemblGenomes-Gn; ABSDF_tRNA64.
DR   EnsemblGenomes-Gn; ABSDF_tRNA7.
DR   EnsemblGenomes-Gn; ABSDF_tRNA8.
DR   EnsemblGenomes-Gn; ABSDF_tRNA9.
DR   EnsemblGenomes-Gn; EBG00001121850.
DR   EnsemblGenomes-Gn; EBG00001121851.
DR   EnsemblGenomes-Gn; EBG00001121852.
DR   EnsemblGenomes-Gn; EBG00001121853.
DR   EnsemblGenomes-Gn; EBG00001121854.
DR   EnsemblGenomes-Gn; EBG00001121855.
DR   EnsemblGenomes-Gn; EBG00001121856.
DR   EnsemblGenomes-Gn; EBG00001121857.
DR   EnsemblGenomes-Gn; EBG00001121858.
DR   EnsemblGenomes-Gn; EBG00001121859.
DR   EnsemblGenomes-Gn; EBG00001121860.
DR   EnsemblGenomes-Gn; EBG00001121861.
DR   EnsemblGenomes-Gn; EBG00001121862.
DR   EnsemblGenomes-Gn; EBG00001121863.
DR   EnsemblGenomes-Gn; EBG00001121864.
DR   EnsemblGenomes-Gn; EBG00001121865.
DR   EnsemblGenomes-Gn; EBG00001121866.
DR   EnsemblGenomes-Gn; EBG00001121867.
DR   EnsemblGenomes-Gn; EBG00001121868.
DR   EnsemblGenomes-Gn; EBG00001121869.
DR   EnsemblGenomes-Gn; EBG00001121870.
DR   EnsemblGenomes-Gn; EBG00001121871.
DR   EnsemblGenomes-Gn; EBG00001121872.
DR   EnsemblGenomes-Gn; EBG00001121873.
DR   EnsemblGenomes-Gn; EBG00001121874.
DR   EnsemblGenomes-Gn; EBG00001121875.
DR   EnsemblGenomes-Gn; EBG00001121876.
DR   EnsemblGenomes-Gn; EBG00001121877.
DR   EnsemblGenomes-Gn; EBG00001121878.
DR   EnsemblGenomes-Gn; EBG00001121879.
DR   EnsemblGenomes-Gn; EBG00001121880.
DR   EnsemblGenomes-Gn; EBG00001121881.
DR   EnsemblGenomes-Gn; EBG00001121882.
DR   EnsemblGenomes-Gn; EBG00001121883.
DR   EnsemblGenomes-Gn; EBG00001121884.
DR   EnsemblGenomes-Gn; EBG00001121885.
DR   EnsemblGenomes-Gn; EBG00001121886.
DR   EnsemblGenomes-Gn; EBG00001121887.
DR   EnsemblGenomes-Gn; EBG00001121888.
DR   EnsemblGenomes-Gn; EBG00001121889.
DR   EnsemblGenomes-Gn; EBG00001121890.
DR   EnsemblGenomes-Gn; EBG00001121891.
DR   EnsemblGenomes-Gn; EBG00001121892.
DR   EnsemblGenomes-Gn; EBG00001121893.
DR   EnsemblGenomes-Gn; EBG00001121894.
DR   EnsemblGenomes-Gn; EBG00001121895.
DR   EnsemblGenomes-Gn; EBG00001121896.
DR   EnsemblGenomes-Gn; EBG00001121897.
DR   EnsemblGenomes-Gn; EBG00001121898.
DR   EnsemblGenomes-Gn; EBG00001121899.
DR   EnsemblGenomes-Gn; EBG00001121900.
DR   EnsemblGenomes-Gn; EBG00001121901.
DR   EnsemblGenomes-Gn; EBG00001121902.
DR   EnsemblGenomes-Gn; EBG00001121903.
DR   EnsemblGenomes-Gn; EBG00001121904.
DR   EnsemblGenomes-Gn; EBG00001121905.
DR   EnsemblGenomes-Gn; EBG00001121906.
DR   EnsemblGenomes-Gn; EBG00001121907.
DR   EnsemblGenomes-Gn; EBG00001121908.
DR   EnsemblGenomes-Gn; EBG00001121909.
DR   EnsemblGenomes-Gn; EBG00001121910.
DR   EnsemblGenomes-Gn; EBG00001121911.
DR   EnsemblGenomes-Gn; EBG00001121912.
DR   EnsemblGenomes-Gn; EBG00001121913.
DR   EnsemblGenomes-Gn; EBG00001121914.
DR   EnsemblGenomes-Gn; EBG00001121915.
DR   EnsemblGenomes-Gn; EBG00001121916.
DR   EnsemblGenomes-Gn; EBG00001121917.
DR   EnsemblGenomes-Gn; EBG00001121918.
DR   EnsemblGenomes-Gn; EBG00001121919.
DR   EnsemblGenomes-Gn; EBG00001121920.
DR   EnsemblGenomes-Gn; EBG00001121921.
DR   EnsemblGenomes-Gn; EBG00001121922.
DR   EnsemblGenomes-Gn; EBG00001121923.
DR   EnsemblGenomes-Gn; EBG00001121924.
DR   EnsemblGenomes-Gn; EBG00001121925.
DR   EnsemblGenomes-Gn; EBG00001121926.
DR   EnsemblGenomes-Gn; EBG00001121927.
DR   EnsemblGenomes-Gn; EBG00001121928.
DR   EnsemblGenomes-Gn; EBG00001121929.
DR   EnsemblGenomes-Gn; EBG00001121930.
DR   EnsemblGenomes-Gn; EBG00001121931.
DR   EnsemblGenomes-Gn; EBG00001121932.
DR   EnsemblGenomes-Gn; EBG00001121933.
DR   EnsemblGenomes-Gn; EBG00001121934.
DR   EnsemblGenomes-Gn; EBG00001121935.
DR   EnsemblGenomes-Gn; EBG00001121936.
DR   EnsemblGenomes-Gn; EBG00001121937.
DR   EnsemblGenomes-Gn; EBG00001121938.
DR   EnsemblGenomes-Gn; EBG00001121939.
DR   EnsemblGenomes-Gn; EBG00001121940.
DR   EnsemblGenomes-Gn; EBG00001121941.
DR   EnsemblGenomes-Gn; EBG00001121942.
DR   EnsemblGenomes-Gn; EBG00001121943.
DR   EnsemblGenomes-Gn; EBG00001121944.
DR   EnsemblGenomes-Gn; EBG00001121945.
DR   EnsemblGenomes-Gn; EBG00001121946.
DR   EnsemblGenomes-Gn; EBG00001121947.
DR   EnsemblGenomes-Gn; EBG00001121948.
DR   EnsemblGenomes-Tr; ABSDF0013.
DR   EnsemblGenomes-Tr; ABSDF0014.
DR   EnsemblGenomes-Tr; ABSDF0017.
DR   EnsemblGenomes-Tr; ABSDF0055.
DR   EnsemblGenomes-Tr; ABSDF0084.
DR   EnsemblGenomes-Tr; ABSDF0085.
DR   EnsemblGenomes-Tr; ABSDF0102.
DR   EnsemblGenomes-Tr; ABSDF0125.
DR   EnsemblGenomes-Tr; ABSDF0126.
DR   EnsemblGenomes-Tr; ABSDF0130.
DR   EnsemblGenomes-Tr; ABSDF0132.
DR   EnsemblGenomes-Tr; ABSDF0140.
DR   EnsemblGenomes-Tr; ABSDF0141.
DR   EnsemblGenomes-Tr; ABSDF0150.
DR   EnsemblGenomes-Tr; ABSDF0152.
DR   EnsemblGenomes-Tr; ABSDF0174.
DR   EnsemblGenomes-Tr; ABSDF0181.
DR   EnsemblGenomes-Tr; ABSDF0182.
DR   EnsemblGenomes-Tr; ABSDF0183.
DR   EnsemblGenomes-Tr; ABSDF0188.
DR   EnsemblGenomes-Tr; ABSDF0190.
DR   EnsemblGenomes-Tr; ABSDF0192.
DR   EnsemblGenomes-Tr; ABSDF0196.
DR   EnsemblGenomes-Tr; ABSDF0200.
DR   EnsemblGenomes-Tr; ABSDF0203.
DR   EnsemblGenomes-Tr; ABSDF0209.
DR   EnsemblGenomes-Tr; ABSDF0224.
DR   EnsemblGenomes-Tr; ABSDF0225.
DR   EnsemblGenomes-Tr; ABSDF0226.
DR   EnsemblGenomes-Tr; ABSDF0229.
DR   EnsemblGenomes-Tr; ABSDF0230.
DR   EnsemblGenomes-Tr; ABSDF0232.
DR   EnsemblGenomes-Tr; ABSDF0235.
DR   EnsemblGenomes-Tr; ABSDF0238.
DR   EnsemblGenomes-Tr; ABSDF0239.
DR   EnsemblGenomes-Tr; ABSDF0245.
DR   EnsemblGenomes-Tr; ABSDF0247.
DR   EnsemblGenomes-Tr; ABSDF0252.
DR   EnsemblGenomes-Tr; ABSDF0254.
DR   EnsemblGenomes-Tr; ABSDF0257.
DR   EnsemblGenomes-Tr; ABSDF0258.
DR   EnsemblGenomes-Tr; ABSDF0266.
DR   EnsemblGenomes-Tr; ABSDF0267.
DR   EnsemblGenomes-Tr; ABSDF0272.
DR   EnsemblGenomes-Tr; ABSDF0273.
DR   EnsemblGenomes-Tr; ABSDF0274.
DR   EnsemblGenomes-Tr; ABSDF0288.
DR   EnsemblGenomes-Tr; ABSDF0290.
DR   EnsemblGenomes-Tr; ABSDF0294.
DR   EnsemblGenomes-Tr; ABSDF0295.
DR   EnsemblGenomes-Tr; ABSDF0298.
DR   EnsemblGenomes-Tr; ABSDF0299.
DR   EnsemblGenomes-Tr; ABSDF0300.
DR   EnsemblGenomes-Tr; ABSDF0311.
DR   EnsemblGenomes-Tr; ABSDF0313.
DR   EnsemblGenomes-Tr; ABSDF0330.
DR   EnsemblGenomes-Tr; ABSDF0331.
DR   EnsemblGenomes-Tr; ABSDF0340.
DR   EnsemblGenomes-Tr; ABSDF0350.
DR   EnsemblGenomes-Tr; ABSDF0351.
DR   EnsemblGenomes-Tr; ABSDF0361.
DR   EnsemblGenomes-Tr; ABSDF0374.
DR   EnsemblGenomes-Tr; ABSDF0376.
DR   EnsemblGenomes-Tr; ABSDF0384.
DR   EnsemblGenomes-Tr; ABSDF0385.
DR   EnsemblGenomes-Tr; ABSDF0407.
DR   EnsemblGenomes-Tr; ABSDF0409.
DR   EnsemblGenomes-Tr; ABSDF0411.
DR   EnsemblGenomes-Tr; ABSDF0416.
DR   EnsemblGenomes-Tr; ABSDF0417.
DR   EnsemblGenomes-Tr; ABSDF0418.
DR   EnsemblGenomes-Tr; ABSDF0453.
DR   EnsemblGenomes-Tr; ABSDF0457.
DR   EnsemblGenomes-Tr; ABSDF0462.
DR   EnsemblGenomes-Tr; ABSDF0475.
DR   EnsemblGenomes-Tr; ABSDF0476.
DR   EnsemblGenomes-Tr; ABSDF0494.
DR   EnsemblGenomes-Tr; ABSDF0499.
DR   EnsemblGenomes-Tr; ABSDF0500.
DR   EnsemblGenomes-Tr; ABSDF0510.
DR   EnsemblGenomes-Tr; ABSDF0512.
DR   EnsemblGenomes-Tr; ABSDF0513.
DR   EnsemblGenomes-Tr; ABSDF0522.
DR   EnsemblGenomes-Tr; ABSDF0523.
DR   EnsemblGenomes-Tr; ABSDF0537.
DR   EnsemblGenomes-Tr; ABSDF0556.
DR   EnsemblGenomes-Tr; ABSDF0558.
DR   EnsemblGenomes-Tr; ABSDF0560.
DR   EnsemblGenomes-Tr; ABSDF0561.
DR   EnsemblGenomes-Tr; ABSDF0562.
DR   EnsemblGenomes-Tr; ABSDF0566.
DR   EnsemblGenomes-Tr; ABSDF0567.
DR   EnsemblGenomes-Tr; ABSDF0579.
DR   EnsemblGenomes-Tr; ABSDF0580.
DR   EnsemblGenomes-Tr; ABSDF0601.
DR   EnsemblGenomes-Tr; ABSDF0607.
DR   EnsemblGenomes-Tr; ABSDF0608.
DR   EnsemblGenomes-Tr; ABSDF0619.
DR   EnsemblGenomes-Tr; ABSDF0620.
DR   EnsemblGenomes-Tr; ABSDF0621.
DR   EnsemblGenomes-Tr; ABSDF0622.
DR   EnsemblGenomes-Tr; ABSDF0625.
DR   EnsemblGenomes-Tr; ABSDF0626.
DR   EnsemblGenomes-Tr; ABSDF0636.
DR   EnsemblGenomes-Tr; ABSDF0637.
DR   EnsemblGenomes-Tr; ABSDF0642.
DR   EnsemblGenomes-Tr; ABSDF0643.
DR   EnsemblGenomes-Tr; ABSDF0649.
DR   EnsemblGenomes-Tr; ABSDF0650.
DR   EnsemblGenomes-Tr; ABSDF0651.
DR   EnsemblGenomes-Tr; ABSDF0661.
DR   EnsemblGenomes-Tr; ABSDF0662.
DR   EnsemblGenomes-Tr; ABSDF0668.
DR   EnsemblGenomes-Tr; ABSDF0669.
DR   EnsemblGenomes-Tr; ABSDF0691.
DR   EnsemblGenomes-Tr; ABSDF0693.
DR   EnsemblGenomes-Tr; ABSDF0699.
DR   EnsemblGenomes-Tr; ABSDF0700.
DR   EnsemblGenomes-Tr; ABSDF0722.
DR   EnsemblGenomes-Tr; ABSDF0723.
DR   EnsemblGenomes-Tr; ABSDF0724.
DR   EnsemblGenomes-Tr; ABSDF0725.
DR   EnsemblGenomes-Tr; ABSDF0731.
DR   EnsemblGenomes-Tr; ABSDF0750.
DR   EnsemblGenomes-Tr; ABSDF0752.
DR   EnsemblGenomes-Tr; ABSDF0753.
DR   EnsemblGenomes-Tr; ABSDF0754.
DR   EnsemblGenomes-Tr; ABSDF0765.
DR   EnsemblGenomes-Tr; ABSDF0766.
DR   EnsemblGenomes-Tr; ABSDF0780.
DR   EnsemblGenomes-Tr; ABSDF0781.
DR   EnsemblGenomes-Tr; ABSDF0783.
DR   EnsemblGenomes-Tr; ABSDF0792.
DR   EnsemblGenomes-Tr; ABSDF0810.
DR   EnsemblGenomes-Tr; ABSDF0813.
DR   EnsemblGenomes-Tr; ABSDF0814.
DR   EnsemblGenomes-Tr; ABSDF0815.
DR   EnsemblGenomes-Tr; ABSDF0816.
DR   EnsemblGenomes-Tr; ABSDF0822.
DR   EnsemblGenomes-Tr; ABSDF0823.
DR   EnsemblGenomes-Tr; ABSDF0825.
DR   EnsemblGenomes-Tr; ABSDF0826.
DR   EnsemblGenomes-Tr; ABSDF0831.
DR   EnsemblGenomes-Tr; ABSDF0832.
DR   EnsemblGenomes-Tr; ABSDF0834.
DR   EnsemblGenomes-Tr; ABSDF0835.
DR   EnsemblGenomes-Tr; ABSDF0840.
DR   EnsemblGenomes-Tr; ABSDF0855.
DR   EnsemblGenomes-Tr; ABSDF0856.
DR   EnsemblGenomes-Tr; ABSDF0861.
DR   EnsemblGenomes-Tr; ABSDF0862.
DR   EnsemblGenomes-Tr; ABSDF0863.
DR   EnsemblGenomes-Tr; ABSDF0865.
DR   EnsemblGenomes-Tr; ABSDF0867.
DR   EnsemblGenomes-Tr; ABSDF0883.
DR   EnsemblGenomes-Tr; ABSDF0884.
DR   EnsemblGenomes-Tr; ABSDF0885.
DR   EnsemblGenomes-Tr; ABSDF0886.
DR   EnsemblGenomes-Tr; ABSDF0887.
DR   EnsemblGenomes-Tr; ABSDF0890.
DR   EnsemblGenomes-Tr; ABSDF0891.
DR   EnsemblGenomes-Tr; ABSDF0913.
DR   EnsemblGenomes-Tr; ABSDF0914.
DR   EnsemblGenomes-Tr; ABSDF0927.
DR   EnsemblGenomes-Tr; ABSDF0929.
DR   EnsemblGenomes-Tr; ABSDF0958.
DR   EnsemblGenomes-Tr; ABSDF0962.
DR   EnsemblGenomes-Tr; ABSDF0964.
DR   EnsemblGenomes-Tr; ABSDF0972.
DR   EnsemblGenomes-Tr; ABSDF0973.
DR   EnsemblGenomes-Tr; ABSDF0978.
DR   EnsemblGenomes-Tr; ABSDF0987.
DR   EnsemblGenomes-Tr; ABSDF0988.
DR   EnsemblGenomes-Tr; ABSDF0990.
DR   EnsemblGenomes-Tr; ABSDF0991.
DR   EnsemblGenomes-Tr; ABSDF1031.
DR   EnsemblGenomes-Tr; ABSDF1062.
DR   EnsemblGenomes-Tr; ABSDF1063.
DR   EnsemblGenomes-Tr; ABSDF1064.
DR   EnsemblGenomes-Tr; ABSDF1065.
DR   EnsemblGenomes-Tr; ABSDF1075.
DR   EnsemblGenomes-Tr; ABSDF1076.
DR   EnsemblGenomes-Tr; ABSDF1080.
DR   EnsemblGenomes-Tr; ABSDF1081.
DR   EnsemblGenomes-Tr; ABSDF1085.
DR   EnsemblGenomes-Tr; ABSDF1086.
DR   EnsemblGenomes-Tr; ABSDF1091.
DR   EnsemblGenomes-Tr; ABSDF1092.
DR   EnsemblGenomes-Tr; ABSDF1093.1.
DR   EnsemblGenomes-Tr; ABSDF1093.5.
DR   EnsemblGenomes-Tr; ABSDF1094.
DR   EnsemblGenomes-Tr; ABSDF1098.
DR   EnsemblGenomes-Tr; ABSDF1099.
DR   EnsemblGenomes-Tr; ABSDF1139.
DR   EnsemblGenomes-Tr; ABSDF1140.
DR   EnsemblGenomes-Tr; ABSDF1141.
DR   EnsemblGenomes-Tr; ABSDF1153.
DR   EnsemblGenomes-Tr; ABSDF1155.
DR   EnsemblGenomes-Tr; ABSDF1155.1.
DR   EnsemblGenomes-Tr; ABSDF1164.
DR   EnsemblGenomes-Tr; ABSDF1166.
DR   EnsemblGenomes-Tr; ABSDF1175.
DR   EnsemblGenomes-Tr; ABSDF1176.
DR   EnsemblGenomes-Tr; ABSDF1178.
DR   EnsemblGenomes-Tr; ABSDF1198.
DR   EnsemblGenomes-Tr; ABSDF1199.
DR   EnsemblGenomes-Tr; ABSDF1205.
DR   EnsemblGenomes-Tr; ABSDF1206.
DR   EnsemblGenomes-Tr; ABSDF1220.
DR   EnsemblGenomes-Tr; ABSDF1221.
DR   EnsemblGenomes-Tr; ABSDF1222.
DR   EnsemblGenomes-Tr; ABSDF1223.
DR   EnsemblGenomes-Tr; ABSDF1224.
DR   EnsemblGenomes-Tr; ABSDF1226.
DR   EnsemblGenomes-Tr; ABSDF1227.
DR   EnsemblGenomes-Tr; ABSDF1231.
DR   EnsemblGenomes-Tr; ABSDF1232.
DR   EnsemblGenomes-Tr; ABSDF1237.
DR   EnsemblGenomes-Tr; ABSDF1238.
DR   EnsemblGenomes-Tr; ABSDF1246.
DR   EnsemblGenomes-Tr; ABSDF1248.
DR   EnsemblGenomes-Tr; ABSDF1256.
DR   EnsemblGenomes-Tr; ABSDF1257.
DR   EnsemblGenomes-Tr; ABSDF1290.
DR   EnsemblGenomes-Tr; ABSDF1292.
DR   EnsemblGenomes-Tr; ABSDF1293.
DR   EnsemblGenomes-Tr; ABSDF1294.
DR   EnsemblGenomes-Tr; ABSDF1296.
DR   EnsemblGenomes-Tr; ABSDF1299.
DR   EnsemblGenomes-Tr; ABSDF1302.
DR   EnsemblGenomes-Tr; ABSDF1305.
DR   EnsemblGenomes-Tr; ABSDF1312.
DR   EnsemblGenomes-Tr; ABSDF1314.
DR   EnsemblGenomes-Tr; ABSDF1316.
DR   EnsemblGenomes-Tr; ABSDF1340.
DR   EnsemblGenomes-Tr; ABSDF1358.
DR   EnsemblGenomes-Tr; ABSDF1360.
DR   EnsemblGenomes-Tr; ABSDF1363.
DR   EnsemblGenomes-Tr; ABSDF1365.
DR   EnsemblGenomes-Tr; ABSDF1366.
DR   EnsemblGenomes-Tr; ABSDF1368.
DR   EnsemblGenomes-Tr; ABSDF1369.
DR   EnsemblGenomes-Tr; ABSDF1370.
DR   EnsemblGenomes-Tr; ABSDF1371.
DR   EnsemblGenomes-Tr; ABSDF1375.
DR   EnsemblGenomes-Tr; ABSDF1377.
DR   EnsemblGenomes-Tr; ABSDF1387.
DR   EnsemblGenomes-Tr; ABSDF1396.
DR   EnsemblGenomes-Tr; ABSDF1398.
DR   EnsemblGenomes-Tr; ABSDF1402.
DR   EnsemblGenomes-Tr; ABSDF1405.
DR   EnsemblGenomes-Tr; ABSDF1406.
DR   EnsemblGenomes-Tr; ABSDF1412.
DR   EnsemblGenomes-Tr; ABSDF1413.
DR   EnsemblGenomes-Tr; ABSDF1414.
DR   EnsemblGenomes-Tr; ABSDF1423.
DR   EnsemblGenomes-Tr; ABSDF1443.
DR   EnsemblGenomes-Tr; ABSDF1444.
DR   EnsemblGenomes-Tr; ABSDF1460.
DR   EnsemblGenomes-Tr; ABSDF1461.
DR   EnsemblGenomes-Tr; ABSDF1466.
DR   EnsemblGenomes-Tr; ABSDF1468.
DR   EnsemblGenomes-Tr; ABSDF1473.
DR   EnsemblGenomes-Tr; ABSDF1490.
DR   EnsemblGenomes-Tr; ABSDF1496.
DR   EnsemblGenomes-Tr; ABSDF1505.
DR   EnsemblGenomes-Tr; ABSDF1519.
DR   EnsemblGenomes-Tr; ABSDF1522.
DR   EnsemblGenomes-Tr; ABSDF1530.
DR   EnsemblGenomes-Tr; ABSDF1531.
DR   EnsemblGenomes-Tr; ABSDF1537.
DR   EnsemblGenomes-Tr; ABSDF1538.
DR   EnsemblGenomes-Tr; ABSDF1539.
DR   EnsemblGenomes-Tr; ABSDF1540.
DR   EnsemblGenomes-Tr; ABSDF1549.
DR   EnsemblGenomes-Tr; ABSDF1550.
DR   EnsemblGenomes-Tr; ABSDF1554.
DR   EnsemblGenomes-Tr; ABSDF1560.
DR   EnsemblGenomes-Tr; ABSDF1561.
DR   EnsemblGenomes-Tr; ABSDF1562.
DR   EnsemblGenomes-Tr; ABSDF1564.
DR   EnsemblGenomes-Tr; ABSDF1566.
DR   EnsemblGenomes-Tr; ABSDF1579.
DR   EnsemblGenomes-Tr; ABSDF1580.
DR   EnsemblGenomes-Tr; ABSDF1583.
DR   EnsemblGenomes-Tr; ABSDF1584.
DR   EnsemblGenomes-Tr; ABSDF1612.
DR   EnsemblGenomes-Tr; ABSDF1613.
DR   EnsemblGenomes-Tr; ABSDF1614.
DR   EnsemblGenomes-Tr; ABSDF1626.
DR   EnsemblGenomes-Tr; ABSDF1627.
DR   EnsemblGenomes-Tr; ABSDF1628.
DR   EnsemblGenomes-Tr; ABSDF1634.
DR   EnsemblGenomes-Tr; ABSDF1635.
DR   EnsemblGenomes-Tr; ABSDF1649.
DR   EnsemblGenomes-Tr; ABSDF1650.
DR   EnsemblGenomes-Tr; ABSDF1653.
DR   EnsemblGenomes-Tr; ABSDF1654.
DR   EnsemblGenomes-Tr; ABSDF1664.
DR   EnsemblGenomes-Tr; ABSDF1667.
DR   EnsemblGenomes-Tr; ABSDF1668.
DR   EnsemblGenomes-Tr; ABSDF1696.
DR   EnsemblGenomes-Tr; ABSDF1697.
DR   EnsemblGenomes-Tr; ABSDF1705.
DR   EnsemblGenomes-Tr; ABSDF1721.
DR   EnsemblGenomes-Tr; ABSDF1744.
DR   EnsemblGenomes-Tr; ABSDF1796.
DR   EnsemblGenomes-Tr; ABSDF1838.
DR   EnsemblGenomes-Tr; ABSDF1839.
DR   EnsemblGenomes-Tr; ABSDF1841.
DR   EnsemblGenomes-Tr; ABSDF1846.
DR   EnsemblGenomes-Tr; ABSDF1847.
DR   EnsemblGenomes-Tr; ABSDF1865.
DR   EnsemblGenomes-Tr; ABSDF1866.
DR   EnsemblGenomes-Tr; ABSDF1878.
DR   EnsemblGenomes-Tr; ABSDF1880.
DR   EnsemblGenomes-Tr; ABSDF1883.
DR   EnsemblGenomes-Tr; ABSDF1884.
DR   EnsemblGenomes-Tr; ABSDF1891.
DR   EnsemblGenomes-Tr; ABSDF1892.
DR   EnsemblGenomes-Tr; ABSDF1893.
DR   EnsemblGenomes-Tr; ABSDF1899.
DR   EnsemblGenomes-Tr; ABSDF1908.
DR   EnsemblGenomes-Tr; ABSDF1909.
DR   EnsemblGenomes-Tr; ABSDF1920.
DR   EnsemblGenomes-Tr; ABSDF1921.
DR   EnsemblGenomes-Tr; ABSDF1932.
DR   EnsemblGenomes-Tr; ABSDF1943.
DR   EnsemblGenomes-Tr; ABSDF1944.
DR   EnsemblGenomes-Tr; ABSDF1945.
DR   EnsemblGenomes-Tr; ABSDF1946.
DR   EnsemblGenomes-Tr; ABSDF1948.
DR   EnsemblGenomes-Tr; ABSDF1949.
DR   EnsemblGenomes-Tr; ABSDF1950.
DR   EnsemblGenomes-Tr; ABSDF1951.
DR   EnsemblGenomes-Tr; ABSDF1952.
DR   EnsemblGenomes-Tr; ABSDF1957.
DR   EnsemblGenomes-Tr; ABSDF1959.
DR   EnsemblGenomes-Tr; ABSDF1966.
DR   EnsemblGenomes-Tr; ABSDF1968.
DR   EnsemblGenomes-Tr; ABSDF1972.
DR   EnsemblGenomes-Tr; ABSDF1973.
DR   EnsemblGenomes-Tr; ABSDF1975.
DR   EnsemblGenomes-Tr; ABSDF1991.
DR   EnsemblGenomes-Tr; ABSDF2001.
DR   EnsemblGenomes-Tr; ABSDF2003.
DR   EnsemblGenomes-Tr; ABSDF2004.
DR   EnsemblGenomes-Tr; ABSDF2006.
DR   EnsemblGenomes-Tr; ABSDF2007.
DR   EnsemblGenomes-Tr; ABSDF2014.
DR   EnsemblGenomes-Tr; ABSDF2015.
DR   EnsemblGenomes-Tr; ABSDF2029.
DR   EnsemblGenomes-Tr; ABSDF2031.
DR   EnsemblGenomes-Tr; ABSDF2040.
DR   EnsemblGenomes-Tr; ABSDF2041.
DR   EnsemblGenomes-Tr; ABSDF2042.
DR   EnsemblGenomes-Tr; ABSDF2043.
DR   EnsemblGenomes-Tr; ABSDF2059.
DR   EnsemblGenomes-Tr; ABSDF2060.
DR   EnsemblGenomes-Tr; ABSDF2062.
DR   EnsemblGenomes-Tr; ABSDF2063.
DR   EnsemblGenomes-Tr; ABSDF2067.
DR   EnsemblGenomes-Tr; ABSDF2068.
DR   EnsemblGenomes-Tr; ABSDF2074.
DR   EnsemblGenomes-Tr; ABSDF2076.
DR   EnsemblGenomes-Tr; ABSDF2078.
DR   EnsemblGenomes-Tr; ABSDF2079.
DR   EnsemblGenomes-Tr; ABSDF2096.
DR   EnsemblGenomes-Tr; ABSDF2110.
DR   EnsemblGenomes-Tr; ABSDF2112.
DR   EnsemblGenomes-Tr; ABSDF2130.
DR   EnsemblGenomes-Tr; ABSDF2131.
DR   EnsemblGenomes-Tr; ABSDF2146.
DR   EnsemblGenomes-Tr; ABSDF2148.
DR   EnsemblGenomes-Tr; ABSDF2149.
DR   EnsemblGenomes-Tr; ABSDF2150.
DR   EnsemblGenomes-Tr; ABSDF2176.
DR   EnsemblGenomes-Tr; ABSDF2177.
DR   EnsemblGenomes-Tr; ABSDF2186.
DR   EnsemblGenomes-Tr; ABSDF2187.
DR   EnsemblGenomes-Tr; ABSDF2196.
DR   EnsemblGenomes-Tr; ABSDF2198.
DR   EnsemblGenomes-Tr; ABSDF2224.
DR   EnsemblGenomes-Tr; ABSDF2225.
DR   EnsemblGenomes-Tr; ABSDF2274.
DR   EnsemblGenomes-Tr; ABSDF2279.
DR   EnsemblGenomes-Tr; ABSDF2286.
DR   EnsemblGenomes-Tr; ABSDF2287.
DR   EnsemblGenomes-Tr; ABSDF2291.
DR   EnsemblGenomes-Tr; ABSDF2293.
DR   EnsemblGenomes-Tr; ABSDF2294.
DR   EnsemblGenomes-Tr; ABSDF2296.
DR   EnsemblGenomes-Tr; ABSDF2297.
DR   EnsemblGenomes-Tr; ABSDF2303.
DR   EnsemblGenomes-Tr; ABSDF2304.
DR   EnsemblGenomes-Tr; ABSDF2305.
DR   EnsemblGenomes-Tr; ABSDF2306.
DR   EnsemblGenomes-Tr; ABSDF2326.
DR   EnsemblGenomes-Tr; ABSDF2328.
DR   EnsemblGenomes-Tr; ABSDF2338.
DR   EnsemblGenomes-Tr; ABSDF2339.
DR   EnsemblGenomes-Tr; ABSDF2354.
DR   EnsemblGenomes-Tr; ABSDF2355.
DR   EnsemblGenomes-Tr; ABSDF2387.
DR   EnsemblGenomes-Tr; ABSDF2391.
DR   EnsemblGenomes-Tr; ABSDF2399.
DR   EnsemblGenomes-Tr; ABSDF2406.
DR   EnsemblGenomes-Tr; ABSDF2407.
DR   EnsemblGenomes-Tr; ABSDF2411.
DR   EnsemblGenomes-Tr; ABSDF2413.
DR   EnsemblGenomes-Tr; ABSDF2414.
DR   EnsemblGenomes-Tr; ABSDF2415.
DR   EnsemblGenomes-Tr; ABSDF2416.
DR   EnsemblGenomes-Tr; ABSDF2425.
DR   EnsemblGenomes-Tr; ABSDF2429.
DR   EnsemblGenomes-Tr; ABSDF2430.
DR   EnsemblGenomes-Tr; ABSDF2431.
DR   EnsemblGenomes-Tr; ABSDF2446.
DR   EnsemblGenomes-Tr; ABSDF2447.
DR   EnsemblGenomes-Tr; ABSDF2448.
DR   EnsemblGenomes-Tr; ABSDF2450.
DR   EnsemblGenomes-Tr; ABSDF2519.
DR   EnsemblGenomes-Tr; ABSDF2520.
DR   EnsemblGenomes-Tr; ABSDF2521.
DR   EnsemblGenomes-Tr; ABSDF2523.
DR   EnsemblGenomes-Tr; ABSDF2534.
DR   EnsemblGenomes-Tr; ABSDF2535.
DR   EnsemblGenomes-Tr; ABSDF2536.
DR   EnsemblGenomes-Tr; ABSDF2537.
DR   EnsemblGenomes-Tr; ABSDF2542.
DR   EnsemblGenomes-Tr; ABSDF2543.
DR   EnsemblGenomes-Tr; ABSDF2580.
DR   EnsemblGenomes-Tr; ABSDF2588.
DR   EnsemblGenomes-Tr; ABSDF2589.
DR   EnsemblGenomes-Tr; ABSDF2591.
DR   EnsemblGenomes-Tr; ABSDF2602.
DR   EnsemblGenomes-Tr; ABSDF2609.
DR   EnsemblGenomes-Tr; ABSDF2610.
DR   EnsemblGenomes-Tr; ABSDF2611.
DR   EnsemblGenomes-Tr; ABSDF2612.
DR   EnsemblGenomes-Tr; ABSDF2631.
DR   EnsemblGenomes-Tr; ABSDF2633.
DR   EnsemblGenomes-Tr; ABSDF2634.
DR   EnsemblGenomes-Tr; ABSDF2670.
DR   EnsemblGenomes-Tr; ABSDF2680.
DR   EnsemblGenomes-Tr; ABSDF2681.
DR   EnsemblGenomes-Tr; ABSDF2682.
DR   EnsemblGenomes-Tr; ABSDF2696.
DR   EnsemblGenomes-Tr; ABSDF2715.
DR   EnsemblGenomes-Tr; ABSDF2716.
DR   EnsemblGenomes-Tr; ABSDF2725.
DR   EnsemblGenomes-Tr; ABSDF2726.
DR   EnsemblGenomes-Tr; ABSDF2735.
DR   EnsemblGenomes-Tr; ABSDF2736.
DR   EnsemblGenomes-Tr; ABSDF2737.
DR   EnsemblGenomes-Tr; ABSDF2739.
DR   EnsemblGenomes-Tr; ABSDF2747.
DR   EnsemblGenomes-Tr; ABSDF2748.
DR   EnsemblGenomes-Tr; ABSDF2756.
DR   EnsemblGenomes-Tr; ABSDF2757.
DR   EnsemblGenomes-Tr; ABSDF2767.
DR   EnsemblGenomes-Tr; ABSDF2774.
DR   EnsemblGenomes-Tr; ABSDF2775.
DR   EnsemblGenomes-Tr; ABSDF2812.
DR   EnsemblGenomes-Tr; ABSDF2814.
DR   EnsemblGenomes-Tr; ABSDF2819.
DR   EnsemblGenomes-Tr; ABSDF2820.
DR   EnsemblGenomes-Tr; ABSDF2827.
DR   EnsemblGenomes-Tr; ABSDF2829.
DR   EnsemblGenomes-Tr; ABSDF2849.
DR   EnsemblGenomes-Tr; ABSDF2851.
DR   EnsemblGenomes-Tr; ABSDF2852.
DR   EnsemblGenomes-Tr; ABSDF2879.
DR   EnsemblGenomes-Tr; ABSDF2880.
DR   EnsemblGenomes-Tr; ABSDF2891.
DR   EnsemblGenomes-Tr; ABSDF2892.
DR   EnsemblGenomes-Tr; ABSDF2909.
DR   EnsemblGenomes-Tr; ABSDF2911.
DR   EnsemblGenomes-Tr; ABSDF2916.
DR   EnsemblGenomes-Tr; ABSDF2918.
DR   EnsemblGenomes-Tr; ABSDF2919.
DR   EnsemblGenomes-Tr; ABSDF2925.
DR   EnsemblGenomes-Tr; ABSDF2926.
DR   EnsemblGenomes-Tr; ABSDF2927.
DR   EnsemblGenomes-Tr; ABSDF2928.
DR   EnsemblGenomes-Tr; ABSDF2939.
DR   EnsemblGenomes-Tr; ABSDF2940.
DR   EnsemblGenomes-Tr; ABSDF2969.
DR   EnsemblGenomes-Tr; ABSDF2970.
DR   EnsemblGenomes-Tr; ABSDF2971.
DR   EnsemblGenomes-Tr; ABSDF2972.
DR   EnsemblGenomes-Tr; ABSDF2974.
DR   EnsemblGenomes-Tr; ABSDF3003.
DR   EnsemblGenomes-Tr; ABSDF3004.
DR   EnsemblGenomes-Tr; ABSDF3015.
DR   EnsemblGenomes-Tr; ABSDF3016.
DR   EnsemblGenomes-Tr; ABSDF3017.
DR   EnsemblGenomes-Tr; ABSDF3023.
DR   EnsemblGenomes-Tr; ABSDF3037.
DR   EnsemblGenomes-Tr; ABSDF3038.
DR   EnsemblGenomes-Tr; ABSDF3044.
DR   EnsemblGenomes-Tr; ABSDF3045.
DR   EnsemblGenomes-Tr; ABSDF3068.
DR   EnsemblGenomes-Tr; ABSDF3072.
DR   EnsemblGenomes-Tr; ABSDF3075.
DR   EnsemblGenomes-Tr; ABSDF3087.
DR   EnsemblGenomes-Tr; ABSDF3088.
DR   EnsemblGenomes-Tr; ABSDF3099.
DR   EnsemblGenomes-Tr; ABSDF3129.
DR   EnsemblGenomes-Tr; ABSDF3130.
DR   EnsemblGenomes-Tr; ABSDF3135.
DR   EnsemblGenomes-Tr; ABSDF3148.
DR   EnsemblGenomes-Tr; ABSDF3150.
DR   EnsemblGenomes-Tr; ABSDF3167.
DR   EnsemblGenomes-Tr; ABSDF3169.
DR   EnsemblGenomes-Tr; ABSDF3189.
DR   EnsemblGenomes-Tr; ABSDF3191.
DR   EnsemblGenomes-Tr; ABSDF3192.
DR   EnsemblGenomes-Tr; ABSDF3193.
DR   EnsemblGenomes-Tr; ABSDF3210.
DR   EnsemblGenomes-Tr; ABSDF3211.
DR   EnsemblGenomes-Tr; ABSDF3212.
DR   EnsemblGenomes-Tr; ABSDF3213.
DR   EnsemblGenomes-Tr; ABSDF3227.
DR   EnsemblGenomes-Tr; ABSDF3228.
DR   EnsemblGenomes-Tr; ABSDF3230.
DR   EnsemblGenomes-Tr; ABSDF3231.
DR   EnsemblGenomes-Tr; ABSDF3240.
DR   EnsemblGenomes-Tr; ABSDF3241.
DR   EnsemblGenomes-Tr; ABSDF3251.
DR   EnsemblGenomes-Tr; ABSDF3252.
DR   EnsemblGenomes-Tr; ABSDF3258.
DR   EnsemblGenomes-Tr; ABSDF3260.
DR   EnsemblGenomes-Tr; ABSDF3269.
DR   EnsemblGenomes-Tr; ABSDF3270.
DR   EnsemblGenomes-Tr; ABSDF3275.
DR   EnsemblGenomes-Tr; ABSDF3276.
DR   EnsemblGenomes-Tr; ABSDF3278.
DR   EnsemblGenomes-Tr; ABSDF3279.
DR   EnsemblGenomes-Tr; ABSDF3298.
DR   EnsemblGenomes-Tr; ABSDF3299.
DR   EnsemblGenomes-Tr; ABSDF3300.
DR   EnsemblGenomes-Tr; ABSDF3301.
DR   EnsemblGenomes-Tr; ABSDF3303.
DR   EnsemblGenomes-Tr; ABSDF3319.
DR   EnsemblGenomes-Tr; ABSDF3341.
DR   EnsemblGenomes-Tr; ABSDF3344.
DR   EnsemblGenomes-Tr; ABSDF3354.
DR   EnsemblGenomes-Tr; ABSDF3355.
DR   EnsemblGenomes-Tr; ABSDF3357.
DR   EnsemblGenomes-Tr; ABSDF3360.
DR   EnsemblGenomes-Tr; ABSDF3361.
DR   EnsemblGenomes-Tr; ABSDF3362.
DR   EnsemblGenomes-Tr; ABSDF3365.
DR   EnsemblGenomes-Tr; ABSDF3370.
DR   EnsemblGenomes-Tr; ABSDF3371.
DR   EnsemblGenomes-Tr; ABSDF3379.
DR   EnsemblGenomes-Tr; ABSDF3381.
DR   EnsemblGenomes-Tr; ABSDF3382.
DR   EnsemblGenomes-Tr; ABSDF3389.
DR   EnsemblGenomes-Tr; ABSDF3390.
DR   EnsemblGenomes-Tr; ABSDF3396.
DR   EnsemblGenomes-Tr; ABSDF3397.
DR   EnsemblGenomes-Tr; ABSDF3407.
DR   EnsemblGenomes-Tr; ABSDF3419.
DR   EnsemblGenomes-Tr; ABSDF3420.
DR   EnsemblGenomes-Tr; ABSDF3424.
DR   EnsemblGenomes-Tr; ABSDF3425.
DR   EnsemblGenomes-Tr; ABSDF3426.
DR   EnsemblGenomes-Tr; ABSDF3436.
DR   EnsemblGenomes-Tr; ABSDF3453.
DR   EnsemblGenomes-Tr; ABSDF3455.
DR   EnsemblGenomes-Tr; ABSDF3460.
DR   EnsemblGenomes-Tr; ABSDF3461.
DR   EnsemblGenomes-Tr; ABSDF3475.
DR   EnsemblGenomes-Tr; ABSDF3477.
DR   EnsemblGenomes-Tr; ABSDF3479.
DR   EnsemblGenomes-Tr; ABSDF3494.
DR   EnsemblGenomes-Tr; ABSDF3496.
DR   EnsemblGenomes-Tr; ABSDF3507.
DR   EnsemblGenomes-Tr; ABSDF3508.
DR   EnsemblGenomes-Tr; ABSDF3510.
DR   EnsemblGenomes-Tr; ABSDF3511.
DR   EnsemblGenomes-Tr; ABSDF3517.
DR   EnsemblGenomes-Tr; ABSDF3518.
DR   EnsemblGenomes-Tr; ABSDF3524.
DR   EnsemblGenomes-Tr; ABSDF3525.
DR   EnsemblGenomes-Tr; ABSDF3532.
DR   EnsemblGenomes-Tr; ABSDF3534.
DR   EnsemblGenomes-Tr; ABSDF3588.
DR   EnsemblGenomes-Tr; ABSDF3590.
DR   EnsemblGenomes-Tr; ABSDF3600.
DR   EnsemblGenomes-Tr; ABSDF3601.
DR   EnsemblGenomes-Tr; ABSDF3611.
DR   EnsemblGenomes-Tr; ABSDF3612.
DR   EnsemblGenomes-Tr; ABSDF3655.
DR   EnsemblGenomes-Tr; ABSDF3661.
DR   EnsemblGenomes-Tr; ABSDF3662.
DR   EnsemblGenomes-Tr; ABSDF_16S_1-1.
DR   EnsemblGenomes-Tr; ABSDF_16S_2-1.
DR   EnsemblGenomes-Tr; ABSDF_16S_3-1.
DR   EnsemblGenomes-Tr; ABSDF_16S_4-1.
DR   EnsemblGenomes-Tr; ABSDF_16S_5-1.
DR   EnsemblGenomes-Tr; ABSDF_23S_1-1.
DR   EnsemblGenomes-Tr; ABSDF_23S_2-1.
DR   EnsemblGenomes-Tr; ABSDF_23S_3-1.
DR   EnsemblGenomes-Tr; ABSDF_23S_4-1.
DR   EnsemblGenomes-Tr; ABSDF_23S_5-1.
DR   EnsemblGenomes-Tr; ABSDF_5S_1-1.
DR   EnsemblGenomes-Tr; ABSDF_5S_2-1.
DR   EnsemblGenomes-Tr; ABSDF_5S_3-1.
DR   EnsemblGenomes-Tr; ABSDF_5S_4-1.
DR   EnsemblGenomes-Tr; ABSDF_5S_5-1.
DR   EnsemblGenomes-Tr; ABSDF_misc_RNA_7-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA1-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA10-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA11-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA12-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA13-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA14-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA15-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA16-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA17-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA18-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA19-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA2-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA20-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA21-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA22-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA23-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA24-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA25-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA26-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA27-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA28-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA29-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA3-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA30-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA31-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA32-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA33-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA34-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA35-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA36-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA37-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA38-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA39-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA4-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA40-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA41-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA42-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA43-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA44-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA45-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA46-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA47-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA48-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA49-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA5-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA50-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA51-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA52-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA53-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA54-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA55-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA56-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA57-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA58-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA59-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA6-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA60-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA61-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA62-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA63-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA64-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA7-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA8-1.
DR   EnsemblGenomes-Tr; ABSDF_tRNA9-1.
DR   EnsemblGenomes-Tr; EBT00001712173.
DR   EnsemblGenomes-Tr; EBT00001712174.
DR   EnsemblGenomes-Tr; EBT00001712175.
DR   EnsemblGenomes-Tr; EBT00001712176.
DR   EnsemblGenomes-Tr; EBT00001712177.
DR   EnsemblGenomes-Tr; EBT00001712178.
DR   EnsemblGenomes-Tr; EBT00001712179.
DR   EnsemblGenomes-Tr; EBT00001712180.
DR   EnsemblGenomes-Tr; EBT00001712181.
DR   EnsemblGenomes-Tr; EBT00001712182.
DR   EnsemblGenomes-Tr; EBT00001712183.
DR   EnsemblGenomes-Tr; EBT00001712184.
DR   EnsemblGenomes-Tr; EBT00001712185.
DR   EnsemblGenomes-Tr; EBT00001712186.
DR   EnsemblGenomes-Tr; EBT00001712187.
DR   EnsemblGenomes-Tr; EBT00001712188.
DR   EnsemblGenomes-Tr; EBT00001712189.
DR   EnsemblGenomes-Tr; EBT00001712190.
DR   EnsemblGenomes-Tr; EBT00001712191.
DR   EnsemblGenomes-Tr; EBT00001712192.
DR   EnsemblGenomes-Tr; EBT00001712193.
DR   EnsemblGenomes-Tr; EBT00001712194.
DR   EnsemblGenomes-Tr; EBT00001712195.
DR   EnsemblGenomes-Tr; EBT00001712196.
DR   EnsemblGenomes-Tr; EBT00001712197.
DR   EnsemblGenomes-Tr; EBT00001712198.
DR   EnsemblGenomes-Tr; EBT00001712199.
DR   EnsemblGenomes-Tr; EBT00001712200.
DR   EnsemblGenomes-Tr; EBT00001712201.
DR   EnsemblGenomes-Tr; EBT00001712202.
DR   EnsemblGenomes-Tr; EBT00001712203.
DR   EnsemblGenomes-Tr; EBT00001712204.
DR   EnsemblGenomes-Tr; EBT00001712205.
DR   EnsemblGenomes-Tr; EBT00001712206.
DR   EnsemblGenomes-Tr; EBT00001712207.
DR   EnsemblGenomes-Tr; EBT00001712208.
DR   EnsemblGenomes-Tr; EBT00001712209.
DR   EnsemblGenomes-Tr; EBT00001712210.
DR   EnsemblGenomes-Tr; EBT00001712211.
DR   EnsemblGenomes-Tr; EBT00001712212.
DR   EnsemblGenomes-Tr; EBT00001712213.
DR   EnsemblGenomes-Tr; EBT00001712214.
DR   EnsemblGenomes-Tr; EBT00001712215.
DR   EnsemblGenomes-Tr; EBT00001712216.
DR   EnsemblGenomes-Tr; EBT00001712217.
DR   EnsemblGenomes-Tr; EBT00001712218.
DR   EnsemblGenomes-Tr; EBT00001712219.
DR   EnsemblGenomes-Tr; EBT00001712220.
DR   EnsemblGenomes-Tr; EBT00001712221.
DR   EnsemblGenomes-Tr; EBT00001712222.
DR   EnsemblGenomes-Tr; EBT00001712223.
DR   EnsemblGenomes-Tr; EBT00001712224.
DR   EnsemblGenomes-Tr; EBT00001712225.
DR   EnsemblGenomes-Tr; EBT00001712226.
DR   EnsemblGenomes-Tr; EBT00001712227.
DR   EnsemblGenomes-Tr; EBT00001712228.
DR   EnsemblGenomes-Tr; EBT00001712229.
DR   EnsemblGenomes-Tr; EBT00001712230.
DR   EnsemblGenomes-Tr; EBT00001712231.
DR   EnsemblGenomes-Tr; EBT00001712232.
DR   EnsemblGenomes-Tr; EBT00001712233.
DR   EnsemblGenomes-Tr; EBT00001712234.
DR   EnsemblGenomes-Tr; EBT00001712235.
DR   EnsemblGenomes-Tr; EBT00001712236.
DR   EnsemblGenomes-Tr; EBT00001712237.
DR   EnsemblGenomes-Tr; EBT00001712238.
DR   EnsemblGenomes-Tr; EBT00001712239.
DR   EnsemblGenomes-Tr; EBT00001712240.
DR   EnsemblGenomes-Tr; EBT00001712241.
DR   EnsemblGenomes-Tr; EBT00001712242.
DR   EnsemblGenomes-Tr; EBT00001712243.
DR   EnsemblGenomes-Tr; EBT00001712244.
DR   EnsemblGenomes-Tr; EBT00001712245.
DR   EnsemblGenomes-Tr; EBT00001712246.
DR   EnsemblGenomes-Tr; EBT00001712247.
DR   EnsemblGenomes-Tr; EBT00001712248.
DR   EnsemblGenomes-Tr; EBT00001712249.
DR   EnsemblGenomes-Tr; EBT00001712250.
DR   EnsemblGenomes-Tr; EBT00001712251.
DR   EnsemblGenomes-Tr; EBT00001712252.
DR   EnsemblGenomes-Tr; EBT00001712253.
DR   EnsemblGenomes-Tr; EBT00001712254.
DR   EnsemblGenomes-Tr; EBT00001712255.
DR   EnsemblGenomes-Tr; EBT00001712256.
DR   EnsemblGenomes-Tr; EBT00001712257.
DR   EnsemblGenomes-Tr; EBT00001712258.
DR   EnsemblGenomes-Tr; EBT00001712259.
DR   EnsemblGenomes-Tr; EBT00001712260.
DR   EnsemblGenomes-Tr; EBT00001712261.
DR   EnsemblGenomes-Tr; EBT00001712262.
DR   EnsemblGenomes-Tr; EBT00001712263.
DR   EnsemblGenomes-Tr; EBT00001712264.
DR   EnsemblGenomes-Tr; EBT00001712265.
DR   EnsemblGenomes-Tr; EBT00001712266.
DR   EnsemblGenomes-Tr; EBT00001712267.
DR   EnsemblGenomes-Tr; EBT00001712268.
DR   EnsemblGenomes-Tr; EBT00001712269.
DR   EnsemblGenomes-Tr; EBT00001712270.
DR   EnsemblGenomes-Tr; EBT00001712271.
DR   EuropePMC; PMC2863528; 20194587.
DR   EuropePMC; PMC2976157; 20713680.
DR   EuropePMC; PMC3043498; 21147956.
DR   EuropePMC; PMC3187012; 21788470.
DR   EuropePMC; PMC3440325; 22984530.
DR   EuropePMC; PMC3526259; 22904089.
DR   EuropePMC; PMC3535948; 23070160.
DR   EuropePMC; PMC3691203; 23826102.
DR   EuropePMC; PMC3767088; 24159468.
DR   EuropePMC; PMC3910750; 24145532.
DR   EuropePMC; PMC4136133; 24899031.
DR   EuropePMC; PMC4136169; 24899022.
DR   EuropePMC; PMC4367897; 25534766.
DR   EuropePMC; PMC4378888; 25822626.
DR   EuropePMC; PMC5472653; 28670571.
DR   EuropePMC; PMC5711439; 28436748.
DR   EuropePMC; PMC6563999; 31194814.
DR   EuropePMC; PMC6586298; 31220143.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02276; Hammerhead_II.
DR   SILVA-LSU; CU468230.
DR   SILVA-SSU; CU468230.
XX
CC   Annotation data relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny results (Syntonizer software) are available in
CC   BaumannoScope database via the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage/baumannoscope.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3421954
FT                   /organism="Acinetobacter baumannii SDF"
FT                   /strain="SDF"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:509170"
FT   gene            367..1764
FT                   /gene="dnaA"
FT                   /locus_tag="ABSDF0001"
FT   CDS_pept        367..1764
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="ABSDF0001"
FT                   /product="DNA replication initiator protein,
FT                   transcriptional regulator of replication and housekeeping
FT                   genes"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.3.7 : nucleoproteins, basic proteins"
FT                   /function="3.1.2.5 : action unknown"
FT                   /function="3.3.2 : regulon"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99422"
FT                   /db_xref="GOA:B0VMK0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VMK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99422.1"
FT                   /translation="MLWTDCLTRLRQELSDNVFAMWIRPLVAEEVEGILRLYAPNPYWT
FT                   RYIQENHLELISILAEQLSEGRVRQVEILVDSRPGSILSSSEQPATTTAALQTAPIPQP
FT                   AKGKREPEPVANTAVSSKSSKKKLLNPQFTFSLFVEGRSNQMAAETCRKVLTQLGASQH
FT                   NPLFLYGPTGLGKTHLMQAVGNALLQAKPNARVMYMTSESFVQDFVSSLQKGKVEEFKK
FT                   NCRSLDLLLVDDIHLLAGKEASLVEFFYTFNALLDESKQIILTSDRYPKELTELDPRLV
FT                   SRFSWGLSVGVEPPDIETRIEILLKKAENSGVDLPRNCALFIAQQVVANVRELEGALNK
FT                   VVAISRFKGAPIDLDVVRESLKDVLAIRARTISVENIQRVVSEYFRIPLKELVGPKRTR
FT                   IYARPRQLAMGLARELTGDSFPEIGMAFGGRDHSTVMHACEKVVSLREEDPIFDEDYKN
FT                   LLRLLQS"
FT   gene            1862..3010
FT                   /gene="dnaN"
FT                   /locus_tag="ABSDF0002"
FT   CDS_pept        1862..3010
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="ABSDF0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /function="2.1.1 : DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99423"
FT                   /db_xref="GOA:B0VMK1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99423.1"
FT                   /translation="MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTIT
FT                   GSDLEVELVASTALSEGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQRCILKS
FT                   GNSRFVLGTLPAEDYPLLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTL
FT                   LEIDENQLRAVTTDGHRLALCEILASSTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLL
FT                   IGRELLNVTINTPSRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDVFKQ
FT                   SLQRVAILSNEKLRGVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQNAPLEMSFNAQYL
FT                   LDVLGVLDGDDVNMSMTEANQSVLVQDPAHPDQTYVVMPMRV"
FT   gene            3025..4107
FT                   /gene="recF"
FT                   /locus_tag="ABSDF0003"
FT   CDS_pept        3025..4107
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="ABSDF0003"
FT                   /product="DNA replication, recombinaison and repair
FT                   protein"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99424"
FT                   /db_xref="GOA:B0VMK2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VMK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99424.1"
FT                   /translation="MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIHL
FT                   LATGRSFRTHIPKNYIQYEADDAIVFAQSATEKIGMQKLASGEQLMKVNGDTVATQGQL
FT                   AKLLPLQHIDPQSTEIIDHGAKPRRQLLDWLMFHVEPEFYFAWQYYSRALKQRNTLLKT
FT                   RRNLSLADLEPWNKMLSNYGEILHSQRLSIVEQWNVYFQNDLSQLLPDLEIELEYSPGF
FT                   HTEQGLMQDLLNQHQKDIERRYTEYGPHRADLRLKTLFGHADDVLSRGQKKLLIIALKL
FT                   SQIAMLHASNKETVVLLDDLTAELDLTAQQRLIERLSQLGSQVFMTTLDRASVKKHLHD
FT                   LSISYQLFSVESGQVSLAAP"
FT   gene            4160..6628
FT                   /gene="gyrB"
FT                   /locus_tag="ABSDF0004"
FT   CDS_pept        4160..6628
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="ABSDF0004"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.2.2 : transcription related"
FT                   /function="3.1.1.1 : DNA bending, supercoiling, inversion"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99425"
FT                   /db_xref="GOA:B0VMK3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99425.1"
FT                   /translation="MSSESQSASQTEQTNEKAYDSSSIKVLRGLDAVRKRPGMYIGDTD
FT                   DGTGLHHMVFEVVDNAIDEALAGHCDEIIVTIHEEESVSVSDNGRGIPTDIHPEEGVSA
FT                   AEVILTILHAGGKFDDNSYKVSGGLHGVGVSVVNALSSKLHLTIYRAGQIHEQEYHHGD
FT                   PQYPLRVIGETDNTGTTVRFWPSAETFSQTIFNVEILARRLRELSFLNAGVRIVLRDER
FT                   INLEHVYDYEGGLSEFVKYINEGKNHLNEIFHFTADADNGITVEVALQWNDSYQENVRC
FT                   FTNNIPQKDGGTHLAGFRAALTRGLNQYLENENILKKEKVNVTGDDAREGLTAIISVKV
FT                   PDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGKIIDAARARDAAR
FT                   KAREMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILP
FT                   LKGKILNVERARFDKMISSQEVGTLITALGCGIGREEYNPDKLRYHKIIIMTDADVDGS
FT                   HIRTLLLTFFFRQMPELVERGHIYIAQPPLYKLKKGKQEQYIKDNDALETYLISNAIDE
FT                   LALHISADAPAITGEALAKVIQDYQVSQKSLQRLTLRYPASLLDALLEVDAFKADQNHD
FT                   QAYVQQWADQVREAVEKLQPSLRPEITLETFERENAQGEKSAHYWPRVTVYVHNLPHAY
FT                   LLDAGLLNSAEYARLLKNSKSWFKLIEDGAYLQKGDRRIQVANFHQVWQHILQDSRRGM
FT                   MIQRYKGLGEMNAEQLWETTMDPENRNMLQVTIDDAIEADRMFSCLMGDDVEPRRAFIE
FT                   ENALNADIDA"
FT   gene            6666..7058
FT                   /locus_tag="ABSDF0005"
FT   CDS_pept        6666..7058
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0005"
FT                   /product="putative of Cytochrome b(562) (CybC)"
FT                   /function="1.4.3 : Electron carrier"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99426"
FT                   /db_xref="GOA:B0VMK4"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99426.1"
FT                   /translation="MMSQKILASMLISCAALVSHSVFAADLEADMKTLAKSTKAFAEAK
FT                   DIDNAKQQLVIMRQAALSSKLSLPHKLEGLPPENVQVKEYQAGLDQLVAEIDRVTVFVD
FT                   KGQLDQAKTEAINLVNIRNENHKKFR"
FT   gene            complement(7144..7701)
FT                   /locus_tag="ABSDF0006"
FT   CDS_pept        complement(7144..7701)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0006"
FT                   /product="putative DedA family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99427"
FT                   /db_xref="GOA:B0VMK5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99427.1"
FT                   /translation="MNFIDFITNFEQFLPILIQEYGAWVYAILFLIIFSETAFVFMFFL
FT                   PGDSLLLTVGALCSVVELMHLGYMITLLTIAATLGYIVNYSIGHHFGNRIFEAKSRFIK
FT                   KEYLNKTNRYFLQHGGKTILLARFIPFARSFAPLAAGSSNMSYGKFLIYNVAGAILWIC
FT                   ILLTAGYLFGHALIQVTDFVEN"
FT   gene            complement(7952..9883)
FT                   /locus_tag="ABSDF0007"
FT   CDS_pept        complement(7952..9883)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0007"
FT                   /product="putative transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /function="4.3.A.1.a : ABC superfamily ATP binding
FT                   cytoplasmic component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99428"
FT                   /db_xref="GOA:B0VMK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99428.1"
FT                   /translation="MIQFDQVSLRRGGRVLFQKASMQLHPGWKIGLTGVNGAGKSTLFA
FT                   ALLGSLGADEGSLTRPSVWTVAHMAQEVKALDMPAIDFVLSGDEEYWDIQNKLAQPEQL
FT                   TDSDLAKLHGRFDEIHGYSAPSKAAQLMAGLGFLEHQLRLNVASFSGGWRMRLNLARTL
FT                   MSRSDLLLLDEPTNHLDLDAILWLEDWLKAYEGTLILISHDRDFLDAITDHILHIENQE
FT                   LTLYTGNYSTFETTRSERLAQQQQAFEKQQEARAHLQKFIDRFKAKATKARQAQSRIKQ
FT                   LERMQQLAPAHVDTPFTFSFREPTKMSSPLLTLENASIGYGDKKIAEKIKLQITPNSRI
FT                   GLLGMNGAGKSTLIKSLVGDLPLLAGERKASELLNIGYFAQHQMDALDGQASPMLQLAR
FT                   IADKQISEATLRSFLGSFGFSGERMDTPCESFSGGERARLALALIVWQRPNVLILDEPT
FT                   NHLDLDMRHALSMALQDFEGAVVLVSHERQLIASVCDELLLVHGGKCTEFEGDLQDYAK
FT                   WLREARQQQINAQTAVAQNNSSSAAPAPAKVDKEAQRKEAARRREQTRPIRKNIEKVES
FT                   QIEKLQPRLAEIEEALADTSLYEANRKDDLLKLMNEQTELKAKLEQYEEQLLELMMELE
FT                   EMEASFEN"
FT   gene            10140..11144
FT                   /locus_tag="ABSDF0008"
FT   CDS_pept        10140..11144
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0008"
FT                   /product="putative RND type efflux pump involved in
FT                   aminoglycoside resistance (AdeT)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99429"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99429.1"
FT                   /translation="MKKRLRIVSAVICCVMGTTHAGQNVCVFDLLGKSGESYKMMEEWA
FT                   LAAKSWQADITLIPFQDEALVDRRLREGKCDAAYMTSMRARNYNKFAGSIDAIGGVTSN
FT                   AIAQKAISYVLDQRNKNRMLTTQNGTNYEVVGIVQIGLAYLFVRDRNLNSIEKVRGTKF
FT                   AILQYDAAQKIMVESVGAQPIPSEITDFVKKFNSGQVEAIAAPAYTYKPLEIGKGIGTN
FT                   GAMFTFPVVNVTGDLIARSDKFPANFGMKSREWFIKQLPQNFAMVKRLETGIPPKIKLN
FT                   FSAEDKLKYQKILREGRLGLTKQGVYDATMMSVLKRARCTIERTNFECTLTGE"
FT   gene            11400..12407
FT                   /locus_tag="ABSDF0010"
FT   CDS_pept        11400..12407
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0010"
FT                   /product="putative RND type efflux pump involved in
FT                   aminoglycoside resistance (AdeT)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99430"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99430.1"
FT                   /translation="MKKIVLAMAAASVVGFSASAQAASTVCVFDLLGKAGDSYKMMEEW
FT                   ALAAKGWGTEINLVPRQDEAVADNDFKAGKCDAVAMTAMRARQYNKFAGSIDSLGGVPN
FT                   NQIAQRAITYVLDARNAAKMTTNLGGKKYEVAGISPLGSAFIFVRDKNINSVEKAAGKK
FT                   FAVLGYDDAQKIMVQRVGAQAVLSDISNFAAKFNNGQVDMVGAPAYAYKPLELNKGLGA
FT                   NGVMWNFPVLHVTADLVLRADKFPAGFGQKSRDWFVKQLPKSFAMINRLEAQIPGKYKM
FT                   NLSAEDKLKYQKMLRDGRMDLTKRGIYDAGMMSVLKKARCSVDKANFECSMPGE"
FT   gene            12751..13755
FT                   /gene="adeT"
FT                   /locus_tag="ABSDF0011"
FT   CDS_pept        12751..13755
FT                   /transl_table=11
FT                   /gene="adeT"
FT                   /locus_tag="ABSDF0011"
FT                   /product="RND type efflux pump involved in aminoglycoside
FT                   resistance"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99431"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99431.1"
FT                   /translation="MRFSKTLLLAMGLTTISFAAEAKQTICVFDFVGKNGDVYALMKDY
FT                   QLAAKNWGADIELKVNQNEAVIAEDFKAGKCDGISVSGMRGRQFNSFTGSLDAIGAIPD
FT                   LKLAVKVMQGLASQTFSKYMVNGRYEVVGVIPVGDAYLLVNDRSINTVAKAVGKKIAVL
FT                   DYDEAQKIMVQQVGAQAVSADVTNFGAKFNNHQVDIIGAPAAAFKPLELQKGLGTKGAI
FT                   VNYPILQVTGNIIIRPDKFPAGFGQKSREWVAGQLPRAFTILGKMKADIPQKYWMEVPA
FT                   ADKPGYQKLMRESRINLTQRGVYDKRMMKLLWQFRCKQDAKNFECGLQDENYK"
FT   gene            13880..14215
FT                   /locus_tag="ABSDF0012"
FT   CDS_pept        13880..14215
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0012"
FT                   /product="putative chaperone involved in Fe-S cluster
FT                   assembly and activation (HesB-like)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99432"
FT                   /db_xref="GOA:B0VML0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VML0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99432.1"
FT                   /translation="MNAQALVLTDNAANKVRQLRDSEGNDDLMLRVYVTGGGCSGFSYG
FT                   FNFAESINEDDAEFVNGDVKMLVDSLSYQYLVGSVVDYVEGLEGSRFIVQNPNATTTCG
FT                   CGSSFSI"
FT   gene            complement(14272..14511)
FT                   /pseudo
FT                   /locus_tag="ABSDF0013"
FT   CDS_pept        complement(14272..14511)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0013"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   3)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99433.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(14460..14783)
FT                   /pseudo
FT                   /locus_tag="ABSDF0014"
FT   CDS_pept        complement(14460..14783)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0014"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   2)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99434.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            14813..15625
FT                   /locus_tag="ABSDF0015"
FT   CDS_pept        14813..15625
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0015"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99435"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VML3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99435.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKRID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAI
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTDGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            complement(16018..16923)
FT                   /locus_tag="ABSDF0016"
FT   CDS_pept        complement(16018..16923)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0016"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99436"
FT                   /db_xref="GOA:B0VKE4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99436.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLKKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(16989..17171)
FT                   /pseudo
FT                   /locus_tag="ABSDF0017"
FT   CDS_pept        complement(16989..17171)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0017"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   1)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99437.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(17299..18426)
FT                   /gene="anmK"
FT                   /locus_tag="ABSDF0018"
FT   CDS_pept        complement(17299..18426)
FT                   /transl_table=11
FT                   /gene="anmK"
FT                   /locus_tag="ABSDF0018"
FT                   /product="Anhydro-N-acetylmuramic acid kinase (AnhMurNAc
FT                   kinase)"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /EC_number="2.7.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99438"
FT                   /db_xref="GOA:B0VML6"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B0VML6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99438.1"
FT                   /translation="MSAIYIGVMTGTSMDGVDIVAASFEPLQLHATLTVPFEPELRDEL
FT                   MALTLPDDNEIDRMGKADVALAKMIGHGINSLIEKHQLDRSQIKAIGSHGQTIRHRPEH
FT                   GFTLQIGDPNIITEITQIPVVSDFRRRDMAAGGQGAPLVPAFHQALFQHPSIHRVILNL
FT                   GGIANVSMLPANNPDGVFGFDTGPANILMDAWCHRHTGHPYDENGDWAAYGHPIRSLLD
FT                   RLYAHEYFSKEPPKSTGREDFNIDWLDDQLIDWRNDLTYDELEDTPENIQANLLKLTVR
FT                   AIQKAIYRSNMETGEVYVCGGGAYNSYLLEQLRWRLRKHNWSVQTTDVLGLSPTWVEAT
FT                   AFAWLAMRFVDGLSGNLPAVTGASDFRILGTITAV"
FT   gene            18506..19720
FT                   /gene="tyrS"
FT                   /locus_tag="ABSDF0019"
FT   CDS_pept        18506..19720
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="ABSDF0019"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99439"
FT                   /db_xref="GOA:B0VML7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="PDB:6BQY"
FT                   /db_xref="PDB:6BQZ"
FT                   /db_xref="UniProtKB/TrEMBL:B0VML7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99439.1"
FT                   /translation="MSNFLPAEEQLALIQRGTHEIISEEDLLKKLKENRPLKIKAGFDP
FT                   TAPDLHLGHTVLINKLKTFQDLGHEVTFLIGDYTAMIGDPTGKSATRPPLSREQVEANA
FT                   KTYQEQVFKILDPNKTKVRFNSEWFNQKSAADLIQLASQQTVSRMLERDDFTKRYNNHQ
FT                   PIAIHEFLYPLVQGYDSIALEADVELGGTDQTFNLLMGRTLQSRYGQESQVCITVPILE
FT                   GLDGVNKMSKSLGNYIGVFDAPGAMYQKVLSMPDSLIERYFDLLSFKSLDEIKALLDEI
FT                   AAGRNPQEVKRILALELVERFHDAEAAANAHKSAGNRITEGEVPADTPEVTISRGEFGG
FT                   EIFIATILRVAGLNPNAAAAKDAVARGAVKVDWNVVDASFSVKENGTFIIQSGKKAIAR
FT                   VTFTD"
FT   gene            complement(19830..20735)
FT                   /locus_tag="ABSDF0020"
FT   CDS_pept        complement(19830..20735)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0020"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99440"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99440.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            21569..23097
FT                   /locus_tag="ABSDF_16S_3"
FT   rRNA            21569..23097
FT                   /locus_tag="ABSDF_16S_3"
FT                   /product="ribosomal RNA 16S"
FT   gene            23158..23234
FT                   /locus_tag="ABSDF_tRNA1"
FT   tRNA            23158..23234
FT                   /locus_tag="ABSDF_tRNA1"
FT                   /product="tRNA-Ile"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            23290..23365
FT                   /locus_tag="ABSDF_tRNA2"
FT   tRNA            23290..23365
FT                   /locus_tag="ABSDF_tRNA2"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            23706..26607
FT                   /locus_tag="ABSDF_23S_3"
FT   rRNA            23706..26607
FT                   /locus_tag="ABSDF_23S_3"
FT                   /product="ribosomal RNA 23S"
FT   gene            26784..26898
FT                   /locus_tag="ABSDF_5S_3"
FT   rRNA            26784..26898
FT                   /locus_tag="ABSDF_5S_3"
FT                   /product="ribosomal RNA 5S"
FT   gene            complement(27228..27710)
FT                   /gene="fkpB"
FT                   /locus_tag="ABSDF0025"
FT   CDS_pept        complement(27228..27710)
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="ABSDF0025"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)"
FT                   /function="2.3.4 : chaperoning, folding"
FT                   /EC_number="5.2.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99441"
FT                   /db_xref="GOA:B0VML9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B0VML9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99441.1"
FT                   /translation="MTEIIQPNEEIRITDGSKVDLHFSVAIENGVEIDNTRSREEPVSL
FT                   TIGDGNLLPGFEKALLGLRAGDRRTVHLPPEDAFGPWNPENIQTFDTVKFEQRPIPGHM
FT                   IEFEDKAKATLFGVVKSVNDDITEIDFNHPLAGKNITFEVEIFKVTPAGQQGIKIM"
FT   gene            complement(27712..28242)
FT                   /gene="lspA"
FT                   /locus_tag="ABSDF0026"
FT   CDS_pept        complement(27712..28242)
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="ABSDF0026"
FT                   /product="prolipoprotein signal peptidase (Signal peptidase
FT                   II.)"
FT                   /function="2.3.5 : export, signal peptide cleavage"
FT                   /EC_number="3.4.23.36"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99442"
FT                   /db_xref="GOA:B0VMM0"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VMM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99442.1"
FT                   /translation="MPNSQAKKGLFQFYPHNLIWLGLSVLAIVLDQWTKWIASTHMNYA
FT                   DPVPVLPFLNWTLLHNYGAAFSFLSDAGGWQRYFFTSLAGLVSILFVFWLLRMPKKMVV
FT                   LPVAIALILGGALGNLIDRITLGYVVDFIHVYYQNHHFPAFNIADSAITLGTILLLIDT
FT                   FFLEKQRPKNSDA"
FT   gene            complement(28235..31072)
FT                   /gene="ileS"
FT                   /locus_tag="ABSDF0027"
FT   CDS_pept        complement(28235..31072)
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="ABSDF0027"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99443"
FT                   /db_xref="GOA:B0VMM1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99443.1"
FT                   /translation="MSDKQTTENAVDYKATLNLPDTQFAMKANLAVREVKWLEEWYTDN
FT                   IYQQIRASRIGKKKYILHDGPPYANGTIHLGHAVNKVLKDIIVKSRTLAGFDAPYVPGW
FT                   DCHGLPIELKVEEKVGKVGEKVDAATFRKHCREYALKQIDLQRTDFKRLGILGDWDNPY
FT                   LTMNYKQEADIVRALGLIQKNGHIQPGLKPVNWCMDCGSALAEAEVEYEDKKSDAIDVG
FT                   FGVVDLKDLSARVNVDVQDPTDIVIWTTTPWTLPANQAVALHAEIEYQLVQVTTERGKQ
FT                   NFILAKDLVASAIERYKLENPVVLADFTGSALENLTLQHPLLTDRQVPVILGEHVIATS
FT                   GTGAVHTAPGHGADDYKVGLQYNLKVENPVGGNGVYLPTAPIFAGEHIYKANPKIIEAL
FT                   GAVGRLWAHQTIKHSYPHCWRHKTPIIFRATPQWFISMDQKGLRDGALNAIENDIEFVP
FT                   NWGKNRIESMIEGRPDWCISRQRTWGVPIPFFVHKDTNELHPRTPELIEEVAKLIEKEG
FT                   IDAWFNRDAKDFIGEDAEQYNAVRDTLDVWFDSGTTHYAVLEQREELESPADLYLEGSD
FT                   QHRGWFQSSLLTSMAIHNRAPYKALLTHGFTVDENGRKLSKSLGNYIPLEEIIKQLGAD
FT                   GLRLYVASSDYRYEIAASKEIFSRVSDSYRRIRNTLRFLLANLNGLKPSTDALAVDDLI
FT                   ALDQYILQRANEVQQTIIAAYEEMNFHVVCSALTSFCINDLGGFYLDIIKDRQYTTKAD
FT                   SQARRSAQTALYHIVQAFVRWMSPILSFTAQEAWPLIPEQTDKYVFTAEWYDLPVSSKA
FT                   NLLSEADWQTLISVKSAVNKQIESARNAKLVGSNLSAKVELWANESLQTVLNQLADELR
FT                   FVLITSQVVVHPFAEQGEATEMEGLRVQVSAAEGEKCARCWHVLPDVNTHADHPGLCGR
FT                   CIVNVTGRGEVRKYA"
FT   gene            complement(31134..32135)
FT                   /gene="ribF"
FT                   /locus_tag="ABSDF0028"
FT   CDS_pept        complement(31134..32135)
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ABSDF0028"
FT                   /product="bifunctional protein [Includes: riboflavin kinase
FT                   (Flavokinase); FMN adenylyltransferase (FAD
FT                   pyrophosphorylase) (FAD synthetase)]"
FT                   /function="1.5.3.9 : riboflavin (Vitamin B2), FAD, FMN"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99444"
FT                   /db_xref="GOA:B0VMM2"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99444.1"
FT                   /translation="MKLLRLNALSPNFQLPQTAVTIGNFDGVHLGHQAMIAQLKKIAAA
FT                   QGLKTLVMIFEPQPLEFFKGYDAPPRINSLREKVEYLAELGVDYIAVAKFDQHFRSMSA
FT                   SEFADLLKDKLNAQALVLGDDFHFGKDRQGNSEFLKNYGFQVTNLHTIELEGERVSSTR
FT                   IRQVLQVGNLALAAKLLGRPYSITGRVQYGDQIGRTLDFPTINVRLNRHKPCLNGIYGV
FT                   EVICETTSLTQKVLQDNPEKPGIAGYHENSLYGAGHVGTRPAIQQEHPEWRLEVHFPDV
FT                   SANLYGLFMRVTFLHYLHGELNYPSLEALKAGIDNDVQQLRQYRNDTTQFPF"
FT   gene            32344..33477
FT                   /locus_tag="ABSDF0029"
FT   CDS_pept        32344..33477
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0029"
FT                   /product="putative malic acid transport protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99445"
FT                   /db_xref="GOA:B0VMM3"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99445.1"
FT                   /translation="MKRPFYQLNQSKDVIRHFTPNWFTATMGTGVVSMVLIQLPFAKSF
FT                   LFMLATLLWQFNIVLFSVFSVLYLLRWLLFPHEAKQIFNHPNMSLFLGAIPMGLATILN
FT                   GFLSFGIGLYGEVAVHIAQALWYIDVFLALAIAWIVPFCMFSRQNHQLHTMTAIWLLPV
FT                   VACEVAASSAGMLVAHLPADVHGFHLLLAGYVLWGISVLPAFAILTILMLRMALHQLPE
FT                   KEVAISSWLSLGPIGTGALGLLLLGEQAQRVFVNVGFPEFAYVFQALGVVGSLVLLGFG
FT                   LWWLGLAILTTLRHAKTGIPFNLGWWGLTFPFGVFILALFNLGHQIEVVFLQYVAVAFS
FT                   ILLLVMWSVVMKKTLAGAYSGKLFFSPCLVALQQRMQ"
FT   gene            33558..34124
FT                   /locus_tag="ABSDF0030"
FT   CDS_pept        33558..34124
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0030"
FT                   /product="putative
FT                   5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase"
FT                   /function="1.7.33 : Nucleotide and nucleoside conversions"
FT                   /EC_number="3.2.2.9"
FT                   /EC_number="3.2.2.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99446"
FT                   /db_xref="GOA:B0VMM4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99446.1"
FT                   /translation="MNTDTALIMALPNESKGLFEQAGIEVHYSGIGKINAAFKAFEVIQ
FT                   KTGCKTLINLGTAGSSSFNRHDLVEIKTFVQRDMDVSPLGFEVGVTPLDDHLAAEIHLQ
FT                   THFADLPKGICGTGDSFETGQPKVACDVVDMEGYALAKVCHKLGVRLISVKYITDGADD
FT                   TAHLDWEENLLLGAQKLLALYQNHF"
FT   gene            complement(34159..34770)
FT                   /locus_tag="ABSDF0031"
FT   CDS_pept        complement(34159..34770)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0031"
FT                   /product="putative transcriptional repressor (TetR/AcrR
FT                   family)"
FT                   /function="2.2.2 : transcription related"
FT                   /function="3.1.2.3 : repressor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99447"
FT                   /db_xref="GOA:B0VMM5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99447.1"
FT                   /translation="MEQKKSTQKRNQLLAAALDVFSLYGFSGASLDEIAQLADMHKSNI
FT                   FYYYENKESLYVEVLTTVLQKWLAPLQTLEAELEPAEALSHYLIQKIELSRSQPKASRL
FT                   FALEIIQGAPHILPILKGPLKKLFKRKAKVIQTWQEQGKISPDIDPELLILNIWGLTQN
FT                   YADFATQMEMVTGKTLRNRSMFQRSIEHTVHMMLYGVLPR"
FT   gene            complement(35040..35840)
FT                   /gene="ssuB"
FT                   /locus_tag="ABSDF0033"
FT   CDS_pept        complement(35040..35840)
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="ABSDF0033"
FT                   /product="alkanesulfonate transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /function="1.8.2 : sulfur metabolism"
FT                   /function="4.3.A.1.a : ABC superfamily ATP binding
FT                   cytoplasmic component"
FT                   /function="4.S.6 : alkanesulphonate"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99448"
FT                   /db_xref="GOA:B0VMM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99448.1"
FT                   /translation="MTNLNLNINQNDVELIPENHPESQEPVVGAEILIEQLYKFYGEVK
FT                   VLEDLNLHIQPGEFLAIVGRSGCGKSTLLRLIAQLEKASFGEIKFKSARHLREGITNDD
FT                   IRVMFQDPRLLPWRNILQNVQLGLPKSQHALAEELLEKVGLKEKAGQWPSQLSGGQRQR
FT                   TALARALSHTPRILLLDEPLGALDALTRLEMQSLIERLWKEQGFTAILVTHDVSEAVQL
FT                   ADRIILLDKGQIAQSFQVNLPRPRKKSITFAQLEQQVLDAVLAT"
FT   gene            complement(35887..36651)
FT                   /gene="ssuC"
FT                   /locus_tag="ABSDF0034"
FT   CDS_pept        complement(35887..36651)
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="ABSDF0034"
FT                   /product="alkanesulfonate transport protein (ABC
FT                   superfamily, membrane)"
FT                   /function="1.8.2 : sulfur metabolism"
FT                   /function="4.3.A.1.m : ABC superfamily, membrane component"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99449"
FT                   /db_xref="GOA:B0VMM7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99449.1"
FT                   /translation="MSKDINIVSRGTKQIGQRLLPWIFPIVLLVVWQIASSSGLLENRI
FT                   LPAPTAVVSAFWHLLISGELWQHVKVSAGRALLGLFIGGGLGLLLGLLNGSSRFASTLL
FT                   DTTLQMIRNIPALALIPLVILWFGIDETAKLFLVAVGVFFPIDINTYHGIRSVDPQLIE
FT                   MGKSYGLSRWQLYKEIILPGAMPSILVGLRFALGLVWVLLIVAETISAQAGIGYMTMNA
FT                   REFLQTDVVLVGILLYALLGKLADVLAQLLER"
FT   gene            complement(36648..37823)
FT                   /gene="ssuD"
FT                   /locus_tag="ABSDF0035"
FT   CDS_pept        complement(36648..37823)
FT                   /transl_table=11
FT                   /gene="ssuD"
FT                   /locus_tag="ABSDF0035"
FT                   /product="FMNH(2)-dependent alkanesulfonate monooxygenase"
FT                   /function="1.5.3.9 : riboflavin (Vitamin B2), FAD, FMN"
FT                   /function="1.8.2 : sulfur metabolism"
FT                   /EC_number="1.14.14.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99450"
FT                   /db_xref="GOA:B0VMM8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019911"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99450.1"
FT                   /translation="MKIFWFIPTHGDSRYLGTSKGARQVDHAYMKQIAVAVDNLGYEGV
FT                   LIPTGRSCEDPWITAASLIDATQHLKFLVALRPGVTTPALAARMAATFDRLSNGRVLLN
FT                   LVTGGDEAELRGDGLYEDHSTRYQTANEYVKIWREILTRSHTGEAFTFHGERLQVDDAK
FT                   LLYPPVQKPYPPLWFGGSSDVAVELAAEQVDTYLTWGEPPAAVKEKIEHVRAKAEAKGR
FT                   KLTYGIRLHVIVRETNEQAWAAANELIQYLDDATIAAAQKKFAQMDSVGQQRMAALHGG
FT                   NRDKLEVSPNLWAGIGLVRGGAGTALVGDPETVAARIQEYADLGIDTFIFSSYPHLEES
FT                   IRFAELVFPLLPIETRAKLAQPNLTGPFGEIIANNYVPDGKKQNSSVKEPA"
FT   gene            complement(37853..38758)
FT                   /locus_tag="ABSDF0036"
FT   CDS_pept        complement(37853..38758)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0036"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99451"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99451.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(38857..39840)
FT                   /gene="ssuA"
FT                   /locus_tag="ABSDF0037"
FT   CDS_pept        complement(38857..39840)
FT                   /transl_table=11
FT                   /gene="ssuA"
FT                   /locus_tag="ABSDF0037"
FT                   /product="alkanesulfonate transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /function="1.8.2 : sulfur metabolism"
FT                   /function="4.3.A.1.p : ABC superfamily, periplasmic binding
FT                   component"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99452"
FT                   /db_xref="GOA:B0VMN0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99452.1"
FT                   /translation="MQHQSLFNKSQWTQLVKHFSAVAVLGLTIAAPAWAIDPTAKELRI
FT                   GFQKSSINFAIAKQQKLFEQEFPNAKITWNEFPAGPQILEALAVGSLDVGVTGDTPPVY
FT                   AQAAGKPLYYIAYEAAKPLASAILVPKNSQLKQLKDIKGKRIALQKGSSSHYLLVQAVR
FT                   KAGLKWSDITPIWLTPADARAAFQKGAVDAWAIWDPYYASAQLEDQARVLVSGKGLSPN
FT                   YTFYLAAPNFVKQYPKAVPGLIKQINQADKWVQSYQVETASAIGQSTGLKPATSDLFIK
FT                   RRPRPSSAAPLNSKVIAEQQQIADIFTQQGIIPKPISIKQAVWGAK"
FT   gene            complement(39912..40880)
FT                   /gene="ssuA"
FT                   /locus_tag="ABSDF0038"
FT   CDS_pept        complement(39912..40880)
FT                   /transl_table=11
FT                   /gene="ssuA"
FT                   /locus_tag="ABSDF0038"
FT                   /product="alkanesulfonate transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /function="1.8.2 : sulfur metabolism"
FT                   /function="4.3.A.1.p : ABC superfamily, periplasmic binding
FT                   component"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99453"
FT                   /db_xref="GOA:B0VMN1"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99453.1"
FT                   /translation="MALFNSTSWAKYSVIAASLAGVMMLGGCAKKEEHTTTTLNIGYQK
FT                   YGILPILKARGDLEKALKDQGVQVKWVEFPAGPQLLEGLNVGSVSLGEAGEAPPIFAQA
FT                   ANPNLVYVANQPAAPKAEALLVQKDSPIQSIKDLKGKRVALNKGSNVHYLLLKVLEANH
FT                   LSLSDIQPVYLPPSDARAAFEKEAVDAWVIWDPFFAAAEHQIQARVLATGENLVSNHQF
FT                   YLADRKFAENNPKVLNTVVQTLNQTTQWVSTHQDEAAKLLEKPTALEFDVLKTSISRMG
FT                   FGVQPISDKVAQEQQYVADAFYAQKLIPNKLTIQEAILKLK"
FT   gene            complement(41215..42570)
FT                   /gene="argA"
FT                   /locus_tag="ABSDF0039"
FT   CDS_pept        complement(41215..42570)
FT                   /transl_table=11
FT                   /gene="argA"
FT                   /locus_tag="ABSDF0039"
FT                   /product="N-alpha-acetylglutamate synthase (amino-acid
FT                   acetyltransferase)"
FT                   /function="1.5.1.3 : arginine"
FT                   /EC_number="2.3.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99454"
FT                   /db_xref="GOA:B0VMN2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99454.1"
FT                   /translation="MPTKSLEKSHNNTQHYVHWFRHSAPYINAHRDKTFVLMFGGEAVR
FT                   DPNFEHIIHDIALLHSLGIRLILVHGARPQINHNLKEKGIETPFYDNCRITTRESLSCV
FT                   MSAVGSIQLEIEALLSMGLANSPMYGARIDVVSGNFVTAKPYGIREGMDFQLTGEVRSI
FT                   DTDAIERHLDNNNIVLLGPTGYSTTGEVFNLRAEEVATKTATYLKADKLIFLGEQQGLP
FT                   NEDGQLLRELSPHQLDYYIQQYQTTHPTLTLHLQEAKKASLSGVHRVHLISYSYDGALI
FT                   EELFTRDGVGTMITDAHYEEVRMAHIQDVGGLMNLLRPLEEEGILVYRSRERLEQEINQ
FT                   FAVIERDGMILACAALYPIPTEFNETRSAEIACVAVHPSYRKSNRGSQILQFLEEKAKQ
FT                   QGIRQLFVLTTRTAHWFLEHGFHQVSVDDLPNARQALYNYQRNSLVFKKLLP"
FT   gene            42814..43719
FT                   /locus_tag="ABSDF0040"
FT   CDS_pept        42814..43719
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0040"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99455"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99455.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(43705..44019)
FT                   /locus_tag="ABSDF0041"
FT   CDS_pept        complement(43705..44019)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0041"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99456"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99456.1"
FT                   /translation="MKKITTAIVLSMSGLIATTAMAAPHDHYHHQGYETKTVKVIHKDD
FT                   HANIWRAGQVVPHQYQHPRYVIDYRSHQKLTKPGRYQKWYKVNGNYVLVNEREFGLSRI
FT                   "
FT   gene            complement(44243..44731)
FT                   /locus_tag="ABSDF0042"
FT   CDS_pept        complement(44243..44731)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0042"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99457"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99457.1"
FT                   /translation="MIFTVSLHFARTVFNMRDIRCKRGCIMKKLFTILALCITVLTTSM
FT                   ASFADPPFDRGHGPKGPKGGPRGEWNDRGHKFDRDDNGDRVRDERRMREERGFERLKQH
FT                   RWQPGYVMPQHYRGNGYKVDYKDNNLPKPDRNQQWYKINNDYILVDTDSNSIVSICGF"
FT   gene            complement(44871..45617)
FT                   /locus_tag="ABSDF0043"
FT   CDS_pept        complement(44871..45617)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0043"
FT                   /product="putative oxoacyl-(acyl carrier protein)
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99458"
FT                   /db_xref="GOA:B0VMN6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99458.1"
FT                   /translation="MKYSEYQPRPDLLKDRIILITGAGDGIGRAAALSYALHGATVVLH
FT                   GRTLNKLEVIYDEIEGLGAPQPAILPLQLSSASDRDYDFLVSTLEKQFGRLDGILHNAG
FT                   ILGERVELAHYPAEVWDDVMAVNLRAPFALTQALLPLLQKSENASVVFTSSGVGREARA
FT                   LWGAYSVSKVAIEAVSKIFAAEHTYPNIRFNCINPGATRTAMRAKAYPEEDPKTLPTPE
FT                   SIMPAYLYLMGEDSLTLNGQSIDAQD"
FT   gene            complement(45683..46381)
FT                   /locus_tag="ABSDF0044"
FT   CDS_pept        complement(45683..46381)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0044"
FT                   /product="putative phosphoglycolate phosphatase 2 (PGP 2)"
FT                   /EC_number="3.1.3.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99459"
FT                   /db_xref="GOA:B0VMN7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99459.1"
FT                   /translation="MKAVLFDLDGTLIDTAADFIRIIQQMCRDARRPVVEADLIRTQVS
FT                   EGARAMVKLVYPELDVTNPIFLAHRQNFLDLYGNNIVVDTDLFEGMYPLLEELEAQQIP
FT                   WGIVTNKPRGLSESLLEKLNLTERCAVLVCPEDVSKTKPDPEPMYLAAKQLNIPANEII
FT                   YVGDHPRDIDAGRNADMYTILAAYGYLPIEHRDDLNAWQADSIVNTVTELHELLRQKLP
FT                   ALQENQRMIS"
FT   gene            complement(46381..47094)
FT                   /gene="ubiG"
FT                   /locus_tag="ABSDF0045"
FT   CDS_pept        complement(46381..47094)
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="ABSDF0045"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase and
FT                   2-octaprenyl-6-hydroxy phenol methylase"
FT                   /function="1.3.6 : aerobic respiration"
FT                   /function="1.5.3.11 : menaquinone, ubiquinone"
FT                   /EC_number="2.1.1.64"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99460"
FT                   /db_xref="GOA:B0VMN8"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VMN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99460.1"
FT                   /translation="MSQLNVDLQEIAKFEALAAKWWDQHSEFRPLHQINPLRLNWIDER
FT                   AGGLAGKKVLDVGCGGGILAESMARRGADVLGIDMGEAPLAVGRLHAQQENVQNIEYRQ
FT                   IPVEELAQEQAGQYDVVTCMEMMEHVPDPASIVKACQTLVKPGGHVFFSTINRNPKSYL
FT                   FAIIGAEYVLRMLPKGTHDYHKFIRPSEMAHDIRNAGLTLKEMTGLHYNPITKRYWLAP
FT                   NVDVNYMVHTIKTGV"
FT   gene            47273..47890
FT                   /gene="dsbA"
FT                   /locus_tag="ABSDF0046"
FT   CDS_pept        47273..47890
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="ABSDF0046"
FT                   /product="thiol:disulfide interchange protein, periplasmic,
FT                   alkali-inducible"
FT                   /function="2.3.4 : chaperoning, folding"
FT                   /function="5.5 : adaptation to stress"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99461"
FT                   /db_xref="GOA:B0VMN9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99461.1"
FT                   /translation="MKKLVLGGLSAAIMAVSGSVMAADFVAGKDYTVIANPGKVEVPGK
FT                   IEVREFFWYGCLHCFKLEPHMQTWLKQIPSDVRFVRTPAAMNKVWEQGARTYYTSEALG
FT                   VRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNSTYNSFAVTAKVAESNKL
FT                   AQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKAK"
FT   gene            complement(47969..48628)
FT                   /locus_tag="ABSDF0047"
FT   CDS_pept        complement(47969..48628)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0047"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99462"
FT                   /db_xref="GOA:B0VMP0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99462.1"
FT                   /translation="MGIPMNLDRHTQFLMRKEKILSVAEKLLQENNQEITLDELVAELD
FT                   IAKGTLFKHFRSKNELLLELIIQNEKQILEISQKYNTDFKEYAPRYMLHHLLTPGKTIL
FT                   LHQLEENLTMTESKLKHLFEELYEVRQQRILAIKDITESYLKSLNYDMSIRDYLSYIWS
FT                   LTYGASLLLNSTYYQRSIGSRQRLINLYINQALSLPTQTTNFDALNFQIEDENSQN"
FT   gene            complement(48754..49392)
FT                   /locus_tag="ABSDF0048"
FT   CDS_pept        complement(48754..49392)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99463"
FT                   /db_xref="GOA:B0VMP1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99463.1"
FT                   /translation="MSIRDERKQQSRQALLDAALHLSTSGRSFSSISLREVAREVGLVP
FT                   TAFYRHFQDMDELGKELVDQVALHLKSVLHQLGQSYLQHKSAKTQTSIELFVQAVNHSP
FT                   KQWQFMIAERWGGSETVRTAIAREIEFLIEDLTTDLTKLENFKHIQNPQDLNVLSTILT
FT                   NMSFTWAMTWLNLAKQYQGEQLKQQQTAFIENASTQVRLLFRGIANWER"
FT   gene            49566..50591
FT                   /locus_tag="ABSDF0049"
FT   CDS_pept        49566..50591
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0049"
FT                   /product="putative oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99464"
FT                   /db_xref="GOA:B0VMP2"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99464.1"
FT                   /translation="MNATLNYQPHWVREDFVDFVLQKINATWAWKRVLAEVTAVQSLHT
FT                   DMVLIKLKPNRNFNFDQVRAGESILLTLLIDGVYQQRSYSIIEVTTQGEIALGIKVQGL
FT                   VSRAAQLLHVGECVEISQPQGDFTLHQGQQPAILIASGSGVTAIYSLLQQALKQQLEQI
FT                   HVIYFNRAEIFHAELKALAEQYPQLQYHFFNTTEQKQHLTESLLQKLVPDFEQTATYVC
FT                   GHHGMMQQANEIYTQKGAQSQLHQEYFQPLQVTGTHAAQPVIFRRAQQEFLAETNLLGS
FT                   AEQAGLRPQHGCRMGVCNKCSCTKVSGVTQNLLTGEIEDQPNRPIKLCVSQALSPVTID
FT                   L"
FT   gene            50616..51764
FT                   /locus_tag="ABSDF0050"
FT   CDS_pept        50616..51764
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99465"
FT                   /db_xref="GOA:B0VMP3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99465.1"
FT                   /translation="MNMALKVSIASKSAHLTPEQIEEFGRRVEQIRQDVMQSLGEQDAK
FT                   YIYKVRNFVRYTEIASRGMLMFGGWIPPVWLLGTGLLGISKIVENMELGHNVMHGQFDW
FT                   LNEPSLNGNTYDWDTIASGDDWRETHNYVHHTYTNIVGKDHDIGYGILRVSDQQKWEPR
FT                   HLFNIPLALQLMFFFEWYVGVQNLHLEDALVYKTKSWKQVWEDAAKVRKKATRQVLKDY
FT                   VFFPVISGPMFLPVFAGNVVANIIRNLWSSAVIFNGHFTEDAETFEPDNTDTETKAEWY
FT                   LRQIRGSSNFSGTEWLHFMSGNLSHQIEHHLFPDMPANRYKEVAPKIKALCAEYGINYN
FT                   EANFMRQFWSVWVRLAKCSLPNHTTAKVMQTLEKLKAKFKFA"
FT   gene            51923..52639
FT                   /gene="rph"
FT                   /locus_tag="ABSDF0051"
FT   CDS_pept        51923..52639
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="ABSDF0051"
FT                   /product="ribonuclease PH (RNase PH), tRNA
FT                   nucleotidyltransferase"
FT                   /function="1.2.1 : RNA"
FT                   /function="2.2.4 : RNA degradation"
FT                   /EC_number="2.7.7.56"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99466"
FT                   /db_xref="GOA:B0VMP4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VMP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99466.1"
FT                   /translation="MRIDQRALDQLREVKITRNYTRYAEGSVLVEFGHTKVLCTASIDN
FT                   SVPRFLKGQGQGWVTAEYGMLPRSTHSRCDREAARGKQTGRTQEIQRLIGRSLRAMVDL
FT                   KKLGENTITIDCDVIQADGGTRTASITGAAVALVDAMNVLLAQKKIKQDPLKGLVAAIS
FT                   VGMYQDEVLLDLCYEEDSNCQTDLNVVMTQAGEFIEIQGTAEDKPFTRAQSNAMLEMAE
FT                   KGIAELIKKQQEALGW"
FT   gene            52929..55097
FT                   /gene="plc"
FT                   /locus_tag="ABSDF0054"
FT   CDS_pept        52929..55097
FT                   /transl_table=11
FT                   /gene="plc"
FT                   /locus_tag="ABSDF0054"
FT                   /product="phospholipase C precursor (PLC-N)
FT                   (Phosphatidylcholine cholinephosphohydrolase)
FT                   (Phosphatidylcholine-hydrolyzing phospholipase C) (PC-PLC)"
FT                   /function="1 : Metabolism"
FT                   /EC_number="3.1.4.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2120196; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99467"
FT                   /db_xref="GOA:B0VMP5"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99467.1"
FT                   /translation="MNRREFLLNSTKTMFGTAALASFPLSIQKALAIDAKVESGTIQDV
FT                   KHIVILTQENRSFDNYFGTLKGVRGFGDRFTIPMTEGRKVWEQYDANKKKVLPYHLDSR
FT                   LGNAQRVSGTPHSWSDGQAAWDNGRMSDWVAYKKPQSMGYYKKQEVEYQFALANAFTIC
FT                   DAYHCAMHAGTNPNRKFIWTGTNGPTGAGVASVVNEFDGIGPSTEGYEWTTYPERLQQA
FT                   GVTWKVYQNMPDNFTDNPLAGFKQYRRANEQSGQPVSNDTLTCPAYDEKIDATQPLYKG
FT                   IANTMPDGGFLGTFKADIAQGKLPQVSWLVAPAAYSEHPGPSSPVQGAWYIQEVLNALT
FT                   ENPQVWSQTVLLVNFDENDGFFDHVPSPSAPSKDINGVVYGKTTLTDQQVSYEYFNHPA
FT                   VATSKSQPKPDGRVYGPGVRVPMYVISPWSRGGWVNSQVFDHTSILQFLEKRFGVQEPN
FT                   ISPYRRAVCGDLTTAFNFKTPNLLPVAELDGKKTKAEADAIRVAQALLPQVPVPSQQQF
FT                   PQQEMGIRPSRALPYILHTSAKVDVTQKTVKLMFSNTGKQAAVFHVYNRLDLTAIPRRY
FT                   MVEAGKQLDDVWNTLNGQYDLWVLGPNGFHHAFKGNLSQANQTQALPEIRVCVEECDAN
FT                   LYLKVRHDGNKSVKLNVKANAYLPNKTWMIETNSSEKELVWDMSEFGGWYDFTVTLADD
FT                   ATFSRRFAGRIETQEDSISDPYMGYLES"
FT   gene            55501..55668
FT                   /pseudo
FT                   /locus_tag="ABSDF0055"
FT   CDS_pept        55501..55668
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0055"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99468.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(55665..56510)
FT                   /gene="nadC"
FT                   /locus_tag="ABSDF0056"
FT   CDS_pept        complement(55665..56510)
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="ABSDF0056"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (quinolinate phosphoribosyltransferase)"
FT                   /function="1.5.3.7 : nicotinamide adenine dinucleotide"
FT                   /EC_number="2.4.2.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99469"
FT                   /db_xref="GOA:B0VMP7"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99469.1"
FT                   /translation="MSIPQSLLEQSIQINIQQALQEDIGDGDITAMLTPEDEQATATII
FT                   SREDMVLAGQPWVNALISAYDNTVQVTWLKQEGDRVAANEAFLKLAGSARSLLTVERPA
FT                   LNFIQTLSAVATKTAEYVQHLEGLNTKLLDTRKTLPGLRIAQKYAVTVGGGQNHRLGLF
FT                   DAFLIKENHIMAAGGIAQAIAKAHQIAPGKPVEVEVETWDELNQALEAGADIVMLDNFS
FT                   QQQMIDAVKHVAGRCKLEASGNITIENLREVATTGVDYISMGVLTKDVKAVDLSMRFNA
FT                   "
FT   gene            56682..57251
FT                   /gene="ampD"
FT                   /locus_tag="ABSDF0057"
FT   CDS_pept        56682..57251
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="ABSDF0057"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase
FT                   (Regulates ampC)"
FT                   /function="1.7.34 : Peptidoglycan (murein) turnover,
FT                   recycling"
FT                   /function="3.1.4 : Regulation level unknown"
FT                   /function="6.2 : Peptidoglycan (murein)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99470"
FT                   /db_xref="GOA:B0VMP8"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99470.1"
FT                   /translation="MKQITPYEVIDGQLKGARQVPSPNFNQRPAGTEIQMIVVHNISLP
FT                   PSQFGGGYIEQFFQNKLDWSVHPYFQTIEGMQVSTHLLILRTGEVLQFVNFNDRAWHAG
FT                   RSSYLAKIECNDYSIGIELEGSDDLPFEDLQYEVLTDVVTAIRQAYPEIKNHIAGHSDI
FT                   APGRKTDPGPYFKWQHFRQLLAQKKT"
FT   gene            57350..58162
FT                   /locus_tag="ABSDF0058"
FT   CDS_pept        57350..58162
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0058"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99471"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99471.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKRID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            58381..59922
FT                   /locus_tag="ABSDF0059"
FT   CDS_pept        58381..59922
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0059"
FT                   /product="putative virulence factor MviN family
FT                   (multidrug/oligosaccharidyl-lipid/polysaccharide exporter
FT                   superfamily)"
FT                   /function="5.10 : defense/survivial"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99472"
FT                   /db_xref="GOA:B0VMQ0"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99472.1"
FT                   /translation="MALWRSTFIVSAMTMLSRVLGLVRDVVLLNVFGAGKDFDTFVVAF
FT                   RIPNFFRRLFAEGAFSQAFIPVLTEYKTGRAHAEVQILISRVFGCLLTVMTLLTFVAMV
FT                   LAPAIIYMYAPGFHNDPEKFDLAVSMFRLTIPYLMFMSLTAFASSILNSYGSFASPAFS
FT                   PVLLNVAMIAGAWWLTPYMAEPIKALGWSVVAAGILQLAIQIPELWRKNLLIPPKVDFK
FT                   HEGVERILKLMLPALFGVSVTQINLLLNTIWASFMQDGSVSWLYSAERMTELPLGLIGV
FT                   AIGTVILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTPIIQALFQRG
FT                   EFDLRDTQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMSVAANAILNV
FT                   VFIGFFKLINWHAEHMALALASSGSALVNAGLLYFYLHKRNIFRFGAHWKKLALQYGLA
FT                   NLAMIAALWFGLNWYNGELSQWIRVAEVVGLCVIGVIAYLIGLLLTGFRPRDLKH"
FT   gene            60009..60914
FT                   /locus_tag="ABSDF0060"
FT   CDS_pept        60009..60914
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0060"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99473"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99473.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(60976..61683)
FT                   /gene="fklB"
FT                   /locus_tag="ABSDF0061"
FT   CDS_pept        complement(60976..61683)
FT                   /transl_table=11
FT                   /gene="fklB"
FT                   /locus_tag="ABSDF0061"
FT                   /product="FKBP-type 22KD peptidyl-prolyl cis-trans
FT                   isomerase (rotamase)"
FT                   /function="2.3.4 : chaperoning, folding"
FT                   /EC_number="5.2.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99474"
FT                   /db_xref="GOA:B0VMQ2"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR008104"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99474.1"
FT                   /translation="MENDMKKISLVIAASTMSLSVFAAAPITNKSPAKDQFSYSYGYLM
FT                   GRNNTDALTDLNLDIFYQGLQEGAQNKTARLTDEEMAKAINDYKKTLEAKQLVEFQKQG
FT                   QQNAQAGAAFLAENTKKSGVITTKSGLQYQVLKEGTGKTPKATSRVKVNYEGRLLDGTV
FT                   FDSSIARNHPVDFQLNQVIAGWTKGLQTMKEGGKTRFFIPAKLAYGEVGAGDSIGPNST
FT                   LIFDIELLQVLPK"
FT   gene            complement(61721..62443)
FT                   /gene="fkpA"
FT                   /locus_tag="ABSDF0062"
FT   CDS_pept        complement(61721..62443)
FT                   /transl_table=11
FT                   /gene="fkpA"
FT                   /locus_tag="ABSDF0062"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)"
FT                   /function="2.3.4 : chaperoning, folding"
FT                   /EC_number="5.2.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99475"
FT                   /db_xref="GOA:B0VMQ3"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99475.1"
FT                   /translation="MSKALPIAVAVVLGGAALVPVYYATQHPTTEVGHKADKNASPIQK
FT                   ISYVLGYEVAQQTPPELDTKAFVQGIHDVRNKQPSAYTQEDLKAAVAAYEKELQQKMQH
FT                   QDKPEQAGTATDSADAQFLAENKTKAGVKTTASGLQYIITKEGTGKQPTAQSIVKVHYE
FT                   GRLINGQVFDSSYKRGQPVEFPLNQVIPGWTEGLQLMKEGGKATFFIPSNLAYGPQELP
FT                   GIPANSTLIFDVELISVK"
FT   gene            complement(62635..64821)
FT                   /gene="ptk"
FT                   /locus_tag="ABSDF0063"
FT   CDS_pept        complement(62635..64821)
FT                   /transl_table=11
FT                   /gene="ptk"
FT                   /locus_tag="ABSDF0063"
FT                   /product="tyrosine-protein kinase, autophosphorylates"
FT                   /function="2.3.3 : posttranslational modification"
FT                   /function="4.8.A.3 : MPA1 Family auxillary transport
FT                   protein"
FT                   /function="1.2.4 : polysaccharides"
FT                   /EC_number="2.7.10.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99476"
FT                   /db_xref="GOA:B0VMQ4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99476.1"
FT                   /translation="MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRV
FT                   TPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKSPAQAEIEILKSRLVLGSVIKDLHL
FT                   NIQVSSTENTLTHRLLSDTDYKTEYTTKSVIFKDGLKSFDIRQFEIPTYYLDKNLLLDF
FT                   DKQSLRLTNPDTEEVILTVPLNQVNQVTGPHGVWKVAIFTKDQFDATYNIKSLSLPIAV
FT                   NAISANYAVAERGKLTGVLGLSYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLK
FT                   FLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYLTQSITLETKKAELEQKQAE
FT                   MAAKYTAKHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTA
FT                   LLNSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLLVLILSVFVGGFLGALIALLRN
FT                   MLRTGIKDSGQIENELDLPVYATVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESL
FT                   RSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQGDKRVLLIDADMRRGY
FT                   MHKYFDVDVKPGLSELLSGQADLQKVLHKTQVTNLDVITRGKSPTNPSEILSSNQFKEL
FT                   LEQLQSQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAG
FT                   VKVNGFILNDIQRASAGYGYGYNYAYAYKAQKED"
FT   gene            complement(64841..65269)
FT                   /gene="ptp"
FT                   /locus_tag="ABSDF0064"
FT   CDS_pept        complement(64841..65269)
FT                   /transl_table=11
FT                   /gene="ptp"
FT                   /locus_tag="ABSDF0064"
FT                   /product="low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /function="1.2.4 : polysaccharides"
FT                   /EC_number="3.1.3.48"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99477"
FT                   /db_xref="GOA:B0VMQ5"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99477.1"
FT                   /translation="MQIKNILVVCIGNICRSPMAEYFLKQQYPQLNIESAGISGLIGHQ
FT                   ADEKARLCMERLGIDMQPHIAKKLNAELIKKADLILVMSTNQQKHIEQTWPFAKGKTYR
FT                   LGHWQNKNVPDPYQHEQAVFDETCQLIQQCVADWEPYI"
FT   gene            complement(65274..66374)
FT                   /gene="wza"
FT                   /locus_tag="ABSDF0065"
FT   CDS_pept        complement(65274..66374)
FT                   /transl_table=11
FT                   /gene="wza"
FT                   /locus_tag="ABSDF0065"
FT                   /product="polysaccharide export protein"
FT                   /function="1.2.4 : polysaccharides"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99478"
FT                   /db_xref="GOA:B0VMQ6"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99478.1"
FT                   /translation="MKYCQFFSVLALGLSAASCAVTSGLQTYDIPSEGVYKTDLGTTVN
FT                   VVKISQETLPAIQPAQIDYQRDYASLFKNQQTIYRLSPGDVLSIQLWAYPEIAPPVNNI
FT                   SNEQSVQAYGYPIDQTGYIQFPLVGRYKAAGKTLAQVNRELHSQLARFLKNPDVVVRVV
FT                   SYEGQRFSVQGSVTKGGQFYLSDQPVSIYTALGMAGGVTTTGDNTYIQLIRNGRTYNLN
FT                   TIDLEKAGYSLHKLLVQPNDTIYVSTRENQKIYVMGESGKNQALPMRDQGMSLTDALGE
FT                   SLGINPLSGSASRIYVVRTNPNDRTTEIYHLNLMSIGDFGLANQFRLRSNDVVYVDATG
FT                   LTRWQRIVNQIIPFSNALYNIDRLGQ"
FT   gene            66730..68004
FT                   /locus_tag="ABSDF0066"
FT   CDS_pept        66730..68004
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0066"
FT                   /product="putative UDP-glucose/GDP-mannose dehydrogenase"
FT                   /function="1.7.10 : sugar nucleotide biosynthesis,
FT                   conversions"
FT                   /EC_number="1.1.1.22"
FT                   /EC_number="1.1.1.132"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99479"
FT                   /db_xref="GOA:B0VMQ7"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99479.1"
FT                   /translation="MQIAKLKIAIIGLGYVGLPLAVEFGKKVPVVGFDIYQKRIDELKN
FT                   GQDHTLEVSPEELKQAVHLKYTAHLDDLQDSNFFIVTVPTPIDDFKQPDLTPLIKASTS
FT                   IGQVLKKGDVVVYESTVYPGATEEVCIPVLEKISGLKFNQDFFAGYSPERINPGDKQHR
FT                   VTNILKITSGSTPEVADYIDEVYNLIIEAGTHKAPNIKVAEAAKVIENTQRDVNIALIN
FT                   ELALIFNKLDIDTEDVLKAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAQSIGLHPEI
FT                   ILAARRLNDRMGEHVATQLIKEMVKQRIQVVGARILVMGLSFKENCPDIRNTKIVDFIK
FT                   ALKEYDLDLDIYDPWVDDTEVQHEYGLAPIKELQQGLYDAIVIAVAHNQFKSMSVEEFH
FT                   ALGKEKHVLYDLKYVLDKESSNIRL"
FT   gene            68018..69214
FT                   /locus_tag="ABSDF0067"
FT   CDS_pept        68018..69214
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0067"
FT                   /product="conserved hypothetical protein; putative
FT                   nucleoside-diphosphate sugar epimerase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99480"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99480.1"
FT                   /translation="MSTDIQLNLIGRTQELFVEDIQHWNNKLIEIVSSSKFLVLGGAGS
FT                   IGQAVVKEIFKRNPKKLHVVDISENNLTEVVRDIRSSFGYIDGDFQTFALDIGSAEYDA
FT                   YIENDGDFDYVLNLSALKHVRSEKDPFTLMRMIHVNILNTEKTIQQSIAKGVKKYFCVS
FT                   TDKAANPVNMMGGSKRIMEMFLMRQSQYIDISTARFANVAFSDGSLLHGFNQRIQKNQP
FT                   IAAPNDIRRYFVTPKESGELCLMSCLLGENRDIFFPKLSEHLHLITFADIAVKYLNNLG
FT                   YEPYLCESEDEARSLIQTLPKQGKWPCLFAGSTTTGEKDFEEFFTDNETLDMQRFNNLG
FT                   VIKNELNIEEDKLQVFEEKINSMLLSKHWNKEEIVDLFNYMMPNFGHKETGLYLDGKM"
FT   gene            69214..70362
FT                   /locus_tag="ABSDF0068"
FT   CDS_pept        69214..70362
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0068"
FT                   /product="conserved hypothetical protein; putative
FT                   polysaccharide biosynthesis protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99481"
FT                   /db_xref="GOA:B0VMQ9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99481.1"
FT                   /translation="MDTSKFNQFVRDIYQTNNFIPLHEPRFLGNEKKYVLDTIDSTFVS
FT                   SVGAYVNDFESKIQHFTGCAKAIATVNGTAALHIALLLAGVKRDDIVITQALTFVATCN
FT                   ALSYIGAEPLFIDVSLKTMGLCPKALDTYLQENAFLDDQGVCKHTATNKRISAIVPMHT
FT                   FGHPVEIDELQEVVTRWNIALVEDAAESLGSYYKGKHTGIFGLVSALSFNGNKVITTGG
FT                   GGMVLCQDEELGVRAKHITTTAKIPHPYEFYHDENGFNYRLPNLNAALGCAQMESLEGF
FT                   LSKKRDLAHQYQNFFKDTDISFFVEPENCQSNYWLNAIICKNKTQRDLILDETNSNKVM
FT                   TRPIWTLMTRLPMYENALQGDLTNSLWLEERVVNIPSSVPLE"
FT   gene            70311..71504
FT                   /locus_tag="ABSDF0069"
FT   CDS_pept        70311..71504
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0069"
FT                   /product="conserved hypothetical protein; putative
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99482"
FT                   /db_xref="GOA:B0VMR0"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99482.1"
FT                   /translation="MARRKSCKYSKFGSSGVMRMKKIAVFTGTRAEYGLLYWLMRDIQQ
FT                   DPELELQILATAMHYSPEHGETWKTIVKDGFEITESVEMLLSSDTSSAVVKSMGVGLLG
FT                   FADALKRMQPDVLVVLGDRFEALAVTQAALIMHVPVAHLHGGEITEGAYDESIRHAITK
FT                   MSNIHFAAAEEYKKRIIQLGEQPERVFNVGALGLDHIQRTTFKSISELSQLYDFDFSKP
FT                   YFLITYHPETNLLEENVAPLFDALKQINDVNFIFSYPNADNGNTNIVKAMLDLKVLLPD
FT                   CVLLVKSFGIQNYLSVLKNALAMVGNSSSGLSEAPALQVPTVNIGDRQKGRLRCESILD
FT                   VRLDENEIVEALQKAINFPKDQLSQVVPPLGLGNTSQKIIEVIKTTDFKKKAPFYDL"
FT   gene            71449..72588
FT                   /locus_tag="ABSDF0070"
FT   CDS_pept        71449..72588
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0070"
FT                   /product="conserved hypothetical protein; putative
FT                   polysaccharide biosynthesis protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99483"
FT                   /db_xref="GOA:B0VMR1"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99483.1"
FT                   /translation="MKLLKRQILRRRRHFMIFNQDEIYVIAEIGVNHNGSVDLAKELIL
FT                   KAKDCGANAVKFQTFKADSLLSDQTEMAAYQKENTGSSQSQLELVKSLELTYEQTEEIK
FT                   KFCDEQKITFISTPFDSDSLKFLVNEIDVPYLKVSSADISNLPFLYEIACSKKHVILST
FT                   GTASLGDIEQALSVFAFVIDKGTEVQPSQQLFREAYSKISVRKQLKQQVSILHCVTQYP
FT                   ALFEESNLKAISTLKNVFDLATGFSDHTLDEYAAVISVSLGARIFEKHITLDKTMAGPD
FT                   HAASMEPNEFKHYVEILHKTHAALGDGIKFMLEQESDNYYLVRRSIVAKTDIAEGELLT
FT                   ADNITTKRAGRVCLEPNKYWDVIGTKAKRSFKKNDFIEI"
FT   gene            72589..73230
FT                   /locus_tag="ABSDF0071"
FT   CDS_pept        72589..73230
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0071"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99484"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99484.1"
FT                   /translation="MKKLAIIGSGGFAKELLDLAIDQGYHQICFLERNAKDGDALLGFP
FT                   ILAESVIPTLTDTIYAIGVADPKIRKRIYETYPDLTYPNLIHSQASLGYGIRELLEDSK
FT                   GIVIAAGARITNSCRFGNFIIVSFNSTIGHDCILENYVSIMPGANISGCVHLMQGTYVG
FT                   TNVAVLPGKNPELLKCLGENSVIGAGAVVVKHTEPNKVYIGSPAKELRRD"
FT   gene            73223..74284
FT                   /locus_tag="ABSDF0072"
FT   CDS_pept        73223..74284
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0072"
FT                   /product="conserved hypothetical protein; putative
FT                   polysaccharide biosynthesis protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99485"
FT                   /db_xref="GOA:B0VMR3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99485.1"
FT                   /translation="MIRDVNKIILHKKDSILKALELLDLYALRIVLVVDDHNHLIGSIT
FT                   DGDIRRGLLKGQDVHASVETIMHTTPYSIEEGSLNNRQIFEIMREKSYLALPVIKNNQL
FT                   VNIITLDDLIRKKRKENPVFIMAGGFGTRLRPLTDTCPKPMLPVGGKPLLETIISSFKN
FT                   QGFYKFYISTHYLPEVINEYFGDGEKLGVQIQYVHETDPLGTGGALSLLPASDIKLPFI
FT                   VINGDVLTNMNFEKLLEFHEKRDAIATMCVREFQYQIPYGVVNSEDHVIQSMTEKPSYF
FT                   FDINTGIYVISPELLPEVNAQFIGMPTILEQQMEKQNKVLSYPLHEYWLDIGHMEDYNR
FT                   AQRDIINLDFGKF"
FT   gene            74284..74991
FT                   /locus_tag="ABSDF0073"
FT   CDS_pept        74284..74991
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0073"
FT                   /product="conserved hypothetical protein; putative
FT                   polysaccharide biosynthesis protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99486"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99486.1"
FT                   /translation="MIGQYRVTALIPARGGSKRLPRKNVKLLVDKPLIAWSIEVAKASK
FT                   YIDRVVVSTDDEEIKQVSEQYGAEVPFLRPEYLSNDHASSFDVIKHAIDFLHLGQKNEL
FT                   IVLLQPTSPLRLVSELDTALEFFIAKNAKGIVSISETEHSPMWSNTLPENGCMSDFIRP
FT                   EVQGKRSQDLPKFFRLNGSIYIYETLCLLEQSKIFFNENVYGFETSLKTAIDIDTDLDF
FT                   LIAETIMKNRAIE"
FT   gene            74988..76187
FT                   /locus_tag="ABSDF0074"
FT   CDS_pept        74988..76187
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0074"
FT                   /product="conserved hypothetical protein; putative
FT                   polysaccharide biosynthesis protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99487"
FT                   /db_xref="GOA:B0VMR5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99487.1"
FT                   /translation="MKVLKDSFIYLIGELFAKSLPFMMLPYLTQKLGPDGFGELSYYLT
FT                   MLVLFGIFVGLSQDGAVTRYFYFYGKKALNTVVKAGYLFNIAISILLLFGCWWLKAEIM
FT                   AYVVLATMFQSFVNVQLALRQCQKQPLKYITIQIILSLTNVLFTIAALEYFSHDLVGYR
FT                   ILAIVISNLTTFLIASLVLGDLFRDHNRFTWQRLRLGLFYIFTFGLPLILHQSSFFIKG
FT                   QLDRIFIYQQYSKAELGIYSAGVQIAAVLPIILMALNKAIVPYYYQGLKDSSLTIKKIK
FT                   KYTLISLPLSVLPAVVGWLLPEQVYLWFLGPSYIGSKYYVIMYLLGFGSNLPYLILVNY
FT                   FFFYAKNKTISTISLISSLVYLLGLWLLCSVDISLIPYSLILSNLVLLCSLWWSIKYVR
FT                   "
FT   gene            76141..77133
FT                   /locus_tag="ABSDF0075"
FT   CDS_pept        76141..77133
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0075"
FT                   /product="conserved hypothetical protein; putative
FT                   polysaccharide biosynthesis protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99488"
FT                   /db_xref="InterPro:IPR012477"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99488.1"
FT                   /translation="MCCFVVYGGVLNMSDKKTSLVICFTPLQMLIAEKIVAQQPSVDLI
FT                   VIALNNNDKYKYYYNIFQHPNIAKQYYLFDNNKSRFFKFINIIKFNENFKLEKFYENIY
FT                   ISSIDNKYTHNILSKVNFNNLYTYDDGTANIVKNSIYFKQTFESKLKDIVLKLIGIRFN
FT                   LNKIKKLSRKHYTIYKGIQNIVEQTEYVSIIEKKEEDRNIFIDQEIKIFLGQPLKDIDK
FT                   NFDTLALKKLLVMEEVNYHFKHPRETDEAFFEEIKTSYIFEDFFAKELSKYRKVIIYTL
FT                   SSTAALNIISLDNVEIRLIKNNTVEIKYPDLVQLFIKSGATVIDMDSIK"
FT   gene            78156..79235
FT                   /locus_tag="ABSDF0076"
FT   CDS_pept        78156..79235
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0076"
FT                   /product="hypothetical protein; putative
FT                   glycosyltransferase"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99489"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99489.1"
FT                   /translation="MMNILHVAPEYKWSKIFILPIANCQIQQGNKVWISAPNVLENTSE
FT                   LDEAKFVSWNSKYKNIFKHIGRLFLILKMVHKYKINKVYFHTTVDSTLNIFILSLFSSA
FT                   QLVYVNHGVPYLGYSSIMQYILKLCEIVNINFSHRSITITQSMKQLLEPLNYKKKEITA
FT                   LIPGTLVGVKIPYSSYTDLQSARALLKTNSDNSILKILYVGRLEHRKGIYDLIEAINHT
FT                   NLNCELTVLGGTANELETELDLLKVKFEGFQSDLRSYYLNADLLCVPSHHEGFGQVYLE
FT                   AAAHGVIPVCCNIPGPTDLIKHNSNGFIVEAKSPDSILELFEEINLKKFDLDAIQKRAF
FT                   ESVQAYESSQVISNNMDHF"
FT   gene            79235..80293
FT                   /locus_tag="ABSDF0077"
FT   CDS_pept        79235..80293
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0077"
FT                   /product="conserved hypothetical protein; putative Glycosyl
FT                   transferase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99490"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99490.1"
FT                   /translation="MTIYFVTNGINRMAGTERVIVQLAQALEDVIILVPGSEQCAFSGC
FT                   ENLNIQSLEVGEFPTHNKLAKIIHRLNYFRKLKSILKRNDTVVSFSFDLNLVNIKLSKI
FT                   LNYTPIVCEHIEYNYHKGFRNLIRKKFYSQDTVTLVCLTETDKRKFLNDGIRTLVIPNF
FT                   IHPLDSKYNSESKKILSIGRLEFQKNFAFLIEAFHLSKIYENGWVLDIVGEGSEQKELE
FT                   EKIKLLNMNEFIRIHPFTKNISKYYQDSALMCMPSRFEAFPMVLLEAMNNSLPVLVSDF
FT                   PTGAREILGEGNTQIVSDYTPEAFARLLASFCLDEDLRKTLSKQNSELIRKYYPEQIIQ
FT                   SWKALLEHSSKE"
FT   gene            80662..81294
FT                   /locus_tag="ABSDF0078"
FT   CDS_pept        80662..81294
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0078"
FT                   /product="putative UDP-galactose phosphate transferase
FT                   (WeeH)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99491"
FT                   /db_xref="GOA:B0VMR9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99491.1"
FT                   /translation="MNENMKRLVDIVISLIALTVLSPIFLIVAYKVRKNLGSPIFFYQE
FT                   RPGKDGKLFKMIKFRSMKDAFDAQGNPLPDEARITPFGQKLRSTSLDEMPQLINVLKGD
FT                   MSVVGPRPMLKDFVALYSPEQARRLEARPGMTGLAQVSGRNELDYEERFKCDVWYVDNH
FT                   NVWVDFKIMFKTVKVMLKREGINAPGHVGPSLFKGNDTQENIDSSVK"
FT   gene            81319..82194
FT                   /gene="galU"
FT                   /locus_tag="ABSDF0079"
FT   CDS_pept        81319..82194
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="ABSDF0079"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /function="1.1.1 : carbon compounds"
FT                   /function="1.6.2 : colanic acid (M antigen)"
FT                   /function="1.7.7 : galactose metabolism"
FT                   /function="1.7.9 : glucose metabolism"
FT                   /function="5.5.5 : dessication"
FT                   /EC_number="2.7.7.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99492"
FT                   /db_xref="GOA:B0VMS0"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99492.1"
FT                   /translation="MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVE
FT                   AGIEQIILVTHSSKASIENYFDRNLELETTLEQKKKFDLLAEITQIVPEHVSVVSVRQP
FT                   QPLGLGHAVLCAKSVVGQDDFAVLLPDVLVKDSSGQNDLSRMISRYNSSQAAQIMVEAV
FT                   PDHLVDQYGIVDVKHSPNEGESIAMQGIVEKPAVGSAPSNLSVVGRYVLPAKIMQLLEN
FT                   TPKGAGNEIQLTDAIAMLQDTDTVEAYRMQGQTFDCGSKIGYLKAVLHYGIEHPKLGND
FT                   FKKLIQELKL"
FT   gene            82310..83572
FT                   /locus_tag="ABSDF0080"
FT   CDS_pept        82310..83572
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0080"
FT                   /product="putative UDP-glucose 6-dehydrogenase (Ugd) (Udg)"
FT                   /EC_number="1.1.1.22"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99493"
FT                   /db_xref="GOA:B0VMS1"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99493.1"
FT                   /translation="MKIAVFGTTLHAGVMAALLAEYGNQIYWCTSVTCEENISILSYQD
FT                   QEVNHYLNKQRKAGFLKESPFSEIPLDIEVYLFCFSPTQIELALKTVEKLSERPIVHPR
FT                   LMINGSTFGLHGTNQLKQHLPKDEWVYFPDVIQEGNAINSVLNVKHVIVGVESSYAQDT
FT                   MQELLRPFFRFSYQYLFMPILDAEFTKLSISGMLATRISYMNDLAMVAEKLGIDIANVK
FT                   HGIAADTRIGAAYLSAGVGFGGENFSHDILTLSSTVSGTGAKSQLLEQVWAINEQQKEI
FT                   LFRKLWNYYHCDLSGKTVAIWGASFKENTSSTHNSPIHILLAALWAQGVKVRLHDPQAL
FT                   DEIATTYGDREDLVLCADQYEAAQGAHALCLVTAWKQYWSPDFKQLQQVMQHPLILDGR
FT                   NIYDPAYVKAKGFAYEGVGRL"
FT   gene            83569..85239
FT                   /gene="pgi"
FT                   /locus_tag="ABSDF0081"
FT   CDS_pept        83569..85239
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="ABSDF0081"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /function="1.3.1 : glycolysis"
FT                   /function="1.7.8 : gluconeogenesis"
FT                   /EC_number="5.3.1.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99494"
FT                   /db_xref="GOA:B0VMS2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VMS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99494.1"
FT                   /translation="MSKSIEKFPKELVSPIAQLHSLVEKNSKLHIKELFAAEQDRFQNY
FT                   SVKFDQLVFDYSKHRITKSVLEQLFALAKTKQLTHWIERLFSQDKVNCTEQRAAMHWAL
FT                   RLPSEYSKFPELTKQVHTQLQRMYVLVEKIHAGQYRGATGEVIQDVVNIGVGGSDLGPQ
FT                   MVTHALCDFKVKTAKPLNVHFVSTMDGSQLSDLLHQLRPETTLFIISSKSFGTIDTLSN
FT                   AQTVRQWLEKALGKHDRVVKSHFIGVSTKAEKMTEWGIAPENQLLLWDWVGGRYSLWSC
FT                   IGFPIALTIGIDGFQQLLAGAHAVDEHFQNTNFEQNIPVLMALLGIWNNNFLNIQTHAV
FT                   LPYDGRLKYFAAYLQQLEMESNGKSVQRDGQKVELDTCPIVWGEVGPNAQHAFYQLLHQ
FT                   GTQAVSCDFIAPIQRYNADHFTYVENAEALIEQHHLALSNCLAQSRLLAFGNEALDSAE
FT                   LKNLPIYKQYEGNQPSSTLLLKELNPYSLGMLIALYEHKVFVQSVIWNINPFDQWGVEK
FT                   GKQIADQLLPILNGAQNDLSALDASTRGLIKILLGKVDG"
FT   gene            85232..86248
FT                   /gene="galE"
FT                   /locus_tag="ABSDF0082"
FT   CDS_pept        85232..86248
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="ABSDF0082"
FT                   /product="UDP-glucose 4-epimerase (Galactowaldenase)
FT                   (UDP-galactose 4-epimerase)"
FT                   /function="1.1.1 : carbon compounds"
FT                   /function="1.5.3.7 : nicotinamide adenine dinucleotide"
FT                   /function="1.6.2 : colanic acid (M antigen)"
FT                   /function="1.7.7 : galactose metabolism"
FT                   /function="5.5.5 : dessication"
FT                   /EC_number="5.1.3.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99495"
FT                   /db_xref="GOA:B0VMS3"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99495.1"
FT                   /translation="MAKILVTGGAGYIGSHTCVELLEAGHEVIVFDNLSNSSKESLNRV
FT                   QEITHKSLTFVEGDIRNSGELDQVFQEHAIDAVIHFAGLKAVGESQEKPLIYFDNNIAG
FT                   SIQLVKSMEKAGVYTLVFSSSATVYDEANTSPLNEEMPTGMPSNNYGYTKLIVEQLLQK
FT                   LSVADSKWSIALLRYFNPVGAHKSGRIGEDPQGIPNNLMPYVTQVAVGRREKLSIYGND
FT                   YDTIDGTGVRDYIHVVDLANAHLCALNNRLQAQGCRAWNIGTGNGSSVLQVKNTFEQVN
FT                   GVPVAFEFAPRRAGDVATSFADNARAVAELGWKPQYGLEDMLKDSWNWQKQNPNGYN"
FT   gene            complement(86293..87663)
FT                   /gene="manB"
FT                   /locus_tag="ABSDF0083"
FT   CDS_pept        complement(86293..87663)
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="ABSDF0083"
FT                   /product="putative bifunctional protein [Includes:
FT                   phosphomannomutase (Pmm); phosphoglucomutase (Glucose
FT                   phosphomutase) (Pgm)]"
FT                   /function="1.6.2 : colanic acid (M antigen)"
FT                   /function="1.7.10 : sugar nucleotide biosynthesis,
FT                   conversions"
FT                   /function="5.5.5 : dessication"
FT                   /EC_number="5.4.2.8"
FT                   /EC_number="5.4.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99496"
FT                   /db_xref="GOA:B0VMS4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B0VMS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99496.1"
FT                   /translation="MTTLTCFKAYDIRGKLGTELNEEIAYKIGRAYGQIYKPKTVVVGC
FT                   DIRLSSEALKQAAIRGLNDAGVNVLDLGMTGTEEVYFAAFHLDVQGGIEVTASHNPMDY
FT                   NGMKLVRENARPISADTGLKEIQALAETNNFEEVGQKGTTQSYNILPEFVDHLLTYIEP
FT                   AKIRPLKLVVNAGNGAAGHVIDAIEEKFKALNVPVEFIKIHHEADGTFPNGIPNPILIE
FT                   NRDSTRNAVLEHKADMGIAWDGDFDRCFLFDEKGQFIEGYYIVGLLAQAFLIKQSGEKI
FT                   VHDPRLVWNTFDIVDEYKGVTVQSKSGHAFIKDVMREHNAVYGGEMSAHHYFRDFAYCD
FT                   SGMIPWLLTIVLLSETGQSLSTLVENMIAKFPCSGEINFKVADTQTTIQKIFDFYADQN
FT                   PQIDRTDGVSLNFGAWRFNVRASNTEPLLRLNIESRADRQAQPMQYYVDELTGLIQN"
FT   gene            87951..88436
FT                   /pseudo
FT                   /gene="lldP"
FT                   /locus_tag="ABSDF0084"
FT   CDS_pept        87951..88436
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lldP"
FT                   /locus_tag="ABSDF0084"
FT                   /product="fragment of L-lactate permease (part 1)"
FT                   /function="1.1.1 : carbon compounds"
FT                   /function="4.2.A.14 : The Lactate Permease (LctP) Family"
FT                   /note="Evidence 7 : Gene remnant; Product type t :
FT                   transporter"
FT                   /db_xref="PSEUDO:CAO99497.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            88345..89706
FT                   /pseudo
FT                   /gene="lldP"
FT                   /locus_tag="ABSDF0085"
FT   CDS_pept        88345..89706
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lldP"
FT                   /locus_tag="ABSDF0085"
FT                   /product="fragment of L-lactate permease (part 2)"
FT                   /function="1.1.1 : carbon compounds"
FT                   /function="4.2.A.14 : The Lactate Permease (LctP) Family"
FT                   /note="Evidence 7 : Gene remnant; Product type t :
FT                   transporter"
FT                   /db_xref="PSEUDO:CAO99498.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            89726..90478
FT                   /gene="lldR"
FT                   /locus_tag="ABSDF0086"
FT   CDS_pept        89726..90478
FT                   /transl_table=11
FT                   /gene="lldR"
FT                   /locus_tag="ABSDF0086"
FT                   /product="transcriptional repressor for L-lactate
FT                   utilization (GntR family)"
FT                   /function="1.3.6 : aerobic respiration"
FT                   /function="2.2.2 : transcription related"
FT                   /function="3.1.2.3 : repressor"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99499"
FT                   /db_xref="GOA:B0VNC9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99499.1"
FT                   /translation="MRISDQVVMKLQALIEERHMKKGDRLPAERQLATSLGVSRPSLRE
FT                   AIQQLNSQGVLISRRGDGTYIQQLPEQWPQQLIVNPISNLIEEDPLYRFDVQEARLVLE
FT                   GGTAWYAALRSTPEDRAKIHHYFNEISRHQNAGDSAQAAVADAEFHLAIAEASHNVVLI
FT                   QMMRSLFDLLQYNVLLGRKKVYNDPVNGDLLSEQHFQVMDAIDRKDPEAARQAVCGHIE
FT                   FVINHVRSLDEDEARQKRANRLNRVDSK"
FT   gene            90475..91626
FT                   /gene="lldD"
FT                   /locus_tag="ABSDF0087"
FT   CDS_pept        90475..91626
FT                   /transl_table=11
FT                   /gene="lldD"
FT                   /locus_tag="ABSDF0087"
FT                   /product="L-lactate dehydrogenase, FMN linked"
FT                   /function="1.3.6 : aerobic respiration"
FT                   /function="1.4.1 : electron donor"
FT                   /EC_number="1.1.2.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99500"
FT                   /db_xref="GOA:B0VND0"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020920"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VND0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99500.1"
FT                   /translation="MIISSGNDYRAAAQRRLPPFLFHYIDGGAYAEYTLKRNVQDLSEI
FT                   ALRQRVLNDMSALSLETKLFNETLSMPVALAPVGLTGMYARRGEVQAAMAADKKGIPFT
FT                   LSTVSVCPIEEVAPAINRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPVPGA
FT                   RYRDAHSGMSGPNAAMRRYMQSVFHPHWSWNVGLMGRPHDLGNISKYLGKPTGLEDYIG
FT                   WLGSNFDPSISWKDLEWIREFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLD
FT                   GVMSSARALPAIADAVKGDLAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAG
FT                   GQGVSNLLDLIDKEMRVAMTLTGAKSISDINTDCLVQAIKQGL"
FT   gene            91894..93624
FT                   /gene="dld"
FT                   /locus_tag="ABSDF0088"
FT   CDS_pept        91894..93624
FT                   /transl_table=11
FT                   /gene="dld"
FT                   /locus_tag="ABSDF0088"
FT                   /product="D-lactate dehydrogenase, NADH independent,
FT                   FAD-binding domain"
FT                   /function="1.3.6 : aerobic respiration"
FT                   /function="1.4.1 : electron donor"
FT                   /EC_number="1.1.1.28"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99501"
FT                   /db_xref="GOA:B0VND1"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012256"
FT                   /db_xref="InterPro:IPR015409"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016172"
FT                   /db_xref="InterPro:IPR016173"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="UniProtKB/TrEMBL:B0VND1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99501.1"
FT                   /translation="MDDQKETIMQTFSPKAVIERLQNIVGRSYVLTDDQSTRQYRQGRR
FT                   FGEGKVLAVVVPGTLLEQWQVLQAAIEAGCIVIMQAANTGLTGGSTPYGDDYDRPVLVM
FT                   STRRLKGIQVIHDGKQVICLPGATLDNLEQILKGYDREPHSVIGSSCIGASVLGGVCNN
FT                   SGGALVRRGPAYTELALYAQVNAAGQLELVNHLGVNLGSTPEEILTRLEKQQYQAVDIL
FT                   DDNEKQASDHRYGHDVTQVDEDTPARFNADPSRLFEASGSAGKVCVFAVRLDTYEKVES
FT                   SVFYIGSNDADDLTAIRRYLLTSLPSLPIAGEYIHRDAYLIGEKYGKDTFLFIEKFGTA
FT                   NVPKAFAMKDKVDGFLEKFKIKGLTDQILQAITFFLPSHLPKRMTEYRDRYEHHLVLRV
FT                   ENNSKAQTEQFLKEYFTVHQSGNYFVCSEEEGRKAFLHRFAIAGAAIRYRDTHRSEVED
FT                   IVALDIALRRNDREWVEQLPAEMEKKIIHKLYYGHFFCHVFHQDYILKKGHDPLEIEHQ
FT                   MWKLLDARRAEYPAEHNVGHLYIAKPALANFYQKLDPTNSFNVGIGHTSKLKYWGKAKS
FT                   "
FT   gene            complement(93673..94887)
FT                   /gene="tyrB"
FT                   /locus_tag="ABSDF0089"
FT   CDS_pept        complement(93673..94887)
FT                   /transl_table=11
FT                   /gene="tyrB"
FT                   /locus_tag="ABSDF0089"
FT                   /product="tyrosine aminotransferase, tyrosine repressible,
FT                   PLP-dependent"
FT                   /function="1.5.1.13 : phenylalanine"
FT                   /function="1.5.1.14 : tyrosine"
FT                   /function="1.5.1.19 : leucine"
FT                   /EC_number="2.6.1.57"
FT                   /EC_number="2.6.1.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99502"
FT                   /db_xref="GOA:B0VND2"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0VND2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99502.1"
FT                   /translation="MFQHIPPYAGDPILSLMEQFNADTRSEKVNLSIGLYYNEDSIVPQ
FT                   LETIIEAQKRIEPKNGKTKLYLPMEGFKPYREAIQALLFGANSPAVKAGRAVTIQTLGG
FT                   SGALKVGADFLKTYFPNSDVWVSQPTWDNHVAIFNGAGIKTHFYPYFDAETRGVDFDGM
FT                   LSTLKTLPEQSIVLLHPCCHNPTGADLNPAQWDQVIAVLKDRNLIPFLDIAYQGFGDGM
FT                   EEDAYAIRALDQAGLNFIVSNSFSKIFSLYGERVGGLTFVCDDAEAAQCTFGQLKATVR
FT                   RIYSSPPTTGAWLVDEVLNDAELNQQWQGEVKEMRERIIKMRSILKDELTKALPDRDFS
FT                   YLVNQKGMFSYTGLTAEQVDILREEYAIYLVRSGRICVAGLNMNNVYTVAKAMAEVLAK
FT                   SVEAA"
FT   gene            95403..96113
FT                   /locus_tag="ABSDF0090"
FT   CDS_pept        95403..96113
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0090"
FT                   /product="putative transcriptional regulator (GntR family)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99503"
FT                   /db_xref="GOA:B0VND3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VND3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99503.1"
FT                   /translation="MQDLTFAPDPLQSQGRTLTENVFKQIQTAIVLGQIPAGSKISEPE
FT                   LARTYGISRGPLREAIHRLEGQRLVERTAHVGARVVSLSLQQFKELYQIRASLEGLACK
FT                   LAAQHIDKKQILALRDVLRMHAEDENFKAGKGYYLQEGQDDFHYCIIKSSGNKTLEKML
FT                   CDELYHLIRMYRIQFSNTPDRPSKAWDEHIRILDAIAEGDGELAELLMHRHINASYKII
FT                   EQTLLQAQGEHNNG"
FT   gene            96106..96990
FT                   /gene="prpB"
FT                   /locus_tag="ABSDF0091"
FT   CDS_pept        96106..96990
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="ABSDF0091"
FT                   /product="methylisocitrate lyase"
FT                   /function="1.1.2.3 : Propionate degradation"
FT                   /EC_number="4.1.3.30"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99504"
FT                   /db_xref="GOA:B0VND4"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B0VND4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99504.1"
FT                   /translation="MAKQSAGQLFRDAVAQEKPLQVVGTINANHALLAKRAGYKAIYLS
FT                   GGGVAAGSLGLPDLGISNLDDVLTDVRRITDVCDLPLLVDADTGFGASAFNIARTTKAL
FT                   IKFGAAAMHIEDQVGAKRCGHRPNKAIVTQEEMVDRIKAAVDARGDDSFVIMARTDALA
FT                   VEGLQAAIDRAGAYIEAGADMLFPEAITELDMYKQFAQKTGVPILANITEFGSTPLFTT
FT                   EELASADVSLALYPLSAFRAMNKAAETVYETLRKEGTQKNVVDIMQTRKELYERINYYA
FT                   FEDYLDNAFAKKK"
FT   gene            97208..98407
FT                   /gene="prpC"
FT                   /locus_tag="ABSDF0092"
FT   CDS_pept        97208..98407
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="ABSDF0092"
FT                   /product="methylcitrate synthase (citrate synthase 2)"
FT                   /function="1.1.2 : fatty acids"
FT                   /EC_number="2.3.3.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99505"
FT                   /db_xref="GOA:B0VND5"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B0VND5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99505.1"
FT                   /translation="MNKQQILVDIKDDSMSSNETTTGFKPKKSVALSGQVAGNTALCTV
FT                   GRSGNDLHYRGYDILDLAAGSEFEEVAHLLVHGKLPNKAELKAYKAKLKALRGLPAALK
FT                   TALEQLPTSAHPMDVMRTGVSVLGCLTPEHEDHNEAGAKDIADKLMASLGSMLLYWYHF
FT                   SNNGRRIEVETDDDSIAAHFLHLLHGEKPCEEWIQAMHTSLILYAEHEFNASTFTSRVV
FT                   AGTGSDMYSAITGGIGALRGPKHGGANEVAFVIQQRYDNPDEAEADIRKRIENKEVVIG
FT                   FGHPVYTVSDPRNEVIKKVAHDLAEAQENTKMYLIAERLEAVMKEVKNMFPNLDWFSAV
FT                   SYHLMGVPTAMFTPLFVIARTAGWSAHVIEQRQDGKIIRPSANYTGPENLEFKPLAERG
FT                   "
FT   gene            98407..101013
FT                   /locus_tag="ABSDF0093"
FT   CDS_pept        98407..101013
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0093"
FT                   /product="putative methyl-cis-aconitic acid hydratase
FT                   (AcnM)"
FT                   /function="1.1.2.3 : Propionate degradation"
FT                   /EC_number="4.2.1.99"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99506"
FT                   /db_xref="GOA:B0VND6"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR012708"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B0VND6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99506.1"
FT                   /translation="MNTKYRKPLAGTQLEYYDVRQAVEDIQPGAYEKLPYTSKVLAEQL
FT                   VRRADAENLTAYLTQLIERRQDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKGGD
FT                   PSKVNPVVPTQLIVDHSLAVEYGGADPDAFAKNRAVEDRRNEDRFHFIEWTKTAFKNVD
FT                   VIPAGNGIMHQINLEKMSPVIQARDGVAFPDTCVGTDSHTPHTDALGVISVGVGGLEAE
FT                   NVMLGRASWMRLPDIIGVELVGQRQAGITATDIVLALTEFLRKERVVGAYLEFFGEGAD
FT                   SMSVGDRATISNMTPEYGATAAMFYIDQNTIDYLRLTGREDAQVALVEQYAKEIGLWAS
FT                   EMTKAEYPRVLRFDLSTVTRNIAGPSNPHARVSTSDLKEKGIAGVVENRSDGLMPDGAI
FT                   IIAAITSCTNTSNPRNTVAAGLLARKANGLGLVRKPWVKSSFAPGSKAAALYLEEAGVL
FT                   KDLEKLGFGIVAYACTTCNGMSGALNPVIQQEIIDRDLYATAVLSGNRNFDGRIHPYAK
FT                   QAFLASPPLVVAYAIAGTIRFDIEKDALGYDKEGNPIYLKDIWPSDAEIDALVKQAVKP
FT                   EQFRKVYIPMFDLGEVEQAKSPLYDWRPQSTYIRRPPYWEGALAAPRTLANMRPLAILG
FT                   DNITTDHLSPSNAILMDSAAGEYLHKMGVPEEDFNSYATHRGDHLTAQRATFANPKLYN
FT                   EMVRRSDGTIKQGSKARVEPEGEVMRMWEAIETYMNRKQPLIIIAGADYGQGSSRDWAA
FT                   KGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFKPGVNRKTLKLDGTELYSVIGNIAP
FT                   RSTLTLVIERATADGKEEIVEVPVTCRLDTEEEVSVYEAGGVLQRFAQDFLEGQVA"
FT   gene            101173..101439
FT                   /locus_tag="ABSDF0094"
FT   CDS_pept        101173..101439
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0094"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99507"
FT                   /db_xref="GOA:B0VND7"
FT                   /db_xref="UniProtKB/TrEMBL:B0VND7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99507.1"
FT                   /translation="METTNKLDNQAERKLPVKAHLLCGWPLVLMLVGGAIGGALGASAY
FT                   GINVKIYKSNLSNIAKVLLNLLTGLTAIILMLIAANLIRMYFL"
FT   gene            101670..101903
FT                   /locus_tag="ABSDF0095"
FT   CDS_pept        101670..101903
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99508"
FT                   /db_xref="InterPro:IPR009912"
FT                   /db_xref="UniProtKB/TrEMBL:B0VND8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99508.1"
FT                   /translation="MHLCHHHRAKWTIDNHSNWVIFLFNIYDYRNVIMVTAGEKPGTGF
FT                   YFCAQCGHRVFLEINTDPLPPCTKCYCTQFKR"
FT   gene            102000..102602
FT                   /locus_tag="ABSDF0096"
FT   CDS_pept        102000..102602
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0096"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99509"
FT                   /db_xref="GOA:B0VND9"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:B0VND9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99509.1"
FT                   /translation="MMGMKKETVMETILGLCIGVGLSAACGFRVFVPLLVMSIATMMGW
FT                   FEPSKGFEWLVLPSVCLALGVATVCEVAAYYIPWVDNALDTVATPAAMIAGTLATMAVS
FT                   SGEMSRFASWAAAIIVGGGTAGVVQMSTVAARGVSTATTGGLGNFIVATGEWIGAILLS
FT                   VSAMLVPALVAIVVLIAVIWVVRWIRHKKQEQAHTPL"
FT   gene            103008..103517
FT                   /locus_tag="ABSDF0098"
FT   CDS_pept        103008..103517
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0098"
FT                   /product="putative Acetyltransferase, GNAT family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99510"
FT                   /db_xref="GOA:B0VNE0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99510.1"
FT                   /translation="MTVILVKPHFRFKDSYNDYINELADEDRHPLTTEFDHTDFESFLN
FT                   KLRDYEKGESLEEGHVPNITYWLVEDNEVIGASNLRLKLNEQIEYCGGHIGLGIRPSKR
FT                   GQNFGSKLLELTIQEAWKLGLTELHIHCYKSNLASAKTIQANNGRLHSEITLAQVVQRY
FT                   VVYKTL"
FT   gene            complement(103877..104161)
FT                   /locus_tag="ABSDF0099"
FT   CDS_pept        complement(103877..104161)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0099"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99511"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99511.1"
FT                   /translation="MTIYKPFLALSFVLVSLGISGCNLHTQQEFEKICLSGGHSKTSCE
FT                   CIYQRLEQTYSPKLMQRLEHVSLQSPVLPRDFAPTFLSTMQRCDKSSLG"
FT   gene            complement(104360..105265)
FT                   /locus_tag="ABSDF0100"
FT   CDS_pept        complement(104360..105265)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0100"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99512"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99512.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(105424..106236)
FT                   /locus_tag="ABSDF0101"
FT   CDS_pept        complement(105424..106236)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0101"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99513"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99513.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKRID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            106405..106524
FT                   /pseudo
FT                   /locus_tag="ABSDF0102"
FT   CDS_pept        106405..106524
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0102"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99514.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            106883..107695
FT                   /locus_tag="ABSDF0104"
FT   CDS_pept        106883..107695
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0104"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99515"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99515.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKRID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            complement(107886..108608)
FT                   /locus_tag="ABSDF0105"
FT   CDS_pept        complement(107886..108608)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0105"
FT                   /product="putative Short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99516"
FT                   /db_xref="GOA:B0VNE6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99516.1"
FT                   /translation="MVFWNFIMNNNIIIFGYGTGISKAVAHKFGKEGYKIGLVARNAQK
FT                   LEKAILELKAQGIEAYAFACDLAVLEDIPNLIKRIKDQLGEIKNIHWNAFHDIEGNILE
FT                   TPPLELTKSFHIRVSSYIATVQACLGDLEKNHGSILSTNGIFAFDAVGIDLVAKEYSSL
FT                   ATTATAQYKTTNLLAHSLADANVYVSQVIVNGFVDGRPEAKDKTYAVHPETVAEQFWYL
FT                   HQHKQETVSLCGEAIQAA"
FT   gene            109332..110051
FT                   /locus_tag="ABSDF0108"
FT   CDS_pept        109332..110051
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99517"
FT                   /db_xref="GOA:B0VNE7"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99517.1"
FT                   /translation="MINKNRLYTNLMINCELDNMENKNQCRQCAVCGRSFPLKDLVSGE
FT                   VIRNVISDEILKDHPDWSYSSFICRADLADYRIKYVQSLLRSEKGELSNLENEVIGSMQ
FT                   RHELISQNTESDFDQNWTFGEKLADKIASFGGSWAFLICFALFLTGWIVLNTVVMVDRP
FT                   VDPYPFILLNLVLSCLAAIQAPIIMMSQNRQEAKDRLRSQHDYQINLKAELEIRHLHEA
FT                   LLHKAIHEGFFSNIISR"
FT   gene            110048..110860
FT                   /locus_tag="ABSDF0109"
FT   CDS_pept        110048..110860
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0109"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99518"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99518.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKRID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            111102..111791
FT                   /locus_tag="ABSDF0110"
FT   CDS_pept        111102..111791
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0110"
FT                   /product="putative dual specificity pseudouridine synthase
FT                   for 23S rRNA and tRNAphe modification (RluA-like)"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="4.2.1.70"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99519"
FT                   /db_xref="GOA:B0VNE9"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99519.1"
FT                   /translation="MLHCCFTTMPLNDNFVYAPPQDPLSILFEDDDLIVVDKPAGLLSV
FT                   MGRLPEHHDSAYLRVLEKFPLAKVTHRLDMATSGLLMFAKHRDAEVAVSKMFQARTVKK
FT                   HYIALVQGQVKQEGSVEVPLITDWENRPRQIVHFELGKHAKTLFQPLVYDATTDQSRVL
FT                   LEPVTGRSHQLRVHMMHIGHPIMGDKLYHPEPKRFHLNRMALHAAYLAFQHPLKGTDVV
FT                   IESQVPF"
FT   gene            111902..112276
FT                   /locus_tag="ABSDF0111"
FT   CDS_pept        111902..112276
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99520"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99520.1"
FT                   /translation="MNRDYEQFPDDDNGNVLWQMVEDGDDLTELHEIEFSIAFQDQQNA
FT                   EQCAMHLLYQEQKISLFQDDSVEPNEWIITIFVTMEPEYSDIVDLEQWFSTIAEQFNGE
FT                   YDGWGCMAYVFDEEEDDILQ"
FT   gene            112305..112685
FT                   /locus_tag="ABSDF0112"
FT   CDS_pept        112305..112685
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99521"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99521.1"
FT                   /translation="MSLSQKEIAVRFLELAAAGEVDEAYGNYTAPNFKHHNPYYAGDKT
FT                   SLKEGMRESAIETPNKVLEVQHVIEDGALVAVHSKLEMQMNNKLTILAVVHICRFENEK
FT                   IAEFWDIGQIQPDPLVNENGMF"
FT   gene            complement(112730..114820)
FT                   /locus_tag="ABSDF0113"
FT   CDS_pept        complement(112730..114820)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0113"
FT                   /product="putative ferric siderophore receptor protein"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99522"
FT                   /db_xref="GOA:B0VNF2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99522.1"
FT                   /translation="MRHKLGLLSSLGLSFISTLTWGEETSTVLETIRIQAESTREDVSQ
FT                   NSSATKFTHDVLDVPFNRAYLSKQIMEQQDVQRIDDALTLVSGVFHQNSFGGGFWDNYS
FT                   FRGFSTDPNLGAAMIRNGLSVNRGISAPKDVVNIESLEFLKGPMAALYGRGETGGLLNL
FT                   NSKKPQWESESELNLRANTQEQYHISLEHTAPINDELAYRLAVAHEDNQSFRDHVSSER
FT                   WFFSPQLTWKISDQTQLDFDSEFTEHKGTFDRGVSTVNHQFVMDPKTFTGEPDDGDLKI
FT                   KDYFYQLHLSHEFNPDWKLNSAVSYKDAKMVGFATEPRRMQADGRALERQRRYRDYTSE
FT                   DVLAQTELLGKIDTSWARHEILLSTELGQLDYKQNQLRRNHSTSSTNTIDIYQPEYGKY
FT                   LPNLTPFTDTKERQRYFALNVQDQIFFNDQWSVLLGNRFDQVEQDFKNHIKQTEDNQTL
FT                   HQNSPRFGVNFKASDQWAFYTNYGRSFAMNSGMNRNGQTFAPEKGESYEVGTKYKINDQ
FT                   SVLSLALFKMKKQNVLTTDPIDKDFQTAAGEVSSKGVEFDLNSQITDRWFINANYSYTD
FT                   AQIEKDQDLAKGARLSNVPKHQGSVSTNYEFLQDGARKAGVGANLTYVGERSGHNLDNG
FT                   FNLPSYTLVNLNGYYAPSDRLRYQLNVNNLFDKTYYVSSYSDLWVQPCEPLNASISAQW
FT                   KF"
FT   gene            114881..116041
FT                   /locus_tag="ABSDF0114"
FT   CDS_pept        114881..116041
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0114"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99523"
FT                   /db_xref="GOA:B0VNF3"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99523.1"
FT                   /translation="MLITAMSLEKNIERLQSIDALRGLVIIIMLLDHVRETFYLHKQVT
FT                   HPMDVTVTEPALFGSRLLAHICAPVFVLLTGISAFLFQSKKQDLQQTRAFLLKRGLFLI
FT                   ALELTLVNFAWTATFPPEVIYLQVIWAIGISMVVLACCVSLPLPVLAGVALVIIFGHNL
FT                   LDSVHFSQGILQNIWFVLHERGWIEIAGIKLRTSYPVLPWIGVILLGYVLGQFFSSKYS
FT                   ANQRSRALLSLGLASIGLFVLLRFINVYGDQPWQHFESLQLSLMSFFNLTKYPPSLLFI
FT                   LLNVGIGLLVLVAFERIQQHSFLKPLVVFGSVPMFFYLLHLYVLKLMYVLALSVWGADY
FT                   GNYLSVNHVWMLWLITIVLSFALYPAVKWFSKFKHQNKHISILKYF"
FT   gene            complement(116082..116549)
FT                   /gene="lrp"
FT                   /locus_tag="ABSDF0115"
FT   CDS_pept        complement(116082..116549)
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="ABSDF0115"
FT                   /product="transcriptional regulator for lrp regulon and
FT                   high-affinity branched-chain amino acid transport system,
FT                   mediator of leucine response (AsnC family)"
FT                   /function="1.5.1.18 : isoleucine/valine"
FT                   /function="1.5.1.19 : leucine"
FT                   /function="2.2.2 : transcription related"
FT                   /function="2.3.7 : nucleoproteins, basic proteins"
FT                   /function="3.1.2.2 : activator"
FT                   /function="3.1.2.3 : repressor"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99524"
FT                   /db_xref="GOA:B0VNF4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99524.1"
FT                   /translation="MRPLDRIDRMILDILQREGRIAISELASRVNLSTTPCSERVKRLE
FT                   RDGIIMGYYARLNPAYVDRNLLVFLEIKLSAKSGDVFDQVARDLVEIPEVLECHLISGE
FT                   FDYLVKARLKEMSAYRRLLGDLLKKLPASASSHSYVVMEEVKETLYLDVSK"
FT   gene            116686..117951
FT                   /gene="dadA"
FT                   /locus_tag="ABSDF0116"
FT   CDS_pept        116686..117951
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="ABSDF0116"
FT                   /product="D-amino acid dehydrogenase, small subunit"
FT                   /function="1.1.3 : amino acids"
FT                   /EC_number="1.4.99.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99525"
FT                   /db_xref="GOA:B0VNF5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99525.1"
FT                   /translation="MRVIVLGSGVIGVASAYYLARQGAEVTVLDRQSGPAEETSFGNAG
FT                   QISPGYSTPWAAPGIPFKAVKWMFQHHAPLAINLDGSMWQLQWMAQMLKNCNPQSYAVN
FT                   KERMMRVAEYSRDCLRELRKDTGIHYENRAKGTLQLFRKEAQMEAVQRDISVLEECGVS
FT                   YELLNGNELGRVEPALANAQDKLVGGLHLPNDETGDCYLFTNALAQIAKELGVNFQFNQ
FT                   NVEKLIVEGDQIKGVQVNGKVLTADRYVLAFGSYSRDFLKPLDLQLPVYPVKGYSLTIP
FT                   IVAPAFAPQSTVLDETYKIAITRFDQRIRVGGMAELSGFNLGLNEDRHATLQMVTQDLF
FT                   PGGDMEQASFWTGLRPMTPDSTPIIGATRFKNLFLNTGHGTLGWTMACGSGKLISDIVL
FT                   NHKTDISTDGLSIQRYSHAHAA"
FT   gene            117972..119075
FT                   /gene="dadX"
FT                   /locus_tag="ABSDF0117"
FT   CDS_pept        117972..119075
FT                   /transl_table=11
FT                   /gene="dadX"
FT                   /locus_tag="ABSDF0117"
FT                   /product="alanine racemase 2, PLP-binding, catabolic"
FT                   /function="1.1.3 : amino acids"
FT                   /function="1.5.1.17 : alanine"
FT                   /EC_number="5.1.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99526"
FT                   /db_xref="GOA:B0VNF6"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99526.1"
FT                   /translation="MPRPITAVIHRQALQNNLAVVRKAMPNSKVFAVVKANAYGHGIER
FT                   VYEAFKAADGFALLDLEEAKRIRALGWTGPILLLEGVFSPQDLFDCVQYQLSFTIHSEA
FT                   QIEWVEQHPYPAQFDVFLKMNSGMSRLGFKPQHYVQAWERLNNLANVAKITHMMHFSDA
FT                   DGDRFGQQGIDYQITAFEEIVKDLPGERSVSNSAAILRYQDQLKSDYVRSGIMLYGSSP
FT                   DYPTHSIADWGLQPTMSLRSEIISVQHLEPNESVGYGSNFVAEQPMTIGIVACGYADGY
FT                   QRISPTGTPVLVDSVRTRTVGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTGVVLPID
FT                   DVAVSSGTVGYELMCAVTARVQFINQV"
FT   gene            119086..119445
FT                   /locus_tag="ABSDF0118"
FT   CDS_pept        119086..119445
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99527"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99527.1"
FT                   /translation="MSNSDIQKINTNEVMSAVTVFNKVVYLSGQVPKNTEQDVAGQTRE
FT                   ILATIEELLALANTDKSRLLSAQLYLKNLSDFSTVNAIWVDWLKGCVAPSRATIQADLV
FT                   NPDWLIEIAVTAAQK"
FT   gene            119608..121035
FT                   /gene="cycA"
FT                   /locus_tag="ABSDF0119"
FT   CDS_pept        119608..121035
FT                   /transl_table=11
FT                   /gene="cycA"
FT                   /locus_tag="ABSDF0119"
FT                   /product="APC family, D-serine/D-alanine/glycine transport
FT                   protein"
FT                   /function="1.1.3 : amino acids"
FT                   /function="1.5.1.10 : glycine"
FT                   /function="1.5.1.17 : alanine"
FT                   /function="1.5.1.11 : serine"
FT                   /function="1.5.2.1 : purine biosynthesis"
FT                   /function="1.5.3.10 : glutathione"
FT                   /function="1.6.7 : peptidoglycan (murein)"
FT                   /function="1.7.17 : formyl-tetrahydrofolate biosynthesis"
FT                   /function="4.2.A.3 : The Amino Acid-Polyamine-Choline (APC)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99528"
FT                   /db_xref="GOA:B0VNF8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99528.1"
FT                   /translation="MTTARHSDTENSPDHLQRKLSNRHLQLIAIGGAIGTGLFMGSGKT
FT                   ISLAGPSILFIYMIIGGMFFFLMRAMGELLLANLHYKSFVDMAHDLIGPWAGYYLGWTY
FT                   WLGWALVGIADLSAVINYLSFWLPDGASFSPIQQAMISAGCVLFVMGLNLLTVRLFGEI
FT                   EFWFALIKILAIIGLIGVGGYYMIFSHFQAPQGAVASISNVWSHGGLFPKGTEGFLAGF
FT                   QIAVFAFVGVELVGTTAAETKDPQKNLPKAINAIPVRIILFYVLALFIVMSVTPWDHIR
FT                   ADKSPFVELFLNAGIPISAIIMNLVVLSSVMSSMNSGVFSTSRMLFGLSKDGQAPSVLG
FT                   RLSKRAVPSNGLIFSCIFIMGGAVLQYFVPNTMEAFTLASSLCVILFISVWILIMACYL
FT                   RYRKIRPELHAASTFKMPGGVLMAYAVIAFFLFTLVILAPDTLKALYVSPVWLVVLSVT
FT                   YYVFYKPRMRKLGQEIF"
FT   gene            complement(121093..121974)
FT                   /locus_tag="ABSDF0120"
FT   CDS_pept        complement(121093..121974)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0120"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99529"
FT                   /db_xref="GOA:B0VNF9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99529.1"
FT                   /translation="MKVDWDHLQFFLVLARTKTLTNAARIIGVEHSTVARRIQALELAL
FT                   GTTLFKREATGYELTLEGMALVPRVEQMEQAFLQIEKPHQPLQGRVRIGTPEGFGTAFL
FT                   ARLLAEFSIQYPLLTIDLIPVPKMIKLSHREADIVVSIERPTSGPYIITRLSDYCLKVY
FT                   GSQNYLAQNPPIRRLEDLTQHRFVNYIDDLVYSPELYCLERLPLKLNANFRSSSILAQQ
FT                   IAVSAGAGLAILPKFLADDKPELEEVLEQQVRFTHTFWMLTFVDLQHEPRIKLVWDYLR
FT                   KQADKYQHLLVD"
FT   gene            122122..123657
FT                   /gene="mmsA"
FT                   /locus_tag="ABSDF0121"
FT   CDS_pept        122122..123657
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="ABSDF0121"
FT                   /product="methylmalonate-semialdehyde dehydrogenase,
FT                   oxidoreductase protein"
FT                   /EC_number="1.2.1.27"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99530"
FT                   /db_xref="GOA:B0VNG0"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99530.1"
FT                   /translation="MTYGEVMNTIQKIELDTAKLLINGQFLESKTQEWQDIVNPATQEV
FT                   IGCVPFATVEEVDAAIQAAQDAFASWRQTPIQARMRIMLKLQDLIRANMKEIAQVLTAE
FT                   QGKTLADAEGDIQRGLEVVEHACSVGTLQMGEYVEGVARGVDTYTLQQPLGVCAGITPF
FT                   NFPAMIPLWMFPMAIVCGNTFVLKPSEQDPLSTMMLVELAIQAGIPAGVLNVVHGGKEV
FT                   VDRLCTHKDIKAISFVGSTAVGTHVYNLAGQHGKRVQAMMGAKNHVVVMPDANKEQTLN
FT                   ALVGAAFGAAGQRCMALSVAVMVGDSKQWIQELVEKAKILKVNAGHEPNTDIGPVISKR
FT                   AKARVIDLINSGVEQGAELLLDGRNVQVQGYESGNFVGATIFSGVNTDMRIYKEEIFGP
FT                   VLSIICVDTLDEAIALINANPFGNGVGLFTQSGAIARTFQNLIDIGQVGINIPIPVPVP
FT                   FFSFTGSRGSKLGDLGPYGKQAVQFYTQTKTITSRWFEDSHEVGGVNTTISLR"
FT   gene            123669..124559
FT                   /gene="mmsB"
FT                   /locus_tag="ABSDF0122"
FT   CDS_pept        123669..124559
FT                   /transl_table=11
FT                   /gene="mmsB"
FT                   /locus_tag="ABSDF0122"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99531"
FT                   /db_xref="GOA:B0VNG1"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99531.1"
FT                   /translation="MNIAFIGLGNMGGRMAQNLLKAGLKVYGYDLSEVAIQHFAEAGGV
FT                   VCDSPQDAAKQADVVITMLPAAKHVKEVYLGENGVLEVLKAGSLCIDSSTIDPQTIKDI
FT                   AAVAHSKNIKICDAPVSGGTIGAQAGTLTFMVGADEQTFNEVKPVLSHMGKNIVHCGDV
FT                   GAGQIAKICNNLILGISMAAVAEGMALGVKLGIDPQALAGVINTSSGRCWSSDVCNPWP
FT                   HINENAPASRGYQDGFATQLMLKDLGLAVEAAGQVKQPVLLGGMVQQLYQQMCMRGNAH
FT                   LDFSSIIQQYLPQEA"
FT   gene            124641..126290
FT                   /locus_tag="ABSDF0123"
FT   CDS_pept        124641..126290
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0123"
FT                   /product="putative acetyl-coA synthetase/AMP-(fatty) acid
FT                   ligase"
FT                   /EC_number="6.2.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99532"
FT                   /db_xref="GOA:B0VNG2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99532.1"
FT                   /translation="MMDYQNAVQAFDLESTAKQMLSGSLDALNACYECCDRHADGDKIA
FT                   LYWQGKDGRKEQYTFRELKEWSSQFANFLKSQGVKAGDRISGLLPRTPELIVTILAAWR
FT                   IGAVYQPLFTAFGPKAIEHRIQLAQSKLVVTDMGNRSKLDEIEKCPAIMTVADAQGTPL
FT                   KAGDFNFWNEVKQQSDQCDLVMRSIQDPFLLMFTSGTTGPAKPLEVPLKALIAFGRYMQ
FT                   DAIGLTEEDSFWNIADPGWAYGLYYAITGPLFLGHATLFYEGGFSIDSLCQIVKDYKVN
FT                   NLAGAPTAYRMMMAADPAQMAPLKGQFRVVSSAGEPLNPEVIRWFKQVLDAPIYDHYGQ
FT                   TEVGMVVCNHHGLKHEIHAGSAGFPSPGYRVAIVNEQGEELPPDTPGILAVDISQSPMM
FT                   WFGGYKESRKSPFIGHYYLTGDTAELHADGSMSFVGRSDDVITTSGYRIGPFDVESALL
FT                   EHDAVIEAAVIGVPDPDRTEVVKAFVILAAGIQPSDALAEELSQFVKRRLSAHAYPRLV
FT                   EFVSELPKTPSGKIQRFLLRNQEIAKQQAKAG"
FT   gene            126302..127429
FT                   /locus_tag="ABSDF0124"
FT   CDS_pept        126302..127429
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0124"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99533"
FT                   /db_xref="GOA:B0VNG3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99533.1"
FT                   /translation="MQFTEEQLLIRDMAKSFAQEQIKPNASDWDRDGTFPKETLTQMGQ
FT                   LGFMGMLVSEEWGGSDTGNLAYVLALEEVAAADGATSTIMSVHNSVGCVPILKFGTDEQ
FT                   KERFLKPLAQGEMIGAFALTEPHTGSDAAAIKTRAVKDGDDYILNGAKQFITSGNNAGV
FT                   IIVFAVTDPSAGKKGISAFLVPRETPGYEVIRVEEKLGLHASDTCQIALTDVRIHKSLM
FT                   LGKEGEGLKIALANLEGGRIGIAAQAVGLARAALEEATRYAKERITFGKPIFEHQTIAF
FT                   RLASMATEIEAARQLVHYAARFKEVGQPCLNEASMAKLFASEMTERVCSSALQVFGGYG
FT                   YLRDFPIERIYRDARICQIYEGTSDIQRLVIARSL"
FT   gene            127451..127741
FT                   /pseudo
FT                   /locus_tag="ABSDF0125"
FT   CDS_pept        127451..127741
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0125"
FT                   /product="fragment of putative enoyl-CoA
FT                   hydratase/isomerase (part 1)"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99534.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            127750..128223
FT                   /pseudo
FT                   /locus_tag="ABSDF0126"
FT   CDS_pept        127750..128223
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0126"
FT                   /product="fragment of putative enoyl-CoA
FT                   hydratase/isomerase (part 2)"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99535.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            128236..129261
FT                   /locus_tag="ABSDF0127"
FT   CDS_pept        128236..129261
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0127"
FT                   /product="putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99536"
FT                   /db_xref="GOA:B0VNG6"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99536.1"
FT                   /translation="MNTENHLMIERQGKLGVITLDRVTHLNALSLDMIEGIGAQLELWR
FT                   NDAAVQAILIKSNSPKAFCAGGDIRYLYDSYKNGTADYKGYFSAEYKMLNTLREYEKPI
FT                   IVVLDGYVLGGGFGLAQACHIVVSSEKSRFAMPETAIGFFPDVGATHFLSRLDDIGVYM
FT                   AITGEQISSSDALYLDLIDYHVPSEQLQALQDALVEAPSLSKEGIEHIITRFITRPAES
FT                   ELKQLAEGIRKHFGFQHLDEIEQSLENEQDESLKTWASKMLSILQQRSFIAKQTSLKLQ
FT                   HLGRGLSLQQCMQLERDLQDIWFEHGDFIEGVRALIVDKDKQPRWQERNPELEQILEKL
FT                   S"
FT   gene            129381..130733
FT                   /locus_tag="ABSDF0129"
FT   CDS_pept        129381..130733
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0129"
FT                   /product="putative transport protein (MFS family)"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99537"
FT                   /db_xref="GOA:B0VNG7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99537.1"
FT                   /translation="MQTIHGNRSHPKKSSHRLAGISSMVGTTIEWYDFFVYGAAAALIF
FT                   NKLFFPNLDPLTGVLAAFATYAVGFIGRPLGGLVFGHFGDKIGRKSMLLLTLMLMGIPT
FT                   VLIGLLPTYESIGYWAAIGLVILRFIQGMAMGGEWGGAVLMAVEHAPEGGKGFWGSLPQ
FT                   ASTGGGLMLASIALGLVSLLPEQALFSWGWRLPFLASIILLAVGWYIRVKVPESPDFEK
FT                   VKQQSEEVKVPAFQVLKNHPKQLITIILARAAENAWFYIASTFTLAYTTTQLGIPRQDI
FT                   LFATICGAAVILFMTPLCGHLSDKVGQRNMFMFGLCVLALYSYPFFSMLNTKDPVLVWT
FT                   AIVLAIGVVFPIMYAPQAQLFARQFPAEIRYSGISISVQLAGVLGGGLAPMIATKLLSI
FT                   GQGNPYLIMYYIGSMAVVAIISTSFMPRDWSYEKDETYYKKANLNLKTKID"
FT   gene            complement(130826..131287)
FT                   /pseudo
FT                   /locus_tag="ABSDF0130"
FT   CDS_pept        complement(130826..131287)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0130"
FT                   /product="fragment of N-acylhomoserine lactone synthase,
FT                   autoinducer synthesis protein"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99538.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            131385..132197
FT                   /locus_tag="ABSDF0131"
FT   CDS_pept        131385..132197
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0131"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99539"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99539.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTVCRRQKHID
FT                   IAISYQQNRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            132355..132741
FT                   /pseudo
FT                   /locus_tag="ABSDF0132"
FT   CDS_pept        132355..132741
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0132"
FT                   /product="fragment of putative 4'-phosphopantetheinyl
FT                   transferase (partial)"
FT                   /function="1.6 : Macromolecules (cellular constituent)
FT                   biosynthesis"
FT                   /EC_number="2.7.8.-"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99540.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(132836..132911)
FT                   /locus_tag="ABSDF_tRNA64"
FT   tRNA            complement(132836..132911)
FT                   /locus_tag="ABSDF_tRNA64"
FT                   /product="tRNA-Gly"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(132957..133032)
FT                   /locus_tag="ABSDF_tRNA63"
FT   tRNA            complement(132957..133032)
FT                   /locus_tag="ABSDF_tRNA63"
FT                   /product="tRNA-Gly"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            133263..133571
FT                   /locus_tag="ABSDF0134"
FT   CDS_pept        133263..133571
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0134"
FT                   /product="putative activator of morphogenic pathway (BolA)
FT                   , important in general stress response"
FT                   /function="3.1.4 : regulation level unknown"
FT                   /function="5.1 : cell division"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99541"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99541.1"
FT                   /translation="MSLEQQLIERLQTLAPSHLEVINESAGHGGYFPGKESHFKVIVVS
FT                   EEFNGLRLVQRHQKVYALASDLMNPGQIHALAIHAYLPSEWQGQAPASPECAHAPKS"
FT   gene            133583..133975
FT                   /locus_tag="ABSDF0135"
FT   CDS_pept        133583..133975
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0135"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99542"
FT                   /db_xref="GOA:B0VNH2"
FT                   /db_xref="InterPro:IPR007360"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99542.1"
FT                   /translation="MDAHLLTKIIHMTAVAAALMVFVLRASTLFIGVQGEQPNPAGRKA
FT                   LVALQHLSFTVVFITGAILLVMKNFQVQPWFYAKIILFLVLLSSLMKAFKKDDTILLAQ
FT                   RRAGLVISAIAFVAIIILVIVKPVFA"
FT   gene            134052..134894
FT                   /locus_tag="ABSDF0136"
FT   CDS_pept        134052..134894
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0136"
FT                   /product="putative ATPase involved in chromosome
FT                   partitioning (ParA family ATPase)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99543"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99543.1"
FT                   /translation="MLTRVVFNQKGGVGKSSITVNLAAISAKHGLRTLVIDLDPQANSS
FT                   QYLLGEEATYAADKAVLEPNIENFFEDVLGNNQQKGLIGNALGSILKAPRNKDLDSFVH
FT                   STSFAKLDVLPASPTLGALEHALESKHKIYKLRDSIQSLVGRYDRIYIDTPPAFNFFTL
FT                   SALIAADKVLIPFDCDVFSKRALQTLIENVLETQDDHNDRLEIEGIVVNQFQPQAKLPR
FT                   EVVQQLKDEGLPVLNSMLPPSILMKESHQKNLPLAHLAPEHKLTQSYEALFSEIEPKR"
FT   gene            134878..135291
FT                   /locus_tag="ABSDF0137"
FT   CDS_pept        134878..135291
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0137"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99544"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99544.1"
FT                   /translation="MNQNDKRKMMKGLYIVPLAAATLLLGACATTVKPTYVSPTQYQSL
FT                   SCQQLQSEYNRIQQYIDNGVQTPKSTGMGVGLGLGGGWGRGGWGFGPSISVNMGQSSST
FT                   KNTELSRVLGQQEAIVQAAQFKNCPIIVRKKTN"
FT   gene            135507..136097
FT                   /locus_tag="ABSDF0138"
FT   CDS_pept        135507..136097
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0138"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99545"
FT                   /db_xref="GOA:B0VNH5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99545.1"
FT                   /translation="MIESWFFVLAMLAVLLIPGPTNALLATAAHSQGLSKTFWLIPMEW
FT                   LGYAYGISFWAVFIHLADPVWPALLLILHITSVLYVFWMAFRLWKTTHLQQFSQNHRNI
FT                   RPRQLFFSTLKNPKSLLFAAGIFPAETWNSPENFLMVLAAFTLILIPAASFWIFFGRAL
FT                   LTGSMKKIKADHLYKGSAMLLILCMLPVVFRFF"
FT   gene            complement(136105..136746)
FT                   /locus_tag="ABSDF0139"
FT   CDS_pept        complement(136105..136746)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0139"
FT                   /product="putative integral membrane protein (DedA)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99546"
FT                   /db_xref="GOA:B0VNH6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99546.1"
FT                   /translation="MELLDFILHVDQHLAEFITNYGTWIYGILFLIIFVETGLVVMPFL
FT                   PGDSLLFAAGALAASTGTMDPWLLGILLFIAAVLGDTVNYHIGRFIGPRVFEMNSRFIN
FT                   KQHLIKTHEFFARHGGKTIIFARFIPFARAFAPFVAGAGSMNYKFFLTYNVIGAFCWVA
FT                   SFVTLGYLFGGHPLVKDNFTHLIFGIIIISILPGVIGFIRQKLKNRKANV"
FT   gene            136958..137665
FT                   /pseudo
FT                   /locus_tag="ABSDF0140"
FT   CDS_pept        136958..137665
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0140"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99547.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            137697..137861
FT                   /pseudo
FT                   /locus_tag="ABSDF0141"
FT   CDS_pept        137697..137861
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0141"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99548.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            137945..138382
FT                   /locus_tag="ABSDF0142"
FT   CDS_pept        137945..138382
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0142"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99549"
FT                   /db_xref="GOA:B0VNH9"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99549.1"
FT                   /translation="MFNPNVVVKNIVTQPGADSFISLVARLLIAYIFLAAGWGKITGYA
FT                   ATAGYMEAMGVPGGLLPLVILVEFGGGLALLFGFQARFAAFGLGIFSILTAFLFHQGGA
FT                   DAAAQYNNGIHFMKNLAMAGGLFFLMLHGAGRISLDHAIEK"
FT   gene            complement(138442..139671)
FT                   /locus_tag="ABSDF0143"
FT   CDS_pept        complement(138442..139671)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0143"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99550"
FT                   /db_xref="GOA:B0VNI0"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99550.1"
FT                   /translation="MLQTMIADFQQHFWLYVSIPFMSGLIGYVTKVIAIQMMFSPLEFK
FT                   GIKPFFGWQGIVPRKAEKMATTAVELMTAKLIKPEEIFARLDPKRIAKEIEKPLMAAAE
FT                   DITREVAQEYQPGLWEGMPEFARQRLIRRVQSKAPEIVEHIMSEVQRDVNRYFDIKHLV
FT                   ISNLLKDKRLLNNIFKRVGKQEFKFFSNVGFVFGFGIGVIQMLCWIVTQGKYPWMLPLF
FT                   GGFVGFFSDWIALQMMFRPLYPKKILGYTWQGLFIKRQNEVAADYAALISKQLLTSRHM
FT                   MEELFSGTHSARVIELVNRHVKQEIDMQAGVIRPLVVYAIGGEKYQNMKTQVAERIMQQ
FT                   LPETMKYVESYAEDAMNIRNTLIERMQKLTPSEFEGMLRPAFKEDEWALIAVGAVLGFV
FT                   VGELQIQFML"
FT   gene            140047..141615
FT                   /gene="guaA"
FT                   /locus_tag="ABSDF0144"
FT   CDS_pept        140047..141615
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="ABSDF0144"
FT                   /product="GMP synthetase (glutamine aminotransferase)"
FT                   /function="1.5.2.1 : purine biosynthesis"
FT                   /function="1.7.33 : nucleotide and nucleoside conversions"
FT                   /EC_number="6.3.5.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99551"
FT                   /db_xref="GOA:B0VNI1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99551.1"
FT                   /translation="MTTNTQITEDRILILDFGSQYSQLIARRVREAGVYSEMYAFDMSE
FT                   EDIRAFKPNGIILSGGPESVHEEGSPRAPQVVFELGVPVLGICYGLQTMSEQLGGKVEL
FT                   GTVHEFGYAEVDIVKRDQLIGNLQDRENQLHVWMSHGDKVSQIPEGFTITASTPSCPVA
FT                   AVSDETRRFYGVQFHPEVTHTAKGEELLSNFVHKICGCGGLWTPEHIIDLRVEQLREQI
FT                   GNEKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLNEGDQVMQMFAENMGIR
FT                   VIRADAEARFLNALAGVTDPEAKRKIIGREFIEVFAEEARKLDGVKFLAQGTIYPDVIE
FT                   SAASKQGKAHVIKSHHNVGGLPDDLAFELVEPLRDLFKDEVRKLGTTLGLPHSMIYRHP
FT                   FPGPGLGVRILGEVKKEYADILRLADDIFMQELRDSGWYGKTAQAFAVFQPVKSVGVVG
FT                   DGRRYAWVIALRAVETVDFMTARFAHLPYELVDKISTRIMNEIKDVSRVVYDVSSKPPA
FT                   TIEWE"
FT   gene            141681..142469
FT                   /locus_tag="ABSDF0145"
FT   CDS_pept        141681..142469
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0145"
FT                   /product="Streptomycin 3''-adenylyltransferase (AADA-like)"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /EC_number="2.7.7.47"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99552"
FT                   /db_xref="GOA:B0VNI2"
FT                   /db_xref="InterPro:IPR025184"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99552.1"
FT                   /translation="MSDFIQLEYLQEKLQQLLAESLFAIYLYGSAVDGGLGPESDLDVL
FT                   VVVTQPLTSALREQLAQELLKISQPVGELQRPLEVTILLKDEIQSGNYPLSYEMQFGEW
FT                   LREELKEGGTLSSQKDPDISILLRKARFHHTVLFGPALDQWAPEISDQELWQAMSDTYP
FT                   EIVAHWDEDADERNQILALCRIYFSLVMKDIASKDNAARWVMPQLPPEQKFVLQRLIQE
FT                   YRGEIGKQNWQEEHYALQPIVNFLSSKIEEQFEQKRNLIT"
FT   gene            142693..143220
FT                   /locus_tag="ABSDF0146"
FT   CDS_pept        142693..143220
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0146"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99553"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99553.1"
FT                   /translation="MRQQSEHHYAEHNDHHHGHHRSGRRGRLFEAGRMKLLVLHLIQQS
FT                   PKHGYEIIKEISDLVGDGYTPSAGTIYPTLTSLEEMNLINLLDVERKQYQITEFGEAYL
FT                   NEHQDKLSGLLEKLRLRREIHSNDQLIEIHRAMENLKTALRLKLNTTDLKQEQIYQIAE
FT                   KIDQAAVAIGRL"
FT   gene            143281..143586
FT                   /locus_tag="ABSDF0147"
FT   CDS_pept        143281..143586
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99554"
FT                   /db_xref="InterPro:IPR024476"
FT                   /db_xref="InterPro:IPR038194"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99554.1"
FT                   /translation="MKQHQYHVTVQHLKDAKGEVSTYTERLEFYTGNHDDIFEIVEKLK
FT                   NAEFFDDQTTKSFAVGLKLFSEVMLENRDHPLFQEFLPQFGQFMKNLKQQVKTQSP"
FT   gene            143743..144690
FT                   /locus_tag="ABSDF0148"
FT   CDS_pept        143743..144690
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99555"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99555.1"
FT                   /translation="MSNNNDYDISDSKDCEKFANQFIQEFPIRSAEIGQGTVIKRALPS
FT                   RQKRMIGAWCFLDHAGPVTFPAGNGLDVGPHPHIGLQTFTWMIEGTMMHTDSLGSKQLI
FT                   RPKQVNLMTAGHGISHTEVAPDTETQMHAAQLWIALPDHKRNMDPKFEHYPDLPVVEKD
FT                   GLEFTVLVGEYLETTSPVVVHTPLVGVDLIATQDTKTRIPLNPEFEYGFMALDGVAHVN
FT                   GHELTADNMVVLDTGLNEIEIEVKKGNRVLLIGGEPFETPILLWWNFVARTMDDLKEAR
FT                   EQWVNHDMRFGEIPDYVGARLEAPVLPDQMRASK"
FT   gene            144687..145094
FT                   /locus_tag="ABSDF0149"
FT   CDS_pept        144687..145094
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99556"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99556.1"
FT                   /translation="MTAVIASSKAKPLAEQWKGEITSGRHQYFCDEPEKLEGHDQGPAP
FT                   YDLLTGSLAACTLITLRMYAKHKGYDFGEYSVEIDFHTNREHEEHIERRIVFKELPNEE
FT                   LQQKILTICSKTPVTKTLLRSLDIHTVLVTA"
FT   gene            145207..145668
FT                   /pseudo
FT                   /locus_tag="ABSDF0150"
FT   CDS_pept        145207..145668
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0150"
FT                   /product="fragment of glutathione S-transferase (part 1)"
FT                   /function="1.7.1 : unassigned reversible reactions"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99557.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            145745..146650
FT                   /locus_tag="ABSDF0151"
FT   CDS_pept        145745..146650
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0151"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99558"
FT                   /db_xref="GOA:B0VKE4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99558.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLKKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            146680..146883
FT                   /pseudo
FT                   /locus_tag="ABSDF0152"
FT   CDS_pept        146680..146883
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0152"
FT                   /product="fragment of glutathione S-transferase (part 2)"
FT                   /function="1.7.1 : unassigned reversible reactions"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99559.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(146927..147562)
FT                   /locus_tag="ABSDF0153"
FT   CDS_pept        complement(146927..147562)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0153"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99560"
FT                   /db_xref="GOA:B0VNJ0"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99560.1"
FT                   /translation="MFGKTQRGVSERPNKPKKPLIPKWLGTLVAILAVLCIAVMLMLWK
FT                   PWQPVSSKNQITSEHYKEEETNKDYRFYDLLPQQQVTPIPEQAIPESKNQGTAMIVEAP
FT                   STASTAQPAASEPASVSTDDTTDSTAAIPQQPNYILQVRSYTDPDQADARRAEIILNGL
FT                   SADVIKSSENGKTWYRVISGPYDTQEAALAAQQTLQHSGIDSIVIKRR"
FT   gene            complement(147716..149506)
FT                   /gene="argS"
FT                   /locus_tag="ABSDF0155"
FT   CDS_pept        complement(147716..149506)
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="ABSDF0155"
FT                   /product="arginyl-tRNA synthetase"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99561"
FT                   /db_xref="GOA:B0VNJ1"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99561.1"
FT                   /translation="MNTAIQAALDHAVQTLQQEGVLPSDWNNSSNLTRTKDRSHGDFAS
FT                   NIAMIGSKAAGMKPRDLAEKILAALPEVADISKAEIAGPGFINFFLNADQRFAILDQIQ
FT                   AQKESFGRSQSNVAKKIQVEFVSANPTSSLHVGHGRGAAYGMTVANLLEATGAKVDREY
FT                   YVNDAGRQMDILATSTYLRYLELLGQNLVFPKNAYQGDYVKEIAQGIIDKDGDAYVREV
FT                   ANVYKDVPEDVQYAEELDSEGNKVVLSGDKEKHIDGLIANSQQLLGEGYRVFHQAALHA
FT                   ILDDIKDDLADFGVTFNQWFSEASLSAKIDEALETLDQRGFLYEKDGNIWFKSTEFGDE
FT                   KDRVVKRRNGQTTYFASDIAYHLNKLQRGYTDLVDIWGSDHHGYISRVKAAIDAMGYDS
FT                   KKLTVLLVQFVSLWRGGEMVQMSSRSGQFVTLRDLRKEVGNDAARFYYVMRKSEQHIDF
FT                   DLDLAVSQSKDNAVYYIQYAHARICRMLEKAASTGLQFEVSAARSHAARLSLDAETEIL
FT                   AKLAAYPDVVLRAANAYEPHQVGNYLKELAALFHGWYNEHKVLSDDAELTQARLLLSIN
FT                   VQQVLRNGLELLGVSAPEAM"
FT   gene            149835..150647
FT                   /locus_tag="ABSDF0156"
FT   CDS_pept        149835..150647
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0156"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99562"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99562.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKRID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            complement(150837..151667)
FT                   /gene="znuB"
FT                   /locus_tag="ABSDF0157"
FT   CDS_pept        complement(150837..151667)
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="ABSDF0157"
FT                   /product="high affinity Zn transport protein (ABC
FT                   superfamily, membrane)"
FT                   /function="4.3.A.1.m : ABC superfamily, membrane component"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99563"
FT                   /db_xref="GOA:B0VNJ3"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99563.1"
FT                   /translation="MMEWLQLLLPAWIMGTLLVFLTAPLGCFMLWRRMSFFADTMAHGT
FT                   LLGVAIAGALSLPLWLGVAGTAILLVAILWALHDNRLPNDALLALCSATLLCSGLLFIQ
FT                   HVPSLRPELLSYLFGDLLSIDWPDLPVFTLIIAVSLAILYRFWQPQIQIAIDPDIAISE
FT                   GVNAKWQRLIFMLLLALFTVLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIWAFVL
FT                   AQLGVSVGLWSSAALNISTGLSIVLCMALSFALIFMVQKIKLKRPKSGCLMDRT"
FT   gene            complement(151671..152459)
FT                   /gene="znuC"
FT                   /locus_tag="ABSDF0158"
FT   CDS_pept        complement(151671..152459)
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="ABSDF0158"
FT                   /product="high affinity Zn transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /function="1.5.3.12 : heme, porphyrine"
FT                   /function="4.3.A.1.a : ABC superfamily ATP binding
FT                   cytoplasmic component"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99564"
FT                   /db_xref="GOA:B0VNJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99564.1"
FT                   /translation="MPAVPHSSLNPVLIQLEQVSVHRDQRDILKKVDFALHENEIVTLI
FT                   GPNGAGKSTLIKVLLGILKPSSGRVISNKKLKMAYVPQKFNPSHSLPLRVQDLLDLEKC
FT                   SPALRQEIIQDTGIAKLQQSKVQQLSGGERQRVLLARALLRKPDILVLDEPMQGLDIQS
FT                   EAELYEYVRSLPERYGCAILIVSHDLQWVMQGTQRVVCLNKHICCSGLPESIQQHPEYQ
FT                   AIFGTHRVFYQHHHDHCAHGDAAHPCPHNNRPHIHPEPEA"
FT   gene            complement(152432..152929)
FT                   /gene="zur"
FT                   /locus_tag="ABSDF0159"
FT   CDS_pept        complement(152432..152929)
FT                   /transl_table=11
FT                   /gene="zur"
FT                   /locus_tag="ABSDF0159"
FT                   /product="transcriptional repressor of Zn transport system
FT                   (Fur family)"
FT                   /function="2.2.2 : transcription related"
FT                   /function="3.1.1 : DNA structure level"
FT                   /function="3.1.2.3 : repressor"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99565"
FT                   /db_xref="GOA:B0VNJ5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99565.1"
FT                   /translation="MSSCMHEHHDSLHGVHDHHNVASRLAEAETLCTAVGARLTPLRKE
FT                   VLELILNASGPMGAYDLLARIKSQTDRPAAPPTVYRTLDFLLEKGLIHRLTSINAYIPC
FT                   CHPREGHQAAFLICTECHTVKEASSQGLTQQLDQLAALDDFAAQHSIIEISGKCQQCRT
FT                   AR"
FT   gene            153057..153896
FT                   /gene="znuA"
FT                   /locus_tag="ABSDF0160"
FT   CDS_pept        153057..153896
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="ABSDF0160"
FT                   /product="high affinity Zn transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /function="4.3.A.1.p : ABC superfamily, periplasmic binding
FT                   component"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99566"
FT                   /db_xref="GOA:B0VNJ6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99566.1"
FT                   /translation="MFRVFVFSMFSLMSTLGWSQGLVVSTHPIYLIAKEITKGVEEPQL
FT                   LLQGQSGHDVQLTPAHRKAINDASLVIWLGKAHEAPLNKLLSNNKKAIALLDSGILSIL
FT                   PQRNTRGAALPNTVDTHVWLEPNNAVRIGFFIAALRSQQHPENKAKYWNNANTFARNML
FT                   QAAQAYDSSSNGKPYWSYHDAYQYLERSLNLKFAGALTDDPHVAPTAAQIKYLNDSRPK
FT                   AQMCLLAESFTTKGQYQKLGSITFQPVDESMNNEDNFVTAWKKLAIKTDKCVLNTQK"
FT   gene            154065..154463
FT                   /gene="atpI"
FT                   /locus_tag="ABSDF0161"
FT   CDS_pept        154065..154463
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="ABSDF0161"
FT                   /product="ATP synthase protein I"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99567"
FT                   /db_xref="GOA:B0VNJ7"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99567.1"
FT                   /translation="MSQTSRLIDRRLAKALVFLQACMIPVSALVAWSIKDMTAALSAAL
FT                   GALVCWLATSYFAWQSFRTAGARASKQVLSNMYRGTLGKFAIMIVGFILILSNVKPLSP
FT                   LALLFGFILVQAMSWVAPFWVSRLQKRV"
FT   gene            154568..155443
FT                   /gene="atpB"
FT                   /locus_tag="ABSDF0163"
FT   CDS_pept        154568..155443
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="ABSDF0163"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   a, important for FO assembly"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="2.3.4 : chaperoning, folding"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99568"
FT                   /db_xref="GOA:B0VNJ8"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99568.1"
FT                   /translation="MAAEEHALTSPEYIKHHLTNMTYGKMPDGTWKLAETAEEAHSMGF
FT                   TAIHLDSMGWSIGLGVIFCLLFWIVARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHGK
FT                   SRLIAPLALTIFVWIFLMNLMDLIPVDWIPQVAAFVGANAFGMDPHHVYFKIVPSTDPN
FT                   ITLGMSLSVFVLILFYSIREKGVGGFVGELALNPFNPSNPVAKALLIPVNLILELVTFL
FT                   ARPISLALRLFGNMYAGELIFILIALLPFWIQWALSVPWAIFHILVITLQAFIFMMLTI
FT                   VYLSMASEKH"
FT   gene            155528..155773
FT                   /gene="atpE"
FT                   /locus_tag="ABSDF0165"
FT   CDS_pept        155528..155773
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="ABSDF0165"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   c"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99569"
FT                   /db_xref="GOA:B0VNJ9"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99569.1"
FT                   /translation="MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELA
FT                   PQLQTRMFLIAGLLDAVPMIGVGIGLFFIFANPFVG"
FT   gene            155812..156282
FT                   /gene="atpF"
FT                   /locus_tag="ABSDF0166"
FT   CDS_pept        155812..156282
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="ABSDF0166"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   b"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99570"
FT                   /db_xref="GOA:B0VNK0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99570.1"
FT                   /translation="MNINLTLIGQAIAFAFFVAFCMKFVWPPLINAISERQRKIADGLN
FT                   AAEKAKADLADAQAQVKQELDAAKAQAAQLIEQANRRAAQLIEEARTQAAAEGERIRQQ
FT                   AKEAVDQEINSAREELRQQVAALVVTGAEKILNQQVDAEAHNAMLSQLAAKL"
FT   gene            156295..156831
FT                   /gene="atpH"
FT                   /locus_tag="ABSDF0167"
FT   CDS_pept        156295..156831
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="ABSDF0167"
FT                   /product="membrane-bound ATP synthase , F1 sector,
FT                   delta-subunit"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99571"
FT                   /db_xref="GOA:B0VNK1"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99571.1"
FT                   /translation="MAELLTLARPYAKAAFAYASEQGATDNWSNALQVLSAAVQDEAFS
FT                   AYLNRPEHTPAEQVKLFAKVLGEDQSQAVSNFLTLLADNDRLVLLPEIAAEYEQLKSQN
FT                   NNNVDVVIESAFPLTAEQEQLLKSALEKRFNSTVTVSVEVKPELIAGVVIRAGDQVIDD
FT                   SALNKLEKMRTRLLA"
FT   gene            156863..158422
FT                   /gene="atpA"
FT                   /locus_tag="ABSDF0168"
FT   CDS_pept        156863..158422
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="ABSDF0168"
FT                   /product="membrane-bound ATP synthase , F1 sector,
FT                   alpha-subunit"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99572"
FT                   /db_xref="GOA:B0VNK2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99572.1"
FT                   /translation="MRNSAMQQLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIV
FT                   RIHGLADAMYGEMIEFDGGLFGMALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVP
FT                   VGPELLGRVVDALGNPIDGKGPIDAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMI
FT                   PVGRGQRELIIGDRQTGKTAMAIDAIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETG
FT                   AMAYTTVVAAAAADPAAMQYLAPYSGCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISL
FT                   LLRRPPGREAYPGDVFYLHSRLLERASRVSAEYVEKFTNGAVTGKTGSLTALPIIETQA
FT                   GDVSAFVPTNVISITDGQIFLETSLFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGI
FT                   RTALAQYRELAAFAQFASDLDEATRKQLEHGQRVTELMKQKQYAPYSIADQAVSVYASN
FT                   EGYMADVEVKKIVDFDAALIAYFRSEYAPLMKQIDETGDYDKDIEAAIKAGIESFKATQ
FT                   TY"
FT   gene            158500..159369
FT                   /gene="atpG"
FT                   /locus_tag="ABSDF0169"
FT   CDS_pept        158500..159369
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="ABSDF0169"
FT                   /product="membrane-bound ATP synthase , F1 sector,
FT                   gamma-subunit"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99573"
FT                   /db_xref="GOA:B0VNK3"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99573.1"
FT                   /translation="MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPY
FT                   ADNMRRVIAHLVQANPEYKHRYMVDRPVKRVGYIIVSSDRGLAGGLNINLFKKVVQHVK
FT                   AQQEQSIEVQFALIGQKAVSFFKNYGGKVLGATTQIGDAPSLEQLTGSVQVMLDAFDKG
FT                   ELDRIYLVSNGFVNAMTQKPKVEQLVPLAPAEEGDDLNRTYGWDYIYEPEAEELLNGLL
FT                   VRYIESMVYQGVIENVACEQSARMVAMKAATDNAGQLIKDLQLIYNKLRQAAITQEISE
FT                   IVGGAAAV"
FT   gene            159400..160794
FT                   /gene="atpD"
FT                   /locus_tag="ABSDF0170"
FT   CDS_pept        159400..160794
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="ABSDF0170"
FT                   /product="membrane-bound ATP synthase , F1 sector,
FT                   beta-subunit"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99574"
FT                   /db_xref="GOA:B0VNK4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99574.1"
FT                   /translation="MSSGRIIQIIGAVIDVEFERTSVPKIYDALQVDGTETTLEVQQQL
FT                   GDGVVRTIAMGSTEGLKRGLTVTSTNAPISVPVGTATLGRIMDVLGRPIDEAGPVATEE
FT                   RLPIHRQAPSYAEQAASTDLLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELIN
FT                   NIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTG
FT                   LTMAEYFRDEKDENGKGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMG
FT                   VLQERITSTKSGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASSGIYPAID
FT                   PLDSTSRQLDPLVVGQEHYEIARAVQNVLQRYKELKDIIAILGMDELAEEDKLVVYRAR
FT                   KIQRFFSQPFHVAEVFTGAPGKLVPLKETIRGFKGLLAGEYDHIPEQAFYMVGGIDEVI
FT                   AKAEKL"
FT   gene            160812..161231
FT                   /gene="atpC"
FT                   /locus_tag="ABSDF0171"
FT   CDS_pept        160812..161231
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="ABSDF0171"
FT                   /product="membrane-bound ATP synthase , F1 sector,
FT                   epsilon-subunit"
FT                   /function="1.3.8 : ATP proton motive force interconversion"
FT                   /function="4.3.A.2 : The H+/Na+-translocating F-, V- and
FT                   A-type ATPase (F-ATPase) Superfamily"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99575"
FT                   /db_xref="GOA:B0VNK5"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99575.1"
FT                   /translation="MATMQCDVVSVKESLYSGAVTMLIAKGAGGELGILPGHAPLVTLL
FT                   QLGPIRVLLENGTEEIVYVSGGVLEVQPHVVTVLADTAIRADNLDEAAILEARKNAEQL
FT                   LANQKSDLDSAAALAALAETAAQLETIRKIKNRAQ"
FT   gene            161595..162500
FT                   /locus_tag="ABSDF0173"
FT   CDS_pept        161595..162500
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0173"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99576"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99576.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(162508..162927)
FT                   /pseudo
FT                   /locus_tag="ABSDF0174"
FT   CDS_pept        complement(162508..162927)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0174"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   1)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99577.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(163045..163590)
FT                   /locus_tag="ABSDF0175"
FT   CDS_pept        complement(163045..163590)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0175"
FT                   /product="glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99578"
FT                   /db_xref="GOA:B0VNK8"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99578.1"
FT                   /translation="MTQSVYHIPVKTISGETVDLDQYKGKVLLIVNTASKCGLTPQYEG
FT                   LEKLYQAKKDQGLEILGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKISVAGEDK
FT                   HPLYQALTTAQPERIGEGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVIARFAPN
FT                   LTADDEQIVKAVEAELAK"
FT   gene            complement(163713..164477)
FT                   /locus_tag="ABSDF0176"
FT   CDS_pept        complement(163713..164477)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0176"
FT                   /product="putative transcriptional regulator (AraC family)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99579"
FT                   /db_xref="GOA:B0VNK9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99579.1"
FT                   /translation="MKNEDQQFSLLESIEVHEFLYEKEDIVRPHASLWGDFNFSLNGIL
FT                   EIQVEEQIYLSPPSYGLWIPPQTVHQSTHIDHEIHYICIRLHPRLCSILGDICRCFSIQ
FT                   PFFRTLVLQILEQQRQTEKPEYLEHLLQVLFDQLQQAPAYSHYLPQTRHPVLLPILEKL
FT                   SDPLLFNLSLQQLLQNFSVSDRHLLRLSQQELQLSLSEWRNRAKIVYAIHQIRQGTPIK
FT                   RLAYDLGYQHSSSFIEFFKRYTGQTPVQIRNN"
FT   gene            complement(164499..165713)
FT                   /locus_tag="ABSDF0177"
FT   CDS_pept        complement(164499..165713)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0177"
FT                   /product="putative transporter (MFS superfamily)"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99580"
FT                   /db_xref="GOA:B0VNL0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99580.1"
FT                   /translation="MDQSTTSKARPMTSTQGSWFAILAVAIVAFALVTSEFLPVGVLNS
FT                   VAADLHISVGTAGLIITVPGIMAAIAAPLLPVSVKQLDRRYVLILLTAIMVIANTITAF
FT                   AENFHVLLLSRLILGISIGGFWATAIALSGKLAPANLPIAKATAVVMAGVTFATVLGVP
FT                   IGTWLSEFYGWRSAFGITAAIGLVVLVLQLIFLPKLLPESAIHIRDLPALLRTPKARSG
FT                   MLIVLLIGLAHFCAYSYLAPFFKNVAGFNGTTISSLLLLYGIAGIFGNAFAGYSGNLNV
FT                   RYTLAFVGTCFAIVFFGFPIFAIHEFGAIVLTALWGFAFGAFPTSANIWMFVHAPHAVE
FT                   KGMPLFVGMFQVMIATGSLLGGYIVDHFNENTLIYGVLSFVALALISTFTLAKGLNNPK
FT                   ATCEN"
FT   gene            165850..166500
FT                   /locus_tag="ABSDF0178"
FT   CDS_pept        165850..166500
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0178"
FT                   /product="putative regulator (TetR/AcrR family)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99581"
FT                   /db_xref="GOA:B0VNL1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99581.1"
FT                   /translation="MIFMTNRHETDLVNEDTLKKKRGRPKCFDEQQVLEKAMLLFWEHG
FT                   YEATSISDLTHALEITAPSLYSAFGDKAGLFYKSIDYYLANEACPIETIFLEAKTAKIA
FT                   FELYLYDNVKRLVQPNKPAGCMLVVAAMNCSDATQEVQQNLLDKRIKTKEKLLKRLEQG
FT                   VEQGDLPTNAPLQEMTDFYATVIQGLTIQARDGASTEQLHKVVEHAMKAWTLF"
FT   gene            166606..167526
FT                   /locus_tag="ABSDF0179"
FT   CDS_pept        166606..167526
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0179"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99582"
FT                   /db_xref="GOA:B0VNL2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99582.1"
FT                   /translation="MSQVMKYHKWAFIFPILAVLIWSLNIVVTRYVSDYISPVSISFYR
FT                   WLIAFIILTPFMFLSVWRQRRLVIPYLPKLAVLSAFGMVLYQGLAYTAAHYTSATNMGI
FT                   VNAFIPIFTIFVSLAILKDVPNRFAVFGSVLSFAGLLYVMSQGNINKLLSGGGHLGDAL
FT                   MIIAVFFYAFYGVFLKKWQLPLPIMTSLYVQIGFSVLFHLPLIFWFGLDALNAQNAPSA
FT                   IYAGVFASLIAPLVWMLAVQQFGPNRTSIFMNLVPVFTAIIASIWLSEQWTIYHTFGGI
FT                   MILVGIIMAQKKVNSKKSDLLPEQN"
FT   gene            complement(167917..168486)
FT                   /locus_tag="ABSDF0180"
FT   CDS_pept        complement(167917..168486)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0180"
FT                   /product="putative ribosome maturation factor
FT                   (dsRNA-binding protein) (RimN)"
FT                   /function="2.3.2 : Translation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99583"
FT                   /db_xref="GOA:B0VNL3"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99583.1"
FT                   /translation="MITTSVTEAAECLQQGQVLAYPTEAVWGLGCDPFNEQAFQKILEL
FT                   KQRPIEKGVILLAGHISQVEHLLTSLPQTTQQEIIDCWTNHQPSERATTWLLPADQHIP
FT                   SWIKGEHPLVAVRVTTHPLCVALCNAFHGFIVSTSANPSGQEPAHSLQDACQYFGSQLN
FT                   YLNGDLGQSQQPSRIINALTGEVIRP"
FT   gene            complement(168537..168965)
FT                   /pseudo
FT                   /locus_tag="ABSDF0181"
FT   CDS_pept        complement(168537..168965)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0181"
FT                   /product="fragment of putative Rossmann-fold
FT                   nucleotide-binding protein involved in DNA uptake (Smf)
FT                   (part 3)"
FT                   /function="5.11 : DNA uptake"
FT                   /note="Evidence 7 : Gene remnant; Product type pf :
FT                   putative factor"
FT                   /db_xref="PSEUDO:CAO99584.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(168916..169128)
FT                   /pseudo
FT                   /locus_tag="ABSDF0182"
FT   CDS_pept        complement(168916..169128)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0182"
FT                   /product="fragment of putative Rossmann-fold
FT                   nucleotide-binding protein involved in DNA uptake (Smf)
FT                   (part 2)"
FT                   /function="5.11 : DNA uptake"
FT                   /note="Evidence 7 : Gene remnant; Product type pf :
FT                   putative factor"
FT                   /db_xref="PSEUDO:CAO99585.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(169294..169680)
FT                   /pseudo
FT                   /locus_tag="ABSDF0183"
FT   CDS_pept        complement(169294..169680)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0183"
FT                   /product="fragment of putative Rossmann-fold
FT                   nucleotide-binding protein involved in DNA uptake (Smf)
FT                   (part 1)"
FT                   /function="5.11 : DNA uptake"
FT                   /note="Evidence 7 : Gene remnant; Product type pf :
FT                   putative factor"
FT                   /db_xref="PSEUDO:CAO99586.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(169680..170834)
FT                   /locus_tag="ABSDF0184"
FT   CDS_pept        complement(169680..170834)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0184"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99587"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99587.1"
FT                   /translation="MKKVFDGMVNFHALGIKKHLLALALCTGVAIGTIAEVHATSPNHN
FT                   PPSLKSNAPNVYVVKRGDTLWDISGHFLNKPWRWPEIWASNQHVKNPHWIYPGDRLLLC
FT                   SLDGRPLVGKDEGDGCVGIIRRYTGQTTHLQPQVRVEALNNSVPVIPLKHIKQWLENST
FT                   ILPADSITNTPYVVGTADQRVLAGKGQTIYARGQGLINGQRYAVYREGEPYYFTDNKGK
FT                   KHSLGIELLQVASGVAVSSEKDITTLELTDSYNAEVRRGDRVMPEEQATLPTLFYPVDA
FT                   KQVTDDGKIIRVMGSIGRAAKNSVVTLDRGTTQGVQVGQVFDITQQGESIRDPKTKEVI
FT                   QLPGQQIGSLMVFRTFDQLSYAYVLESDLPIKVGSSIQPPQFND"
FT   gene            170957..171487
FT                   /gene="def"
FT                   /locus_tag="ABSDF0185"
FT   CDS_pept        170957..171487
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="ABSDF0185"
FT                   /product="peptide deformylase 1
FT                   (N-formylmethionylaminoacyl-tRNA deformylase, binds
FT                   Zn(II))"
FT                   /function="2.3.3 : posttranslational modification"
FT                   /EC_number="3.5.1.88"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99588"
FT                   /db_xref="GOA:B0VNL8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VNL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99588.1"
FT                   /translation="MALLPILSFPDPRLRTIAKPVEEVTDEIRQLAADMFETMYAAPGI
FT                   GLAASQVDRHIQLIVMDLSESKDEPMVFINPKVTPLTEETQPYEEGCLSVPQIYDKVDR
FT                   PSRVKIEAINLEGQAFEIEADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRVREKVEKI
FT                   VRQREREKVAVKR"
FT   gene            171524..171952
FT                   /locus_tag="ABSDF0186"
FT   CDS_pept        171524..171952
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0186"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99589"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99589.1"
FT                   /translation="MVFRSGLLLACAAVFLQIAVFLQPLLPKQYQIAPVCETITRALLK
FT                   PKAQTEAMSHAMHHTHHQHHIEQAQVPDHHDHHDANHQCQYCTVYANLVLPPEFGVKEV
FT                   LVRIQVRLVAYQQAFRHVYFALQRLFLLPQGRAPPLFA"
FT   gene            172025..174139
FT                   /locus_tag="ABSDF0187"
FT   CDS_pept        172025..174139
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0187"
FT                   /product="putative outer membrane copper receptor (OprC)"
FT                   /function="4.1.B.14 : The Outer Membrane Receptor (OMR)
FT                   Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99590"
FT                   /db_xref="GOA:B0VNM0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99590.1"
FT                   /translation="MPHSKFLVQPLWVAMLAVSHSGLVFAESEKNDAETNTLHSLAPIV
FT                   VTAQQGNDANGLIVHADPKQPIQPVPATDGADYLQSIMGFNSIQSGGTNGDVTFRGMFG
FT                   SRIKILTDGTENLGACPNRMDAPTSYISPESYDRISVIKGPQTVQYANTGSAATVLFER
FT                   QPEKLTSEKPYRGQASVLLGSYGRIDHNVEAAIGDEKKYIRLNANRSESNSYQDGDGNT
FT                   VPSAWKKWNADVALGFTPDENTWVEITGGKSDGESLYAGRSMDGSQFAHESLGLRFEKK
FT                   NITDVIKKIEGQVNYSYNDHIMDNFSLRTPPLVEMNHGGMTMLMPNAMAMQVTRRTLNS
FT                   RLAMTSEWNKWSLITGVDSQFNKHGGSMSSPTMPSMNVPYRQDMRFQSYGAFGELGYQW
FT                   NDQNKLVTGARLDRVTVEDERADSQAKGFNTKLEKNLPSAFVRWENQYPEHDFKSYIGL
FT                   GYVERMPDYWELFSPKHGNAGSTNTFNGVNPEKTLQLDLGFQQQHGALNTWASAYAGLV
FT                   DDYILMSYHHHPSMGMDGHDMSHDITAGAKNVDATIAGAEAGIGYQFTDRIQADLSAMY
FT                   AWGKNTTDDKPLPQISPLEGRLNIRYVADKYNLGLLWRAVAEQNRVSLHQGNIVGYDLK
FT                   PSKGFSTLSLNGSYNLRKDIDVSVGIDNVLDKTYTEHLNKAGSAGFGFASEEQFNNIGR
FT                   NYWVRMSMKF"
FT   gene            174193..174399
FT                   /pseudo
FT                   /locus_tag="ABSDF0188"
FT   CDS_pept        174193..174399
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0188"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99591.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(174469..175683)
FT                   /locus_tag="ABSDF0189"
FT   CDS_pept        complement(174469..175683)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99592"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="InterPro:IPR037473"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99592.1"
FT                   /translation="MQMISPTRLASFNDMQDSNFFTQFLNICCEKPVQPGYTEYLSLQH
FT                   ALYEGDIEMDKVIDWVMQNPKDHRIIFEKILFQGRDVLSELIPTELENFFNYIEQKPEW
FT                   LDQRQIDEAVKFTHRLGINNGFILRDLSLMAGYLYPGFNQPLILTGALKKEAGTRLAET
FT                   TKWWVDITEPQGLSRLSAGFTSTIYVRFIHALVRRQLKKSDRWDSEVWGIPLNQFDLAM
FT                   TNLAFSSVVLLGIRALGIWPTKQEAKSFLHFWRYVGWLMGIDEKWLIQSEPEGWKLLYW
FT                   MQFAHPRSDHSSIELGLSLSKEPFERKYLHLRFLQQKLAYRQHLELTQFFIGKKRMKLL
FT                   GLPQQSASWFAYYLIVRNLLLYNGAKLSPKVEKFLSKSGRNIQKLGLTLYQNQGKAKTL
FT                   ASMHQ"
FT   gene            175771..176130
FT                   /pseudo
FT                   /locus_tag="ABSDF0190"
FT   CDS_pept        175771..176130
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0190"
FT                   /product="fragment of putative transcription regulator
FT                   protein (TetR family) (part 1)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 7 : Gene remnant; Product type pr :
FT                   putative regulator"
FT                   /db_xref="PSEUDO:CAO99593.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(176116..177021)
FT                   /locus_tag="ABSDF0191"
FT   CDS_pept        complement(176116..177021)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0191"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99594"
FT                   /db_xref="GOA:B0VKE4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99594.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLKKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            177111..177374
FT                   /pseudo
FT                   /locus_tag="ABSDF0192"
FT   CDS_pept        177111..177374
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0192"
FT                   /product="fragment of putative transcription regulator
FT                   protein (TetR family) (part 2)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 7 : Gene remnant; Product type pr :
FT                   putative regulator"
FT                   /db_xref="PSEUDO:CAO99595.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            177876..179404
FT                   /locus_tag="ABSDF_16S_4"
FT   rRNA            177876..179404
FT                   /locus_tag="ABSDF_16S_4"
FT                   /product="ribosomal RNA 16S"
FT   gene            179465..179541
FT                   /locus_tag="ABSDF_tRNA3"
FT   tRNA            179465..179541
FT                   /locus_tag="ABSDF_tRNA3"
FT                   /product="tRNA-Ile"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            179597..179672
FT                   /locus_tag="ABSDF_tRNA4"
FT   tRNA            179597..179672
FT                   /locus_tag="ABSDF_tRNA4"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            180013..182914
FT                   /locus_tag="ABSDF_23S_4"
FT   rRNA            180013..182914
FT                   /locus_tag="ABSDF_23S_4"
FT                   /product="ribosomal RNA 23S"
FT   gene            183091..183205
FT                   /locus_tag="ABSDF_5S_4"
FT   rRNA            183091..183205
FT                   /locus_tag="ABSDF_5S_4"
FT                   /product="ribosomal RNA 5S"
FT   gene            183369..183563
FT                   /pseudo
FT                   /locus_tag="ABSDF0196"
FT   CDS_pept        183369..183563
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0196"
FT                   /product="fragment of putative acetyltransferase (part 1)"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99596.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(183751..184563)
FT                   /locus_tag="ABSDF0197"
FT   CDS_pept        complement(183751..184563)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0197"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99597"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99597.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTVCRRQKHID
FT                   IAISYQQNRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTDGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            184831..185736
FT                   /locus_tag="ABSDF0198"
FT   CDS_pept        184831..185736
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0198"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99598"
FT                   /db_xref="GOA:B0VKE4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99598.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLKKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(185733..186488)
FT                   /locus_tag="ABSDF0199"
FT   CDS_pept        complement(185733..186488)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0199"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99599"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99599.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFTQSLIKLCGLNWTAPDYSTVCRRQKHID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGNVNSV"
FT   gene            186518..186883
FT                   /pseudo
FT                   /locus_tag="ABSDF0200"
FT   CDS_pept        186518..186883
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0200"
FT                   /product="fragment of putative acetyltransferase (part 2)"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99600.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            187090..188088
FT                   /gene="cysK"
FT                   /locus_tag="ABSDF0201"
FT   CDS_pept        187090..188088
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="ABSDF0201"
FT                   /product="subunit of cysteine synthase A and O-acetylserine
FT                   sulfhydrolase A, PLP-dependent enzyme"
FT                   /function="1.5.1.12 : cysteine"
FT                   /EC_number="2.5.1.47"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99601"
FT                   /db_xref="GOA:B0VP83"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99601.1"
FT                   /translation="MSTDPQFPTPNNLGIAVYSNNAETIGNTPLVRINRLIKTGATVLA
FT                   KVESRNPAFSVKCRIGAALIADAEKRGVLKEGMHIVEPTSGNTGIALAFVAVAKGYSIT
FT                   LTMPASMSLERRKVLKALGANLVLTEPAKGMKGAVDEAVRLATEQPEIYFLPQQFENPA
FT                   NPQIHVDTTGPEIWQATGGQVDILVAGVGTGGTITGISRYFEQVQNKPLYSVAVEPAES
FT                   PIITQTKNGENITPAPHKIQGIGANFIPKNLDLDLVDEVIPVSSEEAIQWARNCAAQEG
FT                   ILVGISSGAALAAAAKIAERPENAGKTIVVILPDSGERYLSSVLFEGLFDE"
FT   gene            complement(188144..188752)
FT                   /locus_tag="ABSDF0202"
FT   CDS_pept        complement(188144..188752)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99602"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99602.1"
FT                   /translation="MKFDYWFCILLTSSLAQDHFAPSQLQRLSLKFFIIALMTIMTGCT
FT                   SLGPNSGSFSWRSSKLSSGLQKAYSVPPSTANRLSPMIIQSADRYNVPPLLLAAVIRQE
FT                   SSYNSNARSPTGAIGLTQIIPSYWQQTCAGNLYDESTNIQCGAYILNHYYQTADSWFKA
FT                   TAYYNVGPTGYERSFWTRHKAKKYARSVKRHQKTLKSAL"
FT   gene            complement(189060..189440)
FT                   /pseudo
FT                   /locus_tag="ABSDF0203"
FT   CDS_pept        complement(189060..189440)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0203"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99603.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(189600..190412)
FT                   /locus_tag="ABSDF0204"
FT   CDS_pept        complement(189600..190412)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0204"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99604"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99604.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTVCRRQKHID
FT                   IAISYQQNRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            190628..193006
FT                   /locus_tag="ABSDF0205"
FT   CDS_pept        190628..193006
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99605"
FT                   /db_xref="GOA:B0VP87"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99605.1"
FT                   /translation="MSTAYTMQTAPKALFDYDKYWASCFEPAPFLPMSREEMDQLGWDA
FT                   CDFILVCGDAYIDHPSFVSGVIGRVLEAQGFRVGIIAQPDWTNVESFRVLGKPTIAWGV
FT                   TAGNMDSMINRYTADRKIRSDDAYSPNNEPNKRPDRAATVYCQRCREAFPDVPVLLGGI
FT                   EGSLRRIAHYDYWSDKVRRSILMDSKADMLMYGNGERAIIDVMHRLAKGEKIHEITDVR
FT                   GTAFIINKHNKAAKAKFVEIASNDVDTIGRVDPIINPYVMTEDIDGCEIEKDKGNTLAQ
FT                   YQGFQKEIVANPIVREGDQLDENTQIVQLKPAQSKAIKHKLPPRELAVIRLPSFEEVAN
FT                   DQVLYAHANRILHLETNPGNARALVQRHGERDVWINPPPIPLTTEEMDYVFDLPYARLP
FT                   HPAYGDARFPAFDMIKFSVNIMRGCFGGCTFCSITEHEGRIIQNRSEDSTLREIEKIRD
FT                   TAPNFTGIISDLGGPTANMYRLHCKDPEIEKNCRKPSCVYPGVCQNLHTDHAPLVQLYR
FT                   KARAIKGVKKILIGSGLRYDLAVLNPEYVKELVQHHVGGYLKIAPEHTEQGPLSKMMKP
FT                   GIGTYDRFKQMFDRFSKEAGKEQYLIPYFIAAHPGTSDYDMMHLAIWLKKNGFRVDQVQ
FT                   TFYPSPMATATTMYYSGKNPLAKVARYTENVDIVKGEKRRRLHKAFLRYHDPNNWPLLR
FT                   EALKEMGRADLIGNSKQHLIPTYQPKGAEGEYKSARKKNSTVAGDSVKRSGQTVQNKNQ
FT                   HKRPQKGQVLTQHTGLPPRETGEKKPFGGKSKPKSKARG"
FT   gene            193320..193820
FT                   /locus_tag="ABSDF0206"
FT   CDS_pept        193320..193820
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0206"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99606"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99606.1"
FT                   /translation="MYYLITILLLFLTVVMAAKSLSRKHQQDSALKRRAVLSSHEQMTL
FT                   TRLQTVLPKFTVLAHVSFDALLTTKYAHTRRKYQNMTADFVVLDQNYQVVVVVMLEESG
FT                   LRRAHQQYERRLLQLAGYRVLSYSTVPDYHELRRDLLTPESELATLHATPQLERISNAF
FT                   VKS"
FT   gene            complement(193966..194319)
FT                   /locus_tag="ABSDF0207"
FT   CDS_pept        complement(193966..194319)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99607"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99607.1"
FT                   /translation="MTVKRLHVTSRYCEVAISGNLVHLAGQLADDTSVDITAQTQQTLD
FT                   NIDRLLAEAGTDKSHILSVMIFLKDIDKDYAAMNAVWDAWISKEHPPARTCVESKLYAP
FT                   DVLVEMTVVAVLP"
FT   gene            complement(194606..195697)
FT                   /gene="dinP"
FT                   /locus_tag="ABSDF0208"
FT   CDS_pept        complement(194606..195697)
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="ABSDF0208"
FT                   /product="DNA polymerase IV, devoid of proofreading,
FT                   damage-inducible protein P"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="5.8 : SOS response"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99608"
FT                   /db_xref="GOA:B0VP90"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99608.1"
FT                   /translation="MRKIIHIDMDAFYASVELRERPDLRHLPVVISSHHPRAVIAAASY
FT                   PAREFGLRSAMSMSQARKLCPQVVIIEPNFEKYRAISAQIHSIFQQYTTLIEPLSLDEA
FT                   YLDVTENLKQIASATEVAMHIREDIFRQTGLTASAGVAPNKFLAKVASDWNKPNGLFVI
FT                   KPSQVASFIQDLPLKKIPGVGKVTQEKLQQLELHTLGDLQKIEEAVLVHHFGKYGQQLY
FT                   LYAQGIDNRPVQAERARQQISKETTFDSDFTLAQCQSYWHGLAEKVWQSLEKKQLNARG
FT                   VNIKLKLKNFQTLQHSKSFKNPIHSQQDLIQVLFLLLNEMHIPENFQFRLIGVLGFINY
FT                   KLKLTTFSCLYGECCFFIQKNKF"
FT   gene            complement(195908..196459)
FT                   /pseudo
FT                   /locus_tag="ABSDF0209"
FT   CDS_pept        complement(195908..196459)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0209"
FT                   /product="fragment of putative lysozyme (partial)"
FT                   /function="1.7.34 : peptidoglycan (murein) turnover,
FT                   recycling"
FT                   /EC_number="3.2.1.17"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99609.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(196537..197928)
FT                   /locus_tag="ABSDF0210"
FT   CDS_pept        complement(196537..197928)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0210"
FT                   /product="putative transport protein (MFS superfamily)"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99610"
FT                   /db_xref="GOA:B0VP92"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99610.1"
FT                   /translation="MNATPTHQALQPEYRLLVLLVSIGFFMQALDTTIVNTAIPAMAHH
FT                   LNEDPLRMHSVVVAYVLSVAACIPLSGWLADRLGVRNTFLSAIIIFTLASLGCGLSQSL
FT                   NQLLFFRVIQGVGGALLLPVGRLSLLKIIPRTQFLAAMSLMSLAGLLGPLAGPTLGGWL
FT                   VEVATWHWIFLINIPMGVLGILMTLKVMPNVKEPTVKTFDLIGFVLLVVAMIGWSLGIE
FT                   HLASPEYSKWFSISLLVVGVVATLWYAYHSHTHQNALFRSRLFRNKIYAIGILGNFFAR
FT                   FGGNALPFVLPLMLQVAFGFEPFIAGLMMIPLVLGSLFSKPIVRPIIQKMGYRRFLLIN
FT                   TTLVGLCIASFAIMTVDTPTWFRALHFFLFGTLNSLQFVGMNTLTLKDLPQQDTSSGNS
FT                   FLSMIMMLSMSIGVALAGTLINIFTDYYGTAHVTTAFHVTLICLGCINIITALIFWQIP
FT                   KNTPV"
FT   gene            complement(198126..198749)
FT                   /locus_tag="ABSDF0211"
FT   CDS_pept        complement(198126..198749)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99611"
FT                   /db_xref="GOA:B0VP93"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99611.1"
FT                   /translation="MNSVLTMAVNDSPITSVKTTQPLIALYCGSRAGNNPIYREKAIEL
FT                   ASGIAEQGFGLVYGGASIGLMGQVAESVLAHGGEAVGVIPEFMLDYEVAHAGLTELHVV
FT                   ETMHERKAMMAERASAFIALPGGLGTFEEILEIATWGQLNQHQKPMILYNVNGFYNALI
FT                   AQLDHAVQEGFLPLQHRAKLIVCEEIDQIYNVIKNLKMPKRFVV"
FT   gene            199077..200669
FT                   /locus_tag="ABSDF0213"
FT   CDS_pept        199077..200669
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0213"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99612"
FT                   /db_xref="GOA:B0VP94"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99612.1"
FT                   /translation="MIFEWMSDPSVWVGLATLIVLEIVLGIDNLVFIAILAEKLPPEQR
FT                   TKARIVGLILALGMRLILLASIAWVVTLTQPLFHIFSHPFSGRDLILLFGGVFLLFKGT
FT                   MELHERMEGKQLHKEDNPVHAAFWMVIVQIVVLDAVFSLDSVITAVGMVKELSVMMVAV
FT                   VIAVGIMLWASRPLMDLVNKHPTVVILCLGFLMMIGFSLVVEGFGFHIPKGYLYAAIGF
FT                   SILVEMINQTMRRNQEKLVTTTDLRYRTASAVLRMLGSKNSGSTADAQTADKEDVLATQ
FT                   AFADEVFDEENGAYHSVLVQGVLGLSERPVKSVMTPRPDLEWIDLDEEPEVLKERLMSM
FT                   THSRLIVARGELDNIEGIALTHKILNGFIETGVIYFQKHLREPVIVHENAQVLMVMEQL
FT                   RQAPLQMAIVLNEYGSIEGIATPIDILEAIAGEFPDEDELDAAAESLEDGSLILEGSTD
FT                   IRHVSLLLGRDLVDESEQYSTLSGYLLFHLGRLPENGETVEADGYRFEVVTMEGHKIEK
FT                   VHIVSIEQGESKD"
FT   gene            200711..201208
FT                   /locus_tag="ABSDF0214"
FT   CDS_pept        200711..201208
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99613"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99613.1"
FT                   /translation="MSYFLFEKYQMTQQTCPCGKGSYAECCEPLHLGTAKALTAEQLMR
FT                   SRYSAFALQQIDYIVQTTALGQQTALDKEAIAEWSKQNQWLGLEVVNANEKLDKTHAQV
FT                   EFKAHYHDGKSAQIHHEVSHFVFHQQQWFFLDPTVDMQVTMKQPCICGSGKKFKQCCAQ
FT                   FL"
FT   gene            201254..201898
FT                   /locus_tag="ABSDF0215"
FT   CDS_pept        201254..201898
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0215"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99614"
FT                   /db_xref="GOA:B0VP96"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99614.1"
FT                   /translation="MLLTVIYIIAITAEAMTGALSAGRRSMDWFGVVLIACVTALGGGS
FT                   VRDVLLGHYPLTWVKHPEYLVLTCCAAFVTIVIAKWMRHLHNIFLVLDALGLIGFTIIG
FT                   CQIALQMGHGFVVSAVAGVLTGVSGGILRDILCNDVPFVFRRELYASISFVAVICYWVC
FT                   LDLGLSLELTVISTLVFGFTLRLIAIYFGLEMPKFIYKDDDAESASSTDEH"
FT   gene            201981..203300
FT                   /locus_tag="ABSDF0216"
FT   CDS_pept        201981..203300
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0216"
FT                   /product="putative transport protein (MFS superfamily)"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99615"
FT                   /db_xref="GOA:B0VP97"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99615.1"
FT                   /translation="MDLVSRIQNLPIGKFHYTLLWVVGLGWMFDAMDTGIIAFIMTTLV
FT                   KDWSLTPVESGWIVSIGFVGMAIGAVCSGALADRFGRKTVFAMTMAIYSIATALCAFAP
FT                   DLKWLLIFRFIVGLGLGGQLPVAVTLVSEYVPAHVRGRFIVLLESFWGLGWLVAALISY
FT                   FIIPKFGWHIAFLIGGLPLIYILVIWKKVPESIPYLINRGRIEEAHALVQKLEAEACVQ
FT                   IVHHIEVVPVAMRQKVSFKQLWSGQFARRSLMLWLIWFGIVYSYYGIFTWLPSLLVKQG
FT                   YDIVKSIEYVLLMILAQLPGYLAAAWFVERLGRKITLAAFIGFCALSAYFFGQADSVNS
FT                   IMFWGCLMSFFNLGAWGVLYTYTPEQYPANIRAFGSGWASAMGRIGGIVAPMVVTHMMV
FT                   AKNGFNHVFMMFTVVLLAVALVILILGEETQGKRLESIGL"
FT   gene            203454..205673
FT                   /gene="parC"
FT                   /locus_tag="ABSDF0217"
FT   CDS_pept        203454..205673
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="ABSDF0217"
FT                   /product="DNA topoisomerase IV, subunit A"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="3.1.1.1 : DNA bending, supercoiling, inversion"
FT                   /EC_number="5.99.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99616"
FT                   /db_xref="GOA:B0VP98"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="PDB:2XKJ"
FT                   /db_xref="PDB:2XKK"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99616.1"
FT                   /translation="MTSLAHHATENRSVAEFTEQAYLNYAMYVIMDRALPHISDGLKPV
FT                   QRRIVYAMSELGLKSSGKPKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLI
FT                   EGQGNWGSPDDPKSFAAMRYTEAKLSAYSELLLSELGQGTSEWQDNFDGSLKEPITLPA
FT                   RVPNILLNGTTGIAVGMATDIPPHNLREVVKGTIALIRNPQTSDEKLAEYIPAPDLPTK
FT                   AEIITPPEELLKIQTTGRGSYRMRAVYTIEKNEIVITELPYQVSGSKVITQIADQMQAK
FT                   KLPLVVDVRDESDHENPTRLVIVLRSNRIDAEAVMSHLFATTDLESSYRVNLNMIGEDG
FT                   RPQVKSIRRILLEWIEIRKKTVTRRLQYHLNRIEKRLHILAGLLIAYLDIDTVIRIIRE
FT                   EDQPKPVLMEHFNIDEIQAEAILELKLRHLAKLEEMEIRHEQDELSAKAAIIREQLENP
FT                   ESLKNLIISELKEDAKKFGDERRSPIVARAEAVQIKEQDLMPAETVTVVLSEAGWVRAA
FT                   KGADVDAENLNYRAGDQYLSHAVGKTNQRVYFLDETGRSYALPISNLPSARGLGDPLSS
FT                   KLSPASGVSFIQVYLDDDESELIAASSAGYGFKTQTKQLDTNAKAGKTFLTVPDKAKAL
FT                   PLISAQNMTHLAVLSSAGRLLILDLAELPNLNKGKGNKLIQLEGKEQILSMTTLNLDEI
FT                   IQVVAGQQHLKLKGDDLQKYMGKRASKGQLLPRGYQKANKLLIQR"
FT   gene            205971..207650
FT                   /gene="fadD"
FT                   /locus_tag="ABSDF0218"
FT   CDS_pept        205971..207650
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="ABSDF0218"
FT                   /product="acyl-CoA synthetase (long-chain-fatty-acid--CoA
FT                   ligase)"
FT                   /function="1.1.2 : fatty acids"
FT                   /function="1.6.1 : phospholipid"
FT                   /EC_number="6.2.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99617"
FT                   /db_xref="GOA:B0VP99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0VP99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99617.1"
FT                   /translation="MEKIWFAEYQKTGIPETVALPAENTSLVDIFERNFQKFGSRDAFI
FT                   FMDKAMSFNELELASRKFATYLQNLGLAKGTRVAVMMPNVLQYPVVALAVLRAGLVLVN
FT                   VNPLYTARELEHQLNDSGAEVLVIIENFASVYQSILGKTPVKHVVVASVGDMLGTLKGT
FT                   LVNFVLRKVRKQIPAWNIPGHVKFNSALNKENPSNYKRPTLTLSDTAVLQYTGGTTGVS
FT                   KGAELTHRNLVANLLQCDGIFQSKFGANDGAKGDRIVCALPLYHIFAFMVCAMYGMYKG
FT                   QANILIPNPRDLPAVIKELRKYQPSFFPAVNTLFNALVNNEEFKQLDHSNLKMAMGGGM
FT                   AVLPSTAEAWKKITGTTIIEGYGLSETSPVATANPPASTEFSGTIGIPLPLTEVAILDD
FT                   DGKEVPLGEQGEISIRGPQVMKGYWNRPDETAKVMTADGFFRTGDIGVMDSRGYVKIVD
FT                   RKKDMILVSGFNVYPSEIEEVIAKHPKVLEVAAIGVPDEKSGEVPKLFIVKKDPSLTTE
FT                   EVLNFAKENLTGYKRPRYVEFMDELPKSNVGKILRKDLRKPV"
FT   gene            complement(207689..208072)
FT                   /locus_tag="ABSDF0219"
FT   CDS_pept        complement(207689..208072)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0219"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99618"
FT                   /db_xref="GOA:B0VPA0"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99618.1"
FT                   /translation="MQQPDQKELFEVLEKQKKNQLQVDRIFKIVLPIVAFLLSVICANF
FT                   NWQSTLGTFVILTVTFIAVGVKRLPLWHWLIVITIYCLVDNYLSYGQLDVTHLRLQLGT
FT                   MLVFVGMVGIGRPYVDRWFMKNH"
FT   gene            208179..208577
FT                   /locus_tag="ABSDF0221"
FT   CDS_pept        208179..208577
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0221"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99619"
FT                   /db_xref="GOA:B0VPA1"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99619.1"
FT                   /translation="MHGISSIIYIILVACLLPYAFTVIAKFTGGFQPVDNQNPRDFLAN
FT                   TKGIAARANAVQQNSFESLPLFLTAILMAEYMVVPEYFILRLGWAYIILRVIYGICYLS
FT                   NWAILRSIVWFLSLLCPIFLLIVTIKLT"
FT   gene            208705..209232
FT                   /gene="ppa"
FT                   /locus_tag="ABSDF0222"
FT   CDS_pept        208705..209232
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="ABSDF0222"
FT                   /product="inorganic pyrophosphatase"
FT                   /function="1.7.1 : unassigned reversible reactions"
FT                   /function="1.8.1 : phosphorous metabolism"
FT                   /EC_number="3.6.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99620"
FT                   /db_xref="GOA:B0VPA2"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99620.1"
FT                   /translation="MSYSNIPAGKDAPNDIYVIIEIPANAAPIKYEIDKDSDALFVDRF
FT                   MGTAMFYPANYGYVPNTLSEDGDPLDVLVVTPHPVAAGSVIRCRPVGKLNMEDDGGIDA
FT                   KLIAVPHEKLSPLYKDVQEYTDLPPLLISQVEHFFSHYKDLEPGKWVKISGWEGADVAK
FT                   AEVLKAIEAAKK"
FT   gene            complement(209338..210654)
FT                   /locus_tag="ABSDF0223"
FT   CDS_pept        complement(209338..210654)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0223"
FT                   /product="putative outer membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99621"
FT                   /db_xref="GOA:B0VPA3"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99621.1"
FT                   /translation="MLKAQKLTLAVLISAAIISSAQASEQSEAKGFVEDANGSILFRTG
FT                   YLTRDKKQGAKDTSSVAQSAIVSIESGFTPGIVGFGVGVVGDGSFKIGENKNTGNQMIP
FT                   KHNDGSAYDHWARGGGSVKARFSNTTVRYGTQVLDLPVLASNTGRMVPEYFTGTLLTSH
FT                   EIKNLEVVAGKFTKDQMSDQINTDADASGRGLDRAIVWGAKYKFNDNLNASYYGLDSKN
FT                   ALERHYANVNFKQPLANDSSLTYDFSGYHTKFDANAHTYSATGTVAPNYAADGIADEEK
FT                   TNNIWAISGTYATGPHSVMLAYQQNTGNVGYDYGQNADGFQSIYLPNSYMSDFIGNHEK
FT                   SAQIQYNVDFGKLGVLPGLNWTTAFVYGWDIKVRNVTDDAQEREFFNQVKYTVQSGFAK
FT                   DASLRIRNSYYRASDAYQGAYIGDTNEWRIFLDIPVKLF"
FT   gene            211260..212147
FT                   /pseudo
FT                   /locus_tag="ABSDF0224"
FT   CDS_pept        211260..212147
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0224"
FT                   /product="fragment of transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99622.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(212027..212398)
FT                   /pseudo
FT                   /locus_tag="ABSDF0225"
FT   CDS_pept        complement(212027..212398)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0225"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99623.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            212433..212804
FT                   /pseudo
FT                   /locus_tag="ABSDF0226"
FT   CDS_pept        212433..212804
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0226"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99624.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(212846..213616)
FT                   /gene="hisF"
FT                   /locus_tag="ABSDF0227"
FT   CDS_pept        complement(212846..213616)
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="ABSDF0227"
FT                   /product="imidazole glycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.16 : histidine"
FT                   /EC_number="4.1.3.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99625"
FT                   /db_xref="GOA:B0VPA7"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99625.1"
FT                   /translation="MEKAMLAKRIIPCLDVDNGRVVKGVQFLDIRDAGDPVEVARRYNE
FT                   QGADEITFLDITATHHGRDTTYRTVERMAETVFVPLTVGGGVRKVEDIRALLNAGADKV
FT                   SINSAAVFNPEFVQEASQHFGAQCIVVAIDAKKTGDNKWEIFTHGGRKPTGIDAIEWAV
FT                   KMADYGAGELLITSMGADGTKAGYDIALMRAINDRVTIPTIASGGVGNLQHLADGILQG
FT                   GADAVLAASIFHFGQYTIPEAKQYLAEQGIEMRL"
FT   gene            213663..214667
FT                   /locus_tag="ABSDF0228"
FT   CDS_pept        213663..214667
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0228"
FT                   /product="putative homoserine kinase (ThrB)"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.8 : threonine"
FT                   /EC_number="2.7.1.39"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99626"
FT                   /db_xref="GOA:B0VPA8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99626.1"
FT                   /translation="MEGRGILSNFTDVFCRFSMSVYTPLSLDEVRTFAAPYGLEVLELN
FT                   PIQGGIQNTNYFLVDVNRKQYVLTVFEELDAQGAGELIPVLEQLGTHDVPVAVPLKHSG
FT                   QAVHFIAGKPAQIAPRLMGHHPMQTTVAQVAAIADAQAKLHVALQDFPLEREYRRDHQY
FT                   WTGVAEQLKPNMTQDDQTLLEQVYQAFNAKTAQYSNRPTGFIHSDLFRDNTLFEGEQLQ
FT                   GILDFYELNQDELLFDIAITINDFCTEYPAAHLNSDKVDAYLEAYQKVRALTSDELECL
FT                   DVFLAMAACRFWSMRLQVAQKNKEEGRTGDDILQKDPQEMRAMMQDRLSHVKA"
FT   gene            214680..214886
FT                   /pseudo
FT                   /locus_tag="ABSDF0229"
FT   CDS_pept        214680..214886
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0229"
FT                   /product="fragment of putative cold shock protein (part 1)"
FT                   /function="5.5.2 : temperature extremes"
FT                   /note="Evidence 7 : Gene remnant; Product type pr :
FT                   putative regulator"
FT                   /db_xref="PSEUDO:CAO99627.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            214962..215309
FT                   /pseudo
FT                   /locus_tag="ABSDF0230"
FT   CDS_pept        214962..215309
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0230"
FT                   /product="fragment of putative cold shock protein (part 2)"
FT                   /function="5.5.2 : temperature extremes"
FT                   /note="Evidence 7 : Gene remnant; Product type pr :
FT                   putative regulator"
FT                   /db_xref="PSEUDO:CAO99628.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            215331..215741
FT                   /locus_tag="ABSDF0231"
FT   CDS_pept        215331..215741
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0231"
FT                   /product="putative transmembrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99629"
FT                   /db_xref="GOA:B0VPB1"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99629.1"
FT                   /translation="MRGIKMNSSIDQDPNRTLTLILYVLYIVAIFTGGLLAIIALIINY
FT                   VKRSDVQGSIFASHFTWQIRTFWWYLAWNIIAFLPFIFLFFTGENTDLFAGVAISSTVF
FT                   CVGVIAAAWIWIVYRAIRGLIALNDNRPMYQP"
FT   gene            complement(215774..216082)
FT                   /pseudo
FT                   /locus_tag="ABSDF0232"
FT   CDS_pept        complement(215774..216082)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0232"
FT                   /product="fragment of putative membrane protein (partial)"
FT                   /function="4 : Transport"
FT                   /note="Evidence 7 : Gene remnant; Product type pm :
FT                   putative membrane component"
FT                   /db_xref="PSEUDO:CAO99630.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            216301..217206
FT                   /locus_tag="ABSDF0233"
FT   CDS_pept        216301..217206
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0233"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99631"
FT                   /db_xref="GOA:B0VKI2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99631.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLKKRGIIEALFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(217296..218108)
FT                   /locus_tag="ABSDF0234"
FT   CDS_pept        complement(217296..218108)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0234"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99632"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99632.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFTQSLIKLCGLNWTAPDYSTVCRRQKHID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            218208..218516
FT                   /pseudo
FT                   /locus_tag="ABSDF0235"
FT   CDS_pept        218208..218516
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0235"
FT                   /product="fragment of putative transport protein (ABC
FT                   superfamily, atp_bind) (partial)"
FT                   /function="4.3.A.1.a : ABC superfamily ATP binding
FT                   cytoplasmic component"
FT                   /note="Evidence 7 : Gene remnant; Product type pt :
FT                   putative transporter"
FT                   /db_xref="PSEUDO:CAO99633.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(218529..219434)
FT                   /locus_tag="ABSDF0236"
FT   CDS_pept        complement(218529..219434)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0236"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99634"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99634.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(219580..220311)
FT                   /gene="hisA"
FT                   /locus_tag="ABSDF0237"
FT   CDS_pept        complement(219580..220311)
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="ABSDF0237"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide isomerase"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.16 : histidine"
FT                   /EC_number="5.3.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99635"
FT                   /db_xref="GOA:B0VPB7"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VPB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99635.1"
FT                   /translation="MLIIPAIDLKDGKCVRLKQGRMEDDTVFSDDLVATAQHWVNEGAR
FT                   RLHLVDLNGAFAGTPIHKPVVEAIAKAQPELPIQIGGGIRSLETIEHYLEAGVTFVIIG
FT                   TKAVQEPEFVEEACKSFAGHIIVGIDAMNGMVATDGWANVTDVKATDLAKRFADAGVSS
FT                   IVYTDIARDGMMQGVNVEQTVNLAQYSGLPVIASGGVTNLDDVRNLKGQLGILGAITGR
FT                   AIYEGTLNLREAQLLLDENRL"
FT   gene            complement(220406..220840)
FT                   /pseudo
FT                   /locus_tag="ABSDF0238"
FT   CDS_pept        complement(220406..220840)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0238"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99636.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            221116..221748
FT                   /pseudo
FT                   /locus_tag="ABSDF0239"
FT   CDS_pept        221116..221748
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0239"
FT                   /product="fragment of transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99637.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(222173..222736)
FT                   /locus_tag="ABSDF0240"
FT   CDS_pept        complement(222173..222736)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0240"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99638"
FT                   /db_xref="GOA:B0VPC0"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99638.1"
FT                   /translation="MIRINTMNSPFENQPLQQDSPFKANGRFGRLSYAAWTFLFTLVLV
FT                   TAILLIMFTFGFTNPEGAPDFSTPGLICIAILYIVGIYINFVFTIRRLHDRNNTGWLSL
FT                   LMLVPIVNIGLTIYLFCAKGTEGPNDYGPKRPTPSWERVLGWIYIVLIPLALIFGVIAV
FT                   IMAPTYEGYDEKSESIVIGNQSQS"
FT   gene            complement(222873..223490)
FT                   /gene="hisH"
FT                   /locus_tag="ABSDF0241"
FT   CDS_pept        complement(222873..223490)
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="ABSDF0241"
FT                   /product="imidazole glycerol phosphate synthetase,
FT                   glutamine amidotransferase subunit"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.16 : histidine"
FT                   /EC_number="2.4.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99639"
FT                   /db_xref="GOA:B0VPC1"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99639.1"
FT                   /translation="MTRIALLDYGMGNLHSAAKALEYVGATVDVTNDPKLIAQADKIVF
FT                   PGVGAMRDCMQGMREAGIDEVVRKAAFNKPVLAICVGMQALLQSSEENGGVDALGIFDG
FT                   VVKHFPQMEGLKVPHMGWNQVHQMDPSHPMWNNIEQDARFYFVHSYYVEPKDENLVAAT
FT                   CEYGVNFCTAIHKDNLFATQFHPEKSHTAGLQLLKNFVEWNI"
FT   gene            complement(223490..224098)
FT                   /gene="hisB"
FT                   /locus_tag="ABSDF0242"
FT   CDS_pept        complement(223490..224098)
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="ABSDF0242"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.16 : histidine"
FT                   /EC_number="4.2.1.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99640"
FT                   /db_xref="GOA:B0VPC2"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VPC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99640.1"
FT                   /translation="MRNVSMTQRISEVVRNTNETKIRVRLNLDGTGQGTLNTGVPFLDH
FT                   MIDQIKQHGLFDIDIHCDGDLEIDDHHTVEDCGITLGQAFAQALGDKKGLRRYGHFYAP
FT                   LDEALSRVVVDLSGRPGLFMDIPFTRARIGTFDVDLFSEFFQGFVNHALMTLHIDNLKG
FT                   KNSHHQIESVFKALARALRMACEIDPRAENTIASTKGSL"
FT   gene            224186..224569
FT                   /locus_tag="ABSDF0243"
FT   CDS_pept        224186..224569
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99641"
FT                   /db_xref="GOA:B0VPC3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99641.1"
FT                   /translation="MPITVHAYSSLDNSEIRDQLERLYDTSPEFGDGHDAIEQLEQDLQ
FT                   QYTTLYTAEFNTKIIGAIWCSGQGESKVLEYIVVHPANRGRGVAERLVEEACRIEEAKG
FT                   VKIFEPGCGAIHRCLAHIGKLHS"
FT   gene            224675..224750
FT                   /locus_tag="ABSDF_tRNA5"
FT   tRNA            224675..224750
FT                   /locus_tag="ABSDF_tRNA5"
FT                   /product="tRNA-Phe"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            224878..224953
FT                   /locus_tag="ABSDF_tRNA6"
FT   tRNA            224878..224953
FT                   /locus_tag="ABSDF_tRNA6"
FT                   /product="tRNA-Phe"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(225123..225377)
FT                   /pseudo
FT                   /locus_tag="ABSDF0245"
FT   CDS_pept        complement(225123..225377)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0245"
FT                   /product="fragment of putative acyltransferase (part 2)"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99642.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            225491..226396
FT                   /locus_tag="ABSDF0246"
FT   CDS_pept        225491..226396
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0246"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99643"
FT                   /db_xref="GOA:B0VKE4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99643.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLKKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(226382..226561)
FT                   /pseudo
FT                   /locus_tag="ABSDF0247"
FT   CDS_pept        complement(226382..226561)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0247"
FT                   /product="fragment of putative acyltransferase (part 1)"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99644.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(226692..228206)
FT                   /locus_tag="ABSDF0248"
FT   CDS_pept        complement(226692..228206)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0248"
FT                   /product="putative acetyl-CoA hydrolase/transferase"
FT                   /function="1.5.3.5 : Coenzyme A"
FT                   /function="1.7.1 : unassigned reversible reactions"
FT                   /EC_number="3.1.2.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99645"
FT                   /db_xref="GOA:B0VPC7"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99645.1"
FT                   /translation="MSLSRIRLASLHDKVISAEQAAQFIENGMTVGMSGFTRAGEAKAV
FT                   PQALVELAKKNPLKITLITGASLGNDLDKQLTEAGVLSRRMPFQVDNTLRRAINNGEVM
FT                   FIDQHLSETVEQMRNQQLKRPDVAVIEAIAITEDGGIIPTTSVGNSASFAIFAEKVIVE
FT                   INTSLSESFEGLHDIYIPTYRPTRTPIPLTKVDERIGTTAIQIDPAKIVGIVFNDTHDS
FT                   PSTVTPLDDETQGIANHLIAFFEKEVAEGHLPKNLGPLQAGIGSIANAVLTGLKDSNFE
FT                   DLIMYSEVLQDCTFELIDAGKMKFASGSSITLSAKCGEKVFGNIEAYKDKLVLRPQEIS
FT                   NHPELVRRLGIIGINTALEFDIYGNVNSTHVCGTKMMNGIGGSGDFARNAHLAIFVTKS
FT                   IAKGGDISSIVPMVSHVDHSEHDVDILVTEQGLADLRGLAPRERARAIIDNCVHPLYRD
FT                   ALNDYFDRACAKGGHTPHLLREALSWHANFEETGQMLQPTPVAKSA"
FT   gene            complement(228398..229855)
FT                   /gene="envZ"
FT                   /locus_tag="ABSDF0249"
FT   CDS_pept        complement(228398..229855)
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="ABSDF0249"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with OmpR"
FT                   /function="2.3.3 : posttranslational modification"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /function="3.1.3.2 : covalent modification, demodification,
FT                   maturation"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99646"
FT                   /db_xref="GOA:B0VPC8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99646.1"
FT                   /translation="MSLEPIPPQTFTDYVAYSERKRTRWERFLDKIKPRSAAMRTTILV
FT                   LLVVLFSLFMSLWFFWRTLYLPEIQQHARYLAVELELVNNPNIRIFHRDSEVDVDTWLR
FT                   NRVGIEYVTNPKEYPSVRDKIIAEFFTNQVEQKLANEIGAKDVTVYFQFKPSPRIWIQT
FT                   PEMHGNWVREPLKTYANYSPELLVGWVVGVPLVSAIIILILVRQMNRPLRRLQNAANEY
FT                   SKSGTAPYLDTNHGPLEIRQVNQAFNRMVYTLEQTERERRIMLAGISHDLRTPLTRIRL
FT                   TAEMLPDEFLREGLVYDVDDMDAILNQFISYMRDGSDEELKDTNINILLQELVVQFKPL
FT                   DVRFNMQDVPIIPARSLSLKRLIANLINNAKRYGAEPIELSAKVENEHILITVADHGEG
FT                   IPEDQIEELMQPFVRGNSARTIQGSGLGLAIVKRIVDIHQGEIQIHNREQGGLEVIISL
FT                   PIPKPAPDENTTHNPLEKIKQTLSERF"
FT   gene            complement(229873..230637)
FT                   /gene="ompR"
FT                   /locus_tag="ABSDF0250"
FT   CDS_pept        complement(229873..230637)
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="ABSDF0250"
FT                   /product="two-component response regulator"
FT                   /function="1.8.1 : phosphorous metabolism"
FT                   /function="2.2.2 : transcription related"
FT                   /function="3.1.2.2 : activator"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99647"
FT                   /db_xref="GOA:B0VPC9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99647.1"
FT                   /translation="MSLVVPAEHPETVHNETDRVERILVVDDDVRLRTLLQRFLEDKGF
FT                   VVKTAHDASQMDRLLQRELFSLIVLDFMLPVEDGLSICRRLRQSNIDTPIIMLTARGSD
FT                   SDRIAGLEAGADDYLPKPFNPNELLARIRAVLRRQVREVPGAPSQQVEVVSFGPWSLDL
FT                   STRTLTREGQIVTLTTGEFAVLKALVQHPREPLTRDKLMNLARGREWGAMERSIDVQVS
FT                   RLRRLIEDNPARARYIQTVWGVGYVFVPDGAE"
FT   gene            231258..233642
FT                   /locus_tag="ABSDF0251"
FT   CDS_pept        231258..233642
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99648"
FT                   /db_xref="GOA:B0VPD0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99648.1"
FT                   /translation="MLLNFILVGSNTMTDLVQQLASELAVRPNQVEAAIRLIDEGASVP
FT                   FIARYRKEVTQGLDDTQLRQLDTRLAYLRDLYERREKVIQSLQEQNKLNDDLLARVNAA
FT                   ETKNALEEIYAPYRPKRTSKSFKAKEAGLGSIAEKIISEQIDPTEALAGFSHEDYPDVE
FT                   SQLDAIQHILIDDWAQNIPLTTELKATFAKTAVLKSTVASEEKKEVGKKFRDYFEFSEG
FT                   LNKLPSHRLLAMLRGRQENVLGLKVDGEDDAPLARIETEYNLDQVQPQTRQDFLKQTAK
FT                   LFWLGKVRPQIEHSLLTEKRLAAEAEAMQVFAENLRHLLLSAPAGSRTTLGVDPGIRTG
FT                   VKLAVVSEAGDVLAHSTIYPFAPKEDKEGSIAELARLCREYNVELIAIGNGTASRETEA
FT                   VVAEMMAANTDLKLTRVTVSEAGASVYSASELAAAELPELDVSIRGAVSIARRLQDPLA
FT                   ELVKIDPKSIGVGQYQHDVNQTGLAKTLDAVVEDCVNAVGVDVNTASPAILAYIAGLNK
FT                   AIAQQIVEYRKEHGRFDTRQALKNVPRLGERTFEQAAGFLRIQNGSEPLDASAVHPESY
FT                   GLVEKIVAAKATTVKDIIGNTEIIRQVKAEEFIDDKFGLPTIQDVLAELEKPGRDPRPE
FT                   FRTAKFREDITEVAQLTEGMQLEGVVTNVTNFGAFVDIGVHQDGLVHISELANEFVSDP
FT                   HKVVKPGQIVQVRVMQVDVERNRVNLSMRAEGAAPVKAQHPPRREQNNEQRSERKPQGK
FT                   RPQPRKDQVERPQRSKQEKPQEQKIGGFGALLLQAGIKGSK"
FT   gene            complement(233943..234329)
FT                   /pseudo
FT                   /locus_tag="ABSDF0252"
FT   CDS_pept        complement(233943..234329)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0252"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99649.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            234556..235368
FT                   /locus_tag="ABSDF0253"
FT   CDS_pept        234556..235368
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0253"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99650"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99650.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKRID
FT                   IAISYQQSRDGLHLLVASTGLKFLGEGEWKRKKHQPEYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTDGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            complement(235510..235896)
FT                   /pseudo
FT                   /locus_tag="ABSDF0254"
FT   CDS_pept        complement(235510..235896)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0254"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99651.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            235989..238208
FT                   /locus_tag="ABSDF0255"
FT   CDS_pept        235989..238208
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0255"
FT                   /product="putative sulfate permease"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99652"
FT                   /db_xref="GOA:B0VPD4"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99652.1"
FT                   /translation="MVVFMPALELKNRFHVNDLLSGVVVFLVALPLCLGIAFMFGIALA
FT                   SGAPIISGIIAGIVGGIIVGLLSGSHISVSGPAAGLTAVILVQLDQLGGNYAAFLLCIV
FT                   FAGILQILFGVFKLGFFANFIPNNVILGLLAAIGAILIVTQLPYLFGLTDFSWKEVWTA
FT                   TPDTFIQKFDAGAALIGLLSLFLILAWDSSPLKKLALPSALIAVVLAAVFNFVLISIGS
FT                   SWAVQSNNLIQLPNILQAPEEVLVFPDFSYLAEPLIYTGAITLAIVASLETLLNLEAAD
FT                   KLDPQKRSSPPNRELWAQGAGNIVSGLIGGMPVTSVIVRSSVNANTGARGKCSTIIHGV
FT                   LLLLAILFFVPLMNMIPLSALAAILIVTGFKLTHPKLFKQLYQKGWRQFLPFIITLVAI
FT                   LLTDLLTGILVGLFTSSAFILYGNFNKGVRVYKEKHLHGIVTRIELPSQVTFLNRSALI
FT                   SALEHVHKNQQLIIDATQCDSIDPDIYQVIQDYQNETAVKRQVDLKLIGFKQHYEEVDD
FT                   AVLDIYISTRDLQCKLSPQQVITLLKEGNERFVKNERLQRDIYRQIRVTADEGQHPIAA
FT                   VLGCMDSRAPTEMIFDVGIGDLFSLRIAGNIAGQKVLGSLEFACQAKGSKVILVLGHTD
FT                   CGAVTSACQLRLQQKQISDVKEMSHIQYVLGPLMHSVESVYDIMQPRELNKTFVNQVTA
FT                   MNVHYNIQYIINNSTVLKDLLDRGEIAIVGAIYDVKTGHVEFLDT"
FT   gene            complement(238278..239168)
FT                   /gene="acr1"
FT                   /locus_tag="ABSDF0256"
FT   CDS_pept        complement(238278..239168)
FT                   /transl_table=11
FT                   /gene="acr1"
FT                   /locus_tag="ABSDF0256"
FT                   /product="fatty acyl-CoA reductase (hexadecanal
FT                   dehydrogenase,acylating)"
FT                   /function="1.1.2 : fatty acids"
FT                   /function="1.8 : metabolism of other compounds"
FT                   /EC_number="1.2.1.42"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99653"
FT                   /db_xref="GOA:B0VPD5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99653.1"
FT                   /translation="MNKKLEALFQEKVQGKVILVTGASSGIGLTISNKLADAGAHVLLV
FT                   ARTQETLEEVKADIESRGGQASIFPCDLNDMEMIDQVSKEILASVDHIDILINNAGRSI
FT                   RRAVHESYDRFHDFERTMQLNYFGAVRLVLNILPHMIQRKDGQVINISSIGVLANATRF
FT                   SAYVASKAALDAFSRCLSAEVHAHKIAITSIYMPLVRTPMIAPTKIYKYVPTLSPEQAA
FT                   DLIAYAIVKRPKRIATNLGRLASMTYSVAPGINNMFMSIGFRLFPSSDAAKGKKAEKLN
FT                   WVQKAYARIFPGEHW"
FT   gene            complement(239442..239621)
FT                   /pseudo
FT                   /gene="metY"
FT                   /locus_tag="ABSDF0257"
FT   CDS_pept        complement(239442..239621)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="metY"
FT                   /locus_tag="ABSDF0257"
FT                   /product="fragment of homocysteine synthase (part 2)"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.9 : methionine"
FT                   /EC_number="2.5.1.49"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99654.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(239742..240719)
FT                   /pseudo
FT                   /gene="metY"
FT                   /locus_tag="ABSDF0258"
FT   CDS_pept        complement(239742..240719)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="metY"
FT                   /locus_tag="ABSDF0258"
FT                   /product="fragment of homocysteine synthase (part 1)"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1 : amino acids"
FT                   /function="1.5.1.9 : methionine"
FT                   /EC_number="2.5.1.49"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99655.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            241017..242678
FT                   /locus_tag="ABSDF0259"
FT   CDS_pept        241017..242678
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0259"
FT                   /product="putative transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /function="4 : transport"
FT                   /function="4.3.A.1 : The ATP-binding Cassette (ABC)
FT                   Superfamily + ABC-type Uptake Permeases"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99656"
FT                   /db_xref="GOA:B0VPD8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99656.1"
FT                   /translation="MAQYIYTMNRVSKMVPPKREILKDISLSFFPGAKIGVLGLNGAGK
FT                   STLLRIMAGVDKDFSGEARAQPGIKIGYLEQEPPLDPTKDVRGNVEDGVREALDALERL
FT                   DQVFAEYADPDADFDALAKEQEKLESIIHAWDAHNLNNQLEIAADALNLPAWDADVTKL
FT                   SGGERRRVALCRLLLSKPDMLLLDEPTNHLDAESVSWLERFLKDFPGTIVAITHDRYFL
FT                   DNVAEWILELDRGHGIPYQGNYTSWLEQKNARLEQEQKQEESFAKALKKELEWVRQNAK
FT                   GQQKKNKARMERFEELNSREFQQRNETSEIYIPPGPRLGNKVVEVENISKSFGDRLLYE
FT                   NLSFTVPPAAIVGIVGPNGAGKTTLFRMMTGEQKPDTGTVTLGDSVKVAYVGQIRDTLD
FT                   DNKTVWEEVSGGLDILKVGDYEIASRAYIGRFNFKGQDQQKRVGELSGGERNRLQLAKI
FT                   LQQGANVILLDEPSNDLDVETLRALEDAILVFPGTVMVVSHDRWFLDRIATHILSFEDE
FT                   QPEFYTGNYTEFEAYRRAKLGDDAQPHRKKYKKISG"
FT   gene            complement(242721..243143)
FT                   /locus_tag="ABSDF0260"
FT   CDS_pept        complement(242721..243143)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0260"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99657"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99657.1"
FT                   /translation="MSQFNQIEEQGETVMNMKTIKHGLNHLFAFENLPADMHSQAEDEI
FT                   EQGLRFEELAIQDHERMQNWLDITPNDRNAMWCYLRAALRGNADASFKLGIGYLNGQFG
FT                   LDKNYTEAEKWLNKAASQGHPDAERCLQEAFSKLAF"
FT   gene            complement(243444..244142)
FT                   /locus_tag="ABSDF0261"
FT   CDS_pept        complement(243444..244142)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0261"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99658"
FT                   /db_xref="GOA:B0VPE0"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99658.1"
FT                   /translation="MFMYKTLTTCLLVTCLGLSGCATSILSTALPNETTEVQTTILKTN
FT                   QIIALGQAVKNQQEQGVVFIGQDFNYLMTEGSSEFLNIIKNIPVNQRTLIIPSPLLLEM
FT                   DDPTHFHGELKFQYNIPASKLSDQQKENLKNLGFKNHFMVMENQTQLLYPYAIIRFKGQ
FT                   IYQTSPTSKVQQTIPTPYPIALQQKDEITKKHPFKRVTRMALYPLAMAFDIVTVAPSLI
FT                   LSDLRGDFTK"
FT   gene            244249..244683
FT                   /locus_tag="ABSDF0262"
FT   CDS_pept        244249..244683
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0262"
FT                   /product="putative Component of the czc cation-efflux
FT                   system (CzcI)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10198000"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99659"
FT                   /db_xref="GOA:B0VPE1"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99659.1"
FT                   /translation="MLRAISNSHGVLLPRSAIFMSVLFCLLIFQSLWNIAAAFCAHENQ
FT                   EKALHHFGHHAALNVYQTSSHTHVEHTETLDAAHKAPLNLQDHHDHLPTCFHVVMTEVA
FT                   KQAQTPVLHVHELSQIYHWSNSYQSPHLSALKPPPVLTPL"
FT   gene            244738..246153
FT                   /gene="czcC"
FT                   /locus_tag="ABSDF0263"
FT   CDS_pept        244738..246153
FT                   /transl_table=11
FT                   /gene="czcC"
FT                   /locus_tag="ABSDF0263"
FT                   /product="Cation efflux system protein"
FT                   /function="4.2.A.4 : The Cation Diffusion Facilitator (CDF)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7766206, 10198000; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99660"
FT                   /db_xref="GOA:B0VPE2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99660.1"
FT                   /translation="MSSIFSNRVSHPDLLGCNVKITLKKVVTISSLSIVMLLAGQMANA
FT                   ASDIQQGSYTQKAAFSFEQALARAQSYQTQQGVWQAQQQMAEAQLKQSRLWANPSLSIE
FT                   QTGLQSDQEKELAIGISQPLDIFGQRKAAQHLAKVEMSKVDLAEQRYKAELELIVKYFW
FT                   SQVALLELEKSLIGEQLAVSQENLSASEKRYQAGSIAQVDVDRVRMSHLENQRLYQQVD
FT                   LKLQVAKQQLANLWGGDSNQFQLSQSSNQLWVLASDVESGQDRQNNLLERSFQLDALAQ
FT                   QATIQQLKAKARPQPAVTLGVNNTRSPEQRTENQIRLGVEIPLNLFNRQQYGIKIAQAK
FT                   QELSQRQQSFYRQQNQVDIETLMSELKGLHIQFKQLNDQQVPLAVQVQQKTLQGFRLGK
FT                   FAVTDVQQATMQLQDVRLRKVELLKQAWQNSIEIQSLRLGLEPEQIMAKDALMQLNQRA
FT                   WQQAQTFSTQAGE"
FT   gene            246111..247373
FT                   /gene="czcB"
FT                   /locus_tag="ABSDF0264"
FT   CDS_pept        246111..247373
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="ABSDF0264"
FT                   /product="RND divalent metal cation efflux membrane fusion
FT                   protein"
FT                   /function="4 : transport"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /function="4.8.A.1 : The Membrane Fusion Protein (MFP)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10198000; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99661"
FT                   /db_xref="GOA:B0VPE3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99661.1"
FT                   /translation="MATSSNFFNSGRRIIMSANLKKNSQWLWVGVIAAITAILIGLLVL
FT                   NSKNKSNSSEPSEGHGHAEEEGKEHHDEGEKPLLLTAQQMQEQNLKIEQAELGEVPQLQ
FT                   TYPAKLVVNTDRQAHVSPSFSGRVEAVYVELGQQVKKGQALASLLVPDLVDQQANLQIA
FT                   QSNLKLARQDYERERSLWSQEISAKQDYQRAYNAYQQAQIQVKAARSRLSAFGAGSGSA
FT                   GRYTLTAPIAGIVSNKDIVVGENVQLADQLFIINQLDQLWLEFILPSNANINVQPNQQI
FT                   EFKSLQTGNSFSAQVQSLTTEADAQTGRLQVRAKVLANSSELRPNLIVNVELNAGSTQK
FT                   VTRVKAQAVQQVEGKDVIFTPKMVKTGFEFEPVTVQLGQRSKDGQWVEVVKGINPSQRY
FT                   VVEGSFLLKSELEKGEAEHGH"
FT   gene            247363..250521
FT                   /gene="czcA"
FT                   /locus_tag="ABSDF0265"
FT   CDS_pept        247363..250521
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="ABSDF0265"
FT                   /product="RND divalent metal cation efflux transporter"
FT                   /function="4 : transport"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10198000; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99662"
FT                   /db_xref="GOA:B0VPE4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99662.1"
FT                   /translation="MDINKPELPKPEGLFDRVIQFAIQNAIWVMLFVLAWIGVGIWSYQ
FT                   KLPIDAVPDITNTQVQINTQANGYTALEVEQRITYPIENAMAGIPNLEQTRSISRYGLS
FT                   QVTIIFKDGTDIYWARQLINQRLQEADGQLPESVDPVMSPVSTGLGEIYQWVIKAKSGA
FT                   KKADGTAYTAMDLREIQDWIVRPQLQRVKGVAEINSIGGYNKTYIVSPDLKRLQQLQIS
FT                   INEFQTALQENNENRGAGFIEENGEQLTVRVPGMLSSVEDIQNITVSTKNGLPIRVVDV
FT                   ANVSIGHDLRTGAATYNGEETVLGIAMMMMGENSRTVAQAVDAKIKEIQSTLPKGVEIE
FT                   TVYDRTSLVNKAIATVQKNLVEGAILVIVILFIFLGNFRAALITACVIPLSMLFTLTGM
FT                   AEQNISANLMGLGALDFGIIVDGAVVIVENCIRRLAEAQHALHRPLTRSERFKEVFLAA
FT                   KQARRPLIFGQMIILVVYLPIFALSGVEAKMFYPMAMTVVMALLGAMILSVTFVPAAVA
FT                   LFVTGEVKEKETRWMQLLKQKYRDVLDQAYQLKIVVVSFALSILVLTGVLATQMGSEFA
FT                   PQLSEGDFALQQMRSPSTGLEQSLRMQENTEKLILKNFPEVKAVFARTGTAEVATDVMP
FT                   PNISDAVILLKPHDQWPNPKETLAELRSRMEAFLATLPGNNSEFSQPIELRFNELISGI
FT                   RSDIGVKIFGDDMQVLNEQAQALAQKVQKISGATAVKVEQTSGLPVLSVEINRPLAAQY
FT                   GLSAKAIQDIVAASVGGQNVGQILQGDRRFDFEIRLEDQQRTIQNLAQLPIQLPNGGLI
FT                   QLQDVAKVERTSGLNQVGRENGKRRVIITANVEGRDLGSFVQELRTTLAKEQLPAGYWL
FT                   EYGGQFENLASAAARMKIVVPLALAMIFILLMAVFHNVKESLLVFSGVPFALSGGLIAL
FT                   WLRDIPLSMSAGVGFIALSGVAVLNGLVMLSFIKELREKFDIQTATWNGAILRLRPVLM
FT                   TACVASHGFIPMALATGTGAEVQRPLATVVIGGIISSTILTLVLLPVIYRWMNEGKTKS
FT                   VEHS"
FT   gene            250635..251342
FT                   /pseudo
FT                   /locus_tag="ABSDF0266"
FT   CDS_pept        250635..251342
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0266"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99663.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            251375..251539
FT                   /pseudo
FT                   /locus_tag="ABSDF0267"
FT   CDS_pept        251375..251539
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0267"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99664.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            251661..252617
FT                   /gene="czcD"
FT                   /locus_tag="ABSDF0268"
FT   CDS_pept        251661..252617
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="ABSDF0268"
FT                   /product="cation efflux system protein"
FT                   /function="4 : transport"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /function="4.2.A.4 : The Cation Diffusion Facilitator (CDF)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10198000; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99665"
FT                   /db_xref="GOA:B0VPE7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99665.1"
FT                   /translation="MGGHHGHDHSHAVVTEGNAKKLTIALALTTTFLIVEVIAGLITQS
FT                   LALLSDAAHMFTDAAALAIALVAIQISKRPADNKRTFGYQRFEILAALFNALMLFVVAI
FT                   YILYEAYIRFSQPPEIQSVGMLIVATIGLVINLISMKILMSSANNSLNVKGAYLEVLSD
FT                   ALGSVGVIIGAIIIYFTNWYWIDTLIAVLIGFWVLPRTWVLLKQSINILLEGVPEEVDI
FT                   EKLRADLLSLNGVESIHQLKVWAITSKNIHLTVHLFAPEADRNKLYQDAVEMLSHEHGI
FT                   GEVTLQIEDDAEINCQHIAQHASHEHNDNDKTRSHQH"
FT   gene            complement(252636..252974)
FT                   /locus_tag="ABSDF0269"
FT   CDS_pept        complement(252636..252974)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99666"
FT                   /db_xref="GOA:B0VPE8"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99666.1"
FT                   /translation="MQYRCPQCQSVKIMPVSQGVNSAKPVVPKSLVILVPAIFVLLLLV
FT                   VISIFMWIFGNGAGSSLQIATVVAFVVTVGAGFMFWRDLPDFKLSMQAFMQSQKHWKCR
FT                   DCNHEWEI"
FT   gene            253077..253982
FT                   /locus_tag="ABSDF0270"
FT   CDS_pept        253077..253982
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0270"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99667"
FT                   /db_xref="GOA:B0VKE4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99667.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLKKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(254003..254950)
FT                   /locus_tag="ABSDF0271"
FT   CDS_pept        complement(254003..254950)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99668.1"
FT                   /translation="MGQEDDNKSKPTTTSTVSGNPDPIKLSFSRRLLHKTLQHAQDAVG
FT                   FASDTTRNLAEVADAALDALDQVTSHTKRGVVGMTNLAAGTVRDMVSETSETARQVALI
FT                   MARTFLGKSTLNLYLPEMLLNSQIRKRIDRSEIDDIKVQCGNDRFQVEIDGHYHRFLYR
FT                   LSLDFRVLECRIGQEKFLRLRQMDESLDVQIRHGGTLSNWAVRRIGRVGFQVINMLPIP
FT                   SLINHLIRDIPGIQRDGHRMWFIDLEQAGFIDFINNRSWMVEKLLNLTDFSILPGLNIL
FT                   RESRELVQQLVDQFEIKGLRVQSGRLEVQVGIAN"
FT   gene            255290..255922
FT                   /pseudo
FT                   /locus_tag="ABSDF0272"
FT   CDS_pept        255290..255922
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0272"
FT                   /product="fragment of transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99669.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(256253..256417)
FT                   /pseudo
FT                   /locus_tag="ABSDF0273"
FT   CDS_pept        complement(256253..256417)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0273"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99670.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(256450..257157)
FT                   /pseudo
FT                   /locus_tag="ABSDF0274"
FT   CDS_pept        complement(256450..257157)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0274"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99671.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(257331..257406)
FT                   /locus_tag="ABSDF_tRNA62"
FT   tRNA            complement(257331..257406)
FT                   /locus_tag="ABSDF_tRNA62"
FT                   /product="tRNA-Glu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(257435..257510)
FT                   /locus_tag="ABSDF_tRNA61"
FT   tRNA            complement(257435..257510)
FT                   /locus_tag="ABSDF_tRNA61"
FT                   /product="tRNA-Glu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(257645..258604)
FT                   /locus_tag="ABSDF0276"
FT   CDS_pept        complement(257645..258604)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99672"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99672.1"
FT                   /translation="MLRDWLYIIYRCRFKFILKNNSLYTMKIIFIHGMNQQNYTAHRLK
FT                   EHWLKVFKVGLKQLHCRVNLRDLHIHMPFYGDLMTKYQLSNQLDLNTLLPKTFNFHLPI
FT                   HLHQQPSTPKEHTPFIPHLPLSPDQPAQSLSKRLYLTSQLVKDRVLKEMVVLLNNFPKL
FT                   HESLIQQFLIETYMYLSNPDFMYEVHQRILKQMHDDEDCIVVAHSLGSVIAYHLLSDPS
FT                   YQFSVQRFITLASPLSFRVIQSKLPTPIERPKCLKGDWYNFYSKDDFLTAFPLSEAPFN
FT                   FTPPIINQEIFTFANQPHEIVGYLQHHAVVKTIIEPFQ"
FT   gene            complement(258648..260075)
FT                   /locus_tag="ABSDF0277"
FT   CDS_pept        complement(258648..260075)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0277"
FT                   /product="putative APC family, S-methylmethionine
FT                   transporter (MmuP)"
FT                   /function="1.5.1.9 : methionine"
FT                   /function="4.2.A.3 : The Amino Acid-Polyamine-Choline (APC)
FT                   Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99673"
FT                   /db_xref="GOA:B0VPF5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99673.1"
FT                   /translation="MCNMQPSDKQLDAQHQNSTAPLKRAMSTRHLVMLSLGGAIGTGLF
FT                   LGSGEVISQTGPIGAIIAYILGGAIAYMVMLCLGELAVHMPVSGSFGAYARKYISPSIG
FT                   YIISWMYWLTWTATLGTEFTAAALLMQEWFPQISMWIWTLIFAVTIFGLNISSTRVFAE
FT                   SEFWLALVKVITVIAFIVLGLLAIFGLIPFHGAQTAPLFSNLTAQGWFPHGFLPIFTTM
FT                   LIVNFAFSGTELIGVAAGETKDPAQNVPKAINAAIWRLLIFFVGTIIVISALLPFQLTG
FT                   LGGDNVSNSPFITVFNYIGIPYADDIIRFVIITALLSAANSGLYAASRMMWSLSEQKLL
FT                   PGVFATLSKSGTPIVALVVTMFGAIPGLLSEQFAPETIFKNLLGVAAFTMVIVWMSICL
FT                   SQFNFRRQWYRSGHTVSDLKYAAPLFPIVPILGFLFCFITCLSMAADPEMRAGFIGCLI
FT                   FTALCYLSYFIFYRNKA"
FT   gene            complement(260198..260273)
FT                   /locus_tag="ABSDF_tRNA60"
FT   tRNA            complement(260198..260273)
FT                   /locus_tag="ABSDF_tRNA60"
FT                   /product="tRNA-Glu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(260299..260374)
FT                   /locus_tag="ABSDF_tRNA59"
FT   tRNA            complement(260299..260374)
FT                   /locus_tag="ABSDF_tRNA59"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(260432..261940)
FT                   /gene="gltX"
FT                   /locus_tag="ABSDF0279"
FT   CDS_pept        complement(260432..261940)
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="ABSDF0279"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.17"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99674"
FT                   /db_xref="GOA:B0VPF6"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VPF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99674.1"
FT                   /translation="MKVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTD
FT                   QLRSTPESEKMILDSLRWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAF
FT                   YCFATAEELDQMRAEQQARGETPKYDGRGLKLSQEEVARRLEAGEPHVIRMKVPEEGVC
FT                   KFNDLLRGEVEIPWAQVDMQVLLKTDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPK
FT                   HQLLYQYFGWEMPTLCHMPLLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMG
FT                   WSMPDEREVFTLQDMMDNFDIQRVSLGGPIFDVEKLNWLNGQWIKGLTPGQLLDRLLTW
FT                   KSDRSTLEDIAAAIQPRINLLSEAVNWAGFYFNHMPQITAEMFESKKLTQEQVRQSLQF
FT                   AIWRLESQFTWNNDTVGQTLMDLANQMGIKLRDFMPTFFIAIAGSTSSTPVMQSMVTLG
FT                   PDLTFARLRHALEIVGAPSKKEVKNWEKLNESLKLPKNEATSEA"
FT   gene            complement(262057..262356)
FT                   /locus_tag="ABSDF0280"
FT   CDS_pept        complement(262057..262356)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0280"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99675"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99675.1"
FT                   /translation="MKIHYGKALSLGLVLSFASQLSTAAVLKDTPSKSLSNKQSSLIEK
FT                   ALDQQKRNTIVLPSTDDELKVLNTIRVTPTQNFLAAQHERFSRFVQAIFQPHTS"
FT   gene            262753..263772
FT                   /gene="sbp"
FT                   /locus_tag="ABSDF0281"
FT   CDS_pept        262753..263772
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="ABSDF0281"
FT                   /product="sulfate transport protein (ABC superfamily,
FT                   peri_bind)"
FT                   /function="1.8.2 : sulfur metabolism"
FT                   /function="4.3.A.1.p : ABC superfamily, periplasmic binding
FT                   component"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99676"
FT                   /db_xref="GOA:B0VPF8"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99676.1"
FT                   /translation="MKRIARIAVATYMGLAVNMGLAVNAVQAATTFLNVSYDPTREFYQ
FT                   EYNQAFGKFWKQRTGQDVDFKQSHGGSGKQARAVATGLEADVVTLALANDIDEIVKAGF
FT                   IQPNWQKEFPNNSAPYTSTVVFLVRKGNPKNIRDWNDLTKPGVEIITPNPKTGGAPRWI
FT                   YLSAWGYALKQPGGNDAKAKELVKKLYHNVNVLDLGARGSLTTFAERGIGDVLLSWENE
FT                   ALLATKGLDKDKYEIVYPSISILAEPSVAIVDKTVDKDGNRTLAKGYLNFLYSPLGQEL
FT                   AAKHYFRPRNPQVAAKYAAQFPKIKLFTINDVFGGWAKAQKTHFANGAIFDQIYDGKQ"
FT   gene            263995..264918
FT                   /gene="mraW"
FT                   /locus_tag="ABSDF0282"
FT   CDS_pept        263995..264918
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="ABSDF0282"
FT                   /product="S-adenosylmethionine methyltransferase"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /function="3.1.1.2 : methylation"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99677"
FT                   /db_xref="GOA:B0VPF9"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VPF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99677.1"
FT                   /translation="MSHISVLLFETVESLLADRTTGVYIDATFGRGGHTHLLLSKLDEN
FT                   ARVYAFDKDPQALEVAAALAQEDPRFTIIHASFADIKEKMQEIGVQSVDGIMADLGVSS
FT                   PQLDQAERGFSFMQDGPLDMRMDNSKGLTAAEWLLEVEEEDLANIIYQYGEERHSRRIA
FT                   RAIKQAGKLDTTAQLAEIVKTAHPKWEKHKHPATRTFQAIRIAINKELDDIEVFLPQAV
FT                   DLLKPKGRLSVISFHSLEDRLIKQFIQKESTLTEDSGWGMPQQQVDTRRLKKISRVRVS
FT                   EEEVKANPRSRSAWLRVAERLEQKGA"
FT   gene            264918..265250
FT                   /gene="ftsL"
FT                   /locus_tag="ABSDF0283"
FT   CDS_pept        264918..265250
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ABSDF0283"
FT                   /product="cell division protein (in growth at septum)"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /function="5.1 : cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99678"
FT                   /db_xref="GOA:B0VPG0"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99678.1"
FT                   /translation="MKSSDEIETTENKVVKKVVVYAVMVALVFISAMMVVFQVFEYRHD
FT                   YRELSSYMRERDDLNAEWGRLLIEQQTFGATAQIGTRAVTQLRMFSPPAAETVVISLPM
FT                   TSEQNK"
FT   gene            265262..267094
FT                   /gene="ftsI"
FT                   /locus_tag="ABSDF0284"
FT   CDS_pept        265262..267094
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ABSDF0284"
FT                   /product="septum formation, penicillin binding protein 3,
FT                   peptidoglycan synthetase"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /function="5.1 : cell division"
FT                   /EC_number="2.4.1.129"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99679"
FT                   /db_xref="GOA:B0VPG1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99679.1"
FT                   /translation="MVDKRTKQTRKKQQSISEKPSLAFDMWRFYLLWAVVLLCFVVLIA
FT                   RAFYVQVINKDFLQNKANANILRTERIEAMRGVISDRHGVPLAISSPIMKIVIDPRDYF
FT                   ETKHLYDQITAELKQDPNNRKLKRQLPDKNLNLDELADVVGVDRADLKKQMNARPRSRY
FT                   LVLKKEVPPQQADLIMKGNFQGVYAEKTYKRYYPQPQPNAQIIGLTNSEGQGIEGLEMQ
FT                   LNKQLSGVDGEQKIIRDKRGNRLKVSEVIREGEPGENITLSIDSRLQYIMYRELTAAGV
FT                   ANNARSATAIAVDVKTGEILAMTSWPSYNPNDKNGLSNKDAMRNRGAIDMFEPGSTMKP
FT                   FTISAALETGQYTPNTIVNTSPGSMRLGWHTIRDTHNYGALTVSGVIIKSSNVGSAKIA
FT                   LSLPKETLPSFFNRVGFGKRSAVRFPGESSGLVLPVNKLNSSQIGTMAYGYGLNATILQ
FT                   LAQGYAMLANHGVKMPLSLHKLDQPPKGEQVLNPKIADQVLLMLEQVTMPGGTAKQANI
FT                   PGYRVGGKTGTAHKLRADGKGYSNNEYRALFAGVAPISDPRLAVIVVVENPQGRYYGGL
FT                   VAAPVFARIMQESLRLMNVPLDKPLNTPENPIRR"
FT   gene            267098..268597
FT                   /gene="murE"
FT                   /locus_tag="ABSDF0285"
FT   CDS_pept        267098..268597
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="ABSDF0285"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate-2,
FT                   6-diaminopimelate ligase"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /EC_number="6.3.2.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99680"
FT                   /db_xref="GOA:B0VPG2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99680.1"
FT                   /translation="MTVSFQEIHPIEIDAQWPQQPFHGFSLDSRKVETGQIFIALTSYS
FT                   QPEKTRTFAEAALANGALAVISETELGVANEWVCPDVRQRMGEWQKRYLQQADVVKPLR
FT                   IIAVTGTNGKTTISRLIAELISSQQQRCAVMGTTGNGILPNLTPSTHTTLDALQLQNAL
FT                   HDYAKQGATFASLEASSHGLEQGRLNGCDIEIAVYSNLSRDHLDYHGTLEAYAEAKARL
FT                   FQFNSLKVAVINLDDAHADLMIKSAQNNPAQPKILTYSLTQNTADYYITDLSYSLAGAT
FT                   FNLVSQQGSFAVESPLLGHFNVENLIAALIAAEQAGFDLQALVNFVPKLIGAPGRMQVI
FT                   RDDERLFVVDYAHTPDALIQVLKTLKRHVSNQLWAVFGCGGDRDRGKRPLMTQAALDGA
FT                   NPVILTSDNPRTEDPEQIFADMKQGIDFSGHRMHEIHDRREAIKFVAEQAQAGDIVVIA
FT                   GKGHENYQEINGVRHWFDDVVEVCSAIDAQHHTVDAAYPAQ"
FT   gene            268606..270006
FT                   /gene="murF"
FT                   /locus_tag="ABSDF0286"
FT   CDS_pept        268606..270006
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ABSDF0286"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase (UDP-MurNAc-pentapeptide synthetase)
FT                   (D-alanyl-D-alanine-adding enzyme)"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /EC_number="6.3.2.10"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99681"
FT                   /db_xref="GOA:B0VPG3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99681.1"
FT                   /translation="MHTSTTSTVPLEPWIAQQLQQATQGYWHKDQIPQSEIKRILTDSR
FT                   HAESGDAFLALKGERFDAHNFVAQVAANGCQVAIVERPIDAEIAQLVVADTRLALGQLG
FT                   AYRREQNAQLKVIALTGSSGKTTTKEMLGSILSRLAPTLINRGNLNNDLGVPMMLLELR
FT                   KEHQYAVMELGANHQGEIDYTSKIVQPHVAGILNIGTAHLGEFGGRDGICRAKSEIYRH
FT                   ILPQGVAIVPQQDDFTAEIREAAKSHQIMSFGAGGDVFATEIELLPQSANFQLHTPQGS
FT                   SFVRLPFAGEHNVQNATAAVAFALALGVSLEDIVKGLEQAQGAKGRLNFIQKAPHLFID
FT                   DTYNANPTSMRAAAQVLLQQNGIKVMVMGDIGELGDSSWQEHHDLGRDLAGLPLDHIVA
FT                   VGQFASAALEGAGLHSTKLKAFQTQAEALPFLINLIQTHQPQSMSFLFKGSRFTHMETL
FT                   MADLMEKL"
FT   gene            270007..271125
FT                   /gene="mraY"
FT                   /locus_tag="ABSDF0287"
FT   CDS_pept        270007..271125
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="ABSDF0287"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide
FT                   transferase"
FT                   /function="6.2 : peptidoglycan (murein)"
FT                   /EC_number="2.7.8.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99682"
FT                   /db_xref="GOA:B0VPG4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VPG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99682.1"
FT                   /translation="MLLWLFEQLAGYHSSFQVVRYLTLRSLLSVLTSLTIGLVLGPIMI
FT                   RKLQALKYGQAVSSFAPENHAKKMGTPTMGGILILLSIGISTLLWADLSNPYVWIVLGV
FT                   MVVFGAVGWADDWIKIRYKDNAGLPARKKFFWTSVASLGAGIALYLIATQQSNAEYTAN
FT                   MLDLLIPFFKNLSIPLSIVPLGLAFIVFTYLVINGASNAVNLTDGLDGLAIMPVVMVAT
FT                   GLGVFAYLSGDIRFANYLHIPYVKYTSELVVICSAMIGAGLAFLWYNAHPAQVFMGDVG
FT                   ALALGAMLGTIAVMVRQEIVFAIMGGVFVMEAVSVFLQIGSLRMRNKRVFLMAPLHHHY
FT                   EKQGWKETQVVIRFWIITIMLVVLGLMTLKLR"
FT   gene            271186..271413
FT                   /pseudo
FT                   /locus_tag="ABSDF0288"
FT   CDS_pept        271186..271413
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0288"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   1)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99683.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(271410..272315)
FT                   /locus_tag="ABSDF0289"
FT   CDS_pept        complement(271410..272315)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0289"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99684"
FT                   /db_xref="GOA:B0VKE4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99684.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLKKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            272406..272525
FT                   /pseudo
FT                   /locus_tag="ABSDF0290"
FT   CDS_pept        272406..272525
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0290"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   2)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99685.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            272528..273352
FT                   /gene="rrm"
FT                   /locus_tag="ABSDF0291"
FT   CDS_pept        272528..273352
FT                   /transl_table=11
FT                   /gene="rrm"
FT                   /locus_tag="ABSDF0291"
FT                   /product="23S ribosomal RNA G745 methyltransferase"
FT                   /function="2.2.6 : rRNA, stable RNA"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="2.1.1.51"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99686"
FT                   /db_xref="GOA:B0VPG8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99686.1"
FT                   /translation="MTTQNLMCPVCRQRLELVSKTWRCEQGHSYDIAKQGYVNLHVVQH
FT                   KHSKNPGDTPESVDARRAFLQGGYYQPLQQAVVHLLKDLQAKMVLDIGCGEGYYTSAMQ
FT                   QVVEQCIGVDIAKNAVQRAAKLNDKVTWVVGTGATLPVIDQSMDVCTSLFSPIPQTEIL
FT                   RVVKDDGYLIVVTSATDHLYAMREALFEQVNPHIPQKFVEQLQDLFELKEQQVIDAPLV
FT                   LDQQALKNLIAMTPYAYKASPERRMQLEQKAHLQVTASFQIYLFQKRNKKAI"
FT   gene            complement(273370..275925)
FT                   /locus_tag="ABSDF0292"
FT   CDS_pept        complement(273370..275925)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0292"
FT                   /product="putative penicillin binding protein (PonA)"
FT                   /function="1.6.7 : peptidoglycan (murein)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99687"
FT                   /db_xref="GOA:B0VPG9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99687.1"
FT                   /translation="MKKLSSLGFVRPIFLIIIIILVSLPMGFYGMYLYIAPTLPEMSSL
FT                   KKAPLLKPLQVYTADNQLIAEYGGKLSIPVEYKQIPPNFIHAFLAAEDSSFFEHSGISF
FT                   KGLGRALSESVTGSDVQTGGSTITMQVAKNYYLSPERTLKRKLTEIFLARKIEQNLSKE
FT                   DILSLYVNKIFLGKNAYGIAAAAKIYYNKSINELSIAQMAMIAGLPKAPSKYNPVVNPE
FT                   RTLERRNWILGRMLQLGYISQAEYQKAVAEPINLNMPNRDLNNIHPYAGEMVRSELVKH
FT                   FGEQAIDSGYKVYTTINAKRQAIAEKAVQDGLEAYDRRHGWRGAEAHDKPLSEFRAYAN
FT                   TYPAQVTKVNSSSFEALMQDGSTVTVQWSGMSWARPYRNANSVGAAPSRASQIVKVKDI
FT                   VRLRPNEAKTAWSLVQVPKVQGQLIAINPNDGSIEAIVGGYNFYQSKFNRALQGWRQPG
FT                   STIKPFLYALALERGMTPYSMVNDSPITIGKWTPKNSDGRYLGMIPLRRALYLSRNTVS
FT                   VRLLQTVGIERTRQLFMDFGLQEDQIPRNYTIALGTPQVLPIQMATGYATFANGGYRVQ
FT                   PHFIQRIEDAYGKVIYEAKPEYACIPCINAPETTDDAQVTTPDDQVVEVTNKELEQKEK
FT                   ATKQLNLKQTDKNNSQYRQAQRILKSSSAYDMANILRDVIEHGTGRAALKIGRSDLGGK
FT                   TGTTNDAKDAWFAGFNGKLVTVTWVGFDQPTTLGRREYGGIAALPIWINFMGQALQGTP
FT                   AAWVRLEKDAQAPISRDKQEVTTEVGDKKTYRAAPPLARPLYRPAPPQPKTTNNDFDDL
FT                   PGEEIVIPSKTTPPAMKPSQGAAPKREKDELENLINQIE"
FT   gene            276125..277147
FT                   /locus_tag="ABSDF0293"
FT   CDS_pept        276125..277147
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0293"
FT                   /product="putative membrane protein (ComM)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99688"
FT                   /db_xref="GOA:B0VPH0"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99688.1"
FT                   /translation="MGVDISSTSVKLLELSVKNGKYWVESYALMPLPENSVVEKNILNP
FT                   EAVAEALERAMNLANPQTTHAAIAVPTSTVIHKTIEMDADMSDDEREVQIRVDAEQYIP
FT                   FPLDEVSLDFEVLPDRLANPNRVNVLLVATRTENVETRVEVLELADLNPKLADVESYAV
FT                   ERTFSVFADSLPIGANTIGILDIGHTMTTLSVMQNGKIIYTREQVFGGKQLTLEIQSRY
FT                   GLSLEEASRAKKDRSLPDDYEIEVLDPFLDAVVQQAARSLQFFFSSSQFNEIDHILLAG
FT                   GNANIPGLAKLLQQKLGYRVTIANPFLQMGFSPQVDVQKIENDASSLMVACGLALRSFD
FT                   "
FT   gene            277147..277413
FT                   /pseudo
FT                   /locus_tag="ABSDF0294"
FT   CDS_pept        277147..277413
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0294"
FT                   /product="fragment of putative membrane protein (ComN)
FT                   (part 1)"
FT                   /note="Evidence 7 : Gene remnant; Product type pm :
FT                   putative membrane component"
FT                   /db_xref="PSEUDO:CAO99689.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            277483..277788
FT                   /pseudo
FT                   /locus_tag="ABSDF0295"
FT   CDS_pept        277483..277788
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0295"
FT                   /product="fragment of putative membrane protein (ComN)
FT                   (part 2)"
FT                   /note="Evidence 7 : Gene remnant; Product type pm :
FT                   putative membrane component"
FT                   /db_xref="PSEUDO:CAO99690.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            277785..278525
FT                   /locus_tag="ABSDF0296"
FT   CDS_pept        277785..278525
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0296"
FT                   /product="putative membrane protein (ComO)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99691"
FT                   /db_xref="GOA:B0VPH3"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:B0VPH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99691.1"
FT                   /translation="MSQDELQELSLEQLSAKKKKFNLDKFLQQFNTLDMNNYGSWPISV
FT                   KITCWIFIFFAVLALGYFIVIQPKLQAIDNAQAQESNLLNEFREKDSKLRNLQQYQVQL
FT                   QEMQANFNQQLEQLPKETEIPSLVEDINLTGVNSGLKFKNIRLEDEVKQEIFIEQPIAI
FT                   EATGDYHAFGAFVSSIAALPRIVTMHDFTVDVSPAKDNKSDIPVLNYSIKAKTYRYVGA
FT                   TDTSEQTGKAPAASASTNTTVQPK"
FT   gene            278533..279063
FT                   /locus_tag="ABSDF0297"
FT   CDS_pept        278533..279063
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0297"
FT                   /product="putative lipoprotein (ComL)"
FT                   /function="1.6.10 : lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99692"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99692.1"
FT                   /translation="MMKIKQITLSVLACAVLVGCDSRIDAVNQEMANIRNQPPLPIEPA
FT                   PIFTPVPQFNYAAHQLKSPFMPSSLAAELKIMAGKRVYPNFSRAPQPLESYALEALNMK
FT                   GSMRNNRGQILALIQTPDQQIERVQVGNYMGMNQGRITHISPTQIDLVEIVPDGREGYV
FT                   ERPRTLVLIGPAP"
FT   gene            279126..279395
FT                   /pseudo
FT                   /locus_tag="ABSDF0298"
FT   CDS_pept        279126..279395
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0298"
FT                   /product="fragment of putative outer membrane protein
FT                   (ComQ) (part 1)"
FT                   /note="Evidence 7 : Gene remnant; Product type pm :
FT                   putative membrane component"
FT                   /db_xref="PSEUDO:CAO99693.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            279530..280108
FT                   /pseudo
FT                   /locus_tag="ABSDF0299"
FT   CDS_pept        279530..280108
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0299"
FT                   /product="fragment of putative outer membrane protein
FT                   (ComQ) (part 2)"
FT                   /note="Evidence 7 : Gene remnant; Product type pm :
FT                   putative membrane component"
FT                   /db_xref="PSEUDO:CAO99694.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            280105..281289
FT                   /pseudo
FT                   /locus_tag="ABSDF0300"
FT   CDS_pept        280105..281289
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0300"
FT                   /product="fragment of putative outer membrane protein
FT                   (ComQ) (part 3)"
FT                   /note="Evidence 7 : Gene remnant; Product type pm :
FT                   putative membrane component"
FT                   /db_xref="PSEUDO:CAO99695.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            281328..281870
FT                   /gene="aroK"
FT                   /locus_tag="ABSDF0301"
FT   CDS_pept        281328..281870
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="ABSDF0301"
FT                   /product="shikimate-kinase"
FT                   /function="1.5.1.13 : phenylalanine"
FT                   /function="1.5.1.14 : tyrosine"
FT                   /function="1.5.1.15 : tryptophan"
FT                   /function="1.5.1.20 : chorismate"
FT                   /function="1.5.3.14 : enterochelin (enterobactin)"
FT                   /EC_number="2.7.1.71"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99696"
FT                   /db_xref="GOA:B0VQ33"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQ33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99696.1"
FT                   /translation="MPSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIE
FT                   RKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGI
FT                   VVYLYTPVELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAA
FT                   RDLAQKILQLILSNKLK"
FT   gene            281899..282981
FT                   /gene="aroB"
FT                   /locus_tag="ABSDF0302"
FT   CDS_pept        281899..282981
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="ABSDF0302"
FT                   /product="3-dehydroquinate synthase"
FT                   /function="1.5.1.13 : phenylalanine"
FT                   /function="1.5.1.14 : tyrosine"
FT                   /function="1.5.1.15 : tryptophan"
FT                   /function="1.5.1.20 : chorismate"
FT                   /function="1.5.3.11 : menaquinone, ubiquinone"
FT                   /function="1.5.3.14 : enterochelin (enterobactin)"
FT                   /EC_number="4.2.3.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99697"
FT                   /db_xref="GOA:B0VQ34"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQ34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99697.1"
FT                   /translation="MQTLHVELGERRYPIFIGSQLDPKQLLEPYIHGQQVMIVSNVTVA
FT                   PLYLSHYQEALESLGKTVATCILPDGEKYKDIQHLNLIFDALLEAGFNRDCTVLALGGG
FT                   VIGDMAGFASACFQRGVYFVQVPTTLLSQVDSSVGGKTGINHPLGKNMLGAFQQPQVVL
FT                   ADMAQLNTLPERELSAGLAEVIKYALLGDEDFLVWLEENMDGLVARDADLLAEAVYRSC
FT                   AHKARIVANDEKEQGERALLNLGHTFGHAIESYLGYGTWLHGEAVATGMVMAADLSQRL
FT                   GWISNEDVARTKKIIQRANLPISCPQIPLDDFLGHMAHDKKVLNGQLRLVLLKQLGQAV
FT                   ITKDFDVELMKQAILANQHG"
FT   gene            282997..283872
FT                   /locus_tag="ABSDF0303"
FT   CDS_pept        282997..283872
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99698"
FT                   /db_xref="GOA:B0VQ35"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99698.1"
FT                   /translation="MTVSRTLWQNVQQYIWLVGGIVCLFLAFIFWVITDNIKLVEVEKS
FT                   VDSDAPVQIQPEKVATTPNLGALADEVRPLDLTTRTVASGEHEPEFRGTKFINENKKQW
FT                   TLELFRASDEDIIKNFLKSRNDRNKFIYFRLSGEQQAEQYVLAYGTFKRSEDAVQQLTQ
FT                   INLQLPDSVKPQPQQFSSYAPLVNDLGADEMKGGNNQLYEVRLRPAALPRIDESLLMST
FT                   PASGTLNTQPKPASTNSATKTTIVRRDAAGNVVDVQQSNSNIDQPNKPAQTRVNENQPK
FT                   NATNEGTRGN"
FT   gene            284327..288808
FT                   /gene="gltB"
FT                   /locus_tag="ABSDF0304"
FT   CDS_pept        284327..288808
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="ABSDF0304"
FT                   /product="glutamate synthase large chain precursor"
FT                   /function="1.5.1.1 : glutamate"
FT                   /EC_number="1.4.1.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99699"
FT                   /db_xref="GOA:B0VQ36"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99699.1"
FT                   /translation="MHMPSPNTVAPAQGLYQPDEFKDNCGFGLIAHMKGESSHHLVETA
FT                   IHSLSCMTHRGGIAADGKTGDGCGLLLAMPKQFFRDEAKKLSDITLSEIFAVGTVFLNI
FT                   DPALAQHSKNILTKEIELEGLRVLAWRIVPTNNDALGEIALQSLPAFEQVIVNCPMGVT
FT                   EVEFNRKLFLARRRAEQQLQNDPLFYVTTLCSTVISYKGLMMPAAIAEFYTDLADERLK
FT                   SHIVVFHQRFSTNTLPRWPLAQPFRYLAHNGEINTITANRNWALARTPKFENPLLPGLT
FT                   ELNPIVNRTGSDSSSLDNMLEILVGGGMDLFRALRMLVPPAWQNVETLDADLRAFYEFN
FT                   SKHMEAWDGPAGLVIQDGRHAICMLDRNGLRPARWVITKNDYITLASEIGVWGYEPEDV
FT                   VSKGRVGPGQILVVDTLTGKVLDTKDVSNHLKNMRPYREWLRDHAIRLNANPELEEQLV
FT                   DKGLTGDALKAAQKMFMVTFEERDQLLRPIAESGQEAVGSMGDDTPMAVLSRQVRHVTD
FT                   YFRQQFAQVTNPPIDPLRESIVMSLETCLGREQNVFEQGPEHADRIIISSPVLSNSKMQ
FT                   QIRSIERAGYEAVDIDLNYAETEGLQAAITRICEESAQAVRDGKTLIVLTDKNIRQGCL
FT                   PANAALATGAVHHHLIKTGLRTDANIMVETGFARDPHQFAVLLGFGATAIYPYLAYDVI
FT                   NDLIAKGELLGDPIHAQANFRKGIEKGLLKVLSKMGISTVASYRGGQLFEAVGLSSEVV
FT                   DQCFLGVPSRIQGATFVDLENDQKKLAATAWSNRKPIDQGGLLKFVFGKEYHAFNPDVI
FT                   NSLHKAVRSGKYEDFKEYAELVNNRPIATIRDLFKLKTTNPIPVEQVESVEAILPRFDS
FT                   AGMSLGALSPEAHEAIAIAMNTIGGRSNSGEGGEDPARYGTIRNSKIKQIASGRFGVTP
FT                   AYLTSAEVLQIKVAQGAKPGEGGQLPGGKVNGLIARLRYSVPGVTLISPPPHHDIYSIE
FT                   DLSQLIFDLKQVNPKAMVSVKLVSEPGVGTIAAGVAKAYADFITISGYDGGTAASPLSS
FT                   IHHAGSPWELGLSEAHQALRVNDLRGKVRVQTDGGLKTGLDVIKAAILGAESFGFGSTP
FT                   MIALGCKYLRICHLNNCATGVATQQDHLRQEHYIGEPQMLINFFHFIAEETREWLAALG
FT                   VASLKDLIGRVDLLEVLPGETEKHAHLDLSALLTSHPAAEGKAQYCEVEGNAPFDKGIL
FT                   AERMVEEMLPAIESSAGGQFNFNVVNCDRSIGARVSGEIARRYGNLGMEAHPVVMNLTG
FT                   TAGQSLGVWNAGGLHIRLEGDANDYVGKGMAGGRISIFPPKGSPFQTQNTAIIGNTCLY
FT                   GATGGKLFAAGTAGERFAVRNSGAFAVIEGAGDHCCEYMTGGVVTVLGKVGHNFGAGMT
FT                   GGFAYVLDLDNDFVDYYNHELIDLTRISTESMEDHKEFLLRIIDEHIKETGSAWAYKIR
FT                   NEFDFYSRKFWLVKPKAANLQSLLKTTQADPQ"
FT   gene            288879..290300
FT                   /gene="gltD"
FT                   /locus_tag="ABSDF0305"
FT   CDS_pept        288879..290300
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="ABSDF0305"
FT                   /product="glutamate synthase small chain"
FT                   /function="1.5.1.1 : glutamate"
FT                   /EC_number="1.4.1.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99700"
FT                   /db_xref="GOA:B0VQ37"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99700.1"
FT                   /translation="MAERLNNDFQFLDVPRQDPEKKDITVRKAEFVEIYKPFTSETVTN
FT                   QTHRCLGCGNPYCEWKCPVHNYIPNWLKLIAEGQIFQAAELCHQTNTLPEVCGRVCPQD
FT                   RLCEGACTLNDGFGAVTIGNAEKYINDTAFALGWRPDMSHVKWTGKKVAIIGAGPAGLG
FT                   CADILARGGVKPVVFDKRPEIGGLLTFGIPEFKMEKDVMKRRREIFTGMGIEFRLNTEI
FT                   GKDVTIDELLAEYDAVFMGMGTYTYMKGGFPGEDLDGVYDALDFLISNVNRCQGWEKDP
FT                   SEYISMDGKKVIVLGGGDTAMDCNRTSLRQGAHDVTCAYRRDESNMPGSAREVKNAYEE
FT                   GVKFLFNRQPIEIVGENGKVTGVKVVTTQMGEPDSRGRRSPEPIPGSEEVLPADAVLLA
FT                   FGFRPSPADWFGSVNINLDGSGRVVAPEQQEFKFQTSNPKIFAGGDMVRGSDLVVTAIW
FT                   EGRQAAEGILDYLGV"
FT   gene            290466..291362
FT                   /locus_tag="ABSDF0306"
FT   CDS_pept        290466..291362
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99701"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99701.1"
FT                   /translation="MLNMNIAGMTAEKSYLNRRKALGITVRRLEFNPQAIKRYYFANSP
FT                   LMSHFLTALSSTFPVGEQFFVNSVRNVRDKVSDPQLQAQIAAFIGQEAMHSKAHGEFNE
FT                   AWRRDDYNLDRFQNWLNERDKYLRTISPKLQLALTCAFEHFTALLGGYILQHPELLKTL
FT                   DQDALKLWVWHAIEEIEHRSVAFDVYQQVYGDDRIRRLLMRSVTTGFASLAFYGTTRLF
FT                   WQDKWKSLPKIGGNLFGLYLLAKMLIQLTPEYFAYYKKDFHPSQKDYGHMVDYWKSYLA
FT                   DEYQMTSFQEEKNPRPS"
FT   gene            291494..292084
FT                   /locus_tag="ABSDF0307"
FT   CDS_pept        291494..292084
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0307"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99702"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99702.1"
FT                   /translation="MKTFKQLAIATTLASTLLFSGCGYNTLQVKDEAVTAAWSEVQNQY
FT                   QRRADLVPNLVNVVKGYAKHEEQVLTEVTQARANVAGLKVDKEVLEDPALLEKYQQAQS
FT                   QLTGALSRLIAVSENYPDLKANTQFQELQVQLEGTENRIAVVRNRYITTVQDYNAYVRQ
FT                   FPQAVTAKVIGMHPKANFSAEASAQQAPKVSFD"
FT   gene            292106..293188
FT                   /locus_tag="ABSDF0308"
FT   CDS_pept        292106..293188
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0308"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99703"
FT                   /db_xref="GOA:B0VQ40"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99703.1"
FT                   /translation="MRNTILLQSKQIRVFVITLIVLCCGVLFQNAAWSENNIATATDET
FT                   DTVVAGKIIQQQQAQASKPQINSQAASSVTPQTQVANDMADGESIRSLPTLNQTVIDQA
FT                   NVLSETEKQQLSQKILNLYQQGKAQIGIVIVPTTGQEDIFDYALRVGEKWQLGSSKRDN
FT                   GLLIAVAINDHRIQILTGYGLEGVLPDIVASRIIRNQITPYFKQAQYAQGLNAGLDEIE
FT                   RILNLDPEVAQQAAQDLKERQHQAAEEQQAKQTTLTMALFILVAGVVGSFIVGRPLSAS
FT                   TAGVAAAVAGFVNGAGVVMSLLLGFGIFFLLITSIAQLILQAILSGAGGGGRGGSFGGG
FT                   GGGYGGGGGRFGGGGASGSW"
FT   gene            293182..293742
FT                   /locus_tag="ABSDF0309"
FT   CDS_pept        293182..293742
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99704"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99704.1"
FT                   /translation="MVTTSETTQIITQPKIEESVEPSLKRWFKHFCYLPASSRYFSKQD
FT                   KQVIAEAVQQAEHGHVGEMQVVIEGHIPCSQAYRQNTRLRAQQLFAELGVWDTELNSGV
FT                   LLYLNLCERTVEIIFDRGIRNATTEQIWQHICKSIVEQLQQKQYQKAVVTGVQQIGEVM
FT                   SRFYDENMPDQLNELGNAPIIIN"
FT   gene            294145..295050
FT                   /locus_tag="ABSDF0310"
FT   CDS_pept        294145..295050
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0310"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99705"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99705.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            295090..295233
FT                   /pseudo
FT                   /locus_tag="ABSDF0311"
FT   CDS_pept        295090..295233
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0311"
FT                   /product="fragment of putative fimbrial protein precursor
FT                   (Pilin) (partial)"
FT                   /function="6.5 : Pilus"
FT                   /note="Evidence 7 : Gene remnant; Product type ps :
FT                   putative structure"
FT                   /db_xref="PSEUDO:CAO99706.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(295332..295964)
FT                   /pseudo
FT                   /locus_tag="ABSDF0313"
FT   CDS_pept        complement(295332..295964)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0313"
FT                   /product="fragment of transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99708.2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            296155..296562
FT                   /locus_tag="ABSDF0314"
FT   CDS_pept        296155..296562
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0314"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99709"
FT                   /db_xref="GOA:B0VQ45"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99709.1"
FT                   /translation="MNSFMQQSLFLAEKNTMTVIRVGTSLRAEMWEFVFEQWKQHPFTG
FT                   VGGGYLSKIQYAYGHHIHNLYLRLIFEWGIIGLIFCIWMLTQLIGLFKDKTVSLILKVG
FT                   VIAVLVDAMFSGGVPSVTNCLCIIYSFYFFS"
FT   gene            296877..298505
FT                   /locus_tag="ABSDF0316"
FT   CDS_pept        296877..298505
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0316"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99710"
FT                   /db_xref="GOA:B0VQ46"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99710.1"
FT                   /translation="MQVFFLFLAAILLGFAWLSPFHYNPWVMFSSEMSTFAAGLSVLAA
FT                   LFYQNIKISRAQLLLLPFILIPVVQWAFGLVFDFSTALLSSLYLLGFWFMVVAGYNLSL
FT                   DQQKRDQIFTGFSLLLIIVSIATSFIAICQWLNIESHFVHMLHLIGNRPYGNFGQPNNM
FT                   ATFLIMGLLGCLFLYEKNKATVWLLFPSALLILFTITLSQSRTSWVVFPFLLIYWIVKL
FT                   FGKQKRFGFIQGFLWCAGFFVIAGVILPFATSLIEAWSSAEVTQASSLVERASSGYLRF
FT                   NIWTQMLLAVQQHPWLGYGWHQTSVAQMSAYALFPTTEWTTSAHNILLDLIIWNGIPIS
FT                   IVIIAYFTCWFLWLNQQAKETISIIAIMMVCTVLIHAMLEFPQRYAYFLLTCGFLLGII
FT                   QAQTPVLKGIVLNKQVLRLIWGISVILLVAIWRDYNVYVTNSNLLFKNKQPNAEILGSN
FT                   QIFILTQFEQRLKWIEMKPETTLSDADLAVWGNFVKNKATPYNLRKYAQLLAYNGKVEQ
FT                   AEQQIFILQHLYRQQITLAELLKNK"
FT   gene            complement(298546..298971)
FT                   /gene="bfrB"
FT                   /locus_tag="ABSDF0317"
FT   CDS_pept        complement(298546..298971)
FT                   /transl_table=11
FT                   /gene="bfrB"
FT                   /locus_tag="ABSDF0317"
FT                   /product="bacterioferritin"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99711"
FT                   /db_xref="GOA:B0VQ47"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99711.1"
FT                   /translation="MLYHHLTAINQYFLHSRMFNDWGIEQLGSAEYKESIRQMKHADKI
FT                   IERILFLEGLPNLQHLGKLYIGQHTEEVLQCDIRKVKENIEAIQKAVALAETEQDYVTR
FT                   DLVQEILEKEEEYWDWLDTQIDLIGSVGIENYIQSQM"
FT   gene            complement(299255..299464)
FT                   /locus_tag="ABSDF0318"
FT   CDS_pept        complement(299255..299464)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0318"
FT                   /product="putative regulatory or redox component complexing
FT                   with Bfr, in iron storage and mobility (Bfd)"
FT                   /function="3.1.4 : regulation level unknown"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99712"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99712.1"
FT                   /translation="MGITPMYVCLCRGITDQDIKDAIENGAESYREIRDLLDLGTCCGR
FT                   CAPEARAIISEELAEIAARISVAA"
FT   gene            complement(299659..300042)
FT                   /locus_tag="ABSDF0319"
FT   CDS_pept        complement(299659..300042)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99713"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99713.1"
FT                   /translation="MSRQVIHTENAPAAIGTYSQAILVGNTLYLSGQIGLDPYSMELVD
FT                   GIEAQIRRVFDNLKAVCEAAGGTLADIAKLNIFLTDLSNFQLVNQIMGEYFAQPYPARA
FT                   ALGVASLPKGALVEMDGIVIINQ"
FT   gene            complement(300163..302268)
FT                   /locus_tag="ABSDF0320"
FT   CDS_pept        complement(300163..302268)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0320"
FT                   /product="putative bifunctional protein (SpoT) [Includes:
FT                   guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase;
FT                   (p)ppGpp synthetase II]"
FT                   /function="5.5 : adaptation to stress"
FT                   /EC_number="3.1.7.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99714"
FT                   /db_xref="GOA:B0VQ50"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99714.1"
FT                   /translation="MPGEEVSQAKQQLKLIIDPYLSVSEVEKVLAACDFGDLAHTGITR
FT                   KSGEPYILHPIAVSCILANMRLDPETLMAALLHDVIEDTQYTKDDIIERFGQTVAELVD
FT                   GVTKLSQSSDKEYNKAASFRKILQATLQDPRVIIIKLADRYHNMTTLGALRPDKRARIA
FT                   QETFDIFVPMARLVGMNEMADNLENLCYQNLDLDMFDNVQNALLQTKPERCKYQSIWEQ
FT                   NLAELLHNYHIQGRIKKKNNNIELLRHFVKNEMDLQELTHSHAFEIVLQSIADCDRLVA
FT                   ALKENFQVIQYQDHIRRPLPGGNQSLMIKLKGEKTTLSLTIQTELMRKAARFGVVLGEN
FT                   APQTCRSAIQASMQNLNTLIDGECAKTTFNDLLDYLHQEKIWVYTPHGQLHELPQGATV
FT                   VDFAYSASLFLGNHAVGAKVDGEIKPLSTPLVSGQVIEIITDVLATPNPDWLSFINTQK
FT                   ARRALQHVLKDQDIEEQRLVGAQALSRALKLFNRSINDLSDADWLDLLQWRHIDNKDAL
FT                   FEQIAVGDLLPQLVANHLFANDKHPRAENSDRLIQGTEGIDVKYAHCCNPILGDPIQGH
FT                   LTRRGLIVHRIRCHNLLHEQHLHPENIMPLQWKADDVDDVRFTAYLAIYMAMNDEQVSD
FT                   LIYQCRKNNAGVEMVHSNEQRTFVNIVVNNRKHIAKVIRDLRMHYGFPRIERLDAPAPQ
FT                   MEISKVS"
FT   gene            complement(302476..302754)
FT                   /gene="rpoZ"
FT                   /locus_tag="ABSDF0321"
FT   CDS_pept        complement(302476..302754)
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="ABSDF0321"
FT                   /product="RNA polymerase, omega subunit"
FT                   /function="2.2.2 : transcription related"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99715"
FT                   /db_xref="GOA:B0VQ51"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQ51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99715.1"
FT                   /translation="MARVTVEDCLDHVDNRFELVLVASKRARQLARQGMEPTVEWDNDK
FT                   PTVVALREIAVGHVTKEILKQREQDYQTSSLDLALSTNSLNLEGFSF"
FT   gene            complement(302827..303456)
FT                   /gene="gmk"
FT                   /locus_tag="ABSDF0322"
FT   CDS_pept        complement(302827..303456)
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="ABSDF0322"
FT                   /product="guanylate kinase"
FT                   /function="1.5.2.3 : purine ribonucleotide biosynthesis"
FT                   /EC_number="2.7.4.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99716"
FT                   /db_xref="GOA:B0VQ52"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99716.1"
FT                   /translation="MSGLLFVVSAASGTGKTSLVKALLDRVSNLHVSVSHTTRGQRPGE
FT                   LDGVHYHFTTKDEFLDQVNQGGFIEYAEVFGNYYGTSQATVKQQLAQGHDVLLEIDWQG
FT                   AEQVRKLFPESKQIFILPPTQFDLRQRLSNRGTDSVEVIEHRLSCAVEDMQHYVNFDYI
FT                   IINDDFNKALHELEAVITANRLVLSQQAKRHQNLIQDLITPQPKQE"
FT   gene            303579..304529
FT                   /gene="ispH"
FT                   /locus_tag="ABSDF0323"
FT   CDS_pept        303579..304529
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="ABSDF0323"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase (also involved in penicillin tolerance and
FT                   control of the stringent response. Seems to directly or
FT                   indirectly interact with relA to maintain it in an inactive
FT                   form during normal growth.)"
FT                   /function="3.1.4 : regulation level unknown"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /EC_number="1.17.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99717"
FT                   /db_xref="GOA:B0VQ53"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQ53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99717.1"
FT                   /translation="MEIVLANPRGFCAGVDRAIAIVNRALECFNPPIYVRHEVVHNKFV
FT                   VDDLRQRGAVFVDELDQVPDDSIVIFSAHGVSKAVQQEAERRGLKVFDATCPLVTKVHI
FT                   EVTKYAREGTEAILIGHEGHPEVEGTMGQYDKLKGGDIYLVEDEADVAALEVRHPEKLA
FT                   FVTQTTLSIDDTAKVIDALRAKFPNIQGPRKDDICYATQNRQDAVRDLAEKCDVVLVVG
FT                   SPNSSNSNRLRELAERMGKAAYLVDNADQLEQSWFNDTCKIGVTAGASAPEILIKQVIQ
FT                   RLQDWGAQAPKELEGREENITFSLPKELRIHVTQA"
FT   gene            complement(304838..305650)
FT                   /locus_tag="ABSDF0324"
FT   CDS_pept        complement(304838..305650)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0324"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99718"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VNG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99718.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTVCRRQKHID
FT                   IAISYQQNRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            305680..306114
FT                   /gene="comF"
FT                   /locus_tag="ABSDF0325"
FT   CDS_pept        305680..306114
FT                   /transl_table=11
FT                   /gene="comF"
FT                   /locus_tag="ABSDF0325"
FT                   /product="pilin like competence factor"
FT                   /function="1.6.13 : fimbria, pili"
FT                   /function="2.3.3 : posttranslational modification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99719"
FT                   /db_xref="GOA:B0VQ55"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99719.1"
FT                   /translation="MNSFMQQSPLIEIMIVVAIIAILAAIVTPSYLQYLRKGHRTAVQS
FT                   EMMNIAQTLESEKVVHNRYPSNATIQSIYGSNVSPIQGQALYKLAFATLNDSTWVLTAT
FT                   PISTSSQAGDGIICLNDQGQKFWAKGATVCALSASSSWTE"
FT   gene            306262..306513
FT                   /gene="rpsP"
FT                   /locus_tag="ABSDF0326"
FT   CDS_pept        306262..306513
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="ABSDF0326"
FT                   /product="30S ribosomal protein S16"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99720"
FT                   /db_xref="GOA:B0VQ56"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQ56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99720.1"
FT                   /translation="MVVIRLARGGAKKRPFYQIVVTDSRNARDGRFIERIGFFNPTAQG
FT                   QAEKLRLDADRFAHWVSQGAQPSERVASLAAQAKKATA"
FT   gene            306533..307081
FT                   /gene="rimM"
FT                   /locus_tag="ABSDF0327"
FT   CDS_pept        306533..307081
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="ABSDF0327"
FT                   /product="16S rRNA processing protein"
FT                   /function="2.2.6 : rRNA, stable RNA"
FT                   /function="2.2.3 : RNA modification"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99721"
FT                   /db_xref="GOA:B0VQ57"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99721.1"
FT                   /translation="MTPTQNVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPW
FT                   YIETKAGWQIVDVKRWKPHGKGLVVALKGVSDRTGAESLVGANIWIAKSQLPKADVDEY
FT                   YWSDLKGLTVLGLDDDEQEVNLGQIHELFETGANDVMVVRATPDSIDSEERMIPWHKDV
FT                   VQRVDLEAGRIYVNWGVDY"
FT   gene            307127..307867
FT                   /gene="trmD"
FT                   /locus_tag="ABSDF0328"
FT   CDS_pept        307127..307867
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="ABSDF0328"
FT                   /product="tRNA (guanine-1-)-methyltransferase."
FT                   /function="2.2.5 : tRNA"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="2.1.1.31"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99722"
FT                   /db_xref="GOA:B0VQ58"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQ58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99722.1"
FT                   /translation="MFFAVITLFPEMFEAITAYGISGRAAKRDIVQVTCINPRDFAEGS
FT                   YRRVDERPFGGGPGMVMMAEPLAKAINHAKQLASQAGCVHVPVVYMSPQGKTLNEQAVQ
FT                   QFVDYDGLIVLCGRYEGVDERLIQHYVDQEWSIGDYVLSGGELPAMVLLDSIIRRLPNV
FT                   MSDEQSAIQDSFVDGLLDCPQYTKPDQFEGLDVPEILKSGHHANIEKWRFLQRYQRTLE
FT                   RRPELIEQVTLTKQQKKWLSDEQG"
FT   gene            308076..308444
FT                   /gene="rplS"
FT                   /locus_tag="ABSDF0329"
FT   CDS_pept        308076..308444
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="ABSDF0329"
FT                   /product="50S ribosomal protein L19"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99723"
FT                   /db_xref="GOA:B0VQ59"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQ59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99723.1"
FT                   /translation="MSGKHPLVQAIENSQLKTDLPEFAPGDTVVVQVKVKEGDRERLQA
FT                   FEGVVIAKKNRGLNSAFTVRKISSGVGVERVFQTHSPVVAKIEVKRRGDVRRAKLYYLR
FT                   DLSGKAARIREKLPARKA"
FT   gene            complement(308497..309072)
FT                   /pseudo
FT                   /locus_tag="ABSDF0330"
FT   CDS_pept        complement(308497..309072)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0330"
FT                   /product="fragment of lipase (part 2)"
FT                   /function="1.1.2 : fatty acids"
FT                   /function="1.7.6 : glycerol metabolism"
FT                   /function="1.8 : metabolism of other compounds"
FT                   /EC_number="3.1.1.3"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99724.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(308997..309470)
FT                   /pseudo
FT                   /locus_tag="ABSDF0331"
FT   CDS_pept        complement(308997..309470)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0331"
FT                   /product="fragment of lipase (part 1)"
FT                   /function="1.1.2 : Fatty acids (fatty acid oxidation)"
FT                   /function="1.7.6 : Glycerol metabolism"
FT                   /function="1.8 : Metabolism of other compounds"
FT                   /EC_number="3.1.1.3"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99725.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(309552..310451)
FT                   /gene="lifO"
FT                   /locus_tag="ABSDF0332"
FT   CDS_pept        complement(309552..310451)
FT                   /transl_table=11
FT                   /gene="lifO"
FT                   /locus_tag="ABSDF0332"
FT                   /product="lipase chaperone (Lipase foldase) (Lipase helper
FT                   protein) (Lipase activator protein) (Lipase modulator)"
FT                   /function="2.3.4 : chaperoning, folding"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99726"
FT                   /db_xref="GOA:B0VQ62"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99726.1"
FT                   /translation="MVATSQSTLNSSLNENTYLSKSQQDTQVNCQLKIDSSQHLVVNSQ
FT                   TRDCFEYFITQYGESNLQQVKTHFKKFIQDQYLEPARSQIIDLWTRYLKYREQLAQIQP
FT                   PQSKKQDQNYFQKIFSSIQDIRKRFFSASEIEGLFSTEDIYQNYTLDRMKILEDSSLSE
FT                   IEKAKKLKERFEQLPEDWQENLQELSKLDDLHTLTKQIKARNGSAEELRQMRTALVGAE
FT                   ATQRLETLDIQRNAWQQRVTGYLNQRDEVLHSNMSDSAKKQAIQQLRQQQFSSSQEQLR
FT                   LRTFETVHDQGGELPFNY"
FT   gene            310741..311646
FT                   /gene="truB"
FT                   /locus_tag="ABSDF0333"
FT   CDS_pept        310741..311646
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="ABSDF0333"
FT                   /product="tRNA pseudouridine 55 synthase"
FT                   /function="2.2.5 : tRNA"
FT                   /EC_number="4.2.1.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99727"
FT                   /db_xref="GOA:B0VQ63"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99727.1"
FT                   /translation="MTTKNQKISRRHISGVFLLNKPLGLSSNAALQKVRWLYRAQKAGH
FT                   TGALDPLATGLLPICLGEATKFSHYLLDSTKRYQTTVRLGQTTTTGDVEGDILQERPIP
FT                   VLSKELIEQTLEKFRGDIQQVPPMYSALKKEGKPLYELARKGIEIEREARPVTIYALEL
FT                   IEFTENSITLDVTCSKGTYIRVLGEDIGEALGCGGHLTMLHRIQTGHFELIPSYTIEYL
FT                   ESLTEEQREALLLPVYAPIYHFLKIQVPEGREKYFCNGLESNIDHSAEAEVLVFSGERC
FT                   LGLAEITDKKRLVPKRILNL"
FT   gene            311672..312442
FT                   /locus_tag="ABSDF0334"
FT   CDS_pept        311672..312442
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0334"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99728"
FT                   /db_xref="GOA:B0VQ64"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99728.1"
FT                   /translation="MEWDVILSLIFFAFTAGAIDAAVGGGGLIQIPGIMSTFPNMSTAT
FT                   VIGTNKVSSIFGTASAAYTFAKKVKLQWKLLAVIAICALISSFAGAACLSLIPQSVLRP
FT                   FVFVMLIVIAIYTLVKKNFGQVHTEQKITTKMLVLAGIGSLAIGFYDGIFGPGTGSFFI
FT                   FFFIRFLQVDFLHASALSKIGNFMTNLAALSFLIPTGHAILHIGLMMAAANVLGSIVGV
FT                   RTALKYGSGFVRIIFLILVSILICRLGYQMFVTG"
FT   gene            312652..313095
FT                   /locus_tag="ABSDF0335"
FT   CDS_pept        312652..313095
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99729"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99729.1"
FT                   /translation="MNIFEALRESHENQRNLSEQLIQTHGLTEERKELFDALKNELYAH
FT                   SVAEDRYLYIPLMFDDVGLDITRHALSEHHEMDELVGQLEKTDMSSPSWLATAKQLSEK
FT                   VHHHLKEEEHKFFQQAGKILKDSEKETLGNKYLKEYKKYKKQQ"
FT   gene            complement(313103..313963)
FT                   /locus_tag="ABSDF0336"
FT   CDS_pept        complement(313103..313963)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0336"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99730"
FT                   /db_xref="GOA:B0VQ66"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99730.1"
FT                   /translation="MQNLPIIAVLYMILSMVSYQISASFAKQLIAALDPLTVTILRLCF
FT                   AAVIVAVMFRSWKIWSRLPYLKWRDLLMYCASLGLMNILFYTSLGKLPQGIAVGLEFIG
FT                   PLGLALVSIKQKSEYIWVAFAMLGIALMVPWQDPTQHHFSYVGAACALGAGLCWAFYIY
FT                   FGQKVVTQNIGMHALTIGITVSALALLPIGIWYNGPALLDTQYWGKALLIAVLATAIPY
FT                   ALDLMALKQLNKLTYGTLTSLAPALAALTGFLLLHEEISMLQWVALACVMLASIGVTLR
FT                   SKTAS"
FT   gene            complement(314054..314938)
FT                   /locus_tag="ABSDF0337"
FT   CDS_pept        complement(314054..314938)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0337"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99731"
FT                   /db_xref="GOA:B0VQ67"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99731.1"
FT                   /translation="MSSPSQKSQLHALGFLILAMLSVQSSASLAKVLFQNFPVLTVSAM
FT                   RLCIGAFILAFIFQIWKINFSQVRWKAILSYGFALAGMNALFYLSLERLPIGIAVAFEF
FT                   IGPLSVALYHAKQKYDFFWVTFAIIGLILLFPFNQAHSLDWIGVLFAMSAGACWALYII
FT                   AGQKPSGISGNHTVCLGMTVGACILLPITFFSGSIGQVIELPYFFYFIGLAVLASALPF
FT                   SLEMLALRNLTPLSFGTLMSLEPAVAALSGFIFLGEYLLWNQWLALATIITASVGCTIT
FT                   TQRARQQREKTVS"
FT   gene            complement(315037..316269)
FT                   /gene="serA"
FT                   /locus_tag="ABSDF0338"
FT   CDS_pept        complement(315037..316269)
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="ABSDF0338"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /function="1.5 : building block biosynthesis"
FT                   /function="1.5.1.11 : serine"
FT                   /EC_number="1.1.1.95"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99732"
FT                   /db_xref="GOA:B0VQ68"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99732.1"
FT                   /translation="MSQHLSLPKDKIRFLLLEGVHQNAVDTLNAAGYTNIDYRKTALEG
FT                   EALKEAIKDAHFIGIRSRTQLTEEVFEAANKLIAVGCFCIGTNQVDLKAAMARGIPVFN
FT                   APYSNTRSVAELVLAETILLLRRVPEKSAACHRGGWDKSAVGSFETRGKTLGIVGYGSI
FT                   GSQLSVLAESMGMNVIYYDAVTKLPMGNARQVGSLDELLATADVVTLHIPDVPSTRNFF
FT                   TKEQFAKMKEGAIFLNAARGTCVVIEDLADAIKSGHLAGAAVDVFPKEPKANGEEFQSP
FT                   LRGLDNVILTPHVGGSTMEAQANIGLEVAEKFVAYSDKGMTLSAVNFPEIALPLTAGQH
FT                   RLLHIHKNVPGVLSKINNLFAEQGINISGQSLMTKGDIGYLVMDVDASASQEALDMLHE
FT                   VEGTIRVRVLF"
FT   gene            316655..318064
FT                   /locus_tag="ABSDF0339"
FT   CDS_pept        316655..318064
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0339"
FT                   /product="putative FAD/FMN-containing dehydrogenase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99733"
FT                   /db_xref="GOA:B0VQ69"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99733.1"
FT                   /translation="MNAPVALTPELLTQLTAIVGENRIKTDADSLENWGKDHTKHFNPN
FT                   PSVIVFPSTTEQVQEVVKLANQFNIAITPSGGRTGLSAGAVATKGEIVISMDKMNQILE
FT                   FFPADRMVRVQAGVVTEQLQNYAEEQGMYYPVDFASAGSSQIGGNIGTNAGGIKVIKYG
FT                   MTRNWVLGLTVVTGKGDILRLNKGMIKNATGYALQHLFIGGEGTLGLVTEAEIKLERQP
FT                   QNLQVLVLGVPDFDAVMPVLHAFQKDIDLTAFEFFGELTMQKVLDRGHVQRPFETQCPF
FT                   YVLLEFEAPYEPIIDKAMEIFEHCMEQGWVLDGVMSQSLDQVESLWRLREDISESIAPF
FT                   IPYKNDISVLITHVPAFIREIDAIVQENYPYFEICWFGHIGDGNLHLNILKPENLTKDE
FT                   FFAKCQVVNKYVFDTVKKYDGSISAEHGVGMTKKPYLEYSRSAEEIEYMKALKKVFDPK
FT                   GIMNPGKLFDL"
FT   gene            318151..318444
FT                   /pseudo
FT                   /locus_tag="ABSDF0340"
FT   CDS_pept        318151..318444
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0340"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99734.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            318510..319415
FT                   /locus_tag="ABSDF0341"
FT   CDS_pept        318510..319415
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0341"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99735"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99735.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            319491..320720
FT                   /gene="mdfA"
FT                   /locus_tag="ABSDF0342"
FT   CDS_pept        319491..320720
FT                   /transl_table=11
FT                   /gene="mdfA"
FT                   /locus_tag="ABSDF0342"
FT                   /product="multidrug/chloramphenicol efflux transport
FT                   protein (MFS superfamily)"
FT                   /function="5.6.4 : drug resistance/sensitivity"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99736"
FT                   /db_xref="GOA:B0VQ72"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99736.1"
FT                   /translation="MKNIQTTALNRTTLMFPLALVLFEFAVYIGNDLIQPAMLAITEDF
FT                   GVSATWAPSSMSFYLLGGASVAWLLGPLSDRLGRKKVLLSGVLFFALCCFLILLTRQIE
FT                   HFLTLRFLQGIGLSVISAVGYAAIQENFAERDAIKVMALMANISLLAPLLGPVLGAFLI
FT                   DYVSWHWGFVAIALLALLSWVGLKKQMPSHKVSVTKQPFSYLFDDFKKVFSNRQFLGLT
FT                   LALPLVGMPLMLWIALSPIILVDELKLTSVQYGLAQFPVFLGLIVGNIVLIKIIDRLAL
FT                   GKTVLIGLPIMLTGTLILILGVVWQAYLIPCLLIGMTLICFGEGISFSVLYRFALMSSE
FT                   VSKGTVAAAVSMLLMTSFFAIIELVRYLYTQFHLWAFVLSAFAFIALWFTQPRLALKRE
FT                   MQERVAQDLH"
FT   gene            complement(320757..322907)
FT                   /locus_tag="ABSDF0343"
FT   CDS_pept        complement(320757..322907)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0343"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99737"
FT                   /db_xref="GOA:B0VQ73"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99737.1"
FT                   /translation="MNNLTQLFNRFKANSILIYCLQILIVLTGTTLGLLWLGHNELIVP
FT                   VTLGAIAAALTDFDDRLSLRLRNLLYVCLLFFTVSTILGFLAPYKFLFILYLSISSACF
FT                   ILLGALGQRYATISFGSILLSIYSMFGLGEYAHWYQQPTYFVYGALWYGLTSILFFILK
FT                   PTLPLQDKLSQIFEEISALLQAKARLFDPDNKENVEQLLFELSLQNTQVAQSLNQIRSS
FT                   LLTRLKASRVSNKSIYWLNLYFFAQDIHEQATSNYLHYEHIQQNFSRSDLIFRFQKNLR
FT                   LQAQACHDLAQCILHNQQYQSSQESQIGLNHLESSLKDWIQQHPQNFEVKNLKLIFNNL
FT                   KGMHEQFEQLQYAQPFNETLSQNKQEHLNLLDDDIQGFSDLVLKIRQQLTPQSALFRHA
FT                   VRIAVVFAAGYAISLLPFAQHGYWILLTSLFVCQITYFATKSRLKLRTIGTLLGVLLGI
FT                   PILYFVPSIEGQLILTIICGVSFFYLRQKKYALATLMATLMVLLIFNLKGAGYSIILPR
FT                   LIDTLLGCFIAWLAVNFIWPDWNFRNIPNNIKKSSQATFDYFNVIVEQYQHGKNQDIEY
FT                   RRIRRAAHNAQIELSNMISSLSAEPNPNPELIHYAFRYLVYSHSQLSYVAALGSQRQKI
FT                   DDQQVLQLLLDCQQILKQSLFEQASVNFSFLEQTLKQIQSLITHEHFSENYTLVLKQMS
FT                   LLLETLPELLSLKGKLLEHEIK"
FT   gene            complement(323102..323719)
FT                   /gene="sodC"
FT                   /locus_tag="ABSDF0344"
FT   CDS_pept        complement(323102..323719)
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="ABSDF0344"
FT                   /product="superoxide dismutase precursor (Cu-Zn)"
FT                   /function="5.6.2 : Detoxification (xenobiotic metabolism)"
FT                   /EC_number="1.15.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8626323; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99738"
FT                   /db_xref="GOA:B0VQ74"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99738.1"
FT                   /translation="MNKKIRFIVIRISIMPVFNKIGAVCALTALLTVGCSTVSKTVSDT
FT                   AHALTTMHTKKVVDVNEVTANGIGKKIGTISFQDSDKGLIITPALADLPSGTRGFHIHE
FT                   NPSCAPAVKDGKPGAALAAGSHYNPNQAPHHGTPTTGHLGDLPALVVDNTGVATTAVIA
FT                   PRLKLADIQGRAIMIHAGGDNYSDSPLPLGGGGARIACGVIK"
FT   gene            complement(323793..324911)
FT                   /locus_tag="ABSDF0345"
FT   CDS_pept        complement(323793..324911)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0345"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99739"
FT                   /db_xref="GOA:B0VQ75"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99739.1"
FT                   /translation="MHPYAPTLQRVLLFGLFFILIFLGFNILKYFIVPVLWAAIIAYMT
FT                   WPIYLRIQHFFGENRNNLNATVMISLVILIVGVPFTCAIFILQHEGRNLYFDLQRQVFS
FT                   GHLSVPDFIRNLPFIGKEISRTLNEINTDPNSTIQNIAAWVQSHLSYGRVLLNEISKNI
FT                   VKLCFAILSLFFFYRDGHTILTQVSKALEMVIGPRIHHYLDTISETTRAVVYGVGLTAI
FT                   AQAVLAGLSYFVAGVPNPMVLTIATFLLALIPFGTPVSYLGVGLWLFSQGQTMEAIGVI
FT                   LWGVLIVSSSDNVIRPLVISGATQIPFLLIMFGVLGGIASFGLVGLFIGPVILAVLLAI
FT                   WREWLHETIDPEPMPKTTMIYDSDDDLPPSKN"
FT   gene            complement(325034..325678)
FT                   /locus_tag="ABSDF0346"
FT   CDS_pept        complement(325034..325678)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0346"
FT                   /product="putative partition-related protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99740"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99740.1"
FT                   /translation="MKTILIANQKGGCGKTMTAITLATALAQKGYKVALADSDNQKSSL
FT                   QWLKQRPDNVAVIQSLDWRQEKSIGDAPKNLDYLIIDAPGALSGDHAEQLVSEAHAIIT
FT                   PLQPSFFDIDSTRRFLKHLQDIKRIRKGKVQILLLANRVKPNSASSKDIQQFFEKIEHE
FT                   PIAWIAERSAYGSLAMQGLSVFDKPQKNFIAIQSQWQPLLNKLIEDKSEWF"
FT   gene            325855..326304
FT                   /locus_tag="ABSDF0347"
FT   CDS_pept        325855..326304
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99741"
FT                   /db_xref="InterPro:IPR019287"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99741.1"
FT                   /translation="MLIGAGIGIIITTLILSNTRNGRIKAEYEQYIAELELEHQQALAQ
FT                   AQKRSVNTSRAVLKGKMAEQFAPVLPEFQYLPSDAKFMGDPVDYIIFDGYTDFRDGDGT
FT                   ADDIQIILLDVKSGGARLTKGQQAIAQAIKEGKVRFETLRIDFED"
FT   gene            326429..327007
FT                   /locus_tag="ABSDF0348"
FT   CDS_pept        326429..327007
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0348"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99742"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99742.1"
FT                   /translation="MRYKAMKKQRLMIALLATLGMGSAFASTSSEYNIANGLLPVEKDQ
FT                   SISVLQPFQGNFRILGSKIYHNDEQAKFSPIDYAVSWGLFAQPEIARHISVKQYDRYLN
FT                   WKIAKLPVPAEQAMQMVSNMHIIPANPEIAQQIKQVKRGDLVYLKGDLVEIKDKDLVWK
FT                   SSLTPTDIGNGACELFRVQSIHWVEKQNI"
FT   gene            complement(327057..327599)
FT                   /locus_tag="ABSDF0349"
FT   CDS_pept        complement(327057..327599)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0349"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99743"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99743.1"
FT                   /translation="MKAMLKKTPHIILMSLLSSSLLSTACKKADEPAKTEQPHTSSSTD
FT                   QVLEKLNERPVKKFPATADDAHDIALLEDYDRRFTEMSDEMENELAKMHEAGTLTAEFE
FT                   QKRTLDNVHSTLTMLKDLDLKTEQGRYIQGLLYQYWENQEKNFSDKQASKDEQVKQLAD
FT                   YLQAQNQLKYWKASQQH"
FT   gene            complement(327606..328034)
FT                   /pseudo
FT                   /locus_tag="ABSDF0350"
FT   CDS_pept        complement(327606..328034)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0350"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   2)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99744.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(328065..328400)
FT                   /pseudo
FT                   /locus_tag="ABSDF0351"
FT   CDS_pept        complement(328065..328400)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0351"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   1)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99745.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            328528..329805
FT                   /locus_tag="ABSDF0352"
FT   CDS_pept        328528..329805
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99746"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99746.1"
FT                   /translation="MDKQIIFEDEHIRAIFLQGDSNTLVLSFGDLITRASGLSINAEKS
FT                   LIKYQYNVIGVMPKQKSWFPKASMVELAKVILPIIQRFKNIVGYGGSMGGYAAIKYSNL
FT                   LNMNRIIAFVPQYSIDPEQVEDRRYAEFFDAVANNDMQIQPQDVDASREYIIVYDPYFS
FT                   IDREHYLKIKEILPSLHTIHLPFTGHEALSVLASSSLLHDFIEHEFDETYFYQQVRKIK
FT                   KQSKFYYRNVLANVLTYHDSMLLKILRQNDFQLDERYLDNPLKQAVTRSLIKTKQATEQ
FT                   DFQKLGIKIQYSQQAKNPKKGFKNQFDAILVFNLINLKLETYAVDVVLANPSYLIPIVA
FT                   GHTGVVQIELNNELYLLGMNDRKIIKLFKQGDALTSDMSPFVIKQYSDFFALSYKQLNL
FT                   NCDKQGVCDYVESSIQPSQQFVLTSY"
FT   gene            329956..330768
FT                   /locus_tag="ABSDF0353"
FT   CDS_pept        329956..330768
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0353"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99747"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99747.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKHID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWSKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            331790..333061
FT                   /gene="gdh"
FT                   /locus_tag="ABSDF0354"
FT   CDS_pept        331790..333061
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="ABSDF0354"
FT                   /product="glutamate dehydrogenase (NAD(P)+) oxidoreductase
FT                   protein"
FT                   /function="1.5.1.1 : glutamate"
FT                   /EC_number="1.4.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99748"
FT                   /db_xref="GOA:B0VQ84"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99748.1"
FT                   /translation="MSDLSYVNEHSDAWQTYLAQIDRVAPYLEHLADYIDTLKRPKRAL
FT                   IVDVPIVMDDGSIQHFEGYRVQHNLSRGPGKGGVRYHPNVDLNEVMALSAWMTIKTAVL
FT                   NLPFGGAKGGIRVDPRKLSNRELERLTRRYTTEIGHIIGPQKDIPAPDVGTNANIMGWM
FT                   MDTYSTSQGHTVTGVVTGKPVHLGGSLGRVKATGRGVFVTGREVAAKINLPIEGAKVAV
FT                   QGFGNVGSEAAFLFVESKAKITHVQDHTGTIFNADGIDLVALRDHVNANQGVGGFAGAQ
FT                   AIADEDFWTAEVDIIIPAALEGQITVERAEKLKAKLILEGANGPTYPKAEDVLVERGIV
FT                   VVPDVVCNAGGVTVSYFEWVQDMASYFWSEEEINERLDKLMVQAMDDVWNTANKNACTL
FT                   RTAAYILACERILKARKERGIFPG"
FT   gene            333197..334411
FT                   /gene="astC"
FT                   /locus_tag="ABSDF0355"
FT   CDS_pept        333197..334411
FT                   /transl_table=11
FT                   /gene="astC"
FT                   /locus_tag="ABSDF0355"
FT                   /product="succinylornithine transaminase (also has
FT                   acetylornitine transaminase activity, PLP-dependent)
FT                   (carbon starvation protein C)"
FT                   /function="1.1.3 : amino acids"
FT                   /EC_number="2.6.1.-"
FT                   /EC_number="2.6.1.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99749"
FT                   /db_xref="GOA:B0VQ85"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99749.1"
FT                   /translation="MEQPISVTRSNFNDWMVPVFAPANFIPVRGEGSRIWDQENKEYID
FT                   FAGGIAVNALGHAHPVAVNALTEQAKKLWHVGNGYTNEPVLRLAKQLTENTFADKVFFC
FT                   NSGAEANEAALKLARKVGLDSGVAGKSGIVAFNNAFHGRTLFTVSAGGQPKYSQDFAPL
FT                   PNGISHVAYNDLEAAKAVINEQTCAVIVEPVQGEGGVIPADIEFLKGLRELCDQFGALL
FT                   IFDEVQTGVGRTGALYAYMNYGVVPDVLTTAKALGGGFPVGAMLTTDKFAPHFSVGTHG
FT                   TTYGGNPLASAVAGAVFEFINTPEVLEGVKHRHQYFLDALNALNAEYQVFDEIRGQGLL
FT                   IGCVLKAEYAGKAKDITTWAGEEGLLALIAGPNVVRFTPSLIIPEQDIDEGIARLKRAL
FT                   AKLAK"
FT   gene            334430..335461
FT                   /gene="astA"
FT                   /locus_tag="ABSDF0356"
FT   CDS_pept        334430..335461
FT                   /transl_table=11
FT                   /gene="astA"
FT                   /locus_tag="ABSDF0356"
FT                   /product="arginine succinyltransferase"
FT                   /function="1.1.3 : amino acids"
FT                   /EC_number="2.3.1.109"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99750"
FT                   /db_xref="GOA:B0VQ86"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99750.1"
FT                   /translation="MMIVRHAEFRDLEDIYKLAGKSGVGLTSLPQNMDTLSARISRTRN
FT                   TLNGNVHKSEQGYLFVLEDTEAQRVIGVSAIEVAVGLIEPWYNFHVGTQVHASKALNVY
FT                   KSLPTLFLSNDRTGSSELCTLFLDPERRENQNGKFLSKIRFMFIAAFKQYFEKKLIAEM
FT                   RGYSDENGCSPFWDAIGHHFFNMDFSTADYLSGIGQKVFIAELMPRFPVYVDLLPKDAQ
FT                   EVIGKMHPHTLPAYHVLESEGLRYQGYVDIFDAGPTIEANIDELRAVKESQLLNVKITN
FT                   EATVGKTQYLVANDNYHDYRAMLLKLDLVDNTLNLTHEQAEKLGVQEGRAVRVLSLNPM
FT                   EVS"
FT   gene            335461..336930
FT                   /gene="astD"
FT                   /locus_tag="ABSDF0357"
FT   CDS_pept        335461..336930
FT                   /transl_table=11
FT                   /gene="astD"
FT                   /locus_tag="ABSDF0357"
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /function="1.1.3 : amino acids"
FT                   /EC_number="1.2.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99751"
FT                   /db_xref="GOA:B0VQ87"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99751.1"
FT                   /translation="MSNSLFINGVWLQGSGTTFVKTNPVDNQTVWSGAEATASDVEKAC
FT                   QAARTAFPAWARLAFAERVAIVEKFAALLEENKKHLAEVISQETSKPFWETLTEVQSMI
FT                   GKVAISIRAYHQRTGESSTEMADGVASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLA
FT                   GNTVVFKPSELTPWTAEETVKLWQQAGLPNGVMNLVQGGRTTGEALAASHEIDGLLFTG
FT                   SANTGYHLHKQMAGAPEKILALEMGGNNALIIDEIENMDAVVNLTIQSAFVSAGQRCTC
FT                   ARRILVKNGAQGDAFIQRFVEVAKNLKVGRWNDEQQPFMGGVISSAAATNMMNAQQKLL
FT                   ELGAKSLLPMTRPQEDSSLLTPGIIDVTGVAGIPDEEYFGPLTTIQRYDSFDEALKIAN
FT                   ATRFGLSVGLVSPKRELFDDLLIEARAGIVNWNKPLTGASSAAPFGGVGASGNHRASAF
FT                   YAADYCAWPMASLESESLTLPEKLSPGIVLP"
FT   gene            336948..338291
FT                   /gene="astB"
FT                   /locus_tag="ABSDF0358"
FT   CDS_pept        336948..338291
FT                   /transl_table=11
FT                   /gene="astB"
FT                   /locus_tag="ABSDF0358"
FT                   /product="succinylarginine dihydrolase"
FT                   /function="1.1.3 : amino acids"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99752"
FT                   /db_xref="GOA:B0VQ88"
FT                   /db_xref="InterPro:IPR007079"
FT                   /db_xref="InterPro:IPR037031"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQ88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99752.1"
FT                   /translation="MKGYEVNFDGLVGPTHHYAGLSFGNEASTKNCNNLSNPKLAAKQG
FT                   LLKMKALADMGMKQGVLAPHERPHVPMLRRLGFTGDDISVVAQAMRYSPELLSSLSSAS
FT                   PMWTANAATVSPSADSQDERVHFTAANLNNKFHRSIEAETTSQVLQAIFKNERHFVHHE
FT                   ALPQVALFGDEGAANHNRLGGDYAKRGVQVFVYGQQHLNNGLPGPKRYPARQTREASEA
FT                   IARLHRLDESHTVFVQQNPDVIDQGVFHNDVIAVSNQQVSFHHQHAFLNQDQAFAEIRQ
FT                   KMASIGEDFISIEVPENRVTVDDAVATYLFNSQILTRPDGGMTIVVPEESRQNAAVWSY
FT                   LNDMIQMGTPIDAIQVYDLRESMRNGGGPACLRLRVALNETELNAVNPKVLMNDQLFMT
FT                   LNQWVDKHYRDRLAQEDLADPHLLMESRMAFDELTKILGLGSVYPFQK"
FT   gene            338304..339278
FT                   /gene="astE"
FT                   /locus_tag="ABSDF0359"
FT   CDS_pept        338304..339278
FT                   /transl_table=11
FT                   /gene="astE"
FT                   /locus_tag="ABSDF0359"
FT                   /product="succinylglutamate desuccinylase"
FT                   /function="1.1.3 : amino acids"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99753"
FT                   /db_xref="GOA:B0VQ89"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016681"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQ89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99753.1"
FT                   /translation="MQDFLALTLQGEQPATREGKQANFSWRWLGEGLLECTPHAQYDKA
FT                   VVLSAGVHGNETAPIELLSHLCTDLFAGRLKLAVRLLLVLGNPYAMRQGKRYVHDDVNR
FT                   MFCGGYKNLPVTEESKRAEVLEQTVATFFQESSSQAKRYHYDLHTAIRASLLPTFALFP
FT                   YQTHSYDADLTASLEAADLDALVYHNAVGKTFTHFTSENFKAASATLELGKALPFGQND
FT                   LSQFASIDEVIRNVVSEQALPVRNKPKIRVFQVSDSLIKKDEEFHMNLSAEAPNFSTFT
FT                   KGEIIATQPSGNYVVEQDQVWILFPNPNVKIGLRAGLVLTETI"
FT   gene            complement(340024..340929)
FT                   /locus_tag="ABSDF0360"
FT   CDS_pept        complement(340024..340929)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0360"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99754"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99754.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(340969..341103)
FT                   /pseudo
FT                   /locus_tag="ABSDF0361"
FT   CDS_pept        complement(340969..341103)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0361"
FT                   /product="fragment of conserved hypothetical protein;
FT                   putative exported protein (partial)"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="PSEUDO:CAO99755.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            341699..342010
FT                   /locus_tag="ABSDF0362"
FT   CDS_pept        341699..342010
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0362"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99756"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99756.1"
FT                   /translation="MMKIIASLLVIVGLIAVVLYFKPTSGASDVFNSALHETNSPQPDT
FT                   SSSLSKLKEPTQPKNVSLNSNHSQSVSADTVPFYDTKSDPSIQPIDPEKDPANEIKAK"
FT   gene            342016..343401
FT                   /locus_tag="ABSDF0363"
FT   CDS_pept        342016..343401
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0363"
FT                   /product="putative alkaline protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99757"
FT                   /db_xref="GOA:B0VQ93"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99757.1"
FT                   /translation="MLVEKLRRKIMQSKTLFLLGLCTIFSTTVSALPLDSKGAKQRLSQ
FT                   AAKQKVFQGKIDLDALVSNDSNDLIVEYNIPSSSVSSGLERRSYIATNKKNLQTRFSRA
FT                   GGVQVLRDYNNLPLAFYRISNREALIALLNDPNVKAVYPNRINRTTTTESLPLINQPQA
FT                   NTNGFTGEGSSVAVLDTGVNYLHSDFGCTAVNTPSSTCRVVYSFDSAPDDGTLDDDGHG
FT                   SNVSAIVSKVATKTKIIGIDVFRKVRSQGKWVSTAYDSDILAGINWAVNNAQTYNIKAV
FT                   NLSLGVPGVKYTSECSDSSYGTAFANARAAGVVPVVASGNDAFPDGISSPACVAGAVRV
FT                   GAVYDSNIGGVSWGNPVKCSDPTTAADKVACFSNGGSLVTLLAPGAMITAGGYTMGGTS
FT                   QATPHVAGAIALLRANSVSPTESIDQTISRLKATGKPITDSRTGLVFPRIDLLAATNGL
FT                   TVN"
FT   gene            343483..344388
FT                   /locus_tag="ABSDF0364"
FT   CDS_pept        343483..344388
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0364"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99758"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99758.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(344508..344939)
FT                   /locus_tag="ABSDF0365"
FT   CDS_pept        complement(344508..344939)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0365"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99759"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99759.1"
FT                   /translation="MNSQKLLFSTLCCLALTACATTAPLSSYPQAQVLEQDTNIKAYPT
FT                   TTGNVAKLIKHDKQACMIEFTGYLGGGQVTEHWIFNNKGLISAQSFTEQYPDSSGILSQ
FT                   ATNSTTKSSTTFNIQNPEIQNNFKKLQSNFNKDNLAKCD"
FT   gene            complement(345034..345453)
FT                   /locus_tag="ABSDF0366"
FT   CDS_pept        complement(345034..345453)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0366"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99760"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99760.1"
FT                   /translation="MKAIKILCITSSILVSSSLFAETPQPQQVNEATSKTMPYGDNPSL
FT                   GRVLLYKTGKGIQNLGDSIQGASEKTSNKISEKWKDTKEFTAEKAEVVQQKADTAKVFT
FT                   EQKIEQAKQNITSSRNGENIPIEQGELSKSSTTAN"
FT   gene            complement(345602..346447)
FT                   /locus_tag="ABSDF0367"
FT   CDS_pept        complement(345602..346447)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0367"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99761"
FT                   /db_xref="GOA:B0VQ97"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99761.1"
FT                   /translation="MFQTVVECGTMAKASLQLHCVPSNITTRIKQLEEELGAPLFYREG
FT                   KSLKLTPSGEIFLDYCHKILALCDEAKRSIHPDAPPSGPLKIGAIESSATTRLPNLLAK
FT                   YHQRYPEVSIQIITGTWKQLLVDISQHKLDGAIVAGNIEFPMLNKLSIYQEDMVLIASH
FT                   SLGEIRCQEDLIGKEIFMWTEGCPYRAALEEWLKLKNISLPITSITSYATIIGCVSAGS
FT                   GVALVPKSIYEQYKNLAHIQSYKFEYLAFMQNHFFWHKNVSNHKARDMFIELIKSEFCL
FT                   "
FT   gene            346577..347479
FT                   /locus_tag="ABSDF0368"
FT   CDS_pept        346577..347479
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0368"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99762"
FT                   /db_xref="GOA:B0VQ98"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99762.1"
FT                   /translation="MAISLAAETQPPAFKLYLCIAVTVFCWGYSPIGVHSALHSYTPQH
FT                   IALLRFLIASVFLLLLVMKKGIQPLKWKDVPALAVLGFFSVTLHHLLINTGQQYVTAVA
FT                   SSILSQSIPLFTFIISALLFKEQISFKQWLCILLGLCGAVLVVSGDHGFGMPSPYSLLI
FT                   ILAAIAWGLYFNLYKKFALNYDALSMMCYIIWFGTLPLLFYSAHLPSEILHATWQANMS
FT                   VVLLGIFPSAMAYVLWGYVLKNMPLTIASNFLYCSPIVAMSLAVIFLNEKPSMMVLLGG
FT                   VIIVGSLVWMNWGNRRTIE"
FT   gene            347515..347799
FT                   /locus_tag="ABSDF0369"
FT   CDS_pept        347515..347799
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99763"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQ99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99763.1"
FT                   /translation="MIVVTLTYKKPLTEVDAVLKEHIAFLDHYYEQKKFLASGRRENRV
FT                   GGVILVLSSSIQEAEEIMKNDPFYIHDVADYDFMWFEPSKSLEEIKEFV"
FT   gene            complement(347871..348572)
FT                   /locus_tag="ABSDF0370"
FT   CDS_pept        complement(347871..348572)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0370"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99764"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99764.1"
FT                   /translation="MTESGAGDYFIKDSQILVGDSSNASASPVSGMFGLIGVGVAMAID
FT                   KNANSSAIEKSSLNQPIKFDQLIHQKITDSLTQNKTDPTLKLLSLNQASEIKIVPYSRL
FT                   SFREKPIVKVNFGLKTQFKNAADNNADTKRLYHYVSKDRISLSEWEANNNLLFMKKADQ
FT                   AFSALSQVFTLDLQHQLNLKAFDENKQKSCKTNADTSLVSFIQTPDNLCVGVVKTSKGD
FT                   VFQNNIYIVEQ"
FT   gene            complement(348925..350994)
FT                   /gene="glyS"
FT                   /locus_tag="ABSDF0371"
FT   CDS_pept        complement(348925..350994)
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="ABSDF0371"
FT                   /product="glycyl-tRNA synthetase, beta chain"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99765"
FT                   /db_xref="GOA:B0VQA1"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99765.1"
FT                   /translation="MSKHTVLFELGCEELPPKSLKTLRDALQVETVKGLNEAGLNFASV
FT                   EAYAAPRRLALKIVDVDAAQADTQKRFDGPAVQAAYDAEGKPTKALEGFMRGQGITVEQ
FT                   LSTFQAGKVEKVCYLKDVKGQSLDALLPQILQTALDNLPIAKRMRSAASRTEFVRPVKW
FT                   VVLLKDDQVIEATIQDHKAGNVTYGHRFHAPEAVTLAHANDYLAALEKAYVVANFEKRQ
FT                   ATIQEQVKKLADEVNATAIVPADLLDEVTSLVEWPVALRATFEERYLAVPQEALITTMQ
FT                   DNQKYFCLINAEGKLQPYFITVSNIESKDPTQIIEGNEKVVRPRLSDAEFFFLQDQKQP
FT                   LASRKEKLTNMVFQAQLGTLWDKSTRIAKLAVALSSITGANPADAEKAALLAKCDLTSE
FT                   LVGEFPELQGIAGTYYARIEGENTEVSEALGEQYLPKFAGDVLPKTKTGTTIALADRLD
FT                   TLVGIFGIGQAPTGSKDPFALRRSAIGILRLIIENELDVTIEELVNLALQSYGDIVKDH
FT                   DKTRADAVAFLEGRYRAKYEDQGVAVDVLQAVQALAPKSPLDFDKRVNAVNHFRTLPEA
FT                   AALAAANKRVANILAKEAASEGSVVEANLVEDAEKALFAELQAVTPVVEPLLTAKDYTA
FT                   ALSKLAALRAPIDAFFDGVMVMADDADLKANRLRLLAQLRNLFTAVADVSVLQG"
FT   gene            complement(350994..351971)
FT                   /gene="glyQ"
FT                   /locus_tag="ABSDF0372"
FT   CDS_pept        complement(350994..351971)
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="ABSDF0372"
FT                   /product="glycyl-tRNA synthetase, alpha chain"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99766"
FT                   /db_xref="GOA:B0VQA2"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99766.1"
FT                   /translation="MSRAISHIDTFQGLILALQNYWAEQGCVVLQPYDMEMGAGTFHTA
FT                   TFLRALGPETWNAAYVQPSRRPKDGRYGENPNRLQHYYQFQVVLKPNPDNIQQLYLDSL
FT                   KAIGIDTLTHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGVECYPVTG
FT                   EITYGLERLAMYLQGVDSVYDLVWTKGQFGTVTYGDVFHQNEVEQSTYNFEYAPVDKLF
FT                   ELFDFYESEANRLMEAKLPLPAYEQVVKASHTFNLLDARGAISVTERQRYILRVRTLAR
FT                   AIAQSYVQARAELGFPMAEPHLRDEVLAQLKAQAESEAAKAEKN"
FT   gene            352314..352466
FT                   /pseudo
FT                   /locus_tag="ABSDF0374"
FT   CDS_pept        352314..352466
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0374"
FT                   /product="fragment of Tetracycline resistance protein,
FT                   class A (TETA(A)) (part 1)"
FT                   /note="Evidence 7 : Gene remnant; Product type t :
FT                   transporter"
FT                   /db_xref="PSEUDO:CAO99767.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            352548..353453
FT                   /locus_tag="ABSDF0375"
FT   CDS_pept        352548..353453
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0375"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99768"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99768.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            353476..354534
FT                   /pseudo
FT                   /locus_tag="ABSDF0376"
FT   CDS_pept        353476..354534
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0376"
FT                   /product="fragment of Tetracycline resistance protein,
FT                   class A (TETA(A)) (part 2)"
FT                   /note="Evidence 7 : Gene remnant; Product type t :
FT                   transporter"
FT                   /db_xref="PSEUDO:CAO99769.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            354706..355968
FT                   /locus_tag="ABSDF0377"
FT   CDS_pept        354706..355968
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99770"
FT                   /db_xref="GOA:B0VQA6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99770.1"
FT                   /translation="MSDRIREKLQILADAAKYDVSCSSSGSDRKNKNKGLGDASHSGIC
FT                   HSYTEDGRCVSLLKILFSNVCIFDCAYCVSRRSNDVQRAAFTVQEVVDLTINFYRRNYI
FT                   EGLFLSSGIFKSADHTMERMLQVVKKLRLEENFNGYIHLKTIPGASPELIHEAGLYADR
FT                   MSINLEMPTEIGLKTFAPEKSHQEVQKDLGLVRDRLIQLKDERQIIKHVPKYVPAGQTT
FT                   QMVVGAHQESDQDVLFMADKHYKEFKLKRVYFSGYIPINNENNYLPAVGSAPPLLRENR
FT                   LYQSDWLMRFYGFEVNEIVNEKHPNLDLDVDPKLSWALRHPEQFPVDLNRADYQMILRV
FT                   PGIGVKSAKKIVQARRFGKIHIDLLKKLGVAYQRAKFFIRCEDSPKFQKELSSSFIRQQ
FT                   ILTQGSSKYVQQLSPQLSLGF"
FT   gene            355971..356780
FT                   /locus_tag="ABSDF0378"
FT   CDS_pept        355971..356780
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99771"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99771.1"
FT                   /translation="MFNDEVAYYFDGSMVGLLSCVFRAFQFKELQVRLCLNDAAQHGLF
FT                   ADKIEVSNNEQHAERVWAALQKKLSSSSLKQFYFAYLSESLDAYQHLFNYCIYVFSSHS
FT                   SVEKDYSNPSVLAIAQWTKKVGREKHRMEAFIRFKKTKDELFLSLVRPDFNVLPLIQPH
FT                   FKRRYQDQRWLIYDEQRKFGLYYDLREIHEVSLEASDVDRNLKNGMSQSFQLELDEQEV
FT                   LYDQLWKDYFKSVNITERQNIKLHVQYLPKRYWRYLNEKLIEYGFVA"
FT   gene            356820..357632
FT                   /locus_tag="ABSDF0379"
FT   CDS_pept        356820..357632
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0379"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99772"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99772.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCKRQKHID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPEYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTDGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            complement(357875..358129)
FT                   /locus_tag="ABSDF0380"
FT   CDS_pept        complement(357875..358129)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99773"
FT                   /db_xref="GOA:B0VQA9"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99773.1"
FT                   /translation="MANSGLYRSNRQSMIAGVMGGIAERFGWNANLLRIIFVLVSIMSA
FT                   AFPGILVYLVLWLVIPKKQPEQVQGYQQPVRTVREEQIH"
FT   gene            358374..359030
FT                   /locus_tag="ABSDF0381"
FT   CDS_pept        358374..359030
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0381"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99774"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99774.1"
FT                   /translation="MMYMSLKSSGLLMKHLSVAAILCMGLSACDVNHADSKDHSAVATT
FT                   SRHEDSLIKSTTKVKTLDDAAGRTFLPEGVPDQSSKLSEADQQYAGRYHTRISCEDNFA
FT                   DCETGEAEYILNLLPDGTAYWNVVHFGRVGSKDGSKSAVINQLCPSLKWKVEPAAHELT
FT                   IQCPLSDVNFYFDIDAKQRLVVNLEKLFYSDFGKNREFLEQNYFVPTKAYVLDKE"
FT   gene            complement(359102..360925)
FT                   /locus_tag="ABSDF0382"
FT   CDS_pept        complement(359102..360925)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0382"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99775"
FT                   /db_xref="GOA:B0VQB1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99775.1"
FT                   /translation="MPAYKAPLHDIRFLMNEVLDYPAHYKTLSNGESADPDTVDMILEG
FT                   AADYCENVLSPLNQSGDEEGCHFDNGEVKTPKGFKEAYDQFVMGGWQGLSYPEEFGGQG
FT                   LPMSLNLIKSEMMGTANWSFTMYPGLSSGCMNTILQFGTDEQKQTYMPKLVEGTWSGTM
FT                   CLTEPQCGTDLGQVKTKAEPQADGTYKISGTKIFISAGEHDLTENIIHIVLARLPDAPA
FT                   GTRGISLFIVPKFIPTAEGGVGERNTVSCGSIEHKMGIRASATAVLNFDNATGYLIGEV
FT                   NKGLHAMFTFMNTARIGTAVQGIAHAELSFQGALPYAKERMSMRALSGKKDPDKVADAI
FT                   IHHADVRRMLLTQKAIAEGGRSMIYYAAQLADKMTDALTRGDQAAFEDYDDKLGFYTPI
FT                   LKGFLTELGLEAANHGMQVYGGHGYIKEWGMEQIVRDARISTLYEGTTGVQALDLIGRK
FT                   VLLSSKGKVVREYTAEILKFCAAHARNKYLRRFAWDLTKLCAQWNTLTVRIMLAARKDR
FT                   DIVSSASVDFLMFSGYVMMAYFWAQQAVVASEKLEAGNGQETPEFYKAKIKVADFYFDR
FT                   LLPRAQGHAESMVTTSRTLTSLPAEHFSFDY"
FT   gene            361163..361975
FT                   /locus_tag="ABSDF0383"
FT   CDS_pept        361163..361975
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0383"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99776"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99776.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTVCRRQKHID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            362231..363658
FT                   /pseudo
FT                   /locus_tag="ABSDF0384"
FT   CDS_pept        362231..363658
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0384"
FT                   /product="fragment of conserved hypothetical protein;
FT                   putative signal peptide (part 1)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99777.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            363649..364536
FT                   /pseudo
FT                   /locus_tag="ABSDF0385"
FT   CDS_pept        363649..364536
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0385"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   2)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99778.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(364583..365371)
FT                   /gene="aroE"
FT                   /locus_tag="ABSDF0386"
FT   CDS_pept        complement(364583..365371)
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="ABSDF0386"
FT                   /product="dehydroshikimate reductase, NAD(P)-binding"
FT                   /function="1.5.1.20 : chorismate"
FT                   /EC_number="1.1.1.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99779"
FT                   /db_xref="GOA:B0VQB5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99779.1"
FT                   /translation="MTKQFAVIGNPIEQSRSPELHHAFAEKTGVDLNYQKRLAPLDGFE
FT                   SSMRSFFAEGGSGMNVTVPFKEQAFALCNVLTERAQIAKAVNTLWMENGKLHGDNTDGQ
FT                   GLVAAIQALEWNLENTTILILGAGGATRGVIYPLVQAGAKKIVIANRTLARAEQLVDDL
FT                   KTAVPQAQLQAISLNDLEGDFDIVINATSASLSGDALQLPEKLKFKYAYEMAYGKPSSF
FT                   LDQAKQRNVPYAEGFGMLVGQAIEAFSIWNGVRPQLKDFL"
FT   gene            complement(365545..366549)
FT                   /gene="hemF"
FT                   /locus_tag="ABSDF0387"
FT   CDS_pept        complement(365545..366549)
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="ABSDF0387"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /function="1.5.3.12 : heme, porphyrine"
FT                   /EC_number="1.3.3.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99780"
FT                   /db_xref="GOA:B0VQB6"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99780.1"
FT                   /translation="MDLCFDVSNLFRSSLRVIMQHPTSTDIQRVREFLLDLQARICAGL
FT                   EQQEKAGGGTAEFIIDDWERPEGGGGRSRVLQNGTVIEKGGVMFSHINISKLPPSATER
FT                   HPQIAGAKAQALGVSLVIHPKNPNIPTSHANVRLFVAEREGQDPIWWFGGGFDLTPFYP
FT                   DDQDVLNWHQAAYDLCKPFGDNVYAEHKKWCDDYFYLKHGDEQRGVGGLFFDDLNCWDF
FT                   ETCFKYIQAVGNGYLNAILPIFEKHREQPYTEAQREFQLYRRGRYVEYNLVYDRGTLFG
FT                   LQTGGRIESILVSLPNLAAWSYRPEWDEDSPEKRLTDYYLKPRDWLGLEEKVA"
FT   gene            complement(366623..367225)
FT                   /gene="ribA"
FT                   /locus_tag="ABSDF0388"
FT   CDS_pept        complement(366623..367225)
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="ABSDF0388"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99781"
FT                   /db_xref="GOA:B0VQB7"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99781.1"
FT                   /translation="MPIEFIATSKLPTAFGEFNISVFQDPVTGEEHVALSKGLENPPTD
FT                   PVLVRVHSECLTGDAFASLKCDCGPQLQATQKLINEAGQGVILYLRQEGRGIGLTNKIR
FT                   AYALQDQGHDTVDANLLLNLPADARRYDMCSIMLDHLKVKEVKLITNNPLKIQALKDQG
FT                   INVVDRVPLTVGRNPFNEQYLKTKRERMAHLYQKDDF"
FT   gene            367520..369433
FT                   /gene="dxs"
FT                   /locus_tag="ABSDF0389"
FT   CDS_pept        367520..369433
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="ABSDF0389"
FT                   /product="1-deoxyxylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99782"
FT                   /db_xref="GOA:B0VQB8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99782.1"
FT                   /translation="MPHMLYTEIPTQRPVTPLLDAIDHPQQLRQLEHSQLLQVADELRQ
FT                   YILYAAGQSGGHFGANLGVVELTVALHYCFNTPNDRLVWDVGHQAYPHKILTGRREQIT
FT                   TIRAKNGLAAFPAREESVFDTFGVGHSSTAISAGLGMSLARRYQKDPCEVVCIVGDGAM
FT                   TAGMAFEAMNDAVAHDADLIVVLNDNDMSISCSTGGFAKHLAAIWEKGHLVNVNEHGEA
FT                   YIQPHPKWTYNSRLHQSATDAADNLFKAIGFDYFGPFDGHDVTQLVQVFNVLKKRKGPR
FT                   LVHVYTKKGKGFAPAEADPITYHAIGKINAASGGKTPPKYSDVFGEWLCDEAAQDERLL
FT                   AITPAMCEGSGMVKFAKQFPQRFFDVAIAEQHAVTLAAGMACEGLKPVVAIYSTFLQRG
FT                   YDQLIHDVALQNLDVTFGIDRAGLVGEDGPTHAGAYDYAYMRTVPNMVIMAPKDENECR
FT                   QMLHTAYAYNGPAAVRYPRGAGVGVEIQKEMTVLELGKAEIVAEIKANSDEQITVLAFG
FT                   SRVMVALEAAEQFAQKHDVSVCVVNMRFVKPLDEQMIRDLAEHTHLFVTVEEHAIMGGA
FT                   GSAVNEFMAQEQIVKPIINLGLPDSFLHQATHNQMLQDCGLDAKGILNSIERAWLKVNQ
FT                   VV"
FT   gene            369556..370386
FT                   /gene="suhB"
FT                   /locus_tag="ABSDF0390"
FT   CDS_pept        369556..370386
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="ABSDF0390"
FT                   /product="inositol-1-monophosphatase (IMPase)
FT                   (Inositol-1-phosphatase) (I-1-Pase)"
FT                   /function="2.2.2 : transcription related"
FT                   /function="3.1.3.2 : covalent modification, demodification,
FT                   maturation"
FT                   /EC_number="3.1.3.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99783"
FT                   /db_xref="GOA:B0VQB9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99783.1"
FT                   /translation="MEPMVVMAARAAQTVGQELLKAHQNRHKLDLQVEEKGIDGPVTRV
FT                   DRYLEQLTIDTLRKSYKNHSFLGEEFGLQEGKGHDADWCWVIDPLDGTQNFINGFPHFC
FT                   ISIAVQHKGITQHGVIYDPVRDELFSASRGRGAVMNQRRIRVNVKDSLENTFLAVGHPY
FT                   RAKRAGEIVSYAEQHFASLLAVTQAGAQIRRGGSAALDLAYVAAGRFDGFFELGLKPWD
FT                   IAAGELIIKEAGGVVVDARGGNDSLENGQVIACSLKMLKSLMQTVVPAWDKAAK"
FT   gene            370784..372643
FT                   /locus_tag="ABSDF0391"
FT   CDS_pept        370784..372643
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0391"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99784"
FT                   /db_xref="GOA:B0VQC0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99784.1"
FT                   /translation="MELSMSKTFAEFSLHETLQQALEGLGFTNPTPVQEQSIPAALEGK
FT                   DLLVSSQTGSGKTAAFLLPTLHNLAGQDTFVPFKERMKAVTQPSILVLCPTRELAQQVS
FT                   QDAIAFVRHMKGVRIAAIMGGMPFGKQIQQLKGAQVVVATPGRLLDLVNRRQLKLDKVD
FT                   ALIVDEADRMLDLGFSEDLEAISDLAVNRGQTLMFSATFADRIIRLAERMMNEPERIAI
FT                   ETGHSTNTDITQTLHWTDGFEHKKKLLTHWLADETLDQAVVFASTQEDTDMLAEELAEA
FT                   GHSVVALHGAMPQTARNRRLRSIREGRAKILVATDVAARGLDVPTISHVINFGLPMKHE
FT                   DYVHRIGRTGRAGRTGQAITLATYRERGKIRALEDYLEARLNVSEIEGLEASPPPARPR
FT                   REGGRGGNGGRDGRRGGGFGGGRRFEGEGNFKRREGGRDDRPRRSFDDKPRGERPAFGG
FT                   EDRPRREFNSDRPRREGGFEDRPKRSFGGEDRPRREFNSDRPRREGGFEDRPKRSFGGE
FT                   DRPRREFNSDRPRREGGFNDKPRFDSNDDNRGNRVDYKPRRENGFGDRPQRSFGGEDRP
FT                   RREGGFGDRPKRSFGGEDRPRRTVREEHFNQESRGERRRKFDR"
FT   gene            complement(372725..373630)
FT                   /locus_tag="ABSDF0392"
FT   CDS_pept        complement(372725..373630)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0392"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99785"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99785.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            374075..374893
FT                   /gene="ttg2A"
FT                   /locus_tag="ABSDF0393"
FT   CDS_pept        374075..374893
FT                   /transl_table=11
FT                   /gene="ttg2A"
FT                   /locus_tag="ABSDF0393"
FT                   /product="toluene tolerance efflux transporter (ABC
FT                   superfamily, atp_bind)"
FT                   /function="4.3.A.1.a : ABC superfamily ATP binding
FT                   cytoplasmic component"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99786"
FT                   /db_xref="GOA:B0VQC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99786.1"
FT                   /translation="MNNKTPLSTQSLIEVKNLSFNRGERVIYDNISLNIRRGQITAIMG
FT                   PSGTGKTTLLRLIGGQLVPDHGEVLLDGKDIAQMSRQELFAARARMGMLFQSGALFTDM
FT                   SVYENVAFPIRAHTKLSENLIAELVALKLESVGLRGTEQLMPTELSGGMNRRVALARAI
FT                   ALDPDLIMYDEPFAGQDPIVKGVLTRLIRSLREALDLTTIIVSHDVPETLSIADYIYVV
FT                   AEGKIQGEGTPEELQAYASPFVKQFLTGSAEGPVEYQFSHQAYLDNEVRP"
FT   gene            374890..375666
FT                   /gene="ttg2B"
FT                   /locus_tag="ABSDF0394"
FT   CDS_pept        374890..375666
FT                   /transl_table=11
FT                   /gene="ttg2B"
FT                   /locus_tag="ABSDF0394"
FT                   /product="toluene tolerance efflux transporter (ABC
FT                   superfamily, membrane)"
FT                   /function="4.3.A.1.m : ABC superfamily, membrane component"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99787"
FT                   /db_xref="GOA:B0VQC3"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99787.1"
FT                   /translation="MNTIAWLGRLVIERIRGIGVAALMLLQIIFSLPSAGGFGRFVYQM
FT                   HRVGVMSLLIITVSGLFIGLVLGLQGYSILVNVGSESMLGTMVSLTLLRELAPVVAALL
FT                   FAGRAGSALTAEIGSMKQSEQLASMEMIGVDPLKQIVSPRLWAGIVSLPMLTVIFAAIG
FT                   IVGGKLVGVDFLGVDEGSFWSGMQNNVQFGHDVVNGIIKSIVFALLCTWIAVFQGYACD
FT                   PTPEGIATAMTRTVVYSSLCVLGFDFVLTAVMFGGI"
FT   gene            375666..376346
FT                   /gene="ttg2C"
FT                   /locus_tag="ABSDF0395"
FT   CDS_pept        375666..376346
FT                   /transl_table=11
FT                   /gene="ttg2C"
FT                   /locus_tag="ABSDF0395"
FT                   /product="toluene tolerance efflux transporter (ABC
FT                   superfamily, peri-bind)"
FT                   /function="4.3.A.1.p : ABC superfamily, periplasmic binding
FT                   component"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99788"
FT                   /db_xref="GOA:B0VQC4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99788.1"
FT                   /translation="MKSRTSELAVGIFVIIFGIALFFLAMKVSGLVGTNLSDGYTMKAQ
FT                   FDNVNGLKPRAKVTMSGVTIGRVDSITLDPVTRLATVTFDLDGKLTSFNAEQLKEVQKN
FT                   ALDELRYSSDYTQAPPAQQKTMEQQLISNMNSITSIDEDAYIMVATNGLLGEKYLKIVP
FT                   GGGLNYLKRGDTISNTQGTMDLEDLISKFITGGGASKVAAGSSSAEEKAPASTDSSAQP
FT                   SFVE"
FT   gene            376355..377014
FT                   /locus_tag="ABSDF0396"
FT   CDS_pept        376355..377014
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0396"
FT                   /product="putative toluene tolerance protein (Ttg2D)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99789"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99789.1"
FT                   /translation="MKEWFQVNTLFKQTLTASILSTMIAGTAFAAPSEAPPDFIKRVAD
FT                   GLISRLKADHAKLQNNPALVKTIVRQNLDPYVDSQAFTRIVMGTYATNQYSTAAQRAQF
FT                   ETNFRNTLIENYGSAFAKYTNQTYTMRPYKATAGKNPVVTLDFNHNGEKIPVSFQLADK
FT                   GSQWKIRNINVSGIDLGLQFRNQFAATVKRNGGDLNKAIATFQPDADAAVNQNKQK"
FT   gene            377026..377313
FT                   /locus_tag="ABSDF0397"
FT   CDS_pept        377026..377313
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0397"
FT                   /product="putative toluene-tolerance protein (Ttg2E)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99790"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99790.1"
FT                   /translation="MVQYLNQELVVSGKIDFENAEQQYQAGLAIIKKQTSFPLIVDLKQ
FT                   LEHGNTLALAVLVQWLRQTPQKSGLHFKNVPEKMLKIIQACHLQEDLHLV"
FT   gene            complement(377383..378468)
FT                   /gene="corA"
FT                   /locus_tag="ABSDF0398"
FT   CDS_pept        complement(377383..378468)
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="ABSDF0398"
FT                   /product="magnesium and cobalt transport protein"
FT                   /function="4.9.A.17 : The Metal Ion Transporter (MIT)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99791"
FT                   /db_xref="GOA:B0VQC7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99791.1"
FT                   /translation="MFFGKSLSKIHPSISIRLRKEKRHMLEAFYATERGSLEDATINGG
FT                   FDLHPELVWLDLIAPSQEEQQWVLDAYNQNLPTLKSLEDISSSARFYRDDDGILHISTY
FT                   FLTKNKNYQVDGDAEDSSHMLAMVQTVAFILHKNRLFTLRGEKLVAFRAFRARARRNDY
FT                   EMDYKDPTWILLGLLEAKLDELADILEDIHKDLEKYSTEVLNNHQREQILDLDDMITRL
FT                   AQQEDMLGKAQLCLIDLRRVLTFLSRPRALGSHIYDADIRELSEDVRSLVEHDAFLFQK
FT                   VRFLLDTTSGFINTEQNDTIRRFSILPSMLAPPMLIASIYGMNTDVLPFAHGTTSFIIV
FT                   LLIIIGFFIGPIIYFRWKKWI"
FT   gene            378554..379135
FT                   /locus_tag="ABSDF0399"
FT   CDS_pept        378554..379135
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0399"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99792"
FT                   /db_xref="GOA:B0VQC8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99792.1"
FT                   /translation="MNSICIFCGSSLGSNPIFQQIAQLTGEAIAKQGKTLVYGGGRSGL
FT                   MGVVADSALQAGGQVIGVIPRALVDRELAHPGLTKLYVVENMHERKTKMADLSDGFIAL
FT                   PGGAGTLEEIFEQWIWAQLGIHQKPCAFLNVAGFYEDLLKMIQGTVDNGFSQARFVDKL
FT                   IASDKIEDILQQFEQYQAPAPKWTNADVQP"
FT   gene            379150..379551
FT                   /locus_tag="ABSDF0400"
FT   CDS_pept        379150..379551
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99793"
FT                   /db_xref="GOA:B0VQC9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99793.1"
FT                   /translation="MKTITVAAAVILNEQNELLLVRKRNTQAFMQVGGKLEPNEAPETA
FT                   IQREILEEIGSPCVIEQFIGRFETAAANEPDHKLISHLYLVRLKQSPQIAAEIAEMKWV
FT                   KFNDSETKLAPLTKEIVIPWCEQNLSITL"
FT   gene            complement(379554..380189)
FT                   /locus_tag="ABSDF0401"
FT   CDS_pept        complement(379554..380189)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0401"
FT                   /product="putative DNA transformation protein (ComF)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99794"
FT                   /db_xref="GOA:B0VQD0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99794.1"
FT                   /translation="MFKFLNPQYLFQLLSPCLLCEIGTREKYSLCKECWEQLPWLKQTI
FT                   QRNDQSVLVACHYAYPINRIIQQFKYEQKLHYQTLLAEVLQQLKFPKVQAIVPMPISKQ
FT                   RLTERGFNQSLLLANLLGKQLKIPVWQPVQRLNEHSQKGLSRLERFENIEQQFVALTQE
FT                   NRRYRRVLIIDDVITTGSSIHALSQALKQLGCTSIHASCLAAASSTSY"
FT   gene            complement(380182..382227)
FT                   /gene="recG"
FT                   /locus_tag="ABSDF0402"
FT   CDS_pept        complement(380182..382227)
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="ABSDF0402"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="2.1.1 : DNA replication"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99795"
FT                   /db_xref="GOA:B0VQP9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99795.1"
FT                   /translation="MTSVHQLQGVGSASAALLEKLNIFTTDDLLFHLPRDYEDRSTIIP
FT                   MNQLMVGRTYLLEGEVKSVDFPPGKRKSMAALIQDEFGKVTLRFYHIYKNLTDKIKPGN
FT                   RLRIFGEVRVGARGLELYHPEIQLINEHTTLPKTQLTAIYPSTDGLTQAKLREYVKQAL
FT                   KHHSDALPELLPKQYTNGYALKEALHYIHEPPIDANMIQLAQDSHPAQQRLIFEELVAH
FT                   QISLLTRRAYIRQIASPAFPSSKVLAKKLLEALPFQMTNAQKRVSKEILNDLKQHQPML
FT                   RLVQGDVGAGKTLVAAVAACHALEADWQVALMAPTEILAEQHYLNFKRWFEPLGITVAW
FT                   LSGKQKGKARAHAERQIKEGHAELIVGTHALFQDNVEFAKLGLVIIDEQHRFGVDQRLA
FT                   LRNKGAEQLTPHQLVMTATPIPRTLAMSAYGDLDTSIIDELPPGRTPIQTVTIPLDRRE
FT                   EVLQRIASNCREGKQAYWVCTLVEQSETLDAQAAEATYQEMKERFPELNIGLVHGKMKA
FT                   DEKQAVMQAFKNNELQLLIATTVIEVGVDVPNASIMVIENAERLGLSQLHQLRGRVGRG
FT                   AKASFCVLLYKPPLSQNGQERLSILRESNDGFVIAEKDLELRGPGELLGTKQTGDMGFR
FT                   VARLERDDHLLSQAHYVAQQVLKDYPEQADALLKRWLPEAPRYAYV"
FT   gene            382248..383063
FT                   /locus_tag="ABSDF0403"
FT   CDS_pept        382248..383063
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99796"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99796.1"
FT                   /translation="MHILFIGYGKTSQRVAKQLFEKGHQITTISRSEKTDPYGTHLVQD
FT                   IFTLDLSEIAPVDVVYILLSPDDSTVEGYQHTYVDSIEPIRQALKSHPVKRLIVVSSTR
FT                   VYGENSGETIDDHSEIHPNDAQGHILHNMELLWQKYFPSQCVIVRPTGIYGASIDCLKR
FT                   MAEHTQTYPNIHYSNRIHIDDLARFLAFLADFEKPHKSYLVANNAPVPLHEVLLWFQSQ
FT                   LDLPLLTLDSAHVSGKKIYAKHLFETGFQLEHPICFNDYLLCLNAHGTN"
FT   gene            383116..384129
FT                   /locus_tag="ABSDF0404"
FT   CDS_pept        383116..384129
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0404"
FT                   /product="putative RND type efflux pump involved in
FT                   aminoglycoside resistance (adeT)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99797"
FT                   /db_xref="GOA:B0VQQ1"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99797.1"
FT                   /translation="MPIKIKRLKVKKFCLALFLSVTSVTSWAGDQVWCAYDPAGTQGDI
FT                   MRRLNDIRLYAQQYQVKFKVVSYQKEQQAIQAFDEGKCSGLAASNFNTYQYNHFMGSTS
FT                   GIGLIPNNRTARNLLQLLNHPTIEKRLINKDYEAVGMIPVGTANMVMKTKKISKVAQLR
FT                   GQRIGVLANNPPQQALVRSVGAQPVYVDLSNAIAQFQQNKIDIMPAPVYGLLPYNLQKD
FT                   FGSETQVINFPLAYFGVNLIIKPQAYPANFGRKIRAWFVQNSQLLTNRAIQWENHLPAY
FT                   YWVDVSFYEKQSYDIMVAKIRNQYVRSGYYDAYFVELMKRLRCIDDPRYFECPMSR"
FT   gene            complement(384173..386746)
FT                   /gene="plsB"
FT                   /locus_tag="ABSDF0405"
FT   CDS_pept        complement(384173..386746)
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="ABSDF0405"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /function="1.5.4 : fatty acid and phosphatidic acid"
FT                   /function="1.6.1 : phospholipid"
FT                   /EC_number="2.3.1.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99798"
FT                   /db_xref="GOA:B0VQQ2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99798.1"
FT                   /translation="MSKSGFGQMYRRLSSKLLDLVVTPHVLGEVPTEPVSETTETEAKT
FT                   ERQKVVCYVLQNHSRSNALVVDGETRRLNLKPALDPLVIGTHQEKASVLFLQHNDENNL
FT                   LNPPPHAFPPRLIKLIEVLQANPELDIELVPVTVLWGRSPDKEDSWFKLLFSDTWATPS
FT                   TVKQLVNIGLHGRQSYLEFHEPQSLRDLVEYAQKHYPNLSPATYIVSTLNDYLDRQREV
FT                   VLGPDLSDRRNVMQSVLKSRDVQEAIRRESIRGKISMLEAERRAIGYVNEIVSDYSHSA
FT                   VRFADLALTRLWTQLYDGVEVHNFSTVRELAKDYEIVYTPCHRSHIDYLLLSYVIYKRG
FT                   LMVPYIAAGDNLNLPFVGQLLRGGGAFFIRRSFRGNGLYTSVFKEYLYSILSRNTPLEY
FT                   FIEGGRSRTGRLLPPKTGMLAMTVHSHLRGRAKPIVFVPTYIGYERLMEGSTYVGEMQG
FT                   KPKEAESIFGILKTLRKIERIFGKVHVNFGEPVFLDDLLKQHNAENVYIEKNDDPVPPA
FT                   VSEAVNSSANAILENINRAVVINPVSLLSIILLATPKHTLDEEICIKQLEAYRNLASNF
FT                   PYDQRTEVTPLSGKEIIAYGLKLKLIKRVQHALGDIIAIEDNQAVLLTYFRNNILHAFV
FT                   LPSLIASLVEHNGKISRADLSNVIYTLYPFLKAELFLKWKSSELKEQIEQYADALVQSN
FT                   LIQQDDEGNLISSAPNTEEHNQLVVLATPVKQSLERYYMTLALITQRGSGNISAKQVEE
FT                   LSHLLGQRLSVLYEFNSPEFFDKALFQSFIKVLTQQNYIRTNDQGQIEFDDNFRQMAAG
FT                   AQLVLDEVTLQMLQHITTFTDEELKEALEAMASQQAKRRLKRKKA"
FT   gene            387022..387894
FT                   /gene="tesB"
FT                   /locus_tag="ABSDF0406"
FT   CDS_pept        387022..387894
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="ABSDF0406"
FT                   /product="acyl-CoA thioesterase II"
FT                   /function="1.5.4 : fatty acid and phosphatidic acid"
FT                   /EC_number="3.1.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99799"
FT                   /db_xref="GOA:B0VQQ3"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99799.1"
FT                   /translation="MNALTQELVELLTLEKLEENIYRGISRNLVGKRVFGGQVLGQALR
FT                   AASYTTDRPAHSLHAYFLYGGDINAPIIYEVDRLRDGKSFVSRQVRAIQHGRVIFSAMV
FT                   SFANPEEGLNYQHPEPDYPAPEALKSESELKEGILNFVPENVRASFMRERHVEIRPIDP
FT                   VNPFQPQPEAPFNAHYIRTHDRIPKQLEDISLHQAIVAFYSDFTLMTTALRPHGLSYIS
FT                   PSLQCASIDHAIYFHRPLRADEWMLYDMEATVSAASRGLNFGRMWQNGQLVCSTVQEGL
FT                   MRLREIETQ"
FT   gene            388027..388170
FT                   /pseudo
FT                   /locus_tag="ABSDF0407"
FT   CDS_pept        388027..388170
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0407"
FT                   /product="fragment of putative Proton/sodium-glutamate
FT                   symport protein (part 1)"
FT                   /function="4 : transport"
FT                   /note="Evidence 7 : Gene remnant; Product type pt :
FT                   putative transporter"
FT                   /db_xref="PSEUDO:CAO99800.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            388287..388598
FT                   /pseudo
FT                   /locus_tag="ABSDF0409"
FT   CDS_pept        388287..388598
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0409"
FT                   /product="fragment of putative Proton/sodium-glutamate
FT                   symport protein (part 2)"
FT                   /function="4 : transport"
FT                   /note="Evidence 7 : Gene remnant; Product type pt :
FT                   putative transporter"
FT                   /db_xref="PSEUDO:CAO99801.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(388606..389511)
FT                   /locus_tag="ABSDF0410"
FT   CDS_pept        complement(388606..389511)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0410"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99802"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99802.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            389546..390265
FT                   /pseudo
FT                   /locus_tag="ABSDF0411"
FT   CDS_pept        389546..390265
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0411"
FT                   /product="fragment of putative Proton/sodium-glutamate
FT                   symport protein (part 3)"
FT                   /function="4 : transport"
FT                   /note="Evidence 7 : Gene remnant; Product type pt :
FT                   putative transporter"
FT                   /db_xref="PSEUDO:CAO99803.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(390308..391258)
FT                   /locus_tag="ABSDF0412"
FT   CDS_pept        complement(390308..391258)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99804"
FT                   /db_xref="GOA:B0VQQ8"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99804.1"
FT                   /translation="MMKLLSFLKNKALGSSIDYKILPRKVKFDWKDTPIDWIPNQPFAS
FT                   YFINEINNILPAGEFWFCRLYNKVLPRITDEKLKQDVQAFIRQEAMHANAHTSANKEYL
FT                   SARNIDIQRNLDIMNYLFTTALADKPFDKEVPQFLQEQWDLFRLGVIATVEHMTCVLGK
FT                   YALYNKRWEELGADPEMVDLVKWHGSEEIEHRTVAFDLYRHLGGGYIPRYYLSLAVIVL
FT                   VLGLWVDGAAHIMKQDPRFADAAKSRFFAAWVALEWYKISRKDNQVLPNPIWLIAQQID
FT                   YLMPWYDPVKEGSTEDAVSYLSQSPAAKRAELQAA"
FT   gene            complement(391382..392158)
FT                   /locus_tag="ABSDF0413"
FT   CDS_pept        complement(391382..392158)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0413"
FT                   /product="putative GTPase, involved in coordination of cell
FT                   cycle (EngB)"
FT                   /function="5.2 : cell cycle physiology"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99805"
FT                   /db_xref="GOA:B0VQQ9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99805.1"
FT                   /translation="MRRSEKSKDTKARLAPKQKISYEKKPDPAITAYAVQSLNWLRQAE
FT                   FLMSAPKLALCVEDSGYEIAFAGRSNAGKSSAINALTNQKQLARASKKPGRTQMINFFS
FT                   LGNPDQRLVDLPGYGYAAVPEDMKRVWQKELENYLIHRKSLQGLVLLMDIRHPLQHFDM
FT                   MMLEWAYSRHLFVHILLTKADKLNRGPANKVLLEVKQQLKKMKLDFSIQLFSSLNKLGL
FT                   EELASVMAGRLHFTLEQQPEFDVDAIPEASDEDAEE"
FT   gene            complement(392267..392713)
FT                   /locus_tag="ABSDF0414"
FT   CDS_pept        complement(392267..392713)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99806"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99806.1"
FT                   /translation="MVIMQLNKFTDYALRILMYVARPSDAPYTIAEIAQDLYVSQNHLV
FT                   KVVHFMGKQGWIITIRGNGGGIRLNPKALDLKLGTIVRILQGDHQIVECNTPPCVLRSH
FT                   CGLKGILDQALESFYQSLDQYTLGEVLQQPKSASDHSPIAFLQL"
FT   gene            complement(392790..393554)
FT                   /locus_tag="ABSDF0415"
FT   CDS_pept        complement(392790..393554)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0415"
FT                   /product="putative flavohemoprotein (Hemoglobin-like
FT                   protein) (Flavohemoglobin)"
FT                   /EC_number="1.5.1.34"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99807"
FT                   /db_xref="GOA:B0VQR1"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99807.1"
FT                   /translation="MTPQQIELVKSTVPVLREHGVTLTTYFYKRMLNNNPELKNVFNLD
FT                   DQTSLRQPRALAAAVLAYAENIENPTVLAKAVERITTKHVSLDIQPDQYAIVGDNLLHS
FT                   ISEVLNVPFESELIEAWKQAYLQLADILIGVEKQKYEQLESLKGGWAGWRSFEITQIDP
FT                   LESGKRFTLKATDHGDVLTSPANAFISVKVQVPNQQLEQPKAFKFTEAQEDNTYLFDVQ
FT                   PEENHTEFSVSNILLEHYRVGDQVQVSAPLTL"
FT   gene            complement(393701..393862)
FT                   /pseudo
FT                   /locus_tag="ABSDF0416"
FT   CDS_pept        complement(393701..393862)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0416"
FT                   /product="fragment of putative enzyme contains P-loop
FT                   containing nucleotide triphosphate hydrolase domain (part
FT                   3)"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99808.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(393822..394103)
FT                   /pseudo
FT                   /locus_tag="ABSDF0417"
FT   CDS_pept        complement(393822..394103)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0417"
FT                   /product="fragment of putative enzyme contains P-loop
FT                   containing nucleotide triphosphate hydrolase domain (part
FT                   2)"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99809.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(394302..395252)
FT                   /pseudo
FT                   /locus_tag="ABSDF0418"
FT   CDS_pept        complement(394302..395252)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0418"
FT                   /product="fragment of putative enzyme contains P-loop
FT                   containing nucleotide triphosphate hydrolase domain (part
FT                   1)"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99810.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(395296..396486)
FT                   /locus_tag="ABSDF0419"
FT   CDS_pept        complement(395296..396486)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0419"
FT                   /product="putative cystathionine beta-lyase, PLP-dependent
FT                   (beta-cystathionase) (MetC)"
FT                   /function="1.5.1.9 : Methionine"
FT                   /EC_number="4.4.1.8"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99811"
FT                   /db_xref="GOA:B0VQR5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99811.1"
FT                   /translation="MKKHNNFQTQLIHAPRKAPQFIETVQPPLFRASTIIFKSTSHLFD
FT                   RHWTNPYDFSYGTHGTPTTFTLGDNIAQIEGGLYCLLAPSGLSAINLVNSAVLATGDEV
FT                   WVPDNIYGPNLEHLNYLKDQYGINVQVYNPIDVSSFQPSDKTKLLWLEAAGSVTLEFPD
FT                   LKALVKKAKAHGVLTVLDNTWGAGLAFNAFDFSDEHLSVDLTIHALTKYPSGGGDILMG
FT                   SVVTRDEKLHHRLFRMHAILGISVSGDDTAQIQRSLAHMSLRYEQQSNNAKTLLTWLKE
FT                   QSQFTQVLHPSDKASPGHQYWQEICSTGRSAGLVSVVFKSDYDISAVRRFCDALKLFKL
FT                   GFSWGGPVSLVMLYDLKMMRKLENTHLQQGLLVRFCIGLEDPQDLIQDIENALKQM"
FT   gene            396597..397382
FT                   /locus_tag="ABSDF0420"
FT   CDS_pept        396597..397382
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99812"
FT                   /db_xref="GOA:B0VQR6"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99812.1"
FT                   /translation="MALFLQRSNQHSNNNRLKRMKSHLRVHYFQHIAGEGFGSCYSFLK
FT                   AHHATITATEFFALPVDLPLEIEALPYIEDVDLLLIMGGTMSVNDEANYPWLKIEKRWI
FT                   RRYLAAGKPAIGLCLGGQLIANALGAAVSRNRYQELGWSTVQRVPNLPKESFLLPEKIN
FT                   VMQWHSETFEIPKGAIHLAENSVCRNQMYQIGSNVLGFQFHPEMTPKVLNLLLENEQEL
FT                   SIFKGEYVQSLDELHHCDIQKFEQGNQLLNRAIEFVVNQ"
FT   gene            397619..397945
FT                   /gene="rpsJ"
FT                   /locus_tag="ABSDF0422"
FT   CDS_pept        397619..397945
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="ABSDF0422"
FT                   /product="30S ribosomal protein S10"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99813"
FT                   /db_xref="GOA:B0VQR7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99813.1"
FT                   /translation="MEFTGMSNQRIRIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPI
FT                   PMPTRIERFNVLTSPHVNKDARDQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQ
FT                   IALG"
FT   gene            398003..398641
FT                   /gene="rplC"
FT                   /locus_tag="ABSDF0423"
FT   CDS_pept        398003..398641
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="ABSDF0423"
FT                   /product="50S ribosomal protein L3"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99814"
FT                   /db_xref="GOA:B0VQR8"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99814.1"
FT                   /translation="MAIGLVGRKCGMTRIFTDAGVSVPVTVIEVDPNRITQIKTLETDG
FT                   YQAVQVTTGERRESRVTNAQKGHFAKAGVAAGRLVKEFRVTEAELEGREVGGTIGVDLF
FT                   TVGQIVDVTGQSKGKGFQGGVKRWNFRTQDATHGNSVSHRVLGSTGQNQTPGRVFKGKK
FT                   MAGHLGDERVTVQGLEIVSVDTERSVLVVKGAIPGATGGDVIVRPAIKA"
FT   gene            398653..399255
FT                   /gene="rplD"
FT                   /locus_tag="ABSDF0424"
FT   CDS_pept        398653..399255
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="ABSDF0424"
FT                   /product="50S ribosomal protein L4, regulates expression of
FT                   S10 operon"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="3.1.2 : transcriptional level"
FT                   /function="3.1.3.1 : translation attenuation and
FT                   efficiency"
FT                   /function="3.3.1 : operon"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99815"
FT                   /db_xref="GOA:B0VQR9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99815.1"
FT                   /translation="MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAH
FT                   KSRADVSGGGKKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAM
FT                   QCILAELVRQDRLVLVEEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNL
FT                   PHVDVVDATAIDPVSLIAFDKVVMSVAAAKKIEVELG"
FT   gene            399252..399572
FT                   /gene="rplW"
FT                   /locus_tag="ABSDF0425"
FT   CDS_pept        399252..399572
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="ABSDF0425"
FT                   /product="50S ribosomal protein L23"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99816"
FT                   /db_xref="GOA:B0VQS0"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99816.1"
FT                   /translation="MNNERIYQVLKGLVFSEKAQVLGDTAGVQVFKVDINATKLEIKKA
FT                   VEKLFGVEVVKVNTTITKGKTKRFGRTLGRRSDVKKAYVTLKAGQDVEMADLGDTAESA
FT                   AE"
FT   gene            399584..400408
FT                   /gene="rplB"
FT                   /locus_tag="ABSDF0426"
FT   CDS_pept        399584..400408
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="ABSDF0426"
FT                   /product="50S ribosomal protein L2"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99817"
FT                   /db_xref="GOA:B0VQS1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99817.1"
FT                   /translation="MPIQKCKPTSPGRRFVEKVVHDHLHKGAPYAPLVEAKKRTGGRNN
FT                   NGHITTRHVGGGHKQHYRIVDFKRNKDGVPAVVERIEYDPNRTAHIALLKYADGERRYI
FT                   IAPKGLRAGDKVQSGNDAPIRPGNCLPLRNMPIGSTLHNVELKIGKGAQLARSAGASVQ
FT                   LLGRDGSYAIIRLRSGEMRKVHVECRAVIGEVSNQENNLRSLGKAGAARWRGVRPTVRG
FT                   MAMNPIDHPHGGGEGRNKGIQPVSPWGQKAKGYKTRTNKRTTKMIIRDRRVK"
FT   gene            400422..400697
FT                   /gene="rpsS"
FT                   /locus_tag="ABSDF0427"
FT   CDS_pept        400422..400697
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="ABSDF0427"
FT                   /product="30S ribosomal protein S19"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99818"
FT                   /db_xref="GOA:B0VQS2"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99818.1"
FT                   /translation="MPRSLKKGPFVDAHLFAKVEAAVASNSRKPIKTWSRRSMILPDFV
FT                   GLTISVHNGRNHVPVIVTEHMVGHKLGEFAPTRTYRGHGVDKKSKR"
FT   gene            400706..401038
FT                   /gene="rplV"
FT                   /locus_tag="ABSDF0428"
FT   CDS_pept        400706..401038
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="ABSDF0428"
FT                   /product="50S ribosomal protein L22"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99819"
FT                   /db_xref="GOA:B0VQS3"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99819.1"
FT                   /translation="MMEVTAKLRGAAISAQKARLVADLIRGKSVAHALNILNFSNKKAA
FT                   VLVKKALESAIANAEHNNSLDVDDLKVSTIYVDEGMSLKRIMPRAKGRADRITKRTCHI
FT                   TVKVGV"
FT   gene            401040..401792
FT                   /gene="rpsC"
FT                   /locus_tag="ABSDF0429"
FT   CDS_pept        401040..401792
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="ABSDF0429"
FT                   /product="30S ribosomal protein S3"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99820"
FT                   /db_xref="GOA:B0VQS4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99820.1"
FT                   /translation="MGQKVHPVGIRLGVVKRHNANWYANPKQYAEYLLKDLQVREFLTK
FT                   KLKNAMVSNILIERPSGAAKVTISTARPGIVIGKKGEDIEKLQRELTNIMGVPAQVSIN
FT                   EIDRPDLDARLVAEAIASQLEKRVMFRRAMKRAVQNTMRAGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATMRAETTYGTIGVKVWIFRGEILGGMKQVMNPAPAEE
FT                   RPAKRGRGRGEGQERRGRRGDRAADKGE"
FT   gene            401796..402209
FT                   /gene="rplP"
FT                   /locus_tag="ABSDF0430"
FT   CDS_pept        401796..402209
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="ABSDF0430"
FT                   /product="50S ribosomal protein L16"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99821"
FT                   /db_xref="GOA:B0VQS5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99821.2"
FT                   /translation="MLQPKRTKFRKVHKGRNTGLAHRGSTVSFGSIAIKATERGRMTAR
FT                   QIEAARRAISRRIKRGGKIFIRVFPDKPITEKPLEVRMGNGKGNVEYWVCEIKPGKILY
FT                   EIEGVNEDLAREAFALAAAKLPFKTTIVTRTVM"
FT   gene            402209..402406
FT                   /gene="rpmC"
FT                   /locus_tag="ABSDF0431"
FT   CDS_pept        402209..402406
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="ABSDF0431"
FT                   /product="50S ribosomal protein L29"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99822"
FT                   /db_xref="GOA:B0VQS6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99822.1"
FT                   /translation="MKTKDLREKSVEELKALLDEQQLNQFRLRMAKATGQLGKSHEVQV
FT                   ARKTIARIKTLLTEKQGNGQ"
FT   gene            402403..402660
FT                   /gene="rpsQ"
FT                   /locus_tag="ABSDF0432"
FT   CDS_pept        402403..402660
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="ABSDF0432"
FT                   /product="30S ribosomal protein S17"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99823"
FT                   /db_xref="GOA:B0VQS7"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99823.1"
FT                   /translation="MSEKTVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKL
FT                   HAHDENNVAKIGDVVTIKESRPISKTKAWTLVEVVEAAAE"
FT   gene            402753..403121
FT                   /gene="rplN"
FT                   /locus_tag="ABSDF0433"
FT   CDS_pept        402753..403121
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="ABSDF0433"
FT                   /product="50S ribosomal protein L14"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99824"
FT                   /db_xref="GOA:B0VQS8"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99824.1"
FT                   /translation="MIQTETMLDVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKE
FT                   AIPRARVKKGDVMNAVVVRTKFGIRRPDGSVIRFDDNAAVILNNNKAPIATRIFGPVTR
FT                   ELRIEQFMKIISLAPEVL"
FT   gene            403131..403448
FT                   /gene="rplX"
FT                   /locus_tag="ABSDF0434"
FT   CDS_pept        403131..403448
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="ABSDF0434"
FT                   /product="50S ribosomal protein L24"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99825"
FT                   /db_xref="GOA:B0VQS9"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99825.1"
FT                   /translation="MAKIKKGDQVIVIAGKEKGKQGTVLSVSEDRVKVEGLNLVKKHQK
FT                   PNRVTGAEGGIVTQEASLHISNVAILNATTQKADRVGYQVIDGVKTRVYKSTGESVAVA
FT                   K"
FT   gene            403464..404000
FT                   /gene="rplE"
FT                   /locus_tag="ABSDF0435"
FT   CDS_pept        403464..404000
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="ABSDF0435"
FT                   /product="50S ribosomal protein L5"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99826"
FT                   /db_xref="GOA:B0VQT0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99826.2"
FT                   /translation="MARLKARYNDELKAKLQEELSIKNVMEIPRITKITLNMGVGAAAT
FT                   DKKLLDGAVADMQLIAGQKPVVTLARKSIAGFKIRDGWPIGCKVTLRGDQMYEFLDRLI
FT                   SIAIPRIRDFRGFSAKSFDGRGNYSMGLKEQIVFPEIDFDKIDRIRGMDITITTTARTD
FT                   DEGRALMRAFGFPFK"
FT   gene            404010..404315
FT                   /gene="rpsN"
FT                   /locus_tag="ABSDF0436"
FT   CDS_pept        404010..404315
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="ABSDF0436"
FT                   /product="30S ribosomal protein S14"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99827"
FT                   /db_xref="GOA:B0VQT1"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99827.1"
FT                   /translation="MAKKGMINRELKREKTVAKYAVKRAELKATIANVNASDEERFEAM
FT                   LKLQALPRNASPVRLRNRCGLTGRPHGYFRKFGLSRNKLRDTVMQGDVPGVVKASW"
FT   gene            404327..404722
FT                   /gene="rpsH"
FT                   /locus_tag="ABSDF0437"
FT   CDS_pept        404327..404722
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="ABSDF0437"
FT                   /product="30S ribosomal protein S8"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99828"
FT                   /db_xref="GOA:B0VQT2"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99828.1"
FT                   /translation="MSMQDTVADMLTRVRNAQMAKKQTVSMPSSKLKVAIANVLQQEGY
FT                   ISNVEVAQEETKSTLTITLKYFEGKPVIEMVKRVSRPGLRQYRGKDKLPSVKQGLGIAI
FT                   VSTSKGIMTDRAARAAGIGGEVIAFVS"
FT   gene            404736..405269
FT                   /gene="rplF"
FT                   /locus_tag="ABSDF0438"
FT   CDS_pept        404736..405269
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="ABSDF0438"
FT                   /product="50S ribosomal protein L6"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99829"
FT                   /db_xref="GOA:B0VQT3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99829.1"
FT                   /translation="MSRVAKAPVTVPNGVTVTQNGRQVEVKGSKGTLSFNLHALVELKQ
FT                   EEGKLQLAPAKESKDAWMQAGTARAVLNNLVKGVSEGFERKLQLVGVGYKAVVKGTVVN
FT                   LNLGYSHPIDYALPEGVTAETPTATEIILKSANKQLLGQVAAEIRAYRSPEPYKGKGVR
FT                   YSDEVILRKEAKKK"
FT   gene            405284..405634
FT                   /gene="rplR"
FT                   /locus_tag="ABSDF0439"
FT   CDS_pept        405284..405634
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="ABSDF0439"
FT                   /product="50S ribosomal protein L18"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99830"
FT                   /db_xref="GOA:B0VQT4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99830.1"
FT                   /translation="MNEKKQSRLRRAKSTRLHIRALGVTRLCVNRTPRHIYAQVISADG
FT                   GKVLAQASTLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHGRIKA
FT                   LADAAREGGLEF"
FT   gene            405637..406134
FT                   /gene="rpsE"
FT                   /locus_tag="ABSDF0440"
FT   CDS_pept        405637..406134
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="ABSDF0440"
FT                   /product="30S ribosomal protein S5"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99831"
FT                   /db_xref="GOA:B0VQT5"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99831.1"
FT                   /translation="MAKVEQNEGLVEKLVAVDRVAKVVKGGRIFSFTALTVVGDGNGRV
FT                   GFGRGKAREVPAAISKALEAARRNMITVDLAGTTLQHPVNARHGASRVYMQPASEGTGV
FT                   IAGGAMRAVLEAAGVHNVLAKCYGSTNAANVVNATFKGLRDMTSPEKVAAKRGKSVEEI
FT                   QG"
FT   gene            406141..406317
FT                   /gene="rpmD"
FT                   /locus_tag="ABSDF0441"
FT   CDS_pept        406141..406317
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="ABSDF0441"
FT                   /product="50S ribosomal protein L30"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99832"
FT                   /db_xref="GOA:B0VQT6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99832.1"
FT                   /translation="MKTIKVTQTKSSSHRLKNHKLCLQGLGLRRIGHTVEVQDTPSNRG
FT                   MINKVYYMVSVEE"
FT   gene            406321..406761
FT                   /gene="rplO"
FT                   /locus_tag="ABSDF0442"
FT   CDS_pept        406321..406761
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="ABSDF0442"
FT                   /product="50S ribosomal protein L15"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99833"
FT                   /db_xref="GOA:B0VQT7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99833.1"
FT                   /translation="MTLRLNELAPAEGAKREHRRLGRGIGSGVGKTGGRGIKGQKSRKS
FT                   GGVRPGFEGGQTAIYRRLPKFGFTSQIALKTAEVRLSELSKVEGDIVSLETLKAANVVR
FT                   RDQIRARIVLSGEITRAFTVQGVALTKGAKAAIEAAGGKVEE"
FT   gene            406768..408126
FT                   /gene="secY"
FT                   /locus_tag="ABSDF0443"
FT   CDS_pept        406768..408126
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="ABSDF0443"
FT                   /product="secretion protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99834"
FT                   /db_xref="GOA:B0VQT8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99834.1"
FT                   /translation="MSMSPSSSGHVNMMKGQPFHVKYREIIRRMSFLIGALLVFRLGAH
FT                   IPVPGINNAALENLFHANQGTILGLFNMFSGGALERMSILALGIMPYISASIIVQLMST
FT                   VIPSLEALKKEGEQGKRKINQYTRQGTLLLAVVQAVGMCAGLIGQGITLSSGLAFYIPA
FT                   VTSLVAGTMFLMWLGEQITERGIGNGISMIIFAGIVAGLPKLIMQSVSSVDNGQTSLIG
FT                   LVIFGLLSLGVLAAIVFIEKAQRRIPVNYAQKQQGRRIFTAQQTHLPLKINMAGVIPAI
FT                   FASSLLLFPASLGQWVGSADPNAGLIKRSLQDLALVLSPGQPLYLVLFGALIIFFCYFY
FT                   TALVFSPKEVSENLKRSGAYVPGIRPGEQTARYLDHILNRLTFIGAIYIAVICLMPMIL
FT                   QSSFGIPFYLGGTSLLIVVVVVMDFMAQLQAHLTFHQYDNQTLMRKTTAHPKG"
FT   gene            408147..408263
FT                   /gene="rpmJ"
FT                   /locus_tag="ABSDF0444"
FT   CDS_pept        408147..408263
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="ABSDF0444"
FT                   /product="50S ribosomal protein L36"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99835"
FT                   /db_xref="GOA:B0VQT9"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99835.1"
FT                   /translation="MKVQASVKKICGSCKVIRRNGVIRVICSAEPRHKQRQG"
FT   gene            408371..408727
FT                   /gene="rpsM"
FT                   /locus_tag="ABSDF0445"
FT   CDS_pept        408371..408727
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="ABSDF0445"
FT                   /product="30S ribosomal protein S13"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99836"
FT                   /db_xref="GOA:B0VQU0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99836.1"
FT                   /translation="MARIAGVNIPDNKHAVISLTYIFGIGRHTAKNILAAVGITETTKI
FT                   RELDDAQLDAIRAEVAKVPTEGDLRREISMNIKRLMDLGCYRGLRHRRSLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            408747..409133
FT                   /gene="rpsK"
FT                   /locus_tag="ABSDF0446"
FT   CDS_pept        408747..409133
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="ABSDF0446"
FT                   /product="30S ribosomal protein S11"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99837"
FT                   /db_xref="GOA:B0VQU1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99837.1"
FT                   /translation="MAKDTRTRKKVTRTVSEGVAHIHASFNNTIVTITDRQGNALAWAT
FT                   SGGQGFRGSRKSTPFAAQVAAEVAGKAALDYGLKNLDVLVKGPGPGRESAVRALGAVGY
FT                   KINSITDVTPIPHNGCRPPKKRRV"
FT   gene            409146..409772
FT                   /gene="rpsD"
FT                   /locus_tag="ABSDF0447"
FT   CDS_pept        409146..409772
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="ABSDF0447"
FT                   /product="30S ribosomal protein S4"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99838"
FT                   /db_xref="GOA:B0VQU2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99838.1"
FT                   /translation="MARYIGPKCKLSRREGTDLQLKSGVKPFDVKTKKANKAPGQHGQA
FT                   RGGKQSEYSLQLREKQKVRRIYGVLERQFSNYYKEAARVKGATGENLLKLLESRLDNVV
FT                   YRMGFGSTRAEARQLVSHRSITLNGRRVNIASIQVKAGDVIAVHEGAKQQLRIKNAIEL
FT                   AAQRGIPAWIEVDHSKLEGTFKAAPDRSDLPAEINESLIVELYSK"
FT   gene            409790..410797
FT                   /gene="rpoA"
FT                   /locus_tag="ABSDF0448"
FT   CDS_pept        409790..410797
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="ABSDF0448"
FT                   /product="RNA polymerase, alpha subunit"
FT                   /function="2.2.2 : transcription related"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99839"
FT                   /db_xref="GOA:B0VQU3"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99839.1"
FT                   /translation="MTRTANEFLTPQAIKVEAVSGTSAKVILEPLERGFGHTLGNALRR
FT                   ILLSSLPGAAVVEVEIEGVEHEYSTLEGLQQDIVELLLNLKGLSIKLFDQNEAYLTLEK
FT                   QGPGDITAADLRLPHNVEVVNPEHLIGTLSATGSLKMRLKVSQGRGYETSDSRFPEGET
FT                   RPVGRLQLDASYSPIKRVSYTVENARVEQRTDLDKLVIDLETNGTVDPEEAIRKAATIL
FT                   QQQIAIFVDLQKDQTPVAQEPREEVDPILLRPVDDLELTVRSANCLKAENIYYIGDLVQ
FT                   RTEVELLKTPNLGKKSLTEIKDVLASKGLQLGMRLENWPPASLRMDDRFAYRSR"
FT   gene            410816..411193
FT                   /gene="rplQ"
FT                   /locus_tag="ABSDF0449"
FT   CDS_pept        410816..411193
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="ABSDF0449"
FT                   /product="50S ribosomal protein L17"
FT                   /function="2.3.2 : translation"
FT                   /function="2.3.8 : ribosomal proteins"
FT                   /function="6.6 : ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99840"
FT                   /db_xref="GOA:B0VQU4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99840.1"
FT                   /translation="MRHRNSGVKLGRTSSHRKAMFQNLANSLFEHELIKTTLPKAKELR
FT                   RVAEPLITLAKNDTVANRRLAFARTRNAATVGKLFTVLGPRYKERNGGYLRVLKAGFRA
FT                   GDAAPMAYVELVDREVNTSAE"
FT   gene            411375..412865
FT                   /locus_tag="ABSDF0450"
FT   CDS_pept        411375..412865
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0450"
FT                   /product="putative monooxygenase, flavin-binding family"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99841"
FT                   /db_xref="GOA:B0VQU5"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99841.1"
FT                   /translation="MEKQVDVLIIGAGISGIGVAAHLSKNSPQRQFEILERRESFGGTW
FT                   DLFRYPGIRSDSDMSTFGFNFKPWRKANVLADGASIKGYLGEVIDEFKLKEKIHFGHRV
FT                   LSANYDSASKKWHVIVEDNKKKQQTWVANFVVGCTGYYNYDQGYAPTFPNQEAFKGQLI
FT                   HPQHWPENLDYKGKKVVIIGSGATAITLVPAMSKGGAGHVTMLQRSPTYIASVPSIDFI
FT                   YEKTRRFMSEEAAYKFTRARNIGMQRAIYALSQKHPKTVRRLLLKAIEMQLKGKVDMKH
FT                   FTPSYNPWDQRLCVVPDGDLFKILREGKASVETDQIEKFTETGIQLKSGKHLDADIIVS
FT                   ATGLQVQIMGGVQATIDGEPVKSSEHMLYNGVMLSDVPNMAMIIGYVNASWTLKVDIAA
FT                   DYICRLLNYMDKNNYDEVIPSGDKSVMEEDTVMGSLSSGYISRAADVIPKQGKQAPWQV
FT                   TNNYLEDRKSLKNAKFDDGVLCFHKHSEVSTRKPKLVS"
FT   gene            complement(412915..414087)
FT                   /gene="fadE"
FT                   /locus_tag="ABSDF0451"
FT   CDS_pept        complement(412915..414087)
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="ABSDF0451"
FT                   /product="acyl coenzyme A dehydrogenase"
FT                   /EC_number="1.3.99.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99842"
FT                   /db_xref="GOA:B0VQU6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99842.1"
FT                   /translation="MQSGAIRPIPNMLPRHLFNEEHEAFRETVRKFYEKEVVPNIEKYE
FT                   KQQHVDRDLWNKAGALGLLCTTMPEQYGGSGVDRLYSMILIEEQAYAMDSSTGFSLHSD
FT                   IVANYINNFGNEEQKQKWLPKMATGETVTAIAMTEPGTGSDLQAVRTTAVLDGDEYVIN
FT                   GSKIFITNGYLCDMAIVVCKTGNSDKGSANLSLIIVEANRAGFTKGKPLNKIGMKGQDT
FT                   CELFFDNVRVPKENLLGMEGMGFIMLMKELAWERMLVAIICQAGAEAAFAHTVQYTKDR
FT                   KAFGKPIGAFQNTRFKLAELRTEIDFCRTYLDRCMELQLNEKLSVEAAAAAKYKISDMF
FT                   SKVVDECLQLHGGYGYMIEYPIARAYIDHRANRIYAGTNEIMKELISRTL"
FT   gene            414275..414532
FT                   /locus_tag="ABSDF0452"
FT   CDS_pept        414275..414532
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99843"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99843.1"
FT                   /translation="MSEEMTLEERKVIYRARRGLKEIDVYFDPYVKNYYLKADPAEKAL
FT                   FAELVEQEDPDLLDWFMEVSEPPRTELRDFIYKLKHYVHG"
FT   gene            414825..414929
FT                   /pseudo
FT                   /locus_tag="ABSDF0453"
FT   CDS_pept        414825..414929
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0453"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99844.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            415699..416784
FT                   /locus_tag="ABSDF0454"
FT   CDS_pept        415699..416784
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0454"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99845"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99845.1"
FT                   /translation="MSKVQKICQGLAVSFLAASVLSGCSYVVKSGANVALGFTEKHVVP
FT                   PILAMQDAVMVCNTGSALTPAIMSTKGMGADPTRVAVLMYAASGVCAENQALEQELRYL
FT                   RASKAGQVTEAQDARIAQKRWAAIAAERQYAGYKLFADRWESKYKYHLGDSCPTMRSDI
FT                   DQTVYLLGMISGLQAVTNDINSGGSVNVPKDIAAIVERGMVCLDNQKFWGAPNATRAVI
FT                   WTSLPGANEGKPDPYETLKQSVQIGEQKGVRLSHALYAVAAQASGDDAKIRDALKTYAA
FT                   SQADDKPVNPNFKLIDSMAGLIVRGISDRYWTEHTGVRTGDDGMSHFWDEKNEGSAELD
FT                   ELFDGGAASEAPADTKTAPAQ"
FT   gene            416862..417428
FT                   /locus_tag="ABSDF0455"
FT   CDS_pept        416862..417428
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0455"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99846"
FT                   /db_xref="GOA:B0VQV0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023826"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99846.1"
FT                   /translation="MKDHVLNKKVLLVAGCISVSACLQVFPDYFIYWRESLLGEFWRLW
FT                   TAHWVHVGWIHFLLNMMAFACLPFIFPHTKVWHILSLLFLLPPFISLVFYFYLPNIDAY
FT                   AGLSGVLHGLYTAVALVYLQYRKERNFAFLVLGLIVAKLIWENTFGQTGTAQLIGSPVL
FT                   TEAHLYGAIGGAIFGGCYWLIQRFK"
FT   gene            417616..419811
FT                   /locus_tag="ABSDF0456"
FT   CDS_pept        417616..419811
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0456"
FT                   /product="putative integral membrane protein, transporter"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99847"
FT                   /db_xref="GOA:B0VQV1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99847.1"
FT                   /translation="MQEYQEKRSGLGLLGYIWNEWISTFIILILLLMTLIIGTGEMIHG
FT                   QLLRIGERLYGNPATGMQYSFLRAEPEKPTCDRHPNIDAQVKEQMKANASDDFASFFGA
FT                   ASERDVRASLLAAQQQCEEKYQAYDKTIKYIEANPGVRTYRAIETGFFGIFKFGTENRA
FT                   ILLVFMVLISAITASLKYHHIGLRNPATKIDYKVYSLFMLIGNALLSFSVISQYRSVIN
FT                   SGVTPTYETVTIYWIWMILFVVLTLISLYQLFVSPPLKREGGNIGLALLSVPLYAYMAL
FT                   ITGIVFTFFMDYPMGQGIYLGLLVEFSGIFLNLALFIWAGMLLTQTRVMDLFLNVLRPW
FT                   NLAPETLTWLILIAAAVPTAYTGASGIFVIAAGAIIYKEVWNAGARRQYALAVSAMSGS
FT                   LGVVVRPCLLVVLIAMLDSRHVTSDELFGHGIYVFWLTAFIFLGVSLLLAEEKFRVNSP
FT                   KVALPGMARAFVPVIPYILITVVVLAFYKYALDTGMNEFTAPVILPLVLIAMILYDKMV
FT                   MPKEAPALNIHEAIVREHEKKSPFLQTHDPHSSQFRLGFGGALRFATSETVGHIGALII
FT                   LMALSASVGGLIERSEVVELLPTHLGSIYISLACIALLLAIIGMCTDPFGAVILVAATI
FT                   APVAYENGIHPIHFWMIVLVAFEFGYVTPPVALNHLLTRLSVGDDEVNAADAEAKEKYT
FT                   SFYYRYERWLLPIIVLFSSLVLVTYAPLILKLFGWYK"
FT   gene            complement(419960..420268)
FT                   /pseudo
FT                   /locus_tag="ABSDF0457"
FT   CDS_pept        complement(419960..420268)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0457"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99848.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(420404..420631)
FT                   /locus_tag="ABSDF0459"
FT   CDS_pept        complement(420404..420631)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99849"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99849.1"
FT                   /translation="MVRVIKMKKRFIAGAKCPKCEAIDRIVMLTTAEDEWIECIECGYS
FT                   ENRPTHIDEPETPAIPDEIGVIQFKPRRSD"
FT   gene            complement(420654..422708)
FT                   /gene="prlC"
FT                   /locus_tag="ABSDF0460"
FT   CDS_pept        complement(420654..422708)
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="ABSDF0460"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99850"
FT                   /db_xref="GOA:B0VQV4"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99850.1"
FT                   /translation="MWLLAMTLQQATLPTPRFDQITLDNLKQDIQQAIQAGQEFLNTLT
FT                   AAPSETDQQLAVLEQIDALENNLNESWGVLSHLNAVMSNAETREVYQSLLPALSEYYTQ
FT                   LGQHTALYQTYQLIHDSQSYSTLSPAQQSAIRLALRDFKLSGVALEGEEKKRYAEISAR
FT                   LSQLSSDFSNHVLDATQAYFKPLTEDELKGLPESNVELLKQYGKQRELDQAVATLDFPA
FT                   YFAIMTYADDRALREELYKAYVTRASDQSEQTEFDNSKIMEEILSLRQEMAKLLGFNNY
FT                   AEYSLASKMAPDVKTVHDFLVDLAEHARTPALQEVAELQAIAKQDGIDELKPWDTTYYS
FT                   EKLKQQQFNLSQEALKPYFPAPKVIQGLFQIVQRLYGINIVEREAPVWHPDARYFELED
FT                   QGEVVGGFFFDLYARTGKRGGAWMSGFRSRMQTVHGLQKPICYMVCNFTPPVGNQPALL
FT                   THDEVITLFHEFGHGLHHMLTEVDNISVAGTHGVAWDAVELPSQFMEFWSWDKESLDVL
FT                   SEHIESKQTLPQELLDALLNARFFQSGMQTLRQLEFALFDLTIHTNTPALNSEQIQQTL
FT                   NDIRKQYAVVPTVDYNRFQHSFSHIFAGGYAAGYYSYKWAEVLASDAFDRFENEGIFNT
FT                   QTGKEFRQAILAVGGKDTALEAFVNFRGREPKIDALLRHQGWTNDNKTA"
FT   gene            complement(422842..425274)
FT                   /gene="rnr"
FT                   /locus_tag="ABSDF0461"
FT   CDS_pept        complement(422842..425274)
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="ABSDF0461"
FT                   /product="exoribonuclease R"
FT                   /function="1.2.1 : RNA"
FT                   /function="2.2.4 : RNA degradation"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99851"
FT                   /db_xref="GOA:B0VQV5"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99851.1"
FT                   /translation="MKPNDMTKNWVDPEAKAEAERYDNPIPSRTLILDTLEQLQTPQSR
FT                   AELVDHFHIQDQKSIEALSHRLSAMVRDGQLMKDGFKFQLVADQPTYEATVYINSKGLG
FT                   TAHIDGQDDLLLPERELRLVFNGDRVRVRQTSVDRKGKPWGFITEVIQHRVKQLIGKLS
FT                   VHDGEYFIQPNNPNQHQPIPLEKELVEHAKANVGDMLRVAIDTYPTREEFATAHIIQSM
FT                   ADKADTEIIIPQTILEFGLPYEFPDEVIKEAESFKEPAEQDREGRVDLRDLALVTIDGE
FT                   DARDFDDAVYAEKRPGGGYRVVVAIADVSHYVRLDSALNEEAEERGTSVYFPHFVLPML
FT                   PEALSNGLCSLNPHVDRLCMVCDLKLSRTGRVTGYEFYPAVMHSKARLTYTQVGQYFEG
FT                   ATDAIPKDRDIHKSLNTLFQLYQILKNLRVDRHAMEFETIETYMTFDELGGIKEILPRT
FT                   RNDAHKLIEECMLLANVAAAEYALEHDIPMLYRVHEAPEFSRIQKVKDFVKLLGLPFPD
FT                   QPTQADYQKVIEATKDRIDAPSIHAVLLRSMMQAYYGAKNAGHYGLAYEAYTHFTSPIR
FT                   RYPDLLLHRAIKAHLKQKPYPLSGAALDDAGEHFSQTERRADEASRSVTTWLKCHYMQQ
FT                   HLGDEFIGIVSAVTEFGLFVTLKDLYVDGMIHISQLGDDFFIYDQASQNLIGQNRGQVF
FT                   GLGDEVKIQVAGVNLEERKIDFQLIKQVTHAGRVVRSRAPRTTKTSTQATEEVFGKPSV
FT                   STDGEKPVRKKKEKGKPSSYSKKSGKKTSTKAEAKPEKVKKKAKPKKKKSNAKSKAD"
FT   gene            425521..425611
FT                   /locus_tag="ABSDF_tRNA7"
FT   tRNA            425521..425611
FT                   /locus_tag="ABSDF_tRNA7"
FT                   /product="tRNA-Ser"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            425622..425698
FT                   /locus_tag="ABSDF_tRNA8"
FT   tRNA            425622..425698
FT                   /locus_tag="ABSDF_tRNA8"
FT                   /product="tRNA-Arg"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            425738..425814
FT                   /locus_tag="ABSDF_tRNA9"
FT   tRNA            425738..425814
FT                   /locus_tag="ABSDF_tRNA9"
FT                   /product="tRNA-Arg"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            425922..426191
FT                   /pseudo
FT                   /locus_tag="ABSDF0462"
FT   CDS_pept        425922..426191
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0462"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99852.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(426451..427263)
FT                   /locus_tag="ABSDF0464"
FT   CDS_pept        complement(426451..427263)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0464"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99853"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VN47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99853.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTVCRRQKHID
FT                   IAISYQQSRDGLHLLVASTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            427477..427977
FT                   /locus_tag="ABSDF0465"
FT   CDS_pept        427477..427977
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99854"
FT                   /db_xref="GOA:B0VQV8"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99854.1"
FT                   /translation="MMTEQKSALSLRYFLNLEESQDGFGLVTFGKKQFTRFLTPVISIA
FT                   IIIWGLYLGFSGVGRYYVALGVFFLVMQGLMRYWLLPMMFKRQFVRYQFGKSEQGIDLY
FT                   QDYFEFYAAGRKQAVQYSEVQTFAKGKLTYMLELKNKTVIIVPKRAFAQASDQTIFENT
FT                   FKK"
FT   gene            428017..428658
FT                   /locus_tag="ABSDF0466"
FT   CDS_pept        428017..428658
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99855"
FT                   /db_xref="GOA:B0VQV9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99855.1"
FT                   /translation="MKTRPSKIVCVGRSYADHVKELNNAMPGRPVLFIKPPSSLIGLDE
FT                   GISWNPAWGSCHFECEFVLRIDQPLKGETDPQKVLQAIGAVTLGLDLTLRDLQNELKDK
FT                   GQPWERAKAFDGSCVLADWVDVSEITNWEETRFTFHINDELRQDGNTALLMFNIAYLLV
FT                   DINQVFSLEPGDVIMTGTPAGVGPLNAGDQLKMTLKGATQDFVWETFVKA"
FT   gene            complement(428734..429573)
FT                   /locus_tag="ABSDF0467"
FT   CDS_pept        complement(428734..429573)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0467"
FT                   /product="putative HTH-type transcriptional regulator (AraC
FT                   family)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99856"
FT                   /db_xref="GOA:B0VQW0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99856.1"
FT                   /translation="MKNRQDISNFRQFSKMKKSAQRVQDFQEIPAHNAIPDLLWFRVRN
FT                   APAETVYPQHAHAWGEFIYAFSGVLEVNIDQINYLTPPPYGIWLPPYTKHSGINRNEVT
FT                   HATLYVHESLCQKLPQKAGILLTSPLVPALLDHLRQNPQDETQVEYIRLLQVLLDRLIQ
FT                   AELVGSYLPTTDHPALAKILNDLHQCPADNSTLQELAERINMTERTLARYSQKELGKSL
FT                   HEWRQRLKVMKAMTMLNQGKTIESIAFDLGYASASAFIYMFKRWMGFTPDQFRKLYQ"
FT   gene            429634..430458
FT                   /locus_tag="ABSDF0468"
FT   CDS_pept        429634..430458
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0468"
FT                   /product="putative membrane protein"
FT                   /function="4 : Transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99857"
FT                   /db_xref="GOA:B0VQW1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99857.1"
FT                   /translation="MEERKNLDTRASALMVLLCMVLGLQQVVLKIAAPDISPIMQIALR
FT                   SGLSAVLVLPLLWRDHSIHLFSYRQCKAGALVALFFSLEFYFVTQALKFTSHTVVLLYT
FT                   APIFVALGLHWKFPTERLNRVQWGGITLAFMGIILTFYPTTTATNAPALAQVLLGDLYA
FT                   LMAGLAWALSTIIVRLSPLAQAPATQTLFYQLFGCFVLLLLIAFLTNQTTIHFTTLTIL
FT                   SFQTLIVSFASLLLWFWLLRNYLASRLGVFSFLTPLFGVLFSILLLEEKIRN"
FT   gene            complement(430558..431805)
FT                   /locus_tag="ABSDF0469"
FT   CDS_pept        complement(430558..431805)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0469"
FT                   /product="putative ribonuclease (Rbn)"
FT                   /function="2.2.3 : RNA modification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99858"
FT                   /db_xref="GOA:B0VQW2"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99858.1"
FT                   /translation="MLERFLKKLPFYNKTWFQFILFVIKRFEADRCREQAGSLTYTTLF
FT                   AVVPMLTVFLVIISSIKALEPARQQLQHLIYSNFLPKSTIAFDKALNAFTEKSSNLTVI
FT                   GVLFLFVTTVLMLTSIETVFNRIWRVKETRSGIVGFMRYWTIISLGPIILGSAFVISST
FT                   VASMNLLSNNFTGYQLDGAFLLWLISFVLTILGFFILYWTIPNRTVPLYAAAIAACLSA
FT                   ALFETLKNLFSFVMSNFTSYEIIYGAFAAVPIFLLWVFLSWNIVLLGVEVSFALTAFHS
FT                   GKEQKRHPVLMLLDILELFYKKQKLGESVSDKEALEILGRGEVGRWPAYVLLLEEQNLV
FT                   KRTDKDEYVLVRNLSQVDFWSFFTALPYPLPLRQDVSNVHDDDEWMEKIGPALVESNDY
FT                   LAAKLSIPLSTIFEEK"
FT   gene            432063..432686
FT                   /gene="wrbA"
FT                   /locus_tag="ABSDF0470"
FT   CDS_pept        432063..432686
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="ABSDF0470"
FT                   /product="tryptophan repressor binding protein"
FT                   /function="1.5.1.15 : tryptophan"
FT                   /function="3.1.4 : regulation level unknown"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99859"
FT                   /db_xref="GOA:B0VQW3"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99859.1"
FT                   /translation="MFFLTKFVKPMQPYILVLYYSKYGSTKEMAHLIANGVESAGMNVK
FT                   IRTVPNIATVVTEAEPSIPEEGDIYCTLEELANCAGLALGSPTRFGNMASEMKYFWDQT
FT                   TNLWLNGALHNKPACVFTSSGSMHGGQESTLLTMLPPLFHHGMMILGLPNSIPALSNTK
FT                   TGGTPYGASHVSGPRHDQSLSQDEKNLCEAQGKRLGEIVKKLYS"
FT   gene            complement(432739..433383)
FT                   /gene="xpt"
FT                   /locus_tag="ABSDF0471"
FT   CDS_pept        complement(432739..433383)
FT                   /transl_table=11
FT                   /gene="xpt"
FT                   /locus_tag="ABSDF0471"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99860"
FT                   /db_xref="GOA:B0VQW4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99860.1"
FT                   /translation="MHFFGCFLKYAFALKSIRLEDSPVHALEQKILTEGIVLSDQVLKV
FT                   DAFLNHQIDPVLMQQIGKEFAARFKDAGITKIITIEASGIAPAIMAGLELGVPVIFARK
FT                   YQSLTLKDDLYRAKVFSFTKQTESTIAISNKHINSSDKALVIDDFLANGQAALGLIDLI
FT                   HQANAEVVGVGIVIEKSFQPGRDLLLEKGYRVESLARVQSLADGTVTFVKE"
FT   gene            complement(433387..434100)
FT                   /locus_tag="ABSDF0472"
FT   CDS_pept        complement(433387..434100)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0472"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99861"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99861.1"
FT                   /translation="MATKFLKSFSIATGISTTLLIASFSSHALAMSPFQANYQFTYNNK
FT                   GMGSATRALSQQGNNWTYQFTAKAGGIASASETSKFSFANGKIGSQSFSRTSKILIHNN
FT                   TMSINFNPGNKTISTKKDDKARSFAWQAGVLDELNAELQIREDLKNGSLKSSYPLADAK
FT                   EVENRRFVKQGNEKIKTSYGTFDTVKVVLQHKKPERSTIFWLAPKLDYLPVKVSHIDGK
FT                   TSYGLLLTSYTGKTN"
FT   gene            complement(434258..434971)
FT                   /locus_tag="ABSDF0473"
FT   CDS_pept        complement(434258..434971)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99862"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99862.1"
FT                   /translation="MCGFFSKSSSGSSFMQTLFSSLVKRLHKVYRKAEAFIEEERDFTL
FT                   SQTFLNATLERYVTNNVEFLDDLHADLYHDWLRLYATMHVKGLETTLSVDFKLIQMEFN
FT                   KEQQLIVFEQISNTQIVEAKYKNFWQKIAVKAAIFYYHKILKKDPLGMILERFDVAQEK
FT                   DDLIFLDLNRWFAKKASIIETLGKVHINYARVREAELVVFGNVNLAALLFRDQDDDFED
FT                   ELGDTEITPIQQKDV"
FT   gene            435127..435999
FT                   /locus_tag="ABSDF0474"
FT   CDS_pept        435127..435999
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0474"
FT                   /product="conserved hypothetical protein; putative
FT                   tonB-domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99863"
FT                   /db_xref="GOA:B0VQW7"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99863.1"
FT                   /translation="MGKRHLYAFKIMLKKRSLSIEPFYYWWQDRVFIAAIILAILLHIF
FT                   VLLIHFAMPAPSEQSTKEIAISIRPTEDVIKHADFLAQADQQGSGAFRAAHRMSSNSPA
FT                   PRPSDASTGEAQLETLEKVQQQRELKFEEKVLMTVLSWQKQAEESQRKKALEQLQSQFQ
FT                   AKAAMVASLEAQYLQRQQDFSRQQKIKTVDGIQAKKDASAAYLDKFREKVELYGNRYYP
FT                   EEAKQQQLKGEVRLMVILNAQGGIRAIRLLESSGHPVLDEAAKASVRRGAPFGRFDANM
FT                   KREFGLSRI"
FT   gene            complement(435985..436149)
FT                   /pseudo
FT                   /locus_tag="ABSDF0475"
FT   CDS_pept        complement(435985..436149)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0475"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99864.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(436213..436890)
FT                   /pseudo
FT                   /locus_tag="ABSDF0476"
FT   CDS_pept        complement(436213..436890)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0476"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99865.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(437141..437617)
FT                   /locus_tag="ABSDF0477"
FT   CDS_pept        complement(437141..437617)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99866"
FT                   /db_xref="GOA:B0VQX0"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99866.1"
FT                   /translation="MKISLSLQQDFQSPELELKRAQLKKIIETTLRHVGYKEDCEIGIA
FT                   CVDLEESHQLNLQYREKDKPTNALSFPSDIPEEVLPMLDALPLGDLVICIPVVLQEALE
FT                   QKKTAQNHFAHLLVHGVLHLLGYDHETSDEDAEEMEGLEIEILAKLNIANPYQE"
FT   gene            complement(437627..438715)
FT                   /gene="phoL"
FT                   /locus_tag="ABSDF0478"
FT   CDS_pept        complement(437627..438715)
FT                   /transl_table=11
FT                   /gene="phoL"
FT                   /locus_tag="ABSDF0478"
FT                   /product="phosphate starvation-inducible protein
FT                   (PhoH-like)"
FT                   /function="1.8.1 : phosphorous metabolism"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99867"
FT                   /db_xref="GOA:B0VQX1"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99867.1"
FT                   /translation="MTPAIRRTVTFPEISMERLKSILGAYNGHLKQIEQRLDVKITHRG
FT                   DVFYIDGEIDAVGRAEALLQRLYEETEASQQISADLLHLLIQSSQTERNFELVGEEMDE
FT                   HDAPMDVYFQTRKGRINPRGANQKRYVQRILQSDISFGVGPAGTGKTYLAVAAAVDMLE
FT                   RNEIQRILLVRPAVEAGEKLGFLPGDLTQKIDPYLRPLYDALYEMLGFEKVAKLIERQV
FT                   IEVAPLAYMRGRTLNHSFVILDEAQNTTPEQMKMFLTRLGFGSRAVITGDITQVDLPRG
FT                   QQSGLAHALRVLENIKEIHITRFHSRDVVRHQLVQKIVEAYEAWDGEQQRLNAEARAER
FT                   KARQEALIAENDTAADLQHQDA"
FT   gene            complement(438753..440204)
FT                   /locus_tag="ABSDF0479"
FT   CDS_pept        complement(438753..440204)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0479"
FT                   /product="putative tRNA-i(6)A37 modification enzyme (MiaB)"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="2.2.5 : tRNA"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99868"
FT                   /db_xref="GOA:B0VQX2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99868.1"
FT                   /translation="MTVQTFIPNGAKAASENTVTQPTHTTDVSIKKLYIETQGCQMNEY
FT                   DSHRMADLLGDSHGYVLTNNPNEADILLMNTCSIREKAQEKVFSELGRWRKLKEQNPDL
FT                   VIGVGGCVASQEGDNIQKRAPYVDMIFGPQTLHRLPQMLDQHHAQVEKPKKEKIKLVDI
FT                   SFPDIEKFDFLPEPRVEGFKAFVSIMEGCSKYCSFCVVPYTRGEEVSRPLDDVLAEIAG
FT                   LAEKGVREISLLGQNVNGYRGETFEGGICTFPELLRLVAEIPGIGRLRYTTSHPLEFSD
FT                   ELIQCYEDLPQMVSHLHLPVQSGSNDVLKAMKRNHTIDVYIDKIAKLRKIRPDMHLSSD
FT                   FIIGFPGETDENFAETLQFIKDLGFDHSYSFVYSKRPGTPASDLPDTTPEHVKKERLAQ
FT                   VQQVIKQSSIEKTDAMLGKIERVLIEKVSDQDPNILVGTADNTRLVTFVGDASRVGRFA
FT                   EIEITEIKTLNLVYGELLNLEPDVA"
FT   gene            440451..442436
FT                   /locus_tag="ABSDF0480"
FT   CDS_pept        440451..442436
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0480"
FT                   /product="putative lytic murein transglycosylase, soluble
FT                   (Slt)"
FT                   /function="1.7.34 : peptidoglycan (murein) turnover,
FT                   recycling"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99869"
FT                   /db_xref="GOA:B0VQX3"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99869.1"
FT                   /translation="MRPGKKSSSNKSRVMKNKYAHRSWLGAVCLLGCSLSYAAEEQFND
FT                   ALNAANSGNTALLDQYQLAMQNDVLGYYPEYWKLNTNLGFQSPTSIVSFAQRYPQSAMA
FT                   EKLAADYVEEKVKQADFASAQPILPYVSNPDQAENCALAQVRAKSGDALVFAEYKDVWL
FT                   ATESQPESCIGLGRMMLSSPLMSTQDKQQRLWVQLRAGLSGQALATAQTLGLNLSLAQL
FT                   NQIQANPLNYLWSAPKTNDVDYAYLIFALGRLANNDLGNAFANVQRVAQGTPESVQKYL
FT                   YRTVAYIGGTTVMKNNFNREVLQYFDASYGYPLSPEEAEIYARQAIRFSAWESLIRAID
FT                   SMSVSQKQEDRWQYWLARATEQRGDSNSKNTAQCIYKKLAESGDDYHNLLAKDRLGVRY
FT                   NHQPYNDEPTASDLRRLDQNIHFNRAFTLRRINVNPTYTNREWNWAVRQAYLQHDDGLL
FT                   LAAAKRAHDMGWYDRAIYAADRTTNKHNDTYRYVTPHKTNVVSHSYNAGIDPAWAYGLM
FT                   RQESRFVTSARSHVGAGGLMQIMPDTAKLIARQMGETYNPAALSEMNTNIRYGTFYLSM
FT                   IQGQLSNNPVLATAGYNAGPNRARRWQPDYQPIEADQYTETIPLLETRDYVKHVMTNAT
FT                   HYGVILGQGAQSLIQRMKVIPTRSSP"
FT   gene            442494..443156
FT                   /locus_tag="ABSDF0481"
FT   CDS_pept        442494..443156
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0481"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99870"
FT                   /db_xref="GOA:B0VQX4"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99870.1"
FT                   /translation="MKYRDLGLQSISQLAWWIICASVGLLSSVLHAEPVNVQGYVMHVQ
FT                   MTPAVCALDPSKQKQRKCLEGYSLTITGLMPETTRTDCSTQSSATLSPLQAKVVARVMP
FT                   DNNARVQLWRSVGGCVPMNASQYFRTIINFAERLKIPANLTSSTNVEMQQSTLRQQLTK
FT                   LNPSLPQNGIRFTCQLSRSDVVLTEVKVCYTVNGQYKQCSNHVVSNCPSEITIKGSY"
FT   gene            443368..444354
FT                   /gene="mdh"
FT                   /locus_tag="ABSDF0482"
FT   CDS_pept        443368..444354
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="ABSDF0482"
FT                   /product="malate dehydrogenase"
FT                   /function="1.3.4 : tricarboxylic acid cycle"
FT                   /EC_number="1.1.1.37"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99871"
FT                   /db_xref="GOA:B0VQX5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99871.1"
FT                   /translation="MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEVPV
FT                   EKAQQALKGVMMELDDCAFPLLAGMIGTDDPKVAFKDADYALLVGSRPRGPGMERADLL
FT                   KVNGEIFIGQGQALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHN
FT                   RALTQVAQKAGVVVADIEKLTVWGNHSPTMYADYRFATANGESLKDKINDPAWNKDVFL
FT                   PTVGKRGAAIIEARGLSSAASAANAAIDHMRDWALGTNGKWVTMGVPSDGSYGIPEGVM
FT                   FGFPVTTENGEYKIVQGLEIDEFSRERINFTLNELEEERAAIADMVK"
FT   gene            444517..444762
FT                   /locus_tag="ABSDF0483"
FT   CDS_pept        444517..444762
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99872"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99872.1"
FT                   /translation="MFEQQPTLQLLFEQLGLESDDASIENFIRTHQLPAEQKLHEASFW
FT                   SQGQSDFLKSHWEKDDEWIVVIDELNEQLHEDSVKK"
FT   gene            complement(444811..445338)
FT                   /locus_tag="ABSDF0484"
FT   CDS_pept        complement(444811..445338)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99873"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99873.1"
FT                   /translation="MSIETKTTVSRIGETDQLYLTENTPELALERAELRMQLVTLSRVR
FT                   QEQIHFLQEAIVLLEQARMEYEEMPMSLYLNLSLHLAKAYMLYFELNKEKRFALIAQQI
FT                   LKPLAHHQHGDIYFFLAYASAAQQESALTRHWLTKYLSTAQCDLELLHEHPIFNPVRHE
FT                   LWYKNLIKLRTH"
FT   gene            complement(445406..446011)
FT                   /locus_tag="ABSDF0485"
FT   CDS_pept        complement(445406..446011)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99874"
FT                   /db_xref="GOA:B0VQX8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99874.1"
FT                   /translation="MHSQPLLDCWNLDQILDDLNAHGFAIVNQAYSAEYHTQVAKECSH
FT                   HFDEFREAGIQNGVVSTIRSDHILWINESLPVAEQHVETLTSFCQHLNQAFFLGIKEVE
FT                   AHFACYNPGEFYALHRDNPQQKNDRIMSTVYYLHPQWQDDWGGQLRLQDKNDIWHIITP
FT                   EPNRLVIFQSNLLHEVLVSKQQRLSITAWLRSGNSIWV"
FT   gene            446129..446986
FT                   /locus_tag="ABSDF0486"
FT   CDS_pept        446129..446986
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99875"
FT                   /db_xref="GOA:B0VQX9"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99875.1"
FT                   /translation="MNYRHHFHAGNFADVMKHVLLLQLLNRLNAKDKPYRYIDTHGGAG
FT                   KYDLSQAPAQKSGEFLTGIHRLVQLSGMEKRQAPEAIQQYLKLVEELRAQEGKGSYPGS
FT                   PWFALQGMREIDKATIFEMQRDVFQQLRHNIHDKRAGLHERDAYEGLLAVIPPKEKRGL
FT                   VMIDPPYELERKDFPQLVELLQSAYKKWPTGVFAVWYPIKDRAMIERFEKKMFKTGIRR
FT                   QLICEICVWPDDTPVGLNGCGLLVINPPWQFSEQADQALQWLFPHLRMQETGGHAAVRW
FT                   LVGE"
FT   gene            447028..447861
FT                   /gene="pssA"
FT                   /locus_tag="ABSDF0487"
FT   CDS_pept        447028..447861
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="ABSDF0487"
FT                   /product="phosphatidylserine synthase"
FT                   /function="1.5.4 : fatty acid and phosphatidic acid"
FT                   /EC_number="2.7.8.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99876"
FT                   /db_xref="GOA:B0VQY0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99876.1"
FT                   /translation="MTNEPKPEQDLTHNEHSFDGITFEVVEEEDNPEGQKVKRRGIYLW
FT                   PNLITTAALLSGFYSIIASMNGEFAQAIYAIFLAALFDGLDGRVARAIGAQSAFGEQYD
FT                   SLSDLLAFGVAPAMLMYSWSLHDLGRIGLACCFVYTACAAFRLARFNVQIGVVDKRYFI
FT                   GIASPLAAIIIISLVWVARDYPFIFDLRDIAIQTINAVIMVVVGLLMISNIKYYSFKQM
FT                   DRKRVPFVVMLPVVLIFAAITYNIPMGILIVSIIYALSGFVTTLLAKKNNETIKT"
FT   gene            447868..448950
FT                   /locus_tag="ABSDF0488"
FT   CDS_pept        447868..448950
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99877"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99877.1"
FT                   /translation="MRFGMPKLISEKNQLQQLSLNSNGGVVYQPARGFFKVVYQGLILP
FT                   NLPAPLRYFNYISLIGQPRIPLCYNTNGILTSAVDTATVLVSNSLHSVGHLKTYSIRRQ
FT                   CQLNPSRYQFDKTDLIEWQIPRVQLRRIDSEMSCDLIVQTPSDISNSSALQWGISDYWS
FT                   ILCHCEGEILYKGQKYEVNGLGRFKHARALHLPFLSLCFYTCQIINLNETTQVTLSQIR
FT                   NQWNIILFSRLDIQELGKQPLTFTEDVNFHIHRVYPKVETPHGREMYLPREFSWQCKKN
FT                   GKVIFELYGESRGDYKFGLAAGYIGSFRYQLSWNDQCLQGEGGYCEYIDCRPLRWQEKN
FT                   QNEKMLDKLLLLQPCLYKKT"
FT   gene            449027..449932
FT                   /locus_tag="ABSDF0489"
FT   CDS_pept        449027..449932
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0489"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99878"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99878.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            450427..451955
FT                   /locus_tag="ABSDF_16S_5"
FT   rRNA            450427..451955
FT                   /locus_tag="ABSDF_16S_5"
FT                   /product="ribosomal RNA 16S"
FT   gene            452016..452092
FT                   /locus_tag="ABSDF_tRNA10"
FT   tRNA            452016..452092
FT                   /locus_tag="ABSDF_tRNA10"
FT                   /product="tRNA-Ile"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            452148..452223
FT                   /locus_tag="ABSDF_tRNA11"
FT   tRNA            452148..452223
FT                   /locus_tag="ABSDF_tRNA11"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            452564..455465
FT                   /locus_tag="ABSDF_23S_5"
FT   rRNA            452564..455465
FT                   /locus_tag="ABSDF_23S_5"
FT                   /product="ribosomal RNA 23S"
FT   gene            455642..455756
FT                   /locus_tag="ABSDF_5S_5"
FT   rRNA            455642..455756
FT                   /locus_tag="ABSDF_5S_5"
FT                   /product="ribosomal RNA 5S"
FT   gene            complement(455968..457341)
FT                   /locus_tag="ABSDF0493"
FT   CDS_pept        complement(455968..457341)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0493"
FT                   /product="putative pyridine nucleotide-disulfide
FT                   oxidoreductase, class I"
FT                   /EC_number="1.8.1.4"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99879"
FT                   /db_xref="GOA:B0VQY3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99879.1"
FT                   /translation="MFDLIIIGAGTAGISAYKEAVKYTNNLLIINDGPWDTTCARVGCM
FT                   PSKVLISTANRMYDIQNAQEVGLSASADISTDQVMEHVRTLRDRFTKATVKDVEQWPTE
FT                   HKISGKAHFIDAKTIEVNGKRHQSKSFILAVGSTPNYDQTWKQELDDRLITTDQIFELN
FT                   TLPKSIAIIGSGVIALEIAQAMHRLGVETTIFARSKRIGIFTSPKLQQLAQEELSKELN
FT                   FLFETLPHEVKSTSDGVILNYKINEKEESIQTEYVLSATGRSSLLDTLKLENIDKSFKD
FT                   IKLLPVNAKTKQLDNYPIFIAGDAYTSTPLQHEAAHEGKKVVHNCLNYPQLNSVKTLPP
FT                   LGIVFSHPEMAIVGQSYKQLKDDGVDFVTGEASYERQGRAIVLGKNKGAIEVYIERESQ
FT                   KLLGAELFTEATEHMAHLLSWIIGEELTLNDILEKPFYHPTLEEGVRTALKHARRQLK"
FT   gene            complement(457428..458057)
FT                   /pseudo
FT                   /locus_tag="ABSDF0494"
FT   CDS_pept        complement(457428..458057)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0494"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99880.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            458299..459111
FT                   /locus_tag="ABSDF0495"
FT   CDS_pept        458299..459111
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0495"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99881"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99881.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKRID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            complement(459409..459744)
FT                   /locus_tag="ABSDF0496"
FT   CDS_pept        complement(459409..459744)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99882"
FT                   /db_xref="GOA:B0VQY6"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99882.1"
FT                   /translation="MSENVGFAGQIGPEHVGQVVEKGFKSIINNRPDMEGGPEQPTSAQ
FT                   IEEAARQAGLDYVYQPVVAGQITELDVRTFANHYNELPKPVLMFCRTGNRSNNLYQLAK
FT                   QMDLLDD"
FT   gene            460049..460831
FT                   /locus_tag="ABSDF0498"
FT   CDS_pept        460049..460831
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99883"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99883.1"
FT                   /translation="MVLPDCVNSNSSYAQRFAQAGYAVILFDYRYWGGSTGKPREMISI
FT                   NSQLEDWKTMIQYASTCKFIDNRRIVLWGTSLSGGYALSLASELKNIQAIMVQIPYVDG
FT                   AETAKLYPLQRYPQALKLSSQDYMGSKMGLNPKRLPVVDQYKLCFMPTADSYYGYLSIV
FT                   NPDYYWSGEVPARVFFNLMRYRPIQLVRQINIPVLFIAAQHDSLIPIESSREAATNIAP
FT                   FVSYHEWDMKHFDIYHGSWFEKAVTTQLEFLHQHIGVM"
FT   gene            460832..461023
FT                   /pseudo
FT                   /gene="thi3"
FT                   /locus_tag="ABSDF0499"
FT   CDS_pept        460832..461023
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="thi3"
FT                   /locus_tag="ABSDF0499"
FT                   /product="fragment of thioredoxin C-3 (part 1)"
FT                   /function="1.6.15.2 : thioredoxin, glutaredoxin"
FT                   /note="Evidence 7 : Gene remnant; Product type c : carrier"
FT                   /db_xref="PSEUDO:CAO99884.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            461039..461173
FT                   /pseudo
FT                   /gene="thi3"
FT                   /locus_tag="ABSDF0500"
FT   CDS_pept        461039..461173
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="thi3"
FT                   /locus_tag="ABSDF0500"
FT                   /product="fragment of thioredoxin C-3 (part 2)"
FT                   /function="1.6.15.2 : thioredoxin, glutaredoxin"
FT                   /note="Evidence 7 : Gene remnant; Product type c : carrier"
FT                   /db_xref="PSEUDO:CAO99885.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            461269..461652
FT                   /locus_tag="ABSDF0501"
FT   CDS_pept        461269..461652
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0501"
FT                   /product="putative acyl-CoA thioester hydrolase"
FT                   /EC_number="3.1.2.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99886"
FT                   /db_xref="GOA:B0VQZ0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99886.1"
FT                   /translation="MSEAYTKPEGILSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIH
FT                   AERFSRGRCATISINQMTFLVPVKVGFVISCYTKILKVGNTSIQMQIEVWDSHDDSRAP
FT                   IRITEGVFTFVAVDVQRQQTSDS"
FT   gene            complement(461732..462226)
FT                   /locus_tag="ABSDF0502"
FT   CDS_pept        complement(461732..462226)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99887"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99887.1"
FT                   /translation="MSQSNRLLKLVKATSKFPKGIRSTLWSKAFGRIVPMVGTANIRYL
FT                   KVDVNHVTVRLENQKNMQNHIKGVHAAAMALLAETATGFLTGLHIPDNRILLIKSLHVD
FT                   YLKVVEGGLTATATLSTEQQKYIADHEKGELVIPVTVIDDAGNEPIQCQMLWAWLAKRK
FT                   K"
FT   gene            complement(462262..462750)
FT                   /locus_tag="ABSDF0503"
FT   CDS_pept        complement(462262..462750)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99888"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VQZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99888.1"
FT                   /translation="MPSFDIVSELELFEVNHAVQNTQKEIATRFDFRGHDVSIELNEKN
FT                   KEIKISTESDFQCEQVYNMLENHFYKRKIDVQALDPQKATASGKNFVQVIKLKDGLDSD
FT                   TAKKINKAIKESGIKVQSSIQGDKIRVTDKKRDTLQQVMAFLREQQFGLPLQFNNFKD"
FT   gene            462818..463156
FT                   /locus_tag="ABSDF0504"
FT   CDS_pept        462818..463156
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99889"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0VQZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99889.1"
FT                   /translation="MFTSKECTMIRKQEITTFEFPENAVIWDVRDSSAYAEGHVKGAVS
FT                   RPINDLNADILNQVAADQPIYILCGGGSKAPRAAEKLEGLDASREYVVLMGGTRAARDA
FT                   GLPLEQGA"
FT   gene            complement(463208..465109)
FT                   /locus_tag="ABSDF0505"
FT   CDS_pept        complement(463208..465109)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99890"
FT                   /db_xref="GOA:B0VR96"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0VR96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99890.1"
FT                   /translation="MVILSDLLNRMNKSNRIQTAELDWESIDGIEVPISKQFGDVYFSK
FT                   DNGLLETRHVFLNGNDLSERLANLQDFEYFSVGETGFGTGLNILALWQLWQQVRPNNHS
FT                   HLHAISVEKFPLSKADLIRALNVWDELKPLSKQLIEQYPLPLAGCHRLSFPEERFSIDL
FT                   WLGDAQDIFPSMVKTKAVNAWFLDGFAPSCNPDMWEQNVLNNIVRLSDYGTTFASFSVA
FT                   GVLKRGLKTHGIDISRPRGFGHKREMLKAVWKAPVSEEILLEPVSDTFHFTQQRIAVIG
FT                   AGIAGLSTAWAFAQRGHQVTLFERTAPLSGASGNPLALLNPKPCPIEQSHEHLMTLSWQ
FT                   HALNFYKNFQAFRPIQIQQMALKNAQDLLDLADQYPADIVTQQTSSLESDYPHILLTEA
FT                   GAVSPHQLRDEILQHQGIELKIANITTLISFENKVQLKSGNETTLGADHVVVCCARESA
FT                   ALFENYPLLKPIRGQVSWVDNSFATLPLNEAYSYGGYCIQLNASELILGASFYPSRDDQ
FT                   EVLIDDHVHNFELIHSVFPHYAKQLPPVEQWQGRASVRAQSPDYFPLVGKMQKESPIST
FT                   FAGLGSKGFLFAPLCSEVLVAQILGEACPVPKSLLQKLDAQRFQKKVKPKKPYFKSQ"
FT   gene            complement(465103..465630)
FT                   /locus_tag="ABSDF0506"
FT   CDS_pept        complement(465103..465630)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0506"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99891"
FT                   /db_xref="GOA:B0VR97"
FT                   /db_xref="UniProtKB/TrEMBL:B0VR97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99891.1"
FT                   /translation="MLMSNHLIKHFQKGKRMQLATKSFLGLCLICSTAGAVEPAATPAT
FT                   PPTAASTQNAKPAPTSATVAKPATTTAPTTTQPLTAEQIAKNKQQQDAKIKALVQDQAS
FT                   RLKQLEHANLEALAQNQELQLKNDNLSVQVQVLQSERSAQMFLYGAVTLAGGVLLGFFI
FT                   ASYVYTKRRRQW"
FT   gene            complement(465587..465889)
FT                   /locus_tag="ABSDF0507"
FT   CDS_pept        complement(465587..465889)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99892"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B0VR98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99892.1"
FT                   /translation="MPFFVLSCTDNEGTLEKRLAVRPQHIERLQKLDDEGRLVAAGAMP
FT                   KDPNDPQVGFYGSTMIVEFDTREALDEWLKEEPFLKEGIYSHVDVKPFNKAFPKG"
FT   gene            complement(465924..466538)
FT                   /locus_tag="ABSDF0508"
FT   CDS_pept        complement(465924..466538)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0508"
FT                   /product="putative intracellular septation protein (IspZ)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99893"
FT                   /db_xref="GOA:B0VR99"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:B0VR99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99893.1"
FT                   /translation="MKALLDFVPLIIFFYLYKTVDPADTQHPLLKLIGSAGGVDNNNIL
FT                   VATTGLIISMLVVYGALFIMQKFRLDKQQWIVLFMTVIFGGITLMLSDDFYIRLKAAIL
FT                   NLVFAGAFLVSPWFGKDRKPLIQRLFDPILALSEKGWKNLNFAWAAMFVVMSGLHVFFA
FT                   FLFHGGKYWGEFTAFGDMIVMFSFIIIQFIILRKHFKSPDA"
FT   gene            466583..467434
FT                   /locus_tag="ABSDF0509"
FT   CDS_pept        466583..467434
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0509"
FT                   /product="putative phosphoesterase (PHP family)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99894"
FT                   /db_xref="GOA:B0VRA0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99894.1"
FT                   /translation="MQGIDLHTHSNISDGTLSPELLVQAAVDVKLHTLALTDHDTMDGL
FT                   QRARNAAQPHDLQIISGVEISSQWSRPSTKKSYSVHIVALNMQDEAPILEALEQQKRIR
FT                   AQRAVVICELLKKCIGFDIYQDVLDKVENQPDRITRTHIAKTLVEKNVVSRPQQAFDRF
FT                   LKEGKRAFVKFEGLGLKETIEVIHNSKGLAVLAHPTRYDLSATNTRYLIEIFASYGGDA
FT                   VELPPPVDPLSTRQMIDRMIDQHHLAISIGSDFHGENMPWIKLGNTPKPTSNQQCIWER
FT                   FI"
FT   gene            complement(467442..467993)
FT                   /pseudo
FT                   /locus_tag="ABSDF0510"
FT   CDS_pept        complement(467442..467993)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0510"
FT                   /product="fragment of conserved hypothetical protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99895.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(468414..468614)
FT                   /pseudo
FT                   /locus_tag="ABSDF0512"
FT   CDS_pept        complement(468414..468614)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0512"
FT                   /product="fragment of DNA repair protein, associated with
FT                   replication forks (RadC) (part 2)"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99896.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(468425..469165)
FT                   /pseudo
FT                   /locus_tag="ABSDF0513"
FT   CDS_pept        complement(468425..469165)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0513"
FT                   /product="fragment of DNA repair protein, associated with
FT                   replication forks (RadC) (part 1)"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.1.4 : DNA repair"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99897.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            469233..470486
FT                   /gene="dfp"
FT                   /locus_tag="ABSDF0514"
FT   CDS_pept        469233..470486
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="ABSDF0514"
FT                   /product="bifunctional protein [Includes:
FT                   4'-phosphopantothenoylcysteine decarboxylase;
FT                   phosphopantothenoylcysteine synthetase, FMN-binding]"
FT                   /function="1.5.3.5 : Coenzyme A"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99898"
FT                   /db_xref="GOA:B0VRA4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99898.1"
FT                   /translation="MSFDLSVIPHKNIVLAVTGGIAAYKSAILVRRLKDYGFDVRVVMT
FT                   HGAQAFITPLTFQALSGNPVHTELLDPEAEAGMGHIELARWADLLLVAPASCDTLAKFA
FT                   NGLADDLLSTLFLATKAPVWVAPAMNQQMWAAKATQRNLQTLVEDGVHVIMPDAGEQAC
FT                   GDVGLGRMPEPEEIARQVAGYFHQAQRAIAEKFGLLAGKRVVITAGPTREAIDPVRYIS
FT                   NHSTGKMGFALAAACYAAGAKVTLIAGPVSLDTPNGVQRVNVASARQMLDVSMESLETG
FT                   CDIFIATAAVADYRVAEVAEHKIKKAGDELNVSLVKNPDIVATIAAQEKRPFMVGFAAE
FT                   TQNVEEYAAGKLVAKKLDMIACNDVSRADIGFASDENAMTVFFAESYHMKKRELEKASK
FT                   QEISQQLVEAISDALRRK"
FT   gene            complement(470550..471515)
FT                   /gene="secF"
FT                   /locus_tag="ABSDF0515"
FT   CDS_pept        complement(470550..471515)
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ABSDF0515"
FT                   /product="preprotein translocase, IISP family, membrane
FT                   subunit"
FT                   /function="4.3.A.5 : The Type II (General) Secretory
FT                   Pathway (IISP) Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99899"
FT                   /db_xref="GOA:B0VRA5"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99899.1"
FT                   /translation="MMTKVTQQPSKQYGRLVDAKIIPFMKIAKPAAIFSILITLASIFF
FT                   IGTKGLNLGLDFTGGVSAELNYAQPANQAEVIQALDKAGFKDAVVQTLGSNKDLLVRMP
FT                   VQDIKVEDLNNAITKAVQLPNNAAEVHKVDSVGGQVGNELYVRSAGAVALALILMLIYV
FT                   TIRFEFKLAMGAVMSLFHDIIIIIGAFALFQWPFDLTVLAAVLAVIGFSLNDNIVVSDR
FT                   IRENFRKIRGATPREIVDIALTETLRRTIHTSMTLLLVVLAMMFLGGDGLHWFSVAMFV
FT                   GVFVGTYSSIYIGTAFALWRGLNRQDFIVQVKPEFEDEIP"
FT   gene            complement(471524..473425)
FT                   /gene="secD"
FT                   /locus_tag="ABSDF0516"
FT   CDS_pept        complement(471524..473425)
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ABSDF0516"
FT                   /product="preprotein translocase, IISP family, part of the
FT                   channel"
FT                   /function="4.3.A.5 : The Type II (General) Secretory
FT                   Pathway (IISP) Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99900"
FT                   /db_xref="GOA:B0VRA6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99900.1"
FT                   /translation="MRYPAWKYLLILVVLVVSTLYALPSLYPDEPAVQISGAKAGTQID
FT                   QSVVQKAEQILKTANIASHDNTFTNNAALLRVSSSEAQLKAKEVLRRDLGDQYVVALNL
FT                   APTTPEWLQKIGAKPMKLGLDLRGGVHFLLEVDMDKAISQRMETSATDLRRQFRENKIK
FT                   FNNLALNNNVITVQFADNADRDAAMDFLRRNGNEYTQQALASTTGSILKLTYTDVRRQE
FT                   IQAYAVNQNLTTLRNRINELGVAEALVQSQGSNRIVVELPGVQDTAEAKRVLGRTANLE
FT                   FRLVSDLNDQYIDPYTGKYNGQPLPPGTEVFAYQSLDSGRQLLLQRNRILTGERVQNAS
FT                   SGFSQDSGGAEVNITLDSAGGKLMSDATRNAVGKRMAVLFIENKQKISYVTDPKTGAQT
FT                   EVRTPYTESVVINAATVQAVLGSTFRITGLSSPQEASELALMLRAGALAAPMYFVEERV
FT                   VGPSLGQENIDKGVLSTQIGFLLVAIWMVVFFRLFGLIANFALVFNLAMILTIMSWIGA
FT                   SLTLPGIAGIVITIGMAVDANVLICERIREEMLWGASPKQAIVAGYDRAYNTIFDSNLT
FT                   TFLVAFILFAIGTGPIKGFAVTLMIGIICSMFTAITVTRAIVQIIYGKRRNLKKLSI"
FT   gene            complement(473477..473806)
FT                   /locus_tag="ABSDF0517"
FT   CDS_pept        complement(473477..473806)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0517"
FT                   /product="putative SecYEG protein translocase auxillary
FT                   subunit (YajC)"
FT                   /function="4.3.A.5 : The Type II (General) Secretory
FT                   Pathway (IISP) Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99901"
FT                   /db_xref="GOA:B0VRA7"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99901.1"
FT                   /translation="MSLFISTAHAAPAAAQSPGLLPNILMIVVFVAIFYFLIWRPQAKR
FT                   AKEHRSLIESLGVGSEVVFAGGLMGKVTKLEGDYAVVELNRGVEVKIQRASVISVLPEG
FT                   TLNNL"
FT   gene            complement(473905..475038)
FT                   /gene="tgt"
FT                   /locus_tag="ABSDF0518"
FT   CDS_pept        complement(473905..475038)
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="ABSDF0518"
FT                   /product="queuine tRNA-ribosyltransferase (tRNA-guanine
FT                   transglycosylase) (Guanine insertion enzyme)"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="2.4.2.29"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99902"
FT                   /db_xref="GOA:B0VRA8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VRA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99902.1"
FT                   /translation="MKFEKLGQSGRARRGRLTLEHGVVETPIFMPVGTYGTVKGMLPRD
FT                   IEDIQAQIILGNTFHLYLRPGLEVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKI
FT                   KEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSDIVMIFDECTPYPATHEEAQKSLQLSL
FT                   RWAKRCKAHHHDELKNKNALFGIIQGGMYEDLRDESLNGLLEIGFDGYAIGGLSVGEPK
FT                   EEMIKVLDYLPNKMPHDKPRYLMGVGKPEDIVEAVRRGVDMFDCVMPTRNARNGHYFVT
FT                   DGLVRIRNSKYRHDQGPLDPHCDCYTCKNFTRAYLFHLEKCGEMLASMLGTIHNLRYYQ
FT                   RLTEGMRDALDKGTFDEFVQDFYARRGLEVPPCPVDE"
FT   gene            complement(475387..476199)
FT                   /locus_tag="ABSDF0519"
FT   CDS_pept        complement(475387..476199)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0519"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99903"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VR04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99903.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKRID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPEYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            complement(476350..477351)
FT                   /locus_tag="ABSDF0520"
FT   CDS_pept        complement(476350..477351)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0520"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99904"
FT                   /db_xref="GOA:B0VRB0"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99904.1"
FT                   /translation="MKLLFQKIQSAFDNQNTHNKITLKNIEALRNLLNQQLPPEILIYS
FT                   LKNWKGTQQLDIRNYIFWNATIFALVCMALGFLISIYFFPFAILAIFYGFYHRASTAEL
FT                   ICLLQDIQVYYYEHKYNFKFATEDNLPKEGTSASDFPLFKLGNQQNSVLTAILGKWQVR
FT                   ETTHPYKIFRYHYVNREMAYNSKGKWELKDVSYNLYGIILENFPVRGVSISSQQKKACR
FT                   LGVAWESSDIRFNQKYQQSGINELDLVKFLSPDRLLLLEKMLEGFPGDFYVHPETSALC
FT                   WLCNVNLLRQQSLYGTSVRELAECLETLSMPEFEQFANILQHFIDETQIPKS"
FT   gene            complement(477419..478474)
FT                   /gene="queA"
FT                   /locus_tag="ABSDF0521"
FT   CDS_pept        complement(477419..478474)
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="ABSDF0521"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase (Queuosine biosynthesis
FT                   protein )"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="5.-.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99905"
FT                   /db_xref="GOA:B0VRB1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VRB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99905.1"
FT                   /translation="MQLSDFSFELPDELIARYPLETRSASRLLHLDAKGQYHDHMFTDI
FT                   IDLFEEGDLLVLNDTKVMKARLKGKRTTGGAIEILVERMPNHTTAYCHIKASNSPKAGA
FT                   ELFVGADNIPVIVRGRHENLFVVEFSQPILPVLEQYGQLPIPPYFNREAEEIDTERYQT
FT                   VFHNPEKIASVAAPTASLHFDEELLAKLDQKGVKKTFVTLHVGAGTFMPVRTDDITNHV
FT                   MHSEWCDVPQETIDLILATKARGNKVIAVGTTATRALESAAQAHGGKIAAWTGDTQIFI
FT                   YPGYEFCIVDRLITNFHLPESTLLMLVSALSNRENILAAYEHAVKDRYHFFSYGDAMLI
FT                   DKLEVLKLKLG"
FT   gene            478657..478743
FT                   /locus_tag="ABSDF_tRNA12"
FT   tRNA            478657..478743
FT                   /locus_tag="ABSDF_tRNA12"
FT                   /product="tRNA-Leu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            479212..479721
FT                   /pseudo
FT                   /locus_tag="ABSDF0522"
FT   CDS_pept        479212..479721
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0522"
FT                   /product="fragment of putative sensory transduction
FT                   histidine kinase (part 1)"
FT                   /EC_number="2.7.3.-"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99906.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            479722..480564
FT                   /pseudo
FT                   /locus_tag="ABSDF0523"
FT   CDS_pept        479722..480564
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0523"
FT                   /product="fragment of putative sensory transduction
FT                   histidine kinase (part 2)"
FT                   /EC_number="2.7.3.-"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99907.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            480633..483383
FT                   /gene="glnE"
FT                   /locus_tag="ABSDF0524"
FT   CDS_pept        480633..483383
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="ABSDF0524"
FT                   /product="glutamine synthetase adenylyltransferase"
FT                   /function="1.8.3 : nitrogen metabolism"
FT                   /function="2.3.3 : posttranslational modification"
FT                   /EC_number="2.7.7.42"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99908"
FT                   /db_xref="GOA:B0VRB4"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99908.1"
FT                   /translation="MNAEQLQKTLRASQYAEQVLGLHQAVLEQDYQIDQFAAPLSTEQI
FT                   YRLVDTTLDGIGDEITWMRALRILRSRLMFRWIWQDANQLTDVVTLTRELSDFADASIC
FT                   AAKAFARVALVAKHGEPFSYSGKVQDLIVVAMGKLGAQELNLSSDIDLIFAFDEQGETN
FT                   GCKCIDVQQFCILWGQKLIYLLEHITADGFVFRVDMRLRPWGDGSALAISHAALEKYLS
FT                   QHGREWERYAWIKARVVTGGKEGQDLLEMTRPFVFRRYVDYTAFAAMRDMKAMIEREVL
FT                   RRHIEDDIKLGAGGIREIEFIVQVFQLIYGGSKRELQDRQCLVSLEHIGEAGLLEKQAV
FT                   LELEDAYLFLRRVEHAIQALNDQQTQLLPEEADLRQRIIDTLGFTSWNEFIDVLNEKRQ
FT                   KVKVQFKQLIEDTSSSAATENFGQLEQQLDEVLDDNAKNLIHEFWHGNALKKLPSNAVQ
FT                   RLKTFWPHLIEAILQSEQPQTALLRLMPLIESVMRRTVYLVMLIESKGALQRLVKMATV
FT                   SPWICEELTQYPVLLDEFLSMDFELPKRKDLEDSLRQQLLRIEIDQVEDQMRVLRLFKK
FT                   SNVLTVAASDVLAESPLMKVSDALTDIAEVGVNATLNLAYQTVAKRHGYPKDVEGKRCS
FT                   LDYKAFAVIGYGKVGGIELGYGSDLDLVFIHYLDEQADTDGTKSITGFEFAMRVAQKFM
FT                   SLMTTQTLDGRVYEIDTRLRPSGEAGLLVTSLKAYEHYQLKSAWLWEHQALVRARSIAG
FT                   DEALCQKFEIFRREILTQSRDEAYVREEVLKMRQKMKDHLGSSSEQKKHGIFHLKQDAG
FT                   GIVDIEFMAQYAVLAWSGTKPDLAHYSDNVRILEDAAKADCLSSEDATALIRAYLSERA
FT                   ESHRLALANQSMQVSAADWRSTRAVVCNLWQRLIDPTASVELDSE"
FT   gene            483396..484334
FT                   /gene="ilvE"
FT                   /locus_tag="ABSDF0525"
FT   CDS_pept        483396..484334
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="ABSDF0525"
FT                   /product="branched-chain amino acid transferase"
FT                   /function="1.5.1.17 : alanine"
FT                   /function="1.5.1.18 : isoleucine/valine"
FT                   /function="1.5.1.19 : leucine"
FT                   /EC_number="2.6.1.42"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99909"
FT                   /db_xref="GOA:B0VRB5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99909.1"
FT                   /translation="MECSMNLADRDGFIWQDGQLIDWRDAKIHVLTHTLHYSMGVFEGV
FT                   RAYETPKGTAIFRLQDHTKRLLNSAKIYQMKVPYDQAALEQAQIDVVRENKLASCYLRP
FT                   LIWIGSEKLGIAATNNTIHAAVAAWAWGAYLGDEAMAKGIRVKTSSFTHHHPNVTMCKA
FT                   KASGNYTLSILAHQEVAHSGYDEAMLMDPQGYVCQGSGENVFLIKDGVLHTPDIAGGAL
FT                   DGITRQTVMTIAKDLGYEVVERRITRDEFYIADEAFFTGTAAEVTPIREYDDRQIGAGC
FT                   RGPITTEIQKTFFDAVQGKKPKYEHWLTYVK"
FT   gene            484402..485292
FT                   /locus_tag="ABSDF0526"
FT   CDS_pept        484402..485292
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99910"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99910.1"
FT                   /translation="MHIVYVSDGKAGHRSQALGLFQAMQRQQANATFEEVSINDLPVMS
FT                   LIKALFSSKKSLFQQAPDFIFGVGSHTHFRVWLLGKIFKKAKTIILMKPNLPTVWFNYA
FT                   VIPEHDGIPANNRVVVTRGALNPIRNEKRHQASRILIALGGSSKRHQWNQEKVLLSVQK
FT                   TVENNPDAEIILTTSRRTPAEFIDILRQQSFAQHLQIFPVEQTPQGWIFEEMQKAEAVW
FT                   VTEDSVSMVFEALTAGCRVGVIAIDRLKDDRITHSIDQMIESQLISQNTCVVQLPQPYA
FT                   FKEADRVATYLLAKN"
FT   gene            485315..486343
FT                   /locus_tag="ABSDF0527"
FT   CDS_pept        485315..486343
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99911"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99911.1"
FT                   /translation="MKILHIANFGFNKQGAHFYCTDRKISAGLIENGHFVYDFSFRDMA
FT                   RMGTIFKTKKLGAKWANKEVLKVVNNIEPDLVLIGHSDLMSPDVLRQIKESYPNTKIAF
FT                   WYVDPLYLENKLDFVKAFSPYLDAIFCTTGGEYLQKLKQPHLSVAYMPNVGHRNVETLQ
FT                   QFSNSKTDKTFIFCGVVYKEPEREKFLKDLAEALQQGHVNYQYYGCFEQPGVYGKAYYK
FT                   VLSETKMGLNYSRRNDVTLYSSDRIVQLTGNGLLTFSPRIPGFEKLYTEQEVVYFDDQF
FT                   DLAKKIQFFDQNPEQAVKVAKEGWEKTRKSFNAKRITQFMVEVTFKQPLSEDYEWSHEV
FT                   YA"
FT   gene            486340..487095
FT                   /locus_tag="ABSDF0528"
FT   CDS_pept        486340..487095
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0528"
FT                   /product="putative polysaccharide deacetylase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99912"
FT                   /db_xref="GOA:B0VRB8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99912.1"
FT                   /translation="MMWFLYVAVGLLALAALLYVLGNYTFWLPFRSSKLPRIVMLHQVT
FT                   PKDAASGMNMPPEKFEQLLTLLTHKGAIFCFVSELEQYRNQKNVVALSFDDGFMDNYLY
FT                   AYPLLKKYNAKATIYLATQIEGIEKLTHEQIHEMANSGLIEFGAHTQHHVNLLKLDDQT
FT                   AYNEMLQSKRDVEALVGKCPSFAYPFGRFNEKHQKMAQEIGFKNAVSTRKKIEAYEADN
FT                   QFNIPRVSTHGAMNALQMRIALAKGRYKL"
FT   gene            487092..487859
FT                   /locus_tag="ABSDF0529"
FT   CDS_pept        487092..487859
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0529"
FT                   /product="putative lipopolysaccharide core biosynthesis
FT                   glycosyl transferase LpsC"
FT                   /function="1.6.3 : lipopolysaccharide"
FT                   /EC_number="2.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99913"
FT                   /db_xref="GOA:B0VRB9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99913.1"
FT                   /translation="MNKIPCSVYIVTLNCGAWLERTLQSVSEFDEVIILDSGSTDNTYE
FT                   IAKRFENTQISHQDWQGYAGQKSLALAKCRNDWVLNLDGDEVLSNELKQEIVETIQQNK
FT                   LDALITPINDVFLGVPNSKYTKKHAKVRFFRRSKGHYDLANKVHENVIVDGETQRAQHD
FT                   IYHYGELSIFVKVEKNNQYSNLKALEKYQKGKSPSIAKLVLVMPVTFMKSYFIRRSFLN
FT                   GWRGFVNSMINAFYAFLKEAKLFEQTMNKDKNK"
FT   gene            487867..488901
FT                   /locus_tag="ABSDF0530"
FT   CDS_pept        487867..488901
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0530"
FT                   /product="putative glycosyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99914"
FT                   /db_xref="GOA:B0VRC0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99914.1"
FT                   /translation="MKIVQVLATSGGVGGLEQHTFNLVNELALNHEVHVIAHPCYVDKF
FT                   SQQVHFHAIDFARSRWNIFLLWQLKNLIQQIQPAIVHAQAGKAAELIARIKPFLSGPKF
FT                   VTTVHGTKKNKSAYLAGDAVIAVSQALTQGIPESKAHVVYNGVYPQPVLTTENKEKLLQ
FT                   SIQKDFTELDTSKKVVMCIGRLESVKNISLLIDSMQQIDANLWIVGDGSLRASLEKQVS
FT                   ELNMQNRVAFLGFRTDARDLVQLADIVVLSSDREGFPLVMVEALQADKAMASTKVNGVI
FT                   EWLPEQYLAEIGDAQGLAIAIEYALQPEAQNDFGPLYAKAKAELTVPAMAEQTLNIYKG
FT                   LLKT"
FT   gene            complement(488898..489788)
FT                   /locus_tag="ABSDF0531"
FT   CDS_pept        complement(488898..489788)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99915"
FT                   /db_xref="GOA:B0VRC1"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99915.1"
FT                   /translation="MLNRLIQKKWYKYQQAKKAKTFDSHWYMRFGWLEQPFTTLEQLDS
FT                   LFEIHSPGKFTFADSFYAHENGRHFIFFEEVDDQHPVGFLSVLEVFKDGTYTPPETILK
FT                   LDYHLSYPCVFKIDSTWYMIPESSANKTIELWKCTDFPMKWEKHSNLMENIEAVDSTPF
FT                   YHEGLWYLFTSTRRDCKKFGDRLDLFFTEDILNPNWQEHPMNPLCQGSQQFRMAGKPFI
FT                   YKGQLVRPSQDSLKRYGGNIELKAITQLSPTAYEEKLLEVVLPDWNQADDGCHTINVED
FT                   NFVVLDAIRLTPKNN"
FT   gene            489848..490612
FT                   /locus_tag="ABSDF0532"
FT   CDS_pept        489848..490612
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0532"
FT                   /product="putative glycosyltransferase involved in LPS
FT                   biosynthesis"
FT                   /function="1.6.3 : Lipopolysaccharide"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99916"
FT                   /db_xref="GOA:B0VRC2"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99916.1"
FT                   /translation="MNEMKKYLISIESTNSERLKNLFSQATFYKYRDEFKQFGVIGKNL
FT                   SVSEYFQQGVAGKKKPMTPGELGCAMSHIAALKDFLSSDEEYAIIFEDDVIERFEIDFQ
FT                   DLEKHIRSLNFGPCFFLSLGGIQMKICNRVRGKLLPEELYNQKILKVDYDYLEKLAYAY
FT                   AYVIDRKMAQMLVDYHQPIKIYDHWQDLVGRGEFSFYVSFLFDHPIIENNDALSYLEKE
FT                   RSLVGSHSQDDSDFLRYLRVKLKKYILNKYII"
FT   gene            490772..491569
FT                   /locus_tag="ABSDF0533"
FT   CDS_pept        490772..491569
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99917"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99917.1"
FT                   /translation="MTEFVNVFSDVKNFKIEFKVSTIGKFKSKSKYSGIYKYKFVKNIF
FT                   KKIIDLTVNEAKPETKIKGLKITGYPHVSRFFEYKEIVENHPDASHVLLTDVRDVFFQR
FT                   NPFKNLSKGLFVGMENPDFTIGTEQYNQKWILDAYGESFYNLAKDEQVSCSGVTIGDHE
FT                   SIKVYINKMIEEFCKQPYQKMSNRIYDQAMHNKLLITNELSEITRCQPFESIIVTLGLY
FT                   PIEQISINDQGFIINRNQEIIPIGHQHDRHLELIQLCDNYIGK"
FT   gene            complement(491607..491825)
FT                   /locus_tag="ABSDF0534"
FT   CDS_pept        complement(491607..491825)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99918"
FT                   /db_xref="GOA:B0VRC4"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99918.1"
FT                   /translation="MAMRPDVRRHALVVIVFSLAQWFFMRYILANELFNLTTNQRILYF
FT                   CVSSLVGALLIFVALIYMVLKGNADKN"
FT   gene            complement(492369..493181)
FT                   /locus_tag="ABSDF0536"
FT   CDS_pept        complement(492369..493181)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0536"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99919"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99919.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKRID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTEGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            493252..493677
FT                   /pseudo
FT                   /locus_tag="ABSDF0537"
FT   CDS_pept        493252..493677
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0537"
FT                   /product="fragment of putative glycosyl transferase
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99920.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(493730..495508)
FT                   /gene="aspS"
FT                   /locus_tag="ABSDF0538"
FT   CDS_pept        complement(493730..495508)
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="ABSDF0538"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.12"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99921"
FT                   /db_xref="GOA:B0VRC7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VRC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99921.1"
FT                   /translation="MMRTHYCGSLTEAQIDQTVTLCGWVHRRRDHGGVIFLDMRDRDGL
FT                   VQVVIDPDTPEAFATADKARSEYVLKITGRVRRRYEGTENPNMVSGQIEVLGKEIEVLA
FT                   ASETPPFPLNDDTINVSEEHRLKYRFLDIRRPEMLDRLRFRSKVTNLIRNYLDDHGFLD
FT                   VETPILTRATPEGARDYLVPSRVQNGSFYALPQSPQLFKQLLMVGGIDRYYQIAKCFRD
FT                   EDLRADRQPEFTQIDIETSFLNDDDIMDLMEGMTVKLFNDLLGVKFEKFRRMPYSEAMR
FT                   DYASDKPDLRIPLKLVDVADLMQEVEFKVFAGPAKDPKGRIAALRVPGAGSLTRSQIDE
FT                   YTKFVGIYGAKGLAYIKVNEIEKGIEGLQSPIVKFIEPIVMQLLERVGAENGDIVFFGA
FT                   DKAKIVNDAMGALRVKIGHDLNLATCEWAPLWVVDFPMFEEADDGKWTSVHHPFTLPKS
FT                   SVEDVKSNPGEALSVAYDMVLNGTEVGGGSLRIYTLEMQKAIFEALGISDEEAEEKFSF
FT                   LLNALRYGAPPHGGLAFGLDRLVMLMTGATSIRDVIAFPKTKTAECPLTQAPAPVEANQ
FT                   LRDLGIRLREQQKKEA"
FT   gene            complement(495679..496443)
FT                   /locus_tag="ABSDF0540"
FT   CDS_pept        complement(495679..496443)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0540"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99922"
FT                   /db_xref="GOA:B0VRC8"
FT                   /db_xref="InterPro:IPR025238"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99922.1"
FT                   /translation="MPFTISHAVIAPPLAKLSRNTLPIAALAIGSMTPDLYRLFTMQSG
FT                   MLTHQWKGLFYPNLALGLLFCVIWYLLYRPVVYRFFGIQHDLKLDSFRHFFSFFIGIII
FT                   ALLIGIATHLIWDGLTHSDFRTFIFQDFLSQTVHLFGRPYLLHRLLQLGSSALALPFLG
FT                   WMSIHYYQRHKQHWKVNYKIKIFAWCLFALSTLLGLFSFWDYARYIPHEVWHSDAYYFT
FT                   GRSINEFMQGWLSTFSLGCLLFLFLDRQQRMG"
FT   gene            496579..498636
FT                   /locus_tag="ABSDF0541"
FT   CDS_pept        496579..498636
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0541"
FT                   /product="putative TonB-dependent receptor protein"
FT                   /function="4.1.B.14 : The Outer Membrane Receptor (OMR)
FT                   Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99923"
FT                   /db_xref="GOA:B0VRC9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99923.1"
FT                   /translation="MLFYKNILTLSILAAISIPVFAAENENVEKLETIRIKAHPLEQTS
FT                   KDFAVADTVVDQKHLTEGAATIGDALNSEVGIYANQFGAGSSRPVIRGQDGPRVKVLQN
FT                   SSENVDVSTLSPDHAVTVDPVLAKQVEVIRGPSTLLFGAGTVGGLVNVIDNKIPTQIPE
FT                   NGYEGQVGLRYNTGSDEKLASAGVTVGLGSQVALRIEGLTRDANNYIAPNYIHEGEKER
FT                   RVDNTFAQGDSVNVGLSWVYDRGYTGISYSNRRDQYGLPGHSHEYETCHIHDLSLHCGD
FT                   HDHEGHSDEEAHDHEHEHGGPWIDLKSERYDFKTELNDPFAGFQKLRAQASYTDYQHDE
FT                   IEEGTIATRFQNKGYDGRIELVHNPIADWEGVIGTQLGQQKLNLTGEEAFMAPTTTKKW
FT                   SVFALEHKQWKDVHFELSARADQQEIDVDDNSKQDFDGSAFSYAGAANWEFAPNYKLSF
FT                   VASHQERLPLAQELYANGGHFATNTYELGNDQLSKEKSNNVELGLHFDNDKLDYHLHVY
FT                   HNWFDDYIYAQTLDRYKDFRLVQYTQDKARFYGAEGEIGYQITPMYKISAFGDYVRGKI
FT                   DAEGNAPRIPAGRLGTKVDADFGDGFSGSAEYYHVFNQDKIAAYETETEGYNMLNLGVA
FT                   YSGQYGAKTDYRVYLKANNLLDDTVYQHASFLSNIPQVGRNFTVGVDFSF"
FT   gene            498712..500175
FT                   /locus_tag="ABSDF0542"
FT   CDS_pept        498712..500175
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0542"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99924"
FT                   /db_xref="GOA:B0VRD0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99924.1"
FT                   /translation="MRIFQRIHQKLNWSGRRYMAVILCVVAIAYLASAIYHTVKPLPQG
FT                   INFSGKLRHADVKFLADKTYIDANGQQQVDQHIFDEILKMIDEAKTTIVVDMFLFNSEV
FT                   GDSKLKQRPLMQELTDALISKKRQNRQIQVVMITDPINSVYGGLSPEHYRQLRQAGVDV
FT                   IETNLAPLRTSNPFWSGFLYICCQNIGNNPEKGWLPNPFGDEKITLRSYLNLFNFKANH
FT                   RKTIVVDTDAGWKSLVTSANPHDGSSRHSNVALMVNGATATDVLQTEAAVAQMSGSSSP
FT                   SLILGDFEKDVSKPQVQVLTEGAIYEAVLKLINTAKPKEHLDLSMFYLSERKIIKALKS
FT                   AQERGVIVRVLLDPNKDAFGRQKNGIPNRQVASELHAAGIPIRWCDTHGEQNHSKMILK
FT                   YNAQQAELIVGSANFTARNLKNYNLETDMLVVGKVQDQVFKDAQNYFNTSWSNLQGRQM
FT                   SVDYAKYADESNVKYWIYRFMEWSGLSTF"
FT   gene            complement(500463..500909)
FT                   /locus_tag="ABSDF0543"
FT   CDS_pept        complement(500463..500909)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99925"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99925.1"
FT                   /translation="MSEISFERLHQFFCKVPSVQEARIMAHGADGEHAWWFKFSIDVEH
FT                   PLAWQTVQELGHVLNYLSTNERLPTLFFPVSPPPYMNGEAKDFLSWVIQCNHPEFSPDV
FT                   VCDWLEVRLPNPVDDESQWKIKTDLSEIEKLDDKALDQLIPPAP"
FT   gene            501074..501457
FT                   /locus_tag="ABSDF0544"
FT   CDS_pept        501074..501457
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0544"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99926"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99926.1"
FT                   /translation="MKKPIVLVLSTLMLGMSATAMADSNHRWDNYHGKDHNRYEQRHDY
FT                   RYDHRNDHRAPVWSHSERGNHYGRYVAFKGSDRIPVEYRNSRYYVSDWRAHRLYAPPRG
FT                   YHWVKTPNQYLLVDSKHHIYRVR"
FT   gene            complement(501494..501976)
FT                   /locus_tag="ABSDF0545"
FT   CDS_pept        complement(501494..501976)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0545"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99927"
FT                   /db_xref="GOA:B0VRD3"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99927.1"
FT                   /translation="MPDPKKFERTLDRFGHYAVEAFHYLALFIIGCMIAWSAAHTVFEI
FT                   LTVKKYASIDDILLLFIYLELGAMVGIYFKTNHMPVRFLIYVAITALTRLMISDIQHDH
FT                   KADLDQVIITGSILILALSILVVRFASWHYPSVMKEKHSKTPTSLKTPQPQDDELA"
FT   gene            complement(502215..502847)
FT                   /locus_tag="ABSDF0546"
FT   CDS_pept        complement(502215..502847)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0546"
FT                   /product="putative Glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99928"
FT                   /db_xref="GOA:B0VRD4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99928.1"
FT                   /translation="MSTFTLFFGVPSGCSFGSIVALEWSGLPYQLCRIEMPAQCNTEEY
FT                   RQINPVGETPALLYDNGKVLTESMAILNHIMAKSLNAAFHYEQGTEQFNLFNQKLAFLN
FT                   TTLFNAFSPHWYSLEHSSSEGNKQALREYGAVQVKKAFTALENSLTNQTWLMGDQLSFV
FT                   DGYYAGIARWLKYHNVIDIDQFPNCKRLYEQLQNEAAVKFAHAIEQE"
FT   gene            502953..503849
FT                   /locus_tag="ABSDF0547"
FT   CDS_pept        502953..503849
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0547"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99929"
FT                   /db_xref="GOA:B0VRD5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99929.1"
FT                   /translation="MLLRQNLNDVYLFVVAVEHQGFSAAAKRLNLPKSTISKRVAILEK
FT                   KLGLTLIYRSSRSFVLSEAGKLFYQHAKNAVDEFRYAEENLLIQQQEPSGVVRLSASVP
FT                   IAQYLLSDCLPELAERYPKLLLQVEVTDRYVDVMSENFDIVIRSHFQPLPDSGLIQRVL
FT                   KNDKIIAVAAPTYLMKSSPIHTPEDLLKHEGIWSELQMNPWHFQNINGQKEIVRPNIRF
FT                   VANESEILKGAAKRGLGITLLPETFCMKELSEGSLIHVLPDWSAGSVTTSLLMLTRRGL
FT                   LPSVNITADFLVEKLKT"
FT   gene            complement(503921..505702)
FT                   /gene="acdA"
FT                   /locus_tag="ABSDF0548"
FT   CDS_pept        complement(503921..505702)
FT                   /transl_table=11
FT                   /gene="acdA"
FT                   /locus_tag="ABSDF0548"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99930"
FT                   /db_xref="GOA:B0VRD6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99930.1"
FT                   /translation="MPIYNAPLADMKFILNDVFKAEQFWQANEKLAHVDAATAEAILEE
FT                   MAKFAQNVTHPLNRTGDEEGARYENGEVFTPAGFKDAFRQYAEGGWIGLGADEEWGGQG
FT                   MPKMLTVLADEMLFATNPSFMLYPLLSVGAGMALSSYASQEQKETYLPKIYSGEWSGTM
FT                   CLTEPHAGTDLGIIKTKAERNEDGTYNITGTKIFITGGDNDLAENIIHLVLAKTPDAPA
FT                   GSRGISLFIVPKYLVNEDGSLGDRNHVGPGSIEHKMGIKASATCVMNFDGAKGYLVGKE
FT                   NEGLAAMFVMMNYERLSMGIQGLGASEFAYQNAAQYATARLQGRSAAGVQSPSKPADSI
FT                   LVHGDVRRMLLNVRANNEASRAFAVYVGQQLDITKFSTDAEAVKKANDRVALLTPIAKA
FT                   YLTDTAFQATLDAQMVFGGHGYIREWGMEQCIRDLRIAQIYEGTNGVQSQDLIGRKTIK
FT                   CGGAFIAEYITEIRDFANDLDTDLNFIKDATLDAATEIEAITQFIIEQAAENVEFPNSA
FT                   AVDYLHAVGLLSFSYMFAKIAAAAKDKSGDFYQNKLALAQYFVERILPDIDARIAKIKA
FT                   GSDLIMGFSEDYFTNQA"
FT   gene            complement(505870..507672)
FT                   /gene="acdB"
FT                   /locus_tag="ABSDF0549"
FT   CDS_pept        complement(505870..507672)
FT                   /transl_table=11
FT                   /gene="acdB"
FT                   /locus_tag="ABSDF0549"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99931"
FT                   /db_xref="GOA:B0VRD7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99931.1"
FT                   /translation="MPQYKAPLRDMQFVLHELLNAEEHYAKLPDFQGNVSRELVDQYLE
FT                   AAANFCENELSPLNQVGDREGCTWNDGVVTTPTGFKEAYQKYIELGFPSLSAEEQYGGQ
FT                   GLPNSLGIAISEMVGSSNWAWGMYPGLSHGAVRTLEHHGSEEQKNTYLPNLVSGVWTGT
FT                   MCLTESHAGSDLGIIRTKAEPNADGSYAISGEKIFISAGEHDMAENIIHIVLARLPGAP
FT                   KGTKGISLFIVPKFNVNADGTLGERNAVRCGSIEHKMGIHGNATCVINFDQAKGYLIGP
FT                   ENRGLNCMFTFMNTARIGTAVQGLSASESSFQGALTYAKERLAMRSLSGPKAPEKEADP
FT                   IIVHPAVRNMLLTQKAFAEGGRALVYLLAQYADIVEKGETEEERKFADNILSLLTPIAK
FT                   AFLTETGSESAKHGVQVFGGHGFISEHGMEQIVRDTRIACLYEGTTEIQALDLLGRKVL
FT                   QTQGAMLRDFTKIVHKFVEANKDNAAMKEFVEPLAALNKEWGDLTMQIGMRAMQNPDEV
FT                   GAAAVDYLYFSGYVTLAYLWARMALVAQEKLAAGTTDVDFYNAKVTTARFYFKKILPRV
FT                   RSHVDVIAGGLDPLMALDAEHFAF"
FT   gene            complement(507971..508342)
FT                   /locus_tag="ABSDF0550"
FT   CDS_pept        complement(507971..508342)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0550"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99932"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99932.1"
FT                   /translation="MKMTAKIALFNAAIVTMGSLAACQSTTQPPKPEHGMMQDGPRDGH
FT                   HHRMKHREFTPEQKAAWEQHRAERKARFEQIQKACEGKAVGQTVNVQVGDKTLEGTCNL
FT                   RFEPKRPQPPVNAPAPVAS"
FT   gene            508474..510132
FT                   /gene="baeS"
FT                   /locus_tag="ABSDF0551"
FT   CDS_pept        508474..510132
FT                   /transl_table=11
FT                   /gene="baeS"
FT                   /locus_tag="ABSDF0551"
FT                   /product="kinase sensor component of a two component signal
FT                   transduction system"
FT                   /function="2.3.3 : posttranslational modification"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /function="3.1.3.2 : covalent modification, demodification,
FT                   maturation"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99933"
FT                   /db_xref="GOA:B0VRD9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99933.1"
FT                   /translation="MNVLRVPIALRLFLTVLLTTLLIATASLSVLHWTMQKNFAKYVAD
FT                   VEMQKLDRLITNLGNVYTVYHDWGNAIQAQILQIEGTAAPDDYDRLSQWWLRRQYDIAI
FT                   QQHSFDEHTLINISPDAGTVNKNSIFSDEELRTLEQNLPSEYQPFEGLRFPLSANQFRP
FT                   SDDKNKSKKGSLKDIETQNGKKRFIALPDRLGLSSRLSLYDAKHQFVVGEPPSSDQMSN
FT                   RPIMVNSQVVGYLGLKPVLDKEDALSINFFSNQKRYLLLIYALTLLSSLVAALLMATYF
FT                   KKLIQRLLNATNELTKGNYQHQVVIKRNDELGDLSTQLNHLAEILHQHEESRRQWVADT
FT                   SHELKTPLAVLQAQIEAMQDGIRKATPEHLDAMMRQVSSLKKLTQDLADLAQADAQQLK
FT                   CYLSSVNPWEVILQEVENFRPKLEQAGLEIEVEGEGASLLLDRDRFKQIIVNLIGNSIR
FT                   YTETGGKIHIHTNQTPQEWTLYVDDSPFGLSDEQLSRLGERFYRVDDSRTRSTGGTGLG
FT                   LALSCKIAQALGGTLSFEHSPLGGLRCVLTFKKQS"
FT   gene            510152..510838
FT                   /gene="baeR"
FT                   /locus_tag="ABSDF0552"
FT   CDS_pept        510152..510838
FT                   /transl_table=11
FT                   /gene="baeR"
FT                   /locus_tag="ABSDF0552"
FT                   /product="transcriptional regulator protein (OmpR
FT                   family),response regulator in two-component regulatory
FT                   system with BaeS, regulates RNA synthesis"
FT                   /function="2.2.2 : transcription related"
FT                   /function="3.1.2.2 : activator"
FT                   /function="3.1.2.4.3 : two component regulatory systems
FT                   (external signal)"
FT                   /EC_number="3.1.1.61"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99934"
FT                   /db_xref="GOA:B0VRE0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99934.1"
FT                   /translation="MKHIMLVEDEVELAHLVCDYLEAAGFEVSMFHDGQDAYTSFQQRK
FT                   PNLMILDLMVPRMDGLTICRKVREQSDLPIIMVTARTEEIDRVLGLNMGADDYVCKPFS
FT                   PKELVARVQAVLRRLERKAEPEQNDSFRIDKAQQRIWYQQKSLSLTPTEFRLLELFLEH
FT                   VGQVYSRAQLLDHINPDSFDVADRVIDSHIKNLRRKITEVAETGNRHEWIQAVYGVGYR
FT                   FEYPEE"
FT   gene            complement(510902..512344)
FT                   /locus_tag="ABSDF0553"
FT   CDS_pept        complement(510902..512344)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99935"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99935.1"
FT                   /translation="MQFNPLYSSLNPKLFHIQQPSPLRGAKAGHFNLALAEELQWTDEE
FT                   KQAWVEICSGQRTFSEFPPLAMVYAGHQFGQWARQLGDGRGLLIAQILNKKGQTIDLHL
FT                   KGAGPTPYSRMGDGRAVLRSVIREYLAGHALNALGVASSHAVGFTSSTQGVQREKLEPG
FT                   AMLLRTSECHIRLGHFEWINQYAPELLAEFTQKCIEWHYPECQQEEQPILAFAKAVIRN
FT                   TAIMIAKWQLVGFAHGVMNTDNLNITGSTLDFGPYGFMERFRPNWINNHSDYQGRYTYQ
FT                   NQPSIAHWNLWTWLNNLIPLAEPEHKEQFKEALAACLEEFEPTFIEHYTTGLCQKMGLP
FT                   HFHKDSTECGLSFLRILQAEQLDYTQSFIRLQNKEYKALRDDCLDIRQFDAFLTQYQNI
FT                   REYQDIDELDANMQQVNPIYILRNHMAQRAIEVAERDDFSEVDRLFKLLNHPYTRQSDL
FT                   EKPEDLGPLPSDVPDVAVSCSS"
FT   gene            complement(512458..513696)
FT                   /locus_tag="ABSDF0554"
FT   CDS_pept        complement(512458..513696)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0554"
FT                   /product="putative fatty acid desaturase"
FT                   /function="1.5.4 : fatty acid and phosphatidic acid"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99936"
FT                   /db_xref="GOA:B0VRE2"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99936.1"
FT                   /translation="MVLLCRFVFLPCMTRFLGALPDMTSAPLKAPINWTASITLIGLPI
FT                   LTAIIIPIYAYYYDFSVSAWVSLFFLLALSSMGITAGYHRLWAHRAYEASSPLKILLMI
FT                   GGTFAVQNSILFWASGHRTHHRHVDDVDEDPYSIERGFWYAHMGWMIRDHSPSEPDFKN
FT                   APDLLNDKLVMFQHRYYALMVVAVHVGILGLVGWATGDLWGVVLLGGLLRLIISHQVTF
FT                   FINSLCHMFGKRPYTDENSARDNFWLAIATWGEGYHNYHHIFQYDYRNGVKWWQYDPTK
FT                   WLIWTCSKIGLAKNLRRIPSFNIKKAELAMKFKYAEQDLAIYGHDVNADISQMKQRIAQ
FT                   EYEAFTHTLNDWAKLKEQELQAKKAAMAEKIHKMDHKLKVDFQLLEHRLSHHRECLETL
FT                   MRNIKKNTNVVPD"
FT   gene            513803..514369
FT                   /locus_tag="ABSDF0555"
FT   CDS_pept        513803..514369
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0555"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99937"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99937.1"
FT                   /translation="MPDNISDRRSCVMKIQRLRKKNSIDIARKLPLKCLFIAISLVLAA
FT                   CQSTSQPNNHKGQAKPTHRVQTPVVKKKVSPDGVQDIDWQITQINGHKAKFFNQWPTLS
FT                   LNSTVKTVTGHTGCNRVFGRYTFDFSQKKLDMEVNAGHSSCDGALAQEAELVDSLQRIK
FT                   RFQLVGNTLYLLDQSGQRLIQAEKK"
FT   gene            complement(514398..514637)
FT                   /pseudo
FT                   /locus_tag="ABSDF0556"
FT   CDS_pept        complement(514398..514637)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0556"
FT                   /product="fragment of putative glycerophosphodiester
FT                   phosphodiesterase (part 2)"
FT                   /function="1.7.6 : glycerol metabolism"
FT                   /EC_number="3.1.4.46"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99938.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(514748..515653)
FT                   /locus_tag="ABSDF0557"
FT   CDS_pept        complement(514748..515653)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0557"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0557"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99939"
FT                   /db_xref="GOA:B0VRE5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99939.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSTSRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALAL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(515730..516119)
FT                   /pseudo
FT                   /locus_tag="ABSDF0558"
FT   CDS_pept        complement(515730..516119)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0558"
FT                   /product="fragment of putative glycerophosphodiester
FT                   phosphodiesterase (part 1)"
FT                   /function="1.7.6 : glycerol metabolism"
FT                   /EC_number="3.1.4.46"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99940.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(516192..516770)
FT                   /locus_tag="ABSDF0559"
FT   CDS_pept        complement(516192..516770)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0559"
FT                   /product="putative cobalamin adenosyltransferase"
FT                   /function="1.5.3.13 : Cobalamin (Vitamin B12)"
FT                   /EC_number="2.5.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99941"
FT                   /db_xref="GOA:B0VRE7"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99941.1"
FT                   /translation="MGHRLSKIYTRTGDSGTTGLGDGSRVAKDDLRIAALGDVDELNAI
FT                   IGVLRAQITDSQVANKADWDKSLSLIQHWLFDLGGEVCIPNYNLLQPVCIEFLEKEIDC
FT                   MNEDLPMLKEFILPSGSLSCSYAHQARAVCRRAERSLMSVQSCDQNIQATALQLLNRLS
FT                   DWLFVASRALQRAEGGQEVLWQKNINEMI"
FT   gene            complement(516867..517187)
FT                   /pseudo
FT                   /locus_tag="ABSDF0560"
FT   CDS_pept        complement(516867..517187)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0560"
FT                   /product="fragment of putative TonB-dependent Outer
FT                   membrane receptor for vitamin B12/cobalamin transport
FT                   (Btub) (part 3)"
FT                   /function="4.1.B : Beta barrel porins (The Outer Membrane
FT                   Porin (OMP) Functional Superfamily)"
FT                   /note="Evidence 7 : Gene remnant; Product type t :
FT                   transporter"
FT                   /db_xref="PSEUDO:CAO99942.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(517141..518217)
FT                   /pseudo
FT                   /locus_tag="ABSDF0561"
FT   CDS_pept        complement(517141..518217)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0561"
FT                   /product="fragment of putative TonB-dependent Outer
FT                   membrane receptor for vitamin B12/cobalamin transport
FT                   (Btub) (part 2)"
FT                   /function="4.1.B : Beta barrel porins (The Outer Membrane
FT                   Porin (OMP) Functional Superfamily)"
FT                   /note="Evidence 7 : Gene remnant; Product type t :
FT                   transporter"
FT                   /db_xref="PSEUDO:CAO99943.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(518526..518750)
FT                   /pseudo
FT                   /locus_tag="ABSDF0562"
FT   CDS_pept        complement(518526..518750)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0562"
FT                   /product="fragment of putative TonB-dependent Outer
FT                   membrane receptor for vitamin B12/cobalamin transport
FT                   (Btub) (part 1)"
FT                   /function="4.1.B : Beta barrel porins (The Outer Membrane
FT                   Porin (OMP) Functional Superfamily)"
FT                   /note="Evidence 7 : Gene remnant; Product type t :
FT                   transporter"
FT                   /db_xref="PSEUDO:CAO99944.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(518774..518981)
FT                   /locus_tag="ABSDF_misc_RNA_3"
FT   misc_RNA        complement(518774..518981)
FT                   /locus_tag="ABSDF_misc_RNA_3"
FT                   /product="Cobalamin"
FT                   /inference="profile:Rfam:8.0"
FT   gene            519108..519767
FT                   /gene="trpF"
FT                   /locus_tag="ABSDF0564"
FT   CDS_pept        519108..519767
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="ABSDF0564"
FT                   /product="N-(5'-phosphoribosyl)anthranilate isomerase
FT                   (PRAI)"
FT                   /function="1.5.1.15 : tryptophan"
FT                   /EC_number="5.3.1.24"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2299982, 2211532; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99945"
FT                   /db_xref="GOA:B0VRF1"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99945.1"
FT                   /translation="MSQSNQKRTRAKICGITRKQDVQAVVAAGADAIGFVFFPPSPRNV
FT                   TVEQAEELAKLVPPYVQMVGLFVNASLTEIQDILDCVPLDVLQLHGDETPEQCQEIARH
FT                   CKRRWYKAIQVKPDLDVIAEIQKYQAAGASAVLLDAWHPELKGGTGHQFDWSKFPKLDI
FT                   PLILAGGLTPDNVIDAIHTTGAFAVDVSGGVESAKGIKDQQLIERFMQGVQRGSAK"
FT   gene            519769..520980
FT                   /gene="trpB"
FT                   /locus_tag="ABSDF0565"
FT   CDS_pept        519769..520980
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="ABSDF0565"
FT                   /product="tryptophan synthase beta chain"
FT                   /function="1.5.1.15 : tryptophan"
FT                   /EC_number="4.2.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2211532, 2299982; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99946"
FT                   /db_xref="GOA:B0VRF2"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99946.1"
FT                   /translation="MIDYTQFPDANGHFGIHGGRFVSETLMAALEDLENLYSRMKNDEQ
FT                   FLAEFDRDLAYYVGRPSPLYYAERWSKELGGAQIYLKREDLNHTGSHKVNNTIGQALLA
FT                   KLSGKKRIIAETGAGQHGVATATIAARLGLECVVYMGAEDVKRQAMNVYRMRLLGATVV
FT                   PVQSGSKTLKDAMNEAMRDWVTNVDTTYYVIGTVAGPHPYPQLVRDFQSIIGREARKQI
FT                   LEQAGRLPDALVACVGGGSNAMGLFYPFLNDASVKMYGVEAAGFGIETGKHSAPLNAGH
FT                   VGVLHGNRTYLMSDEQGQIIETHSISAGLDYPGVGPEHSFLKDMKRVEYVPINDTGALQ
FT                   GFRDLTKIEGIIPALESSHAMAYVSKLAPTMSKDQIIIATVSGRGDKDLMTVARIDGVE
FT                   MVEM"
FT   gene            520990..521133
FT                   /pseudo
FT                   /locus_tag="ABSDF0566"
FT   CDS_pept        520990..521133
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0566"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   1)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99947.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            521302..521502
FT                   /pseudo
FT                   /locus_tag="ABSDF0567"
FT   CDS_pept        521302..521502
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0567"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   2)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99948.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            521540..522535
FT                   /locus_tag="ABSDF0568"
FT   CDS_pept        521540..522535
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99949"
FT                   /db_xref="InterPro:IPR021243"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99949.1"
FT                   /translation="MDLIQENGQPRYGRFESVPSTIHVQRYIYKTPYGKVLKGWRKQLK
FT                   YKKFKFCGIQHKHYSIGLAIADIGWVGHGFFYIHDHETGQVIEWNAIQPLGHKTYLDEQ
FT                   PLFNQSYFSKSPYQFDIQHANGVRYIRVTKYGEICLSARIFCAGTDILSLCTPTGINGW
FT                   TYTQKQTTLAVEGMFINKQNQVVQFDEKTFASLDDTCGFLRPETAWFWLSCNFWDEQGR
FT                   RIGLNLASGVNESFGNENCLWINGVLFPLTDVLFEKVNDELWQISSLDQKLNLQVHIGW
FT                   CRYENINLRMIGSQFNQWQAKISGTIEHETTDIINCKEQYGLLEQHYAKW"
FT   gene            complement(522544..523419)
FT                   /locus_tag="ABSDF0569"
FT   CDS_pept        complement(522544..523419)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99950"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99950.1"
FT                   /translation="MNAHVSYQVEPVVRKELDFHLNEVPRFWFNNDPFLTRMFDALSLT
FT                   FPDGERYFIECVRMFRDKIDDPELQKRVADFIKQEAQHGIAHDKMNQLMKEQGMPVDQF
FT                   TTTLKKIFRFELTKRSPQYNIAMTAAAEHLTALMAETFYSHKKTLENAHPYVRALFAWH
FT                   AIEEMEHRDVAFDVMRQVGEVPESTRRFVLVLTTVLMFGFTLYRTNIMLKCDGFSPRER
FT                   LLMNLKGLPWFFGKNGTLTAMKKQYMDWFKKDFHPSQHPVIRQYPVWIETLEKTNDPIA
FT                   AGEAFWQAGL"
FT   gene            523540..524589
FT                   /locus_tag="ABSDF0571"
FT   CDS_pept        523540..524589
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0571"
FT                   /product="putative HTH-type transcriptional regulator (AraC
FT                   family)"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99951"
FT                   /db_xref="GOA:B0VRF7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99951.1"
FT                   /translation="MQEFTISNGYFYLLNTYLKEKGINWQTLNLSEIQTRQVQNILSAS
FT                   IDAQSSLDLFIELLEITETRLHVTNLALEMAACITPANFGVLGYMASRSDTLGQVVEYI
FT                   AKFHRLVIDGAQVVPIQIEQDASKIRLYWPLVDDSNILLSELTLAAMVQLAKQIAPLHE
FT                   FLLQHVEFVHRARGAVVHYQRFFQCKLSFERPYYALTFASESLNVRPQHADPTLVQLLV
FT                   KQAEEALVQRKIHADLVQQIHWIVQEYFKHKQQAPKIEDIAIELNVSVRSLQRQLQALN
FT                   TSFKLILDAERMKRCEILLSQNESLTAIADQLGYSDQSALARAYKNLTGQTLLTRKKQL
FT                   QLIQKNATK"
FT   gene            524834..525637
FT                   /gene="trpA"
FT                   /locus_tag="ABSDF0573"
FT   CDS_pept        524834..525637
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="ABSDF0573"
FT                   /product="tryptophan synthase alpha chain"
FT                   /function="1.5.1.15 : tryptophan"
FT                   /EC_number="4.2.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99952"
FT                   /db_xref="GOA:B0VRF8"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VRF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99952.1"
FT                   /translation="MSRLATRFEKLQSQQRKALVSYVMAGDPQPQVTVPLLHKMVAAGV
FT                   DVIELGLPFSDPMADGPVIALAAERALAAGTNTLDALNMVKEFREQDQETPVVLMGYLN
FT                   PVEVIGYEKFVSYAKQCGVDGLLLVDLPPEESKEFGAILKQHDMDQIFLLAPTSTDQRI
FT                   QHVANQASGFIYYVSLKGVTGAATLDTSEAAARIEKIKGMTNVPVGVGFGISDAASAKA
FT                   MGSVADAVIVGSAFVKSFATLAADEAVEQTVNKVKELRAALDELV"
FT   gene            525634..526530
FT                   /gene="accD"
FT                   /locus_tag="ABSDF0574"
FT   CDS_pept        525634..526530
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="ABSDF0574"
FT                   /product="acetylCoA carboxylase, beta subunit"
FT                   /function="1.5.4 : fatty acid and phosphatidic acid"
FT                   /EC_number="6.4.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99953"
FT                   /db_xref="GOA:B0VRF9"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VRF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99953.1"
FT                   /translation="MNQEVKSGKVLSPSTPWTQRPVPGIEVADEQQTLKATFTEPTIEC
FT                   PECHALVTRTAISFNAYVCPQCDEHLRMKARDRLNWFFDNVVAELGQEFSAKDPLKFVD
FT                   SKPYPDRMREAQTKTGETEALIAMQGNLNGVDMIACAFEFDFMAGSMGTVVGDRFVKAA
FT                   ELAIEKRQPLICFAASGGARMQEGMLSLMQMARTSAAIQKLKDTGLPYIVVLTHPVYGG
FT                   VTASLAMLGDIHIAEPKAMIGFAGKRVIEQTVRETLEEPFQRAEYLLDHGVVDQIVHRH
FT                   ALRDTVSRLVSKLMNLP"
FT   gene            526527..527813
FT                   /gene="folC"
FT                   /locus_tag="ABSDF0575"
FT   CDS_pept        526527..527813
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="ABSDF0575"
FT                   /product="bifunctional protein [Includes:
FT                   folylpolyglutamate synthase (FPGS); dihydrofolate synthase
FT                   ]."
FT                   /function="1.5.3.2 : folic acid"
FT                   /function="1.7.17 : formyl-tetrahydrofolate biosynthesis"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99954"
FT                   /db_xref="GOA:B0VRG0"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99954.1"
FT                   /translation="MKQQAPLSTDSLDTWLNYWSHVHVTGIDLGLERVIPVAEKLGVTK
FT                   PNAKVFTVAGTNGKGSTTTTLASILKAQGYKVGLYQSPHIYRFNERVKLGGVEVDDQSL
FT                   IDAFVQVDQARRECDLSLSFFEATTLAAFVIFKQQQCNVWGLEVGLGGRLDVVNVIDPD
FT                   IAVITNIGLDHTDWLGDTIEKIAFEKAGIIRPHIPVIFAGEQSLPQAIQDKANSSQATL
FT                   YAINRDYFYKLADDGKHWYFASEGTTLRLPLGTLAIENIAGAVAAVLNSGLEISQLALE
FT                   EGIANARLAGRFEVRQVNGKTIIFDAGHNPHGVEFLLKQLRNFLEYNKQYTEVVAVFSM
FT                   LADKDIKSVADLLKPTVLHWKIAELNVLRAAPIQQLNDALQGQTIQQFGNIKEAFKSAL
FT                   EQTNNNQLILACGSFHTLEAIWEYLEECQ"
FT   gene            527810..528796
FT                   /locus_tag="ABSDF0576"
FT   CDS_pept        527810..528796
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0576"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99955"
FT                   /db_xref="GOA:B0VRG1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99955.1"
FT                   /translation="MNNKQRWMGGVVLLGGGVLLAALLLKGNEEIKQVDVQPQTSTSPK
FT                   LQAKPKQSAQEGQMVQLQPLAVDVETEKRLLEEQRRSREKAVAEQEARAAEFLAMQQQA
FT                   EADAARKAAAEYAAINARRAAAQESSDNIPPEVAGSENKAKGQQTDTKKSVDLAKADAD
FT                   KKAAEAKRLAEADKKAAEAKRQAEADKKAAEAKRQAEADKKAAEAKRQAEADKKAAEAK
FT                   RKAEAEKKAEAEKARELLENGDKKWMVQVALAANQANADAVVSKLRAKGYKVTTSPTSK
FT                   GIRIMVGPAKDRDTADTTRKKITSDASLNMKSAWVIDWVPLDQRKSD"
FT   gene            complement(528816..529394)
FT                   /locus_tag="ABSDF0577"
FT   CDS_pept        complement(528816..529394)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0577"
FT                   /product="conserved hypothetical protein; putative
FT                   phosphatase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99956"
FT                   /db_xref="GOA:B0VRG2"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99956.1"
FT                   /translation="MKIFSLIAFAVCLSLQGCMQHESIAHEHRPHDRGTLVSQTHNFYQ
FT                   ISNDVFRSEQPDAAMIPELKHHQIGTIINLRAKASDDLVFKNENFNLIHIPINTWAIDR
FT                   QDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVSMYRIIFENWVIDDAVKEMKQGGY
FT                   GYHIIWKNIDRLFTPENVKWIQQQLSNPS"
FT   gene            complement(529391..530203)
FT                   /locus_tag="ABSDF0578"
FT   CDS_pept        complement(529391..530203)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0578"
FT                   /product="conserved hypothetical protein; putative
FT                   AHL-lactonase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99957"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99957.1"
FT                   /translation="MIHKIHHLKCGSMCPVCAPLFGQKGWKAEIVCHCLLVETDRGLVL
FT                   IDTGFGLQDYLHMQQRLGSLVKRLGKIEPNLEFSAIQQIQKLGFHPKDVQHIFVTHLDF
FT                   DHAGGISDFPHATVHVLANEYNAAQLPNFKGKLRYKTNQYKQHRYWNFVEYQQGEKWFN
FT                   LEKVKGFPLFQDEILMVPLLGHSAGHCGIAIKQQNQWLLFCGDAYYSHLELNPANKLRS
FT                   LTLLEKTFAEDNEKRLINLKKLQHLAQHEPTIEIICAHDPHELRRYQT"
FT   gene            complement(530464..530937)
FT                   /pseudo
FT                   /locus_tag="ABSDF0579"
FT   CDS_pept        complement(530464..530937)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0579"
FT                   /product="fragment of putative antioxidant protein (part
FT                   2)"
FT                   /function="5.5 : adaptation to stress"
FT                   /function="5.6 : protection"
FT                   /note="Evidence 7 : Gene remnant; Product type ph :
FT                   phenotype"
FT                   /db_xref="PSEUDO:CAO99958.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(530888..531106)
FT                   /pseudo
FT                   /locus_tag="ABSDF0580"
FT   CDS_pept        complement(530888..531106)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0580"
FT                   /product="fragment of putative antioxidant protein (part
FT                   1)"
FT                   /function="5.5 : adaptation to stress"
FT                   /function="5.6 : protection"
FT                   /note="Evidence 7 : Gene remnant; Product type ph :
FT                   phenotype"
FT                   /db_xref="PSEUDO:CAO99959.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            531251..532156
FT                   /locus_tag="ABSDF0581"
FT   CDS_pept        531251..532156
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0581"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99960"
FT                   /db_xref="GOA:B0VKD2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99960.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            532522..535257
FT                   /gene="secA"
FT                   /locus_tag="ABSDF0582"
FT   CDS_pept        532522..535257
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="ABSDF0582"
FT                   /product="preprotein translocase, secretion protein of IISP
FT                   family"
FT                   /function="4.3.A.5 : The Type II (General) Secretory
FT                   Pathway (IISP) Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99961"
FT                   /db_xref="GOA:B0VRG7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VRG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99961.1"
FT                   /translation="MLASLIGGIFGTKNERELKRMRKIVEQINALEPTISALSDADLSA
FT                   KTPEFKQRYNNGESLDKLLPEAFAVCREAAKRVMGMRHYDVQLIGGITLHEGKIAEMRT
FT                   GEGKTLMGTLACYLNALSGEGVHVITVNDYLAQRDAELNRPLFEFLGLSIGTIYSMQEP
FT                   AEKAAAYLADITYGTNNEFGFDYLRDNMVFSLAEKKQRGLHYAIIDEVDSILIDEARTP
FT                   LIISGQSEDSSHLYTAINTIPPKLRPQKEEKVADGGHFWIDEKQRSVEMTEIGYETVEQ
FT                   ELIQMGLLAEGESLYSATNLNLVHHVSAAIRAHVLFQRDVHYIIHDGEVVIVDEHTGRT
FT                   MPGRRWSEGLHQAVEAKEGLAIQPENQTLATTTFQNYFRPYKKLSGMTGTADTEAAEMK
FT                   EIYGLDVVIIPTHRPMIRNDQNDLIYLNRNGKYNAIIQEIMNIRQQGVAPILIGTATIE
FT                   ASEILSSKLKQAGIHHEVLNAKQHEREADIIAQAGSPNAVTIATNMAGRGTDIILGGNW
FT                   KAKLAKLENPTPEDEARLKAQWEQDHEDVLQAGGLHIIGSERHESRRIDNQLRGRAGRQ
FT                   GDPGVSRFYLSLEDDLMRIFAGDRVVAMMRAMGLKEDEAIEHKMVSRSIENAQRKVEAR
FT                   NFDIRKNLLKYDDVNNEQRKIIYSQRDEILAENTLQEYVEEMHREVMQAMIANFIPPES
FT                   IHDQWDVEGLENALRIDLGIELPVQEWLEQDRRLDEEGLVERISDEVIARYRQRRAQMG
FT                   DESAAMLERHFVLNSLDRHWKDHLAAMDYLRQGIHLRGYAQKNPEQEYKKESFNLFVNM
FT                   LGVIKTDVVTDLVTDLSRVHIPTPEELAEMEAQQQQQAEAMKLSFEHDDVDGLTGEVTA
FT                   SQEALNESATEQQTFPVPESRNAPCPCGSGLKYKQCHGKI"
FT   gene            535388..535831
FT                   /locus_tag="ABSDF0583"
FT   CDS_pept        535388..535831
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0583"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99962"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99962.1"
FT                   /translation="MKKVLQPLFLTVLAVPSFVFAAETASAPQTTTVDKVLAAKGPTSA
FT                   QAVVKQENTTVISPRTGIRYTLGNTGNRPIILQTAAIAPANSANINRIVASNPALSPKS
FT                   QEKAKVALIGEAAVAGAAAVAANNVTAPAVPNSVTPANPASLN"
FT   gene            complement(535896..537206)
FT                   /locus_tag="ABSDF0584"
FT   CDS_pept        complement(535896..537206)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0584"
FT                   /product="putative transport protein (MFS superfamily)"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99963"
FT                   /db_xref="GOA:B0VRG9"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99963.1"
FT                   /translation="MESTSATAAPVVATNSKTRVLFASLVGTTIEFFDFYIYATAAVII
FT                   FPHLFFPASSGSAAVLQSLATFAIAFIARPIGAALFGHLGDHIGRKATLVAALLTMGIS
FT                   TVCIGLLPTYAQIGIVAPLLLALCRLGQGLGLGGEWSGAVLLATENAPEGKRAWYGMFP
FT                   QLGAPIGFILATGSFLLLSAAIPEQAFMQWGWRIPFIASAVLVIVGLYIRLKLHETPAF
FT                   QKVLDKQKEVNIPFKEVVTKHTSKLILGTIAAICTFVVFYLTTVFALNWGTTKLGYARG
FT                   EFLELQLFATLCFAAFIPLSAIFAEKFGRKATSIGVCIAAAIFGLFFSSMLESGNTLIV
FT                   FLFLCTGLSIMGLTYGPIGTVLSEIFPTSVRYTGSALTFNLAGIFGASFAPLIATKLAE
FT                   TYGLYAVGYYLTAASLLSLIAFLLIRETKNVDVNNQI"
FT   gene            complement(537341..537982)
FT                   /locus_tag="ABSDF0585"
FT   CDS_pept        complement(537341..537982)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0585"
FT                   /product="putative hemolysin III (HLY-III)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99964"
FT                   /db_xref="GOA:B0VRH0"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99964.1"
FT                   /translation="MSKSVLETYDPKEELFNAYSHGAGVVMAVIASVFLIIKGSYLSTA
FT                   QWIGLWVYAFSLILVFTSSTLYHFAQTQNLRYWYKKLDHTAIYYLIAGTYTPFLSIAIP
FT                   TQKTHILLIALWNIAAIGTLFKLVFIHRFQKISLLAYVLMGWLAVFVMDDMRTYLSKDT
FT                   LMLLITGGLAYTVGALFYALKKVRYTHAIWHIFVLLGAGAHFLAIYWYVV"
FT   gene            538082..539320
FT                   /locus_tag="ABSDF0586"
FT   CDS_pept        538082..539320
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0586"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99965"
FT                   /db_xref="GOA:B0VRH1"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99965.1"
FT                   /translation="MSHHFLGISVSVFSFEQEQQFFHEIKQMLDQQTFERLILSQYKGE
FT                   LTQLEKITFRVVELHGKKQLSALYHHTTQDVTKNYSFEDGLEQIAVLITQCKQANLFST
FT                   HQEIQLKKNKKKAMLNMVKKQSMTTAPTVQAHDREKQRYVQQSSAFLKELGITDEKSQI
FT                   IPSMARKWKQINKFIEIFASAYEQIDAEQKELNIVDFGSGKGYLTFALYDYLQEQQKVP
FT                   LITGVELRRNLVEFCQNVAEKLHFNHLDFFEGDVRSYQPEKLDVMIALHACDIATDFAI
FT                   HTGIRLNASMIMCAPCCHKELRPQLHSPEVLQPMLQFGIHAGQQAEMLTDTLRALLLKA
FT                   YGYETKVFEFVSLEHTSKNKMILATKRKNVSQPDAKIMAQIQALKEMYGIKKQTLELLL
FT                   QDQLPIENIGCKC"
FT   gene            539333..539752
FT                   /locus_tag="ABSDF0587"
FT   CDS_pept        539333..539752
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0587"
FT                   /product="putative acetyl transferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99966"
FT                   /db_xref="GOA:B0VRH2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99966.1"
FT                   /translation="MYKVIAGSWTKFKEDAKYIREQVFIQEQGIAHEDEWDDFDSIAMH
FT                   FMVYDEGQPIATARLLPQHSVGRVAVLMLYRKQGIGKILMQHIIEYARQHKLPYLKLSA
FT                   QTYVTAFYEALGFKVQGEVYQDCGIPHIDMTLALS"
FT   gene            complement(539797..540642)
FT                   /locus_tag="ABSDF0588"
FT   CDS_pept        complement(539797..540642)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99967"
FT                   /db_xref="GOA:B0VRH3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99967.1"
FT                   /translation="MTDFSRNALVVEDGGMRGTFTSGVLDAFLQQRFNPFDLYVGVSSG
FT                   STNVANYLAGQQGRTLTFYIDHSLRPEFIDYKRFFKGGDLLDLKWMWEIGEQEHPLDQQ
FT                   RLFASNPDFYMVLTHAKTGQAEYLRAGKDNLLNALRASSSIPVLTRHPVDIMGEPYFDG
FT                   GVADALPVRWTAQQSGVKKLLVLRTRPKNYFKASSRGDQFLAKYAFKHHYGFANSLRNR
FT                   CASYNASVEFVRSSNPEQQILEVCPPPLKNMAGRLTTNPKKLRYSYEVGLETGLQAIEN
FT                   "
FT   gene            complement(540658..540942)
FT                   /locus_tag="ABSDF0589"
FT   CDS_pept        complement(540658..540942)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99968"
FT                   /db_xref="GOA:B0VRH4"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99968.1"
FT                   /translation="MLLQHIRDILMSDKNSSESAILGWKFVLIVGVLSAIFLGFFYLAM
FT                   SNEPDYMPGAQRKAQQHEMQQKAEKSTDQQTQHDNMPEMDMQEHQHSHQ"
FT   gene            complement(541077..543212)
FT                   /locus_tag="ABSDF0590"
FT   CDS_pept        complement(541077..543212)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0590"
FT                   /product="putative 3-hydroxybutyryl-CoA epimerase"
FT                   /EC_number="5.1.2.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99969"
FT                   /db_xref="GOA:B0VRH5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99969.1"
FT                   /translation="MSAIQYEKNADNIVILTLDSTGQPANTMNAEFRDSLDEVTQKLKA
FT                   ETELSGVIFRSAKKTFFAGGDLDELIQIQPEHATDFFNMVEKLKGHLRTIETLGIPVVA
FT                   ALNGTALGGGWEIALSCHHRIAINDPKSKFGLPEVTLGLLPGGGGIVRMVRLLGLQNAF
FT                   PFLMEGKQFGVDKAKSLGLIHDTAENEQELLDKAIAWIKANPKSQQPFDVKGYKIPGGD
FT                   PKTPAVAQVLAIAPAMLKDKTKGCYPAPEAIMAAAVEGAQVDVDTALRIESRYFTQLAT
FT                   GQISKNMIGTFWHGLNAIKSGASRPADIAKWQATKVGVLGAGMMGAGIAYATAIKGIPV
FT                   ILKDVSVENAEKGKAYSQKLLDKRVSQGRMTAEKRDQILSLITATASAEDLQGCDLIIE
FT                   AVFENQELKAKVTQEAEQYLAPNGVIASNTSTLPITGLAQASKNDKAFIGLHFFSPVDK
FT                   MQLVEIIKGKNTSAETLAKAYDFVQQIGKTPIVVNDSRGFFTSRVFGTFIQEGMRLLAE
FT                   GVHPARIEMAALKAGMPVGPLAIQDEVSLTLTEHVASEARKALQAEGKELPKTPVDEVI
FT                   HTMIHELNRKGKAAGAGFYDYPENGKKHLWEGLNRWQKDHDISEQDMIDRILFVQALDT
FT                   LRCYEEGVLESVIDANVGSIFGIGYAPWTGGAIQFLNQYGIDKAQKRAEELAAKYGERF
FT                   TPPTLLKTKAEQKQNIQ"
FT   gene            complement(543233..544438)
FT                   /locus_tag="ABSDF0591"
FT   CDS_pept        complement(543233..544438)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0591"
FT                   /product="putative thiolase; acyl-CoA thiolase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99970"
FT                   /db_xref="GOA:B0VRH6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99970.1"
FT                   /translation="MSEAYIIDAIRTPRGKGKKDGSLYEVKPITLLTTLLNELQQRHQL
FT                   DTSKVDDIVLGCVTPIGDQGGDIAKTAAIAAGWNDDVAGVQINRFCASGLEAVNMAAMK
FT                   VRSGWEDLVVAGGVESMSRIPMGSDGGPWALDPETNLKSSFVPQGVGADLIATLDGYSR
FT                   EDVDNFAVKSQQKAAAAQANGYFDQSVVPVKDHAGVVILEKDEFIKGNTTLEGLAKLNP
FT                   SFEMMGQMGFDAIALQKYPEAQKVNHVHHAGNSSGIVDGAALVLLASEKAVKEQNLKPR
FT                   AKVLATALVGTDPTIMLTGPAPAARKALEKAGLTIDDIDLFEVNEAFAAVVMRFINELN
FT                   VPAEKVNVNGGAIALGHPLGATGAMILGTLLDELERQNKKRGLATLCVGGGMGIATIIE
FT                   RV"
FT   gene            complement(544610..545767)
FT                   /locus_tag="ABSDF0592"
FT   CDS_pept        complement(544610..545767)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0592"
FT                   /product="putative transcriptional regulator (AraC family)
FT                   (AdiY)"
FT                   /function="3.1.2 : transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99971"
FT                   /db_xref="GOA:B0VRH7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99971.1"
FT                   /translation="MSCSAIYLDHFGNLTCKKCFYTVVNRQFIFLDGHLGQFKVNIKET
FT                   EGFNMSRDTISIHFVNAALTGVKRLGMDVETLLSHVGIEAELLRQPKARISPEQYTRFI
FT                   KMLWMVTQDEHVGFDVQPRRLGTFAIMCQLIIHTKTLGQALELSSQFYKLFGDEWSVTL
FT                   ERDKHEARLVPLIPKTLDPDHFITESMLMIWHGLASWLIERRLPLERVHFSYPRPAHAD
FT                   EYDALFFAPVMQFDAPRTEITFAADYLDLPIRQDEKTLEEFLKAAPAQLLVKFKNTNSL
FT                   TSRIREVLKSQIGEEMPTLNDVASMLYLSPQTLRRRLAAEGKSYQGVKDALRRDAAIHL
FT                   LLNPELTLEDVAQQVGFSETSTFHRAFKKWTGVTPGLYRQLHGYH"
FT   gene            complement(545810..546715)
FT                   /locus_tag="ABSDF0593"
FT   CDS_pept        complement(545810..546715)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0593"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99972"
FT                   /db_xref="GOA:B0VKP3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99972.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSHLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLRKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            546839..547957
FT                   /locus_tag="ABSDF0594"
FT   CDS_pept        546839..547957
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99973"
FT                   /db_xref="GOA:B0VRH9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99973.1"
FT                   /translation="MTTALNGLKVLDFSTLLPGPFATMYLADMGAEVIHIESPSRPDLI
FT                   RIMPPYANGQATAHSYLNRNKQSIVLDLKDAASIDLIKAKISEFDIVIEQFRPDVMRRL
FT                   GLDYATLAEINPRLIYCSITGYGQTGSYKDRAGHDINYLALAGIAGYSGRQDSGPPPLG
FT                   IQVADIAGGSLHAVIAILAAVVERSRSGIGQYIDISMTDCVASLNSMAASATLAAQVEQ
FT                   APEQGMLNGGIFYDYYMTQDGRYLSIGSLEPQFMAGLSAALDLPVLLQKGASLDEQDRQ
FT                   EVKQAIQEKIKAKTFKEWHEIFANLDVCVEPVLSLSEALNSPLAHQRGWIVNVPLQNNT
FT                   PDTEPQIACPIKFSRSQMRYSFVGQKLGEGQW"
FT   gene            548092..549345
FT                   /locus_tag="ABSDF0595"
FT   CDS_pept        548092..549345
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0595"
FT                   /product="putative glucose-sensitive porin (OprB-like )"
FT                   /function="4.1.B.3 : The Sugar Porin (SP) Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99974"
FT                   /db_xref="GOA:B0VRI0"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99974.1"
FT                   /translation="MKTHKSLMVSCLSVLSITLFVQHAQAAAAFDPNGSWMLGDWNGQR
FT                   TALQAQGYDFSFGYTGEYAGILDSKQTSTHGSAYTGQLALGSHLDLGKILGWQDTEAQI
FT                   TLTYRDGQSLSEHSPALAGHQSSVQEVWGREQTWRLTDLWIKKKFLDQKLDVKVGRFGE
FT                   GEDFNSFDCDFQNLALCGSQVGNWVGDQWYNWPVSQWAMRVKYNLQPDLYTQVGVYEYN
FT                   PENLERGKGFNLSTDGSHGAIIPAEVVWSPKLGVQSMPGEYRLGYYYSTADAKEIADST
FT                   KTSHKQGVWVTAKQKLFQPADQADRGLTGFVNLTFHDSDTNKVDNMQNIGLVYKGLLNQ
FT                   RPQDELALGVARIHINDDWNDVQAKEYDTEYNTELYYGIHATNWLTIRPNVQYVRHVGA
FT                   LKNGDNTWVGGIKFSTAF"
FT   gene            549519..551924
FT                   /gene="gcd"
FT                   /locus_tag="ABSDF0596"
FT   CDS_pept        549519..551924
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="ABSDF0596"
FT                   /product="glucose dehydrogenase [pyrroloquinoline-quinone]
FT                   precursor (Quinoprotein glucose DH)"
FT                   /function="1.1.1 : carbon compounds"
FT                   /function="1.4.1 : electron donor"
FT                   /function="1.7.9 : glucose metabolism"
FT                   /function="1.3.9 : Entner-Doudoroff pathway"
FT                   /EC_number="1.1.5.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99975"
FT                   /db_xref="GOA:B0VRI1"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99975.1"
FT                   /translation="MNQPSSRSGLTTFTVIIIGLLALFLLIGGIWLATLGGSIYYIVAG
FT                   VLLLIVAWQLYKRASAALWVYAALMLGTIIWSVWEVGTDFWALAPRLDILGILGLWLLV
FT                   PAVTRGINNLGSSKVALSSTLAIAIVLMVYSIFNDPQEINGEIKTPQPETAQAVPGVAE
FT                   SDWPAYGRTQAGERYSPLKQINDQNVKDLKVAWTFRTGDFKTDNDSGETTNQVTPIKIG
FT                   NNMFICTAHQQLIAIDPATGKEKWRFDPKLKTDKSFQHLTCRGVMYYDANNTTEFATSL
FT                   QTKKSTSTQCPRKVFVPVNDGRLVAVNADTGKACTDFGQNGEVNLQEFMPYAYPGGYNP
FT                   TSPGVVTGSTVVIAGSVTDNYSNKEPSGVIRGYDVNTGKLLWVFDTGAADPNAMPGEGT
FT                   TFVHNSPNAWAPLAYDAKLDIVYVPTGVGTPDIWGGDRTELKERYANSMLAINASTGKL
FT                   IWNFQTTHHDLWDMDVPSQPSLADIKDKSGKTVPAIYVLTKTGNAFVLDRRNGQPIVPV
FT                   TEKPVPQTVKRGPQTKGEHYSKTQPFSDLNLAPQDKLTDKDMWGATMLDQLMCRVSFKR
FT                   LNYDGIYTPPSENGTLVFPGNLGVFEWGGMSVNPDRQVAVMNPIGLPFVSRLIPADPNR
FT                   AQTAKGAGTEQGVQPMYGVPYGVEISAFLSPLGLPCKQPAWGYVAGVDLKTHEVVWKKR
FT                   IGTIRDSLPNLFQLPAVKIGVPGLGGSISTAGNVMFVGATQDNYIRAFNVTNGEKLWEA
FT                   RLPAGGQATPMTYEINGKQYVVIMAGGHGSFGTKMGDYLVAYALPDNK"
FT   gene            552091..553734
FT                   /gene="cysI"
FT                   /locus_tag="ABSDF0597"
FT   CDS_pept        552091..553734
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="ABSDF0597"
FT                   /product="sulfite reductase"
FT                   /function="1.8.2 : sulfur metabolism"
FT                   /EC_number="1.8.7.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99976"
FT                   /db_xref="GOA:B0VRI2"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99976.1"
FT                   /translation="MYLYTDFDQQLINQRVAQFRNQTERYLVGKLSEDEYRPLRLQNGL
FT                   YVQRYAPMLRIAVPYGLMNSKQLRKIAEVSTQYDRGYAHVSTRQNIQLNWPALEDVPEI
FT                   LAELATVQMHAIQTSGNCIRNTTTDQYAGVVAGEIADPRPTCELIRQWSTFHPEFAFLP
FT                   RKFKIAVSALEEKDRAATAFHDIGVYIVRNEAGEMGYKIMVGGGLGRTPIIGSVIREFL
FT                   PREDLIAYLEAVLRVYNLHGRRDNKYKARIKILVKALTPEVFAQKVEAEFEYTRETLKI
FT                   QPEILKKLDEEFTPFDYQDLEDEDFTALFAEHPKFKQWFNINTHAHKVKGYRIVSISLK
FT                   RAGIAPGDMTTEEMNFIADLADKYTFGELRTTHEQNIALADVPQKDLFDVWQALEQHNM
FT                   ARAHIGFITDIISCPGGDFCSLANAKSIPIAEAITRRFEDLDKVYDLGHLDLNISGCMN
FT                   ACGHHHVGNIGILGVDKKGAEFYQITLGGNSDHDASIGDILGPSFAAEAVPDVIEEVLN
FT                   TYLDLRTEGERFVDTYRRVGIQPFKERAYA"
FT   gene            553721..554212
FT                   /locus_tag="ABSDF0598"
FT   CDS_pept        553721..554212
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99977"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99977.1"
FT                   /translation="MHMLNTALPVLYKDGAIADNTYQIIAEDGVIPQGDVVLTTAQLDQ
FT                   LANIQGKKALYVTVNDSPEDHTFPLSELDAIFIEFAGFGDGRGYSFAALLRRQDFQGEL
FT                   RATGDVFKDVLNYLKRSGFDSFVIKEGKDVQEAAAGLQDFTHPYQASTAVPKASYQTGA
FT                   "
FT   gene            554295..554657
FT                   /locus_tag="ABSDF0599"
FT   CDS_pept        554295..554657
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0599"
FT                   /product="putative multidrug transporter"
FT                   /function="4.2.A.7 : The Drug/Metabolite Transporter (DMT)
FT                   Superfamily"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99978"
FT                   /db_xref="GOA:B0VRI4"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99978.1"
FT                   /translation="MFALISKINPGAWWLIFAIATDVLSTFYSAKGNGLVNKTAQGIAL
FT                   VLYIISFACAAIALKYMQAGILYVLWSGVGVLATAFLAKIFLGQNIDVAGWIGIGFITV
FT                   GLLCCIKLFMKVSSAI"
FT   gene            554665..555477
FT                   /locus_tag="ABSDF0600"
FT   CDS_pept        554665..555477
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0600"
FT                   /product="transposase of ISAba7, IS5 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99979"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99979.1"
FT                   /translation="MKKPVPKIYRTTNWSSYNQALIKRGNISIWFDPKTQWYAQPQGKH
FT                   GRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFAQSLIKLCGLNWTAPDYSTLCRRQKRID
FT                   IAISYQQSRDGLHLLVDSTGLKFLGEGEWKRKKHQPAYRRQWRKLHIGIDAKTLQIRAV
FT                   QLTTNNVSDSQVLGDLLDQIPLDERIDSVYTDGAYDTKHCRQVILDRDAHAVIPPRKNA
FT                   KPWKDKKLRSLERNELLKTVKRLGRSLWKKWSGYHRRSLVETKMHCIK"
FT   gene            555637..555978
FT                   /pseudo
FT                   /locus_tag="ABSDF0601"
FT   CDS_pept        555637..555978
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0601"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAO99980.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(556093..557271)
FT                   /locus_tag="ABSDF0602"
FT   CDS_pept        complement(556093..557271)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0602"
FT                   /product="putative acetyl-CoA acetyltransferase
FT                   (Acetoacetyl-CoA thiolase)"
FT                   /EC_number="2.3.1.9"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99981"
FT                   /db_xref="GOA:B0VRI7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99981.1"
FT                   /translation="MTDIVIVNGARTAMGGFQGSLSGLTAPELGAVTIKEAIARAGLQP
FT                   TDVEEVIMGCVLPAGLKQGPARQAMRKAGLPDSTGAVTINKLCGSGMKAVMQAADMIKA
FT                   GSAEIVVAGGMESMTNAPYVLPKARAGYRMGHGEIKDHMFFDGLEDAETGRLMGSFAQD
FT                   MANTRGYTREQMDDFAIRSLKCAQTAITEGYFKDEIVPVTVSTRKGDVIVDQDEQPLNA
FT                   KIDKIPSLKPAFAKDGTITAANASSISDGASALVLTSSEVAAQRGLQPLAKIIATASNS
FT                   QHPSEFTIAPVGAIEKVLKKAGWNAQDVDLWEINEAFAMVTMCPIDDFKLDPEKVNIHG
FT                   GACALGHPVGSTGSRIILTLIHALKRTGGKKGVAALCIGGGEATAVAIEILY"
FT   gene            557520..558425
FT                   /locus_tag="ABSDF0603"
FT   CDS_pept        557520..558425
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0603"
FT                   /product="transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99982"
FT                   /db_xref="GOA:B0VKE4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0VKE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99982.1"
FT                   /translation="MPIDTQLTTLFCLIDDFCTDITQNVEQYMLTYGQTKRLRQSKIHA
FT                   SEVITLLLWFHLTGSRNFKAFYLYWAKPFLCSYFTNLPSYSRFIELKAKYAMYFVALIE
FT                   SLKVHSAGIAFIDSTKLAVCHNKRIHQHRVFADSASRGKTSVDWFYGFKIHLICDHIGR
FT                   LVSYCITTGNVDDRKVLPDLIEHSKLKGKLFGDRGYVGKNWKSRLAEVGVQLITRVKRN
FT                   MKPQVLAPFDHAVLKKRGIIEAPFKLMKSQFDLEHSRHRSKMGLLTTIFAALTLYALVL
FT                   VNGYKSGIQQILKPIDLNSA"
FT   gene            complement(558411..558893)
FT                   /locus_tag="ABSDF0604"
FT   CDS_pept        complement(558411..558893)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0604"
FT                   /product="putative type IV fimbrial biogenesis protein"
FT                   /function="6.5 : Pilus"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99983"
FT                   /db_xref="GOA:B0VRI9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99983.1"
FT                   /translation="MFKSPGFTIVELTITLVILVIMSVIAIPLYHQFMASVELKNTLRI
FT                   LTIHIQKAKYDAIIRHKNVVLCPSSDQLVCNTNWDNRIISFVDNNRNLQHDLNEELLAS
FT                   IDLNHHYGSMKLQRFGKKQNSIIFQGNSGLPIESNGSFIYCSYDQLKKREFGLSRI"
FT   gene            559274..560347
FT                   /locus_tag="ABSDF0605"
FT   CDS_pept        559274..560347
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0605"
FT                   /product="putative Outer membrane protein precursor
FT                   (OmpA-like)"
FT                   /function="4.1.B : Beta barrel porins (The Outer Membrane
FT                   Porin (OMP) Functional Superfamily)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99984"
FT                   /db_xref="GOA:B0VRJ0"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99984.1"
FT                   /translation="MKLSRIALATMLVAAPLAAANAGVTVTPLLLGYTFQDSQHNNGGK
FT                   DGNLTNSPELQDDLFVGAALGIELTPWLGFEAEYNQVKGDVDGASAGAEYKQKQINGNF
FT                   YVTSDLITKNYDSKIKPYVLLGAGHYKYDFDGVNRGTRGNSEEGTLGNAGVGAFWRLND
FT                   ALSLRTEARATYNADEEFWNYTALAGLNVVLGGHLKPAAPVVVEVAPVEPTPVAPQPQE
FT                   LTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNE
FT                   RLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
FT                   TVVVQPGQEAAAPAAAQ"
FT   gene            complement(560634..561515)
FT                   /pseudo
FT                   /locus_tag="ABSDF0607"
FT   CDS_pept        complement(560634..561515)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0607"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   2)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99985.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(561523..561873)
FT                   /pseudo
FT                   /locus_tag="ABSDF0608"
FT   CDS_pept        complement(561523..561873)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0608"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   1)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAO99986.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(562117..563577)
FT                   /gene="lysP"
FT                   /locus_tag="ABSDF0609"
FT   CDS_pept        complement(562117..563577)
FT                   /transl_table=11
FT                   /gene="lysP"
FT                   /locus_tag="ABSDF0609"
FT                   /product="lysine-specific permease"
FT                   /function="1.5.1.7 : lysine, diaminopimelate"
FT                   /function="4.2.A.3 : The Amino Acid-Polyamine-Choline (APC)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99987"
FT                   /db_xref="GOA:B0VRJ3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99987.1"
FT                   /translation="MSETHAPEKLQRKLGARHLNMIAIGGSIGTGLFLASGSTIANAGP
FT                   GGALLAYSLIGIMIYFLMTSLGELATHTPTSGAFFTYGSRYIEEGFGFALGWNYWYNWA
FT                   ITVAFELVAVQFIMKFWFPDIPGFYWSALFLVIIFMINAMTVKGFGESEFWFSMVKVIA
FT                   IVAFIIIGIAMIIKIMLTPGVATFGNWTYKEAPFVGGLQAMIGVAMIAGFSFQGTEMVG
FT                   VAAGESKDPKKTIPLAIKQIFWRILLFYILCIFIIGTLIAYDDPNLLQAAATENIALSP
FT                   FTLLYEKVGFAFAASLMNAVILTAILSAGNSGMYSSTRMLFDMAQQGRAPKWFAKLDNR
FT                   GVPMNALYATTFIAAFCFLTTFIGEKQVFNWLLNMSGMCGFIVWLGIAISHYRFRKGYI
FT                   AQGYKLEDLAYRAKFFPFAPWFAFILCSVIILGQNYQAVLGGKIDWIGLLSTYINLPLF
FT                   LVIWLGYKWKNKTKLIPYDQMDVKPEQD"
FT   gene            complement(563599..564612)
FT                   /gene="rsmC"
FT                   /locus_tag="ABSDF0610"
FT   CDS_pept        complement(563599..564612)
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="ABSDF0610"
FT                   /product="ribosomal RNA small subunit methyltransferase C
FT                   (rRNA (guanine-N(2)-)-methyltransferase) (16S rRNA m2G1207
FT                   methyltransferase)"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="2.1.1.52"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99988"
FT                   /db_xref="GOA:B0VRJ4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VRJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99988.1"
FT                   /translation="MDPRSEVILRQQDYLKGRVLLINAPNDALVSQLPTEIDASVWTWN
FT                   YADYQVFLNAGATAHFSVEFPLQEFDQAIIFVPKSKELLNYILHVVMSHLKIDQSVFLV
FT                   GEKKGGVERAAKQLQSFGKILKLDSARHCQLWHLKIEKTEKIKPLESWLKTYTVQVNEQ
FT                   ELTICALPGVFSQTHLDVGTAVLLPYLNQVKSGRIADFGCGAGIISCYLAKANSSNIIH
FT                   ALDIDAFALQSTEMTFSRNGIGSDQLRLQPVTGIADAPTELDAIVSNPPFHQGIHTNYD
FT                   ASEGLCQNAKKHLKASGELWIVANRFLNYPILIEKHFGQCEIKTDLQGFKVLYACA"
FT   gene            complement(564675..566060)
FT                   /locus_tag="ABSDF0611"
FT   CDS_pept        complement(564675..566060)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0611"
FT                   /product="putative transporter"
FT                   /function="4 : transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99989"
FT                   /db_xref="GOA:B0VRJ5"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99989.1"
FT                   /translation="MRNCGVFTPMSNQPSQDRLDLVYGLDDRPKPFVAFLAAFQHLLAI
FT                   IVPIVTPGLLICLALGVPRNETNMILSMSLVISGIATFLQCKKVGPFGAGLLIVQGTSF
FT                   NFIGPIIGIGSAMVAAGTPVNQVMAAIFGVVIAGSFIEMGVSQILPWVKKLITPLVTGI
FT                   VVLLIGLTLIKEGLISMGGGYQAMQDHTFASADNLIMSCTVLAIIIVLNRIRIVWIKSS
FT                   AILIALVIGYILAGFMGYLDFSGLKDAPVIQIPTPMHFGLSFSWGLFIPMAFIYLVTSL
FT                   EAIGDVTATSKLSNQPVDGPQWMQRIKGGVLVNGANSLLAGLFNTFPSSVFAQNNGVIQ
FT                   LTGVASRYVGIWIAALLILLGLFPAVAGVIQAVPQAVLGGAVMVMFGAVAASGINILSS
FT                   IHLDRRALLIIAISLALGLGVAQVPQILEHLPELFKNIFSSGVATGGIAALILNVVLPE
FT                   THK"
FT   gene            566212..568047
FT                   /gene="typA"
FT                   /locus_tag="ABSDF0612"
FT   CDS_pept        566212..568047
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="ABSDF0612"
FT                   /product="GTP-binding elongation factor family protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99990"
FT                   /db_xref="GOA:B0VRJ6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99990.1"
FT                   /translation="MSDIKNLRNIAIIAHVDHGKTTLVDKLLQQSGALGDRAGEIERVM
FT                   DSNALESERGITILAKNTAITWLDKRTDTTYRINIVDTPGHADFGGEVERVMSMVDCVL
FT                   LLVDSQEGPMPQTRFVTQKAFARGLKPIVIINKVDKPSARPDWVIDQVFDLFDNLGATD
FT                   EQLDFPIVYASGLRGVAGPAPEELAEDMTPLFETIVDIVEPPAVDVDGPFQMQISSLDY
FT                   NSFVGVIGVGRIQRGFVKLNTPVTVIDKEGNTRNGRILKIMGYHGLERIDVDSASAGDI
FT                   VCITGIDALNISDTICDPKNVEALPPLSVDEPTVSMTFQVNNSPFAGKEGKFVTSRNIR
FT                   ERLDRELIHNVALRVEDTDSPDRFKVSGRGELHLSVLIENMRREGFELGVSRPQVIIKE
FT                   IDGEKQEPYENVTFDVEEQHQGAVMEQMGHRKGEMTNMEVDGKGRIRIEATVPSRGLIG
FT                   FRSEFLTMTSGTGIMTSSFSHYGPLKQGTVAKRQNGVLISMVQGTCLGYALFSLQDRGR
FT                   LFAKPQLEVYEGMIVGINSRSDDMVVNPTKAKQLTNVRASGTDDALTLTPAIEFTLEQA
FT                   LEFIEDDELVEVTPKSIRIRKRYLTENERKRNRDK"
FT   gene            568302..568733
FT                   /gene="mscL"
FT                   /locus_tag="ABSDF0613"
FT   CDS_pept        568302..568733
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="ABSDF0613"
FT                   /product="mechanosensitive channel"
FT                   /function="4.1.A.22 : The Large Conductance
FT                   Mechanosensitive Ion Channel (MscL) Family"
FT                   /function="5.5.6 : other (mechanical, nutritional,
FT                   oxidative stress)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99991"
FT                   /db_xref="GOA:B0VRV0"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VRV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99991.1"
FT                   /translation="MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLI
FT                   TVITGGGVDFSQKFIVLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFL
FT                   MVKLLNKLRRDKNEPEAPAATPEDIQLLREIRDELKKQA"
FT   gene            568877..569230
FT                   /locus_tag="ABSDF0614"
FT   CDS_pept        568877..569230
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0614"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99992"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99992.1"
FT                   /translation="MNQLFVYGTLCPNKANAHILEQIGGNWTKASVRGVIHILDWGPDK
FT                   GLKALELDPEADWVEGYLFSTEKLAENWQMLDDFEGFQYQRVTADIKLESGEYVKAWTY
FT                   QINMQAKASHNYK"
FT   gene            complement(569241..569531)
FT                   /gene="ppiC"
FT                   /locus_tag="ABSDF0615"
FT   CDS_pept        complement(569241..569531)
FT                   /transl_table=11
FT                   /gene="ppiC"
FT                   /locus_tag="ABSDF0615"
FT                   /product="peptidyl-prolyl cis-trans isomerase precursor
FT                   (PPIase) (Rotamase)"
FT                   /function="2.3.4 : chaperoning, folding"
FT                   /EC_number="5.2.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99993"
FT                   /db_xref="GOA:B0VRV2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99993.1"
FT                   /translation="MQTAIVRHILVKDKDLAEQLKKKLQSGADFAKLAKQYSTCNSAKR
FT                   GGELGEVKKGQLVPVIDKVVFTAAERVLQGPIKSQFGYHLLEVKFRMTGLR"
FT   gene            complement(569551..570375)
FT                   /gene="mutM"
FT                   /locus_tag="ABSDF0616"
FT   CDS_pept        complement(569551..570375)
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="ABSDF0616"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /function="2.1.4 : DNA repair"
FT                   /EC_number="3.2.2.23"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99994"
FT                   /db_xref="GOA:B0VRV3"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VRV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99994.1"
FT                   /translation="MPELPEVETTKTSLFPLLNQKVLSVEVRNPSLRWPIPDNVQKLVG
FT                   QRLIGLNRRSKYILAEFEQDQMLWHLGMSGSFRLCQPNDELRKHDHLIIQFEDQQLRYH
FT                   DPRRFGCILWLNPETQGKLIDTLGPEPLSTDFHAEYLASKLKNKSVGIKIALMDNHVVV
FT                   GVGNIYATESLFNVGIHPAQPAGDLTMQQIEKLVVEIKRILKSAIDLGGSTLRDYSNAM
FT                   GENGYFQQTLLAYGRAREMCVNCETTLENLKLGQRASVFCPQCQPLKKLRKP"
FT   gene            570424..571017
FT                   /locus_tag="ABSDF0617"
FT   CDS_pept        570424..571017
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0617"
FT                   /product="putative 3-methyladenine DNA glycosylase"
FT                   /EC_number="3.2.2.21"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99995"
FT                   /db_xref="GOA:B0VRV4"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99995.1"
FT                   /translation="MVCNISENAMSDILPLSWFQRETSEVAYDLIGCLLCKRQPDGQVI
FT                   RCTISETEAYLGVRDKACHSYNDKRTARTEVMYRHGGTIYVYLIYGMYEMLNIITQTEG
FT                   VPEGVMIRSSFLNSASTKKEYKLLAGPGKLTRYLGIDRTLKGQTLGEESGLWIEAATIQ
FT                   PEVVLTPRIGIDYAEEAKDWPERYCWKDHPSLSR"
FT   gene            571150..573288
FT                   /locus_tag="ABSDF0618"
FT   CDS_pept        571150..573288
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0618"
FT                   /product="putative tonB-dependent receptor protein"
FT                   /function="4.1.B.14 : The Outer Membrane Receptor (OMR)
FT                   Family"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAO99996"
FT                   /db_xref="GOA:B0VRV5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAO99996.1"
FT                   /translation="MSLLRLDRLHYCILMSMGCISSPLVWAEDLNSDVAKLPTLHVEAT
FT                   RTDTGYLQTPASVFRIEAPQVDSSSQVNLTEVVKGIPSLQIRNRENYAQDLQLSMRGFG
FT                   ARSTFGVRGIRLYVDGIPATMPDGQGQTSNIDLSSLDHVEVLTGPFSSLYGNSSGGTIL
FT                   TSTKEGQGKDSIELSYSGGSHDKSRAGLVLQGGAKGANEPSYIISSSYFDTDGYREHSG
FT                   AEKVLNNAKLSWNLDDGSKINWVTNYVKINADDPGGLTRADWQNNPKQVVQNVLDYNAR
FT                   KEIEQTQTGLTWSKPINDQHELYAMTYMGQRQVTQYQSIPDTVQKNPNTPYQAGGVIDF
FT                   KRNYYGADFRWTGKELLPNTTLSIGVALDAMKEDRQGYQNFNDTGDKGVKGALRRDEDN
FT                   TLWNIDPYVQASWQFLPTWRLDTGVRYSNVHYKSKDYYIVGLNGDNSGKTSYEEVLPSV
FT                   ALSWQITPEVLAYASYAKGFETPTFTEMAYPAQGGASTLDLKPSTSDTYETGLKSQNQL
FT                   GDFTLAVFQTKTKNDIVSAESFGGRSTFRNADKTLREGVEFAWNKKLWRDLIAIASYTY
FT                   LDATFDSTVPAAGKISEIPEGNAIPGIAKNQAYVSLAWQPSHGLYGGVDVQYMDKVYVN
FT                   DTNSDAAPSYSVTSANVGYAWVMGDWKVNSFARVDNLFDRNYAGSVIVNDSTQPVGRYF
FT                   EPADGRNWSAGLRVIKQF"
FT   gene            573298..573414
FT                   /pseudo
FT                   /locus_tag="ABSDF0619"
FT   CDS_pept        573298..573414
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0619"
FT                   /product="fragment of putative FMN oxidoreductase (part 1)"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99997.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            573421..574419
FT                   /pseudo
FT                   /locus_tag="ABSDF0620"
FT   CDS_pept        573421..574419
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0620"
FT                   /product="fragment of putative FMN oxidoreductase (part 2)"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAO99998.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            574485..574754
FT                   /pseudo
FT                   /locus_tag="ABSDF0621"
FT   CDS_pept        574485..574754
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0621"
FT                   /product="fragment of putative transporter (part 1)"
FT                   /note="Evidence 7 : Gene remnant; Product type pt :
FT                   putative transporter"
FT                   /db_xref="PSEUDO:CAO99999.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            574658..575407
FT                   /pseudo
FT                   /locus_tag="ABSDF0622"
FT   CDS_pept        574658..575407
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0622"
FT                   /product="fragment of putative transporter (part 2)"
FT                   /note="Evidence 7 : Gene remnant; Product type pt :
FT                   putative transporter"
FT                   /db_xref="PSEUDO:CAP00000.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(575442..576266)
FT                   /locus_tag="ABSDF0623"
FT   CDS_pept        complement(575442..576266)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0623"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAP00001"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP00001.1"
FT                   /translation="MKKLLIASLIAISSSSIFAADTTASAAKNDVFKQAEQLYAAKNYP
FT                   AAFQEVQRLAQTGNAQAIYNLGYMTQMGQGTAKDNAKALKYYEDASNKGYAQASYTLAQ
FT                   IYETGELGVAKDSNKFSQYIQKAAAQGSDDATVKIATILFAQKKPQSHQIALQKLAPLI
FT                   RKGNYPAIQVKALYDISQGVENKNPLMKRQGIEALQTIAQKGYAPASMALATMMANGNI
FT                   IPQNLPQAKQIFTELAKQNVPNARESLASVEKIIAEKNKQAAAAPTQPAPKK"
FT   gene            complement(576449..577159)
FT                   /locus_tag="ABSDF0624"
FT   CDS_pept        complement(576449..577159)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0624"
FT                   /product="putative thiol:disulphide interchange protein
FT                   (DsbC-like)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAP00002"
FT                   /db_xref="GOA:B0VRW1"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP00002.1"
FT                   /translation="MKTKLAILILSLAFFGSAHADVKTLEQNLKTNYPDLPVKGVYQSP
FT                   VAGIYEVYTSGRIVYTNQDAKYFFVGNLVDIKQQKNMTEERIAELGKIDVKSLPLNQAI
FT                   KYVKGKGERTLYIFSDPDCPYCQRLEQNMVGVDNVTVYVFLYPLTSLHPNAEKVSNQIW
FT                   CSKNPSEAWTNYMLNRKLPAAGKSCTSPVQKNIALGQKLNIDGTPTLFLQDGQKISGVP
FT                   GDAKQIEELLQSVK"
FT   gene            complement(577243..577407)
FT                   /pseudo
FT                   /locus_tag="ABSDF0625"
FT   CDS_pept        complement(577243..577407)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0625"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAP00003.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(577471..578148)
FT                   /pseudo
FT                   /locus_tag="ABSDF0626"
FT   CDS_pept        complement(577471..578148)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0626"
FT                   /product="fragment of transposase of ISAba6, IS982 family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAP00004.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(578313..579035)
FT                   /locus_tag="ABSDF0627"
FT   CDS_pept        complement(578313..579035)
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAP00005"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP00005.1"
FT                   /translation="MSLLAFSSYALNGVDAQKFLQGQVTVDTERLAENETRYTAICDLK
FT                   GRIHFGLWLKKNNAESFDIIVTQDQAEEFAKHIKKYGAFSKMTLSEQGAVFPKVVNGHT
FT                   EFSSTETDISEWQKQAIVTGQAWIAQATEHEFQPQELRLHQREGVNYDKGCYLGQEIVA
FT                   RLWFKAKPKHWLHLVQGTGDAPAPATQLHNDVEVVNSTQTTDGYIALVVAKPAALQELG
FT                   LQVLDLPEALSGDVARPQ"
FT   gene            579252..579698
FT                   /locus_tag="ABSDF0628"
FT   CDS_pept        579252..579698
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0628"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAP00006"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP00006.1"
FT                   /translation="MATGTVKLHRVFKAPAERVYRAFLDPDALVKWMAPHGFTAKVHSF
FT                   DAKVGGSYKMSFTNFSTGSTHSFGGTYVELVPNELIRYNDQFDDAYLPGTMQVTITKTV
FT                   LVGTEIHITQEGIPEVIPVEACYLGWQESLSLLKLLVEADIPDQ"
FT   gene            579841..580197
FT                   /locus_tag="ABSDF0629"
FT   CDS_pept        579841..580197
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAP00007"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP00007.1"
FT                   /translation="MDIQIKRIYDDVSGDDGKRILVDRLWSRGISKENAHLDLWLKEIA
FT                   PSTELRKWFHAESAEHWDEFKQRYLKELETNPAVKELLEIVSYHKVTLLYSAKDVEHNH
FT                   AIILKEYLLEKSKN"
FT   gene            580288..580632
FT                   /locus_tag="ABSDF0630"
FT   CDS_pept        580288..580632
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0630"
FT                   /product="putative alkylphosphonate uptake protein (PhnA)
FT                   in phosphonate metabolism"
FT                   /function="4 : transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAP00008"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP00008.1"
FT                   /translation="MSLPNCPKCQSEYTYQDGDLLICPECSHEWKEGEALVTEEQEVIK
FT                   DANGNVLADGDSVTVIKDLKIKGSSSVVKVGTKVKSIRLVPDASDGHNIDCKIDGIGQM
FT                   KLKSEFVKKA"
FT   gene            580843..581184
FT                   /locus_tag="ABSDF0631"
FT   CDS_pept        580843..581184
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0631"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0631"
FT                   /db_xref="EnsemblGenomes-Tr:CAP00009"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP00009.1"
FT                   /translation="MAGWYEITQANDGQYRFVLKAGNGEIILNSELYKAKASAVNGIES
FT                   VQKNSSDDARYDRLTAKNGKPYFNLKAANHQIIGSSQFYASEASRDKGIESVKSNGSST
FT                   TIKDLTVQA"
FT   gene            complement(581238..582953)
FT                   /gene="proS"
FT                   /locus_tag="ABSDF0632"
FT   CDS_pept        complement(581238..582953)
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="ABSDF0632"
FT                   /product="prolyl-tRNA synthetase"
FT                   /function="2.3.1 : amino acid -activation"
FT                   /EC_number="6.1.1.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAP00010"
FT                   /db_xref="GOA:B0VRW9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0VRW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP00010.1"
FT                   /translation="MRTSRFLFATLRETPNDAEVISHQLMLRAGMIRKLASGLYTWLPM
FT                   GTRVLKKVDAIVREEMNRSGAMEVFMPVTQPASLWEESGRYEQYGPGLLRFKDRHDNPF
FT                   VLGPTHEEVITDLARNELKSYKQLPVNFYQIQTKFRDEIRPRFGVMRSREFIMKDAYSF
FT                   HATQESLQETYNVMYDTYSRIFTRLGLDFRPVQADTGSIGGSASHEFHVLAASGEDDIA
FT                   FSTESDYAANVEMAEAVLVGERAAPTQEFKLVETPNQKTIADVCQFLNADPKQSVKALL
FT                   VQGVADEKGNVPVVALFLRGDHELNEIKAEKHPLVAAPLAFATEEQLQAFGLTAGFTGP
FT                   QGLVEKGITVIVDRAASVLSDFVAGANEADKHAVGVNWERDAQITEVFDLRNVVEGDPS
FT                   PDGKGTLQIKCGIEVGHIFQLGTKYSEALGCKVLGEDGKPFTVTMGCYGIGVTRVVAAA
FT                   IEQNYDDKGIIWPQAIAPFEIAIVPMNAHKSPRTLEAAEALYAELQAQGFDVLLDDRNE
FT                   RPGVKFSDLELMGIPHRIVIGEKGLDAGTFEYKGRRDAEASNLTKEELLAKLAR"
FT   gene            complement(583012..586110)
FT                   /gene="nolG"
FT                   /locus_tag="ABSDF0634"
FT   CDS_pept        complement(583012..586110)
FT                   /transl_table=11
FT                   /gene="nolG"
FT                   /locus_tag="ABSDF0634"
FT                   /product="nodulation protein precursor"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAP00011"
FT                   /db_xref="GOA:B0VRX0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP00011.1"
FT                   /translation="MWFTRISVKYPVFTIMMMLSLMVLGLASWKRMTVEEFPNIDFPFV
FT                   VVTTQYAGASPEAVESDITKKLEDQINTISGIKQITSRSSEGLSMVIAEFNLDTSSAIA
FT                   AQDVRDKIAPVIAQFRDEIDTPIVQRYDPSSSPIMSVVFESNSMSLAQLSSYVDKKIVP
FT                   QLKTVSGVGNVNLLGDAKRQIRIKVHPEQLQSYGIGIDQVINTLKNENIEVPAGTLQQK
FT                   NSELVVQIQSKVIHPLGFGDLVIANKNGSPIFLKQVATVEDTQAELQSSAFYNGRTAVS
FT                   VDILKSSDANVIQVVDKTYQTLEKLKAQMPAGLNYKVVADSSKGIRASIKDVVRTIIEG
FT                   AVLAVLIVLLFLGSFRSTVITGLTLPITLLGTLTFIWAFGFSINMMTLLALSLSIGLLI
FT                   DDAIVVRENIVRHTELGKDHVTAALDGTKEIGLAVLATTLTIVAVFLPVAFMGGLIGRF
FT                   FYQFGVTVSTAVLISMFISFTLDPMLSAHWKDPVKKKESRLQRFFNYISNLLDGLTHIY
FT                   EKLLKLALRFRFITVIIAIVSLVVALGLSKMIGTEFVPTPDKGEIRIQFETPVDSSLEY
FT                   TQAKLHQVDQIIRQFPDVVSTYGVVNSEVDSGKNHAGLGVTLKPKQERSADLTTLNNEF
FT                   RDRLQSVAGIRVTSVAAAQDSVSGGQKPIMISIKGSDLNELQKISDRFMAEMEKIDGVV
FT                   DLESSLKEPKPTLGVHINRVLASDLGLSVSQIANAIRPLIAGDNVTTWEDRDGETYDVN
FT                   IRLNENKRVLPQDVQNLYLNSNKTNANGQNILVPLSAIATTQEKLGASQINRRDLEREV
FT                   LIEANTSGRPSGDIGQDIDKMQKAFKLPAGYTFDTQGANADMAESAGYALTAITLSIVF
FT                   IYIVLGSQFNSFIHPAAIMASLPLSLIGVFLALFLFRSTLNLFSIIGIIMLMGLVTKNA
FT                   ILLIDFIKKAMEDGISRYDAILQAGKTRLRPILMTTSAMVMGMVPLALGLGEGGEQSAP
FT                   MAHAVIGGVITSTLLTLVVVPVIFTYLDDLKNFMLRQTRRFMS"
FT   gene            complement(586126..587244)
FT                   /gene="nolF"
FT                   /locus_tag="ABSDF0635"
FT   CDS_pept        complement(586126..587244)
FT                   /transl_table=11
FT                   /gene="nolF"
FT                   /locus_tag="ABSDF0635"
FT                   /product="nodulation protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAP00012"
FT                   /db_xref="GOA:B0VRX1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B0VRX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP00012.1"
FT                   /translation="MRTTHLTPSTFFKLSLISLSLILAACNQQEVPKTTASEPKKIELI
FT                   PQDLIPVKEGSLAAQTAFTGTIRAVQQSSIQAQVSATATAVTANVGQKVQKGQVLVRLN
FT                   NQDNAARLAQAQANLASAQAQAELARNLMNRKQRLLNQGFIARVEFEQSQVDYKGQLES
FT                   VRAQQANVDIAKKADRDGIITSPISGVITKRQVEPGQTVSVGQTLFEIVNPDQLEIQAK
FT                   LPIEQQSALKVGSSIQYQIQGNSKQLHAILTRISPVADQDSRQIEFFASPKEAIDSLSI
FT                   GAFINGIILHNDSNQGQTIPLDSIQNLQHDPFVWVIRNQTIQKVKIRVVEQRYNENIAL
FT                   VQGLQSTDQVSRIQFEDSDINKKVTLTTEKNK"
FT   gene            complement(587304..587477)
FT                   /pseudo
FT                   /locus_tag="ABSDF0636"
FT   CDS_pept        complement(587304..587477)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0636"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   2)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAP00013.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(587488..587973)
FT                   /pseudo
FT                   /locus_tag="ABSDF0637"
FT   CDS_pept        complement(587488..587973)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ABSDF0637"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   1)"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAP00014.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            588225..588608
FT                   /gene="pilG"
FT                   /locus_tag="ABSDF0638"
FT   CDS_pept        588225..588608
FT                   /transl_table=11
FT                   /gene="pilG"
FT                   /locus_tag="ABSDF0638"
FT                   /product="twitching motility protein"
FT                   /function="6.5 : pilus"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ABSDF0638"
FT                   /db_xref="EnsemblGenomes