(data stored in ACNUC7421 zone)

EMBL: CU633749

ID   CU633749; SV 1; circular; genomic DNA; STD; PRO; 3416911 BP.
XX
AC   CU633749;
XX
PR   Project:PRJNA15733;
XX
DT   26-MAR-2008 (Rel. 95, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Cupriavidus taiwanensis str. LMG19424 chromosome 1, complete genome.
XX
KW   .
XX
OS   Cupriavidus taiwanensis
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Cupriavidus.
XX
RN   [1]
RP   1-3416911
RA   Genoscope;
RT   ;
RL   Submitted (07-JAN-2008) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-3416911
RX   DOI; 10.1101/gr.076448.108.
RX   PUBMED; 18490699.
RA   Amadou C., Pascal G., Mangenot S., Glew M., Bontemps C., Capela D.,
RA   Carrere S., Cruveiller S., Dossat C., Lajus A., Marchetti M., Poinsot V.,
RA   Rouy Z., Servin B., Saad M., Schenowitz C., Barbe V., Batut J., Medigue C.,
RA   Masson-Boivin C.;
RT   "Genome sequence of the beta-rhizobium Cupriavidus taiwanensis and
RT   comparative genomics of rhizobia";
RL   Genome Res. 18(9):1472-1483(2008).
XX
DR   MD5; 4919ea55288ce778c9ca21ea72df1abc.
DR   BioSample; SAMEA3138280.
DR   CABRI; LMG 19424.
DR   EnsemblGenomes-Gn; EBG00001170843.
DR   EnsemblGenomes-Gn; EBG00001170844.
DR   EnsemblGenomes-Gn; EBG00001170845.
DR   EnsemblGenomes-Gn; EBG00001170846.
DR   EnsemblGenomes-Gn; EBG00001170847.
DR   EnsemblGenomes-Gn; EBG00001170848.
DR   EnsemblGenomes-Gn; EBG00001170849.
DR   EnsemblGenomes-Gn; EBG00001170850.
DR   EnsemblGenomes-Gn; EBG00001170851.
DR   EnsemblGenomes-Gn; EBG00001170852.
DR   EnsemblGenomes-Gn; EBG00001170853.
DR   EnsemblGenomes-Gn; EBG00001170854.
DR   EnsemblGenomes-Gn; EBG00001170855.
DR   EnsemblGenomes-Gn; EBG00001170856.
DR   EnsemblGenomes-Gn; EBG00001170857.
DR   EnsemblGenomes-Gn; EBG00001170858.
DR   EnsemblGenomes-Gn; EBG00001170859.
DR   EnsemblGenomes-Gn; EBG00001170860.
DR   EnsemblGenomes-Gn; EBG00001170861.
DR   EnsemblGenomes-Gn; EBG00001170862.
DR   EnsemblGenomes-Gn; EBG00001170863.
DR   EnsemblGenomes-Gn; EBG00001170864.
DR   EnsemblGenomes-Gn; EBG00001170865.
DR   EnsemblGenomes-Gn; EBG00001170866.
DR   EnsemblGenomes-Gn; EBG00001170867.
DR   EnsemblGenomes-Gn; EBG00001170868.
DR   EnsemblGenomes-Gn; EBG00001170869.
DR   EnsemblGenomes-Gn; EBG00001170870.
DR   EnsemblGenomes-Gn; EBG00001170871.
DR   EnsemblGenomes-Gn; EBG00001170872.
DR   EnsemblGenomes-Gn; EBG00001170873.
DR   EnsemblGenomes-Gn; EBG00001170874.
DR   EnsemblGenomes-Gn; EBG00001170875.
DR   EnsemblGenomes-Gn; EBG00001170876.
DR   EnsemblGenomes-Gn; EBG00001170877.
DR   EnsemblGenomes-Gn; EBG00001170878.
DR   EnsemblGenomes-Gn; EBG00001170879.
DR   EnsemblGenomes-Gn; EBG00001170880.
DR   EnsemblGenomes-Gn; EBG00001170881.
DR   EnsemblGenomes-Gn; EBG00001170882.
DR   EnsemblGenomes-Gn; EBG00001170883.
DR   EnsemblGenomes-Gn; EBG00001170884.
DR   EnsemblGenomes-Gn; EBG00001170885.
DR   EnsemblGenomes-Gn; EBG00001170886.
DR   EnsemblGenomes-Gn; EBG00001170887.
DR   EnsemblGenomes-Gn; EBG00001170888.
DR   EnsemblGenomes-Gn; EBG00001170889.
DR   EnsemblGenomes-Gn; EBG00001170890.
DR   EnsemblGenomes-Gn; EBG00001170891.
DR   EnsemblGenomes-Gn; EBG00001170892.
DR   EnsemblGenomes-Gn; EBG00001170893.
DR   EnsemblGenomes-Gn; EBG00001170894.
DR   EnsemblGenomes-Gn; EBG00001170895.
DR   EnsemblGenomes-Gn; EBG00001170896.
DR   EnsemblGenomes-Gn; EBG00001170897.
DR   EnsemblGenomes-Gn; EBG00001170898.
DR   EnsemblGenomes-Gn; EBG00001170899.
DR   EnsemblGenomes-Gn; EBG00001170900.
DR   EnsemblGenomes-Gn; EBG00001170901.
DR   EnsemblGenomes-Gn; EBG00001170902.
DR   EnsemblGenomes-Gn; EBG00001170903.
DR   EnsemblGenomes-Gn; EBG00001170904.
DR   EnsemblGenomes-Gn; EBG00001170905.
DR   EnsemblGenomes-Gn; EBG00001170906.
DR   EnsemblGenomes-Gn; EBG00001170907.
DR   EnsemblGenomes-Gn; EBG00001170908.
DR   EnsemblGenomes-Gn; EBG00001170909.
DR   EnsemblGenomes-Gn; EBG00001170910.
DR   EnsemblGenomes-Gn; EBG00001170911.
DR   EnsemblGenomes-Gn; EBG00001170912.
DR   EnsemblGenomes-Gn; EBG00001170913.
DR   EnsemblGenomes-Gn; EBG00001170914.
DR   EnsemblGenomes-Gn; EBG00001170915.
DR   EnsemblGenomes-Gn; EBG00001170916.
DR   EnsemblGenomes-Gn; EBG00001170917.
DR   EnsemblGenomes-Gn; EBG00001170918.
DR   EnsemblGenomes-Gn; EBG00001170919.
DR   EnsemblGenomes-Gn; EBG00001170920.
DR   EnsemblGenomes-Gn; EBG00001170921.
DR   EnsemblGenomes-Gn; RALTA_A0421.
DR   EnsemblGenomes-Gn; RALTA_A0422.
DR   EnsemblGenomes-Gn; RALTA_A0911.
DR   EnsemblGenomes-Gn; RALTA_A1660.
DR   EnsemblGenomes-Gn; RALTA_A1661.
DR   EnsemblGenomes-Gn; RALTA_A1902.
DR   EnsemblGenomes-Gn; RALTA_A1903.
DR   EnsemblGenomes-Gn; RALTA_A2379.
DR   EnsemblGenomes-Gn; RALTA_A2381.
DR   EnsemblGenomes-Gn; RALTA_A_16S_1.
DR   EnsemblGenomes-Gn; RALTA_A_16S_2.
DR   EnsemblGenomes-Gn; RALTA_A_16S_3.
DR   EnsemblGenomes-Gn; RALTA_A_23S_1.
DR   EnsemblGenomes-Gn; RALTA_A_23S_2.
DR   EnsemblGenomes-Gn; RALTA_A_23S_3.
DR   EnsemblGenomes-Gn; RALTA_A_5S_1.
DR   EnsemblGenomes-Gn; RALTA_A_5S_2.
DR   EnsemblGenomes-Gn; RALTA_A_5S_3.
DR   EnsemblGenomes-Gn; RALTA_AfCDS935043R.
DR   EnsemblGenomes-Gn; RALTA_AtRNA1.
DR   EnsemblGenomes-Gn; RALTA_AtRNA10.
DR   EnsemblGenomes-Gn; RALTA_AtRNA11.
DR   EnsemblGenomes-Gn; RALTA_AtRNA12.
DR   EnsemblGenomes-Gn; RALTA_AtRNA13.
DR   EnsemblGenomes-Gn; RALTA_AtRNA14.
DR   EnsemblGenomes-Gn; RALTA_AtRNA15.
DR   EnsemblGenomes-Gn; RALTA_AtRNA16.
DR   EnsemblGenomes-Gn; RALTA_AtRNA17.
DR   EnsemblGenomes-Gn; RALTA_AtRNA18.
DR   EnsemblGenomes-Gn; RALTA_AtRNA19.
DR   EnsemblGenomes-Gn; RALTA_AtRNA2.
DR   EnsemblGenomes-Gn; RALTA_AtRNA20.
DR   EnsemblGenomes-Gn; RALTA_AtRNA21.
DR   EnsemblGenomes-Gn; RALTA_AtRNA22.
DR   EnsemblGenomes-Gn; RALTA_AtRNA23.
DR   EnsemblGenomes-Gn; RALTA_AtRNA24.
DR   EnsemblGenomes-Gn; RALTA_AtRNA25.
DR   EnsemblGenomes-Gn; RALTA_AtRNA26.
DR   EnsemblGenomes-Gn; RALTA_AtRNA27.
DR   EnsemblGenomes-Gn; RALTA_AtRNA28.
DR   EnsemblGenomes-Gn; RALTA_AtRNA29.
DR   EnsemblGenomes-Gn; RALTA_AtRNA3.
DR   EnsemblGenomes-Gn; RALTA_AtRNA30.
DR   EnsemblGenomes-Gn; RALTA_AtRNA31.
DR   EnsemblGenomes-Gn; RALTA_AtRNA32.
DR   EnsemblGenomes-Gn; RALTA_AtRNA33.
DR   EnsemblGenomes-Gn; RALTA_AtRNA34.
DR   EnsemblGenomes-Gn; RALTA_AtRNA35.
DR   EnsemblGenomes-Gn; RALTA_AtRNA36.
DR   EnsemblGenomes-Gn; RALTA_AtRNA37.
DR   EnsemblGenomes-Gn; RALTA_AtRNA38.
DR   EnsemblGenomes-Gn; RALTA_AtRNA39.
DR   EnsemblGenomes-Gn; RALTA_AtRNA4.
DR   EnsemblGenomes-Gn; RALTA_AtRNA40.
DR   EnsemblGenomes-Gn; RALTA_AtRNA41.
DR   EnsemblGenomes-Gn; RALTA_AtRNA42.
DR   EnsemblGenomes-Gn; RALTA_AtRNA43.
DR   EnsemblGenomes-Gn; RALTA_AtRNA44.
DR   EnsemblGenomes-Gn; RALTA_AtRNA45.
DR   EnsemblGenomes-Gn; RALTA_AtRNA46.
DR   EnsemblGenomes-Gn; RALTA_AtRNA47.
DR   EnsemblGenomes-Gn; RALTA_AtRNA48.
DR   EnsemblGenomes-Gn; RALTA_AtRNA49.
DR   EnsemblGenomes-Gn; RALTA_AtRNA5.
DR   EnsemblGenomes-Gn; RALTA_AtRNA50.
DR   EnsemblGenomes-Gn; RALTA_AtRNA51.
DR   EnsemblGenomes-Gn; RALTA_AtRNA52.
DR   EnsemblGenomes-Gn; RALTA_AtRNA53.
DR   EnsemblGenomes-Gn; RALTA_AtRNA54.
DR   EnsemblGenomes-Gn; RALTA_AtRNA55.
DR   EnsemblGenomes-Gn; RALTA_AtRNA56.
DR   EnsemblGenomes-Gn; RALTA_AtRNA57.
DR   EnsemblGenomes-Gn; RALTA_AtRNA6.
DR   EnsemblGenomes-Gn; RALTA_AtRNA7.
DR   EnsemblGenomes-Gn; RALTA_AtRNA8.
DR   EnsemblGenomes-Gn; RALTA_AtRNA9.
DR   EnsemblGenomes-Tr; EBT00001737569.
DR   EnsemblGenomes-Tr; EBT00001737571.
DR   EnsemblGenomes-Tr; EBT00001737573.
DR   EnsemblGenomes-Tr; EBT00001737575.
DR   EnsemblGenomes-Tr; EBT00001737576.
DR   EnsemblGenomes-Tr; EBT00001737578.
DR   EnsemblGenomes-Tr; EBT00001737579.
DR   EnsemblGenomes-Tr; EBT00001737583.
DR   EnsemblGenomes-Tr; EBT00001737585.
DR   EnsemblGenomes-Tr; EBT00001737587.
DR   EnsemblGenomes-Tr; EBT00001737588.
DR   EnsemblGenomes-Tr; EBT00001737589.
DR   EnsemblGenomes-Tr; EBT00001737591.
DR   EnsemblGenomes-Tr; EBT00001737592.
DR   EnsemblGenomes-Tr; EBT00001737593.
DR   EnsemblGenomes-Tr; EBT00001737594.
DR   EnsemblGenomes-Tr; EBT00001737596.
DR   EnsemblGenomes-Tr; EBT00001737598.
DR   EnsemblGenomes-Tr; EBT00001737601.
DR   EnsemblGenomes-Tr; EBT00001737603.
DR   EnsemblGenomes-Tr; EBT00001737604.
DR   EnsemblGenomes-Tr; EBT00001737607.
DR   EnsemblGenomes-Tr; EBT00001737608.
DR   EnsemblGenomes-Tr; EBT00001737609.
DR   EnsemblGenomes-Tr; EBT00001737610.
DR   EnsemblGenomes-Tr; EBT00001737611.
DR   EnsemblGenomes-Tr; EBT00001737612.
DR   EnsemblGenomes-Tr; EBT00001737613.
DR   EnsemblGenomes-Tr; EBT00001737614.
DR   EnsemblGenomes-Tr; EBT00001737615.
DR   EnsemblGenomes-Tr; EBT00001737617.
DR   EnsemblGenomes-Tr; EBT00001737618.
DR   EnsemblGenomes-Tr; EBT00001737619.
DR   EnsemblGenomes-Tr; EBT00001737620.
DR   EnsemblGenomes-Tr; EBT00001737621.
DR   EnsemblGenomes-Tr; EBT00001737624.
DR   EnsemblGenomes-Tr; EBT00001737626.
DR   EnsemblGenomes-Tr; EBT00001737628.
DR   EnsemblGenomes-Tr; EBT00001737630.
DR   EnsemblGenomes-Tr; EBT00001737632.
DR   EnsemblGenomes-Tr; EBT00001737634.
DR   EnsemblGenomes-Tr; EBT00001737636.
DR   EnsemblGenomes-Tr; EBT00001737638.
DR   EnsemblGenomes-Tr; EBT00001737640.
DR   EnsemblGenomes-Tr; EBT00001737642.
DR   EnsemblGenomes-Tr; EBT00001737643.
DR   EnsemblGenomes-Tr; EBT00001737644.
DR   EnsemblGenomes-Tr; EBT00001737645.
DR   EnsemblGenomes-Tr; EBT00001737646.
DR   EnsemblGenomes-Tr; EBT00001737647.
DR   EnsemblGenomes-Tr; EBT00001737649.
DR   EnsemblGenomes-Tr; EBT00001737651.
DR   EnsemblGenomes-Tr; EBT00001737652.
DR   EnsemblGenomes-Tr; EBT00001737653.
DR   EnsemblGenomes-Tr; EBT00001737656.
DR   EnsemblGenomes-Tr; EBT00001737657.
DR   EnsemblGenomes-Tr; EBT00001737659.
DR   EnsemblGenomes-Tr; EBT00001737660.
DR   EnsemblGenomes-Tr; EBT00001737661.
DR   EnsemblGenomes-Tr; EBT00001737662.
DR   EnsemblGenomes-Tr; EBT00001737663.
DR   EnsemblGenomes-Tr; EBT00001737664.
DR   EnsemblGenomes-Tr; EBT00001737665.
DR   EnsemblGenomes-Tr; EBT00001737667.
DR   EnsemblGenomes-Tr; EBT00001737668.
DR   EnsemblGenomes-Tr; EBT00001737670.
DR   EnsemblGenomes-Tr; EBT00001737671.
DR   EnsemblGenomes-Tr; EBT00001737673.
DR   EnsemblGenomes-Tr; EBT00001737675.
DR   EnsemblGenomes-Tr; EBT00001737678.
DR   EnsemblGenomes-Tr; EBT00001737680.
DR   EnsemblGenomes-Tr; EBT00001737682.
DR   EnsemblGenomes-Tr; EBT00001737684.
DR   EnsemblGenomes-Tr; EBT00001737686.
DR   EnsemblGenomes-Tr; EBT00001737688.
DR   EnsemblGenomes-Tr; EBT00001737689.
DR   EnsemblGenomes-Tr; EBT00001737691.
DR   EnsemblGenomes-Tr; EBT00001737692.
DR   EnsemblGenomes-Tr; EBT00001737695.
DR   EnsemblGenomes-Tr; RALTA_A0421.
DR   EnsemblGenomes-Tr; RALTA_A0422.
DR   EnsemblGenomes-Tr; RALTA_A0911.
DR   EnsemblGenomes-Tr; RALTA_A1660.
DR   EnsemblGenomes-Tr; RALTA_A1661.
DR   EnsemblGenomes-Tr; RALTA_A1902.
DR   EnsemblGenomes-Tr; RALTA_A1903.
DR   EnsemblGenomes-Tr; RALTA_A2379.
DR   EnsemblGenomes-Tr; RALTA_A2381.
DR   EnsemblGenomes-Tr; RALTA_A_16S_1-1.
DR   EnsemblGenomes-Tr; RALTA_A_16S_2-1.
DR   EnsemblGenomes-Tr; RALTA_A_16S_3-1.
DR   EnsemblGenomes-Tr; RALTA_A_23S_1-1.
DR   EnsemblGenomes-Tr; RALTA_A_23S_2-1.
DR   EnsemblGenomes-Tr; RALTA_A_23S_3-1.
DR   EnsemblGenomes-Tr; RALTA_A_5S_1-1.
DR   EnsemblGenomes-Tr; RALTA_A_5S_2-1.
DR   EnsemblGenomes-Tr; RALTA_A_5S_3-1.
DR   EnsemblGenomes-Tr; RALTA_AfCDS935043R.
DR   EnsemblGenomes-Tr; RALTA_AtRNA1-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA10-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA11-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA12-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA13-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA14-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA15-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA16-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA17-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA18-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA19-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA2-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA20-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA21-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA22-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA23-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA24-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA25-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA26-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA27-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA28-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA29-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA3-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA30-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA31-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA32-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA33-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA34-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA35-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA36-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA37-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA38-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA39-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA4-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA40-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA41-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA42-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA43-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA44-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA45-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA46-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA47-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA48-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA49-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA5-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA50-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA51-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA52-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA53-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA54-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA55-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA56-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA57-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA6-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA7-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA8-1.
DR   EnsemblGenomes-Tr; RALTA_AtRNA9-1.
DR   EuropePMC; PMC2527706; 18490699.
DR   EuropePMC; PMC4777769; 26941158.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CU633749.
DR   SILVA-SSU; CU633749.
DR   StrainInfo; 49173; 1.
XX
CC   Annotation data relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny results (Syntonizer software) are available in
CC   the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3416911
FT                   /organism="Cupriavidus taiwanensis"
FT                   /strain="LMG19424"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:164546"
FT   gene            707..2476
FT                   /gene="dnaA"
FT                   /locus_tag="RALTA_A0001"
FT   CDS_pept        707..2476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="RALTA_A0001"
FT                   /product="chromosomal replication initiator protein DnaA,
FT                   DNA-binding transcriptional dual regulator"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10749858; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62674"
FT                   /db_xref="GOA:B2AFZ7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AFZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62674.1"
FT                   /translation="MQDFWQAAAAQLERELTPQQFKTWIKPLAPVAFDEETHALRIAAP
FT                   NRFKLDWVKSQFSGRITALACEYWEAQVSVQFVLDPAASGRAAAYMQPAQPGMGAGGMD
FT                   RMDHHAAPGTGMGGYPGAQPAQTMGGQAPFAMPGQPAQPGYGEYPTAAAYGLGQPQYGH
FT                   PTGNPAGMPSAAPVPAGARGQGMGQHPGQHHPQHNAELGEIDVVQMDPAEASARSYRAP
FT                   QQGQHPHAAMGNGAAQMPGHQPSDTVHERSRLNPILTFDNFVTGKANQLARAAAIQVAN
FT                   NPGKSYNPLYLYGGVGLGKTHLIHSIGNHMLMENPRARIRYIHAEQYVSDVVKAYQRKA
FT                   FDEFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITG
FT                   IDDRLISRFDSGLTVAIEPPELEMRVAILMKKAAAENVNVPEEVAFFVAKHLRSNVREL
FT                   EGALRKILAFSNFHGKDITIEVTREALKDLLTVQNRQISVENIQKTCADFYNIKVADMY
FT                   SKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQL
FT                   NHELHVLEQTLKG"
FT   gene            2901..4016
FT                   /gene="dnaN"
FT                   /locus_tag="RALTA_A0002"
FT   CDS_pept        2901..4016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="RALTA_A0002"
FT                   /product="DNA polymerase III, beta-subunit"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1575709; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62675"
FT                   /db_xref="GOA:B2AFZ8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62675.1"
FT                   /translation="MQLVKTSRDNLLRPLQIVSGIVERRHTLPILANLLIRKSGSNVSF
FT                   LSTDIEIQITTHAECGVGNDSVATTVAARKLLDILRAMPDGDVALSLNDKRMTVQSGKS
FT                   RFALQTLAAEEFPTVAEASEFNASVSLPQKTFKHLLAMVHFAMAQQDIRYYLNGMLLVV
FT                   EGKKVMAVATDGHRLAYCGVELENEAAGVGSRQEVIIPRKTILELQRLLEDNDDPVTVQ
FT                   LAANQVKFTFANIELISKLVEGKFPDFQRVIPKGYKNAFAIDRVQLQQALQRTAILTTD
FT                   KFKGVRCILDTHMLKISSTNADQEEAQEELELDYSGDALDIGFNVTYLLDVLANLKTEQ
FT                   VQVSLGDSNSSALITVPDDDNFKYVVMPMRI"
FT   gene            4270..6795
FT                   /gene="gyrB"
FT                   /locus_tag="RALTA_A0003"
FT   CDS_pept        4270..6795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="RALTA_A0003"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /function="2.1.1 : DNA replication"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.1.1 : DNA bending, supercoiling, inversion"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2174443; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62676"
FT                   /db_xref="GOA:B2AFZ9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62676.1"
FT                   /translation="MTEQQNPQQENTYGASSIQILEGLEAVRKRPGMYIGDTSDGTGLH
FT                   HLVFEVLDNSIDEALAGYCTEIQVTIHSDNSISIVDNGRGIPPLVKFDDKHEPKRSAAE
FT                   IAMTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSKWLRLTVRRDGQVHLIEFAKGEVQ
FT                   NRIIETVDGPDGQPVEVSPMKITGATDKRGTEVHFLADEEIFTNVEFHYEVLSKRIREL
FT                   SFLNNGVHIKLTDQRTGKEEDFAFSGGVKGFVEYINRAKTTLHPNIFYANAEKDGIAVE
FT                   VAMQWNDGYNEQVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIEENEIAKKAKVETSG
FT                   DDMREGLACVLSVKVPEPKFSSQTKDKLVSSEVRLPVEELVSKALTDFLLETPADAKTI
FT                   CGKIVDAARAREAARKAREMTRRKGVMDGMGLPGKLADCQEKDPAQSELFLVEGDSAGG
FT                   SAKQGRDRKFQAILPLKGKILNVERARFDKMLSSQEVLTLITALGTGIGKDDYNLDKLR
FT                   YHRIIIMTDADVDGSHIRTLLLTFFYRQMPDIIERGYVYIAQPPLYKIKHGKEERYIKD
FT                   DVELNAYLLKLAMEKASLVRPDGSEISGDALTELARQYQLTEGVIGRLSRVVDTDALRA
FT                   IADGVTLDLDSAAAAEASAVALKAKLAEMHAKTLIGAAVNDDGTADVYAQFDEKTDKHR
FT                   LMIARRHHGNVRLSHLDADFVHGADYAALSNAAKTFQGLTPEGTKVQRGEGDKLRDQTV
FT                   NDFHGAMQWLLAEAERGVSRQRYKGLGEMNPEQLFETTLDVTQRRLLKVQIEDAIAADQ
FT                   IFTTLMGDEVEPRRNFIESNALVARNIDV"
FT   gene            7033..7401
FT                   /locus_tag="RALTA_A0004"
FT   CDS_pept        7033..7401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0004"
FT                   /product="putative Type I restriction enzyme R fragment
FT                   (HSDR), N_term motif"
FT                   /function="2.1.2 : DNA restriction/modification"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62677"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62677.1"
FT                   /translation="MTENQNPEQKARDNIDALLKQAGWVVQSAKRIDFGAGLGIAVREY
FT                   QTDVGPADYVLLVDKKAVGVIEAKKEDLGHKITEVEQQTEGYAAAKLKWVNNKEPLPFL
FT                   YESTGIITGSVRNFVFRA"
FT   gene            7422..8681
FT                   /locus_tag="RALTA_A0005"
FT   CDS_pept        7422..8681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0005"
FT                   /product="Transposase of insertion sequence ISRta2, IS256
FT                   family"
FT                   /function="8.3.1 : transposases"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62678"
FT                   /db_xref="GOA:B2AG01"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62678.1"
FT                   /translation="MPRKTKTSLAADRELPTIPEDLIAHFVKGPMTAEAVQDASMAFKK
FT                   ALIERALGAELGHHLGYPPGAERPAGTANQRNGKSAKTVLTEDGPLRVDIPRDRDGSFD
FT                   PILIPKHERRFTGFDDKIIAMYARGMTVREIQAFLAEQYGTEVSPEFISSVTDAVMDEV
FT                   TTWQARPLEVMYPVVFFDALRVKMREDGVVRNKAVYLALGVLPDGTRDILGLWIENTEG
FT                   AKFWMKVFNDLKTRGTQDILIAVTDGLKGMEQALNAVFPHTTLQTCIVHLIRNSLEYVS
FT                   WKERREVAAALKPVYTAPTVEAALAELAAFEQGKWGQQYKPIAASWHRAWDQVIPFFTF
FT                   PPAIRKIIYTTNAIESINAQLRKIIKTRGHFPSDEAATKLLWLALRNITGKWGSSTHDW
FT                   KAAMNQFAILYEERFAHPHR"
FT   gene            complement(8773..9159)
FT                   /locus_tag="RALTA_A0006"
FT   CDS_pept        complement(8773..9159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0006"
FT                   /product="conserved hypothetical protein, DUF350; putative
FT                   transmembrane protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62679"
FT                   /db_xref="GOA:B2AG02"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62679.1"
FT                   /translation="MHPALAYLIYIATSFAMLGLFLLVYTRVTPHREFTLIREGNIAAA
FT                   LSLGGAVLGFSLTLSSSIQHNATFAMFLLWAFGAFAVQVVAYLVAARALGGVSEAISSD
FT                   NRGMGAVMGVISLSVGVVNAACLT"
FT   gene            complement(9231..9953)
FT                   /locus_tag="RALTA_A0007"
FT   CDS_pept        complement(9231..9953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0007"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62680"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62680.1"
FT                   /translation="MANKKKGTKRSKYGSPYMPGRGGSGGPSPRIAAYQAEQKKQGSSP
FT                   ALWIVGACAVVAGVAVLGSCSDDADDDPGVTVRRASYATLEDCEADWNTPNDCESVPID
FT                   DPSTIYSSSLNAPASETAGSGTTHGSSAYYARWYGPYYTASGTVYHPNGTQTQRDMTSG
FT                   PLRPMQVYDRNGTPTQSFTTATPRAAMVEEATVRRSTLGGGRSIGLTMRSAAVSRAPVV
FT                   SRGGFTSRFGSSGRSGGG"
FT   gene            complement(9957..11132)
FT                   /gene="gsp"
FT                   /locus_tag="RALTA_A0008"
FT   CDS_pept        complement(9957..11132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsp"
FT                   /locus_tag="RALTA_A0008"
FT                   /product="Bifunctional glutathionylspermidine
FT                   synthetase/Glutathionylspermidine amidase"
FT                   /function="1.5.3.10 : Glutathione"
FT                   /EC_number="6.3.1.8"
FT                   /EC_number="3.5.1.78"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7775463; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62681"
FT                   /db_xref="GOA:B2AFX6"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62681.1"
FT                   /translation="MQRIPQTPRRNWPRELEKVGFHFHSLDEFNVPREVDDHTFFYWRE
FT                   DAAYAFSKQEVETLYAAAYDLNQRCLEAVQHVIDHDLFARLAIDADFAQLIRTSWDRDE
FT                   PTLFGRFDMTLDPHGVPKLYEFNADTPTSLIESAVAQWYWKDAVQPQADQFNSLHDALV
FT                   ARWQWLRNHYRNASLLHLACMFDSQEDVCNTEYLMDTALQAGWSVKLIDLQDIGTDGRG
FT                   NFYDADNVPMEVVFKLYPWEWMATSDYRDQLAHSPVRWVEPPWKAVLSNKAILPILWDL
FT                   FPGHPNLIEASFDPGHFAGKPHAKKPFLSREGESVTLLTPEGDRVHNPGEYGEEGFIYQ
FT                   AYEPARRFDGRYTTLGVWIVDDVPSGLCVREESGPIAKNTSFFVPHYFTHA"
FT   gene            complement(11132..12586)
FT                   /locus_tag="RALTA_A0009"
FT   CDS_pept        complement(11132..12586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0009"
FT                   /product="Homospermidine synthase (HSS)"
FT                   /function="1.7.32 : Putrescine catabolism"
FT                   /EC_number="2.5.1.44"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8841401; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62682"
FT                   /db_xref="GOA:B2AFX7"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR023181"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62682.1"
FT                   /translation="MCRRGRVRDRPCRFSGGRVCVIEQIVIVGFGCIGQAVLPLLELAW
FT                   PRAAITVVDRVLDRARQELVARHKLQAIQATITAGNYETMLVPLLRPGAFLLNLAPSVC
FT                   SRDLIALAQAHGAFYVDAGIEPWDYTADPRASHLSNYALRHEMLAFARGREALPTALVA
FT                   HGANPGLVSVLVKAALMALAGKAGLNQPEPGDRAAWAALARALDVRVIQVAEYDSQQAP
FT                   GYPRDGEFANTWSAEGFITECLQDAELGWGSHEPALPPDGYRHSYGSGAAIALDRPGHR
FT                   TRVRSWSPVHGPFDACLITHNESISIAEYLTDTRAGQPLYRPTVYYAYRPTAATQASMQ
FT                   WLDDRAAPRVRGERILRDEIQCGEDELGVLLMSGRHGAVWHGSRLSVQRARSLAPYNTA
FT                   TSLQVASSLVAGMQWMLAHPSRGVVESDALDFGPVLADAAHWWAPLGIAFTDWLPHPGA
FT                   AALAFTDFLLDDTQVQPDSSLLTLAC"
FT   gene            complement(12702..13652)
FT                   /locus_tag="RALTA_A0010"
FT   CDS_pept        complement(12702..13652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0010"
FT                   /product="Formimidoylglutamase"
FT                   /function="1.1.3.11 : Histidine degradation"
FT                   /EC_number="3.5.3.8"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62683"
FT                   /db_xref="GOA:B2AFX8"
FT                   /db_xref="InterPro:IPR005923"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62683.1"
FT                   /translation="MRMAVTQNPWQGRVDHGEQGDTTRLFRIVQALDTADTAPLDHAPV
FT                   LLGFRCDAGVLRNQGRPGAAHGPDAIRQALANVPAHGLQALYDAGNVSCDDGDLESAQQ
FT                   ALADAVHAVLARGGFPLVLGGGHEVAWGTWQGLRAHLDAQHDDGRVLIVNIDAHFDLRT
FT                   SRPASSGTPFDQIAHACAERGQPFDYVCLGVSRLANTPALFGRAEALGVCYVEDVDMQE
FT                   RHLAARLAELSARIDAADHVYLTIDLDALPGAVMPGVSAPAAYGVPLPVVEEVVGLVRR
FT                   SGKLRVADLAEYNPQYDRDHLGARVAARLAWRLLR"
FT   gene            complement(13649..14410)
FT                   /gene="glnQ"
FT                   /locus_tag="RALTA_A0011"
FT   CDS_pept        complement(13649..14410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="RALTA_A0011"
FT                   /product="high-affinity glutamine transport protein, ABC
FT                   transporter, ATP binding component"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /function="7.1 : Cytoplasm"
FT                   /function="1.5.1.2 : Glutamine"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62684"
FT                   /db_xref="GOA:B2AFX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62684.1"
FT                   /translation="MSDSAIIRIRNLGKSFGSHTVLRGIDFDVEPSQVVVVIGPSGSGK
FT                   STFLRCCNGLEQPEAGTIDIVGKRLVTDGQLIDEQGLNQLRTEVGMVFQSFNLFPHLSV
FT                   LHNVTVGPRMLRGVSRDDAERKAISLLEKVGLAHKAHAMPASLSGGQKQRVAIARALAM
FT                   EPRVMLFDEPTSALDPELVGEVLQVMKVLAAEGMTMVVVTHEMGFAREVADVVVVMDGG
FT                   GIIEAGPPSVIFSAPTQERTRGFLQAVLTRA"
FT   gene            complement(14407..15075)
FT                   /gene="glnP"
FT                   /locus_tag="RALTA_A0012"
FT   CDS_pept        complement(14407..15075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="RALTA_A0012"
FT                   /product="high-affinity glutamine transport protein, ABC
FT                   transporter, membrane component"
FT                   /function="1.5.1.2 : Glutamine"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62685"
FT                   /db_xref="GOA:B2AFY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62685.1"
FT                   /translation="MELDFSPVFAGWPDILHGAVITVQVTACALVLGCVMGLLVGIGRL
FT                   DPKRRVIYGICTAYVTFIRGTPLLVQLFLLFFGLPQFNILLPAFVCGVIGLGIYSGAYV
FT                   SEIVRGAIQSVDKGQMEAARSIGMSSGQAMRAIILPQAIVRMIPPLGNEFIALIKNSAL
FT                   VSLLTIADLMHEGQKIISVSYRSLEVYLAIALVYLILTSAAGLILRRAEQRLRMGGMVQ
FT                   "
FT   gene            complement(15094..15849)
FT                   /gene="glnH"
FT                   /locus_tag="RALTA_A0013"
FT   CDS_pept        complement(15094..15849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="RALTA_A0013"
FT                   /product="high-affinity glutamine transport protein, ABC
FT                   transporter, periplasmic binding component peri_bind)"
FT                   /function="1.5.1.2 : Glutamine"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /function="7.2 : Periplasmic space"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62686"
FT                   /db_xref="GOA:B2AFY1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62686.1"
FT                   /translation="MNLRRKCLIAALSAVAGLTFGASAHAQDSNVLRVATDATFPPMEF
FT                   IENGKRTGFDVELVEAMAKTMGKQVEWTNIDFKGLIPGLVSRRFDMAVSGIYITPERRK
FT                   VVDFTEPYYTGGLVALVKSGNTAINKPEDLNGKKVSVQVGTKSVSFLRDTYPQVTRVEV
FT                   EKNQEMFNLVEIGRADAAVTGKPAAMQYVKTRGGLRVVEQQLTTEEYGMAVRKDTPELT
FT                   RALNAALAKVKADGTYAKLTQKWFGSAAK"
FT   gene            complement(15930..16724)
FT                   /locus_tag="RALTA_A0014"
FT   CDS_pept        complement(15930..16724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0014"
FT                   /product="putative transcriptional regulator, IclR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62687"
FT                   /db_xref="GOA:B2AFY2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62687.1"
FT                   /translation="MLNAVDPTIAPQPASPTSTESAQPAGGADRVLFVLAALAHHGAPI
FT                   TVRELVARTGLPKSTLYRQLMLLKRWGFVLESDGEYAPGPISLQLALGFDMASHLAREA
FT                   LPDMRLLAQQSDESVGLVVAVKDHAVCLEMVESRQSLRCSFEKGRGVPLRAGASAKSLL
FT                   AFMRDDARERVVRAQCEPAEAEQLLAELAAIRATGYAVSEGEVDPGVWGVSAPLFSRRA
FT                   KADALGSITLMVPATRRQGRESALIDMTVAAAMRISARLQSY"
FT   gene            complement(16859..17518)
FT                   /locus_tag="RALTA_A0015"
FT   CDS_pept        complement(16859..17518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0015"
FT                   /product="Putative isoprenylcysteine carboxyl
FT                   methyltransferase transmembrane protein"
FT                   /function="2.3.3 : Posttranslational modification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62688"
FT                   /db_xref="GOA:B2AFY9"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62688.1"
FT                   /translation="MRPTPGLTMATLAGTLAYLAIAIAGWGGPGPFFAHPARIALALVL
FT                   FALAIAAVFSGGNVSSGMREDRGNRWVLAVFGVLGLLAAYLPPFTDRLGVWTIDGDTMR
FT                   WAGVAMFAGGGVLRLWPVFVLGNRFSGLVAIQPGHTLVTTGIYGVIRHPSYLGFLTSSL
FT                   GWGLAFRSGVGVVLTLLMVPPLLARIRAEEALLRDQFGEAYASYCARTWRMLPGIY"
FT   gene            17664..17987
FT                   /locus_tag="RALTA_A0016"
FT   CDS_pept        17664..17987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62689"
FT                   /db_xref="GOA:B2AFZ0"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62689.1"
FT                   /translation="MPLIDIKNLQQAAYDFGEARHWGKYHSPKNLAMALSVEVSELVEI
FT                   FQWQTEDESRAIMSTPKREHVEQELADITIYLAQLVTALGVDLDAAVRAKMEINARKYP
FT                   VPE"
FT   gene            complement(18007..18507)
FT                   /locus_tag="RALTA_A0017"
FT   CDS_pept        complement(18007..18507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0017"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62690"
FT                   /db_xref="GOA:B2AFZ1"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62690.1"
FT                   /translation="MLLHATVIGTGATLVMDAWAIVRKRLLGVPALNYGLVGRWLAWLP
FT                   RGRFHHHAIAATHPVRGEQAIGWIAHYLTGIAFAGILLGLWGLDWARQPTLAPALIVGI
FT                   GSVAAPFLLMQPAMGAGIAASRTPQPYVARMHSLVTHAVFGMGLYGAGWLARLIADPNW
FT                   SLA"
FT   gene            complement(18521..19414)
FT                   /locus_tag="RALTA_A0018"
FT   CDS_pept        complement(18521..19414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0018"
FT                   /product="conserved hypothetical protein; putative
FT                   methyltransferase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62691.1"
FT                   /translation="MGEQQQISGNGGEQAALWNGVSGQAWVEHQGLLDDMFRPMEAQLV
FT                   QAARNAAAQRILDVGCGTGSTTLALARHIGAQGHCTGVDISGPMLAVARTRAQREGINA
FT                   SFIHADAQEHAFAAASFDMIVSRLGVMFFSDPVRAFANLRRAATSDATLHCIAWRSAAE
FT                   NPFMTTAERAAAPLLPNLPPRQPGAPGQFAFGNRERVLSILQTSGWGDIDIRPTDVTCT
FT                   LPEPALAGYLSRLGPVGLALQGADPTTRERVAATVRAAFDPYVQGDTVRYTAACWTITA
FT                   RATAAATPRRQDTNHA"
FT   gene            19479..19922
FT                   /locus_tag="RALTA_A0019"
FT   CDS_pept        19479..19922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0019"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62692"
FT                   /db_xref="GOA:B2AFY4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62692.1"
FT                   /translation="MRSLDIAEVARQAGVPASTLRYYEEKGLIVSIGRRGMRRVFDAGV
FT                   LERLALIALGRAAGFSLDDIAQMFSPQGQPRIDRQMLAAKADELDRTIRKLTAMRDGLR
FT                   HAAVCPAPSHMECPTFQRIVRAASTGAIGGRRERPAVPPAKAR"
FT   gene            complement(19935..21734)
FT                   /locus_tag="RALTA_A0020"
FT   CDS_pept        complement(19935..21734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0020"
FT                   /product="putative METHYL-ACCEPTING CHEMOTAXIS
FT                   TRANSMEMBRANE receptor"
FT                   /function="5.3 : Motility (incl. chemotaxis, energytaxis,
FT                   aerotaxis, redoxtaxis)"
FT                   /function="3 : Regulation"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62693"
FT                   /db_xref="GOA:B2AFY5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62693.1"
FT                   /translation="MFTTIRARIVALCVAIVVAALAINTALNQFVANRHNEDAIDSSLA
FT                   AVQSGHASAIVDWVASHSRMIESLQDAVLQPEPDAALRQIAQAGGFTNVYVGYADKTAK
FT                   FSNPQGIPPGYDPTGRPWYQQAAAAGKPVVTPPYVDAGTGKLVVAFAAPVVRDGSVQAV
FT                   VSGDVAMDTVITNVKAIHPSPASFGMLVARNGDIVAHTDDKLTLKPVTDLVPALGADKL
FT                   AALAGAKTPLEVDVRGSAKLLGARAIPGTDWLVIVALDKAEATAGMRSVLIASVIALVL
FT                   IAGVAAAVVWGVATMSLRGLSTVRDAMDAIGSGDGDLTQRLPANGNDEVAQIARAFNTF
FT                   ADKLCTIMRQIRDASASVRAAADEIAAGNMDLSRRTESAAASLQQTAASMEEITATVGQ
FT                   SANSAQHANDSVAAASRVAADGGVVIGDVISTMGQIETASVKVSDIIGVIEGIAFQTNI
FT                   LALNAAVEAARAGDQGRGFAVVAGEVRALAQRSAQAAREIKTLIETTVGSVASGSEQVR
FT                   RAGDTMGEIVSNVSKVTGIISEITHAAMEQTRGIQEVNMAVSQLDQMVQQNAALVEQST
FT                   AAAAALQTQAGSLAGAVGQFRLD"
FT   gene            22066..23244
FT                   /locus_tag="RALTA_A0021"
FT   CDS_pept        22066..23244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0021"
FT                   /product="putative lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62694"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62694.1"
FT                   /translation="MRLLALSGVLALAACGGGGGDDGGDAGRGTLQVSMTDAPACGFSN
FT                   VFVTVNKVRVHSSASADTSAGGWVDIDVVPARKIDLLSLTNGVMTVLGQTALPAGNYQQ
FT                   VRLVLDANRGGGASALANSVVPVGGAEQPLDTPSAVQSGIKINRSFSVARGTLTDLVLD
FT                   FDACKSVVRRGNGTFGLKPVVTAIPMTVSGEVNGVVAAAPGARVYAERNGVVVKSTVAD
FT                   ANGSFRLSPIEQSSTAGPVDVVVVPGAANAKAAGIVRGVPVVVGTPTAISTAAAPMTLP
FT                   ASTYRRVSGTVAPASAEATLRALQLVSGGTFEIAATAAASDTGAYSLFATEPALPVAAP
FT                   VVGTYQAALPIPLSADGAAAGKYSIQATSVSGAVQTQPADVNIADVLLNFSF"
FT   gene            23386..24321
FT                   /locus_tag="RALTA_A0022"
FT   CDS_pept        23386..24321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0022"
FT                   /product="conserved hypothetical protein, DUF72; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62695"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62695.1"
FT                   /translation="MPARTAAKAASTPAAASAAASGAPSKTPSAAPSRKAAAPAGLVRV
FT                   GIGGWNYAPWRDNFYPAKLPQSRELAYASRHLSAIEINSTYHGTQKRTSFAKWRDETPD
FT                   DFVFAVKASRFATNRRVLAEAGDSIARFIDSGIAELGRKLGPVVWQFAPTKQFDAEDFE
FT                   AFLQLLPASVEGVSLRHVLEVRHDSFLSPDYLALARKYKAATVFTDSRKFPSMADLTAD
FT                   FVYARLMESSEKLKTGYGPKALDQWAARARSWAQGAQPDDLPVLGDRQPTARQREVFLF
FT                   FINGAKERAPAAAQALLERLGWTPPADAAA"
FT   gene            24344..25753
FT                   /gene="dbpA"
FT                   /locus_tag="RALTA_A0023"
FT   CDS_pept        24344..25753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="RALTA_A0023"
FT                   /product="ATP-dependent RNA helicase, stimulated by 23S
FT                   rRNA"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="6.6 : Ribosome"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15173385; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62696"
FT                   /db_xref="GOA:B2AFY8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62696.1"
FT                   /translation="MNSTPAQPPAGPAFSALPLSPAMLATLAQLGYDEMTPIQAASLPI
FT                   TLAGQDLVAQAKTGSGKTAAFGLALLHRLDPRRFDVQAMVLCPTRELADQVTQEIRRLA
FT                   RAEENVKVLTLCGGSPMRPQVDSLIHGAHIVVGTPGRILDHIDRGSLDLAAINTLVLDE
FT                   ADRMLDMGFFDDIAYVASRCPRDRQTLLFSATYPPGIDKLSHRFLRNPQSLKLEATHDN
FT                   TTIRQRFYEVEESERLNAVGRLLDHFRPASTLAFCNTKARCRDLVELLRAQGYQALALH
FT                   GELEQRERDQVLVQFANRSCSVLVATDVAARGLDIAQLEAVINVEITPDPEVHVHRIGR
FT                   TGRADQEGWAFSLVSMDEMGRVGNLEQHHGGEFEWHPLAELTPASSERLLAPMVTLQML
FT                   GGRKEKIRPGDILGALTGEAGFAKEQIGKINVLEMSTYIAVERSIGREAVKRLNAGKVK
FT                   GKKVKVRMLTE"
FT   gene            25908..26348
FT                   /locus_tag="RALTA_A0024"
FT   CDS_pept        25908..26348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0024"
FT                   /product="conserved hypothetical protein, CBS domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62697"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62697.1"
FT                   /translation="MKTARQVLESKPSQAIYSIPPTATVYAALQLMAEKGIGALLVIEH
FT                   GEIKGILSERDYARKVILMQRTSRETLVRDIMTTAVIYVSANQTTDECMALMTRHRLRH
FT                   LPVMEGNQLIGMLSIGDLVKDIISEQQFIIEQLEHYITGGGR"
FT   gene            26521..28146
FT                   /locus_tag="RALTA_A0025"
FT   CDS_pept        26521..28146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0025"
FT                   /product="putative transporter, MSF family; putative Drug
FT                   resistance transporter EmrB/QacA subfamily"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62698"
FT                   /db_xref="GOA:B2AFZ3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62698.1"
FT                   /translation="MLSPHIAAALCLPMSSPASAGSTAPAVSSRPDPASALPVHDHRAV
FT                   MRVIGGIVLCILLAALDQTVVIPAVPAIANDLNGFGHLSWIVTAYLIVSTVTTPLYGKL
FT                   SDSFGRRRLLMVAITLFIGASVACALAQTLGQLILFRALQGVGGGGLMSLAQAAIADVV
FT                   APRQRGRYQGYLATVWAVASIAGPLVGGWVSDHMSWRWLFWVNVPLGLLAMFMCYRGLA
FT                   MLPARGGRARVDWLGALLLAVAIVAFLLAMSWGGDVYDWLSPELGALLLAAVAAVLLLT
FT                   WQERRAADPMLPPRLFANRAYVLGVAASALAALDIFLCIFALPLHFQLVRGADASTSGL
FT                   LVMPFLLATVAGNFIVAWLAPRVGRLRGILTAGYIAGALGLIVLALVTPAVPLAVVLAA
FT                   MTLAGVGLGITMVATLMSVQNALERRDTGAGTGALLVLRSLGSALGGAVAGTLLTLEFR
FT                   HALAASGVTQALDLGALRHGSEAFAQLSPSVRAVLAGGVESGFHLIFAVGAAAAVLALL
FT                   IVRRMPDVELRSSVTEHAATLAMD"
FT   gene            28229..28858
FT                   /locus_tag="RALTA_A0026"
FT   CDS_pept        28229..28858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0026"
FT                   /product="putative glutathione peroxydase"
FT                   /function="5.5.6 : Other stresses (mechanical, nutritional,
FT                   oxidative)"
FT                   /EC_number="1.11.1.9"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62699"
FT                   /db_xref="GOA:B2AFZ4"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62699.1"
FT                   /translation="MSRRPLPFRLSVPLAAALTLAAASGALLPAPLRAADKPATSTVPA
FT                   AAGACPASLNFTFPRLQDDAPQNLCQYAGKVVLVVNTASYCGFTPQYEGLEALYAKYNA
FT                   RGLVVLGFPSNDFSQEPGSQKEIADFCYNTYGVKFPMLGKSHVRGSEANPMYALLAKQT
FT                   GTAPKWNFYKYLIGRDGKVVASYGSRTTPDDKELVAKIESLLAAPR"
FT   gene            complement(28887..29513)
FT                   /gene="gst"
FT                   /locus_tag="RALTA_A0027"
FT   CDS_pept        complement(28887..29513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="RALTA_A0027"
FT                   /product="glutathionine S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62700"
FT                   /db_xref="GOA:B2AFZ5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62700.1"
FT                   /translation="MKLYYTPGVCSMAVHIALREAGLPVTLAKVDLHTHKLAVPENGTD
FT                   DYYTINPRGYVPLLQLDDGSRHTEVASLLQYVADLVPERKLLPAAGTRERLEATGWITL
FT                   VSTELHKVFSPWLWHKETAQSTQDECKAKLQRRFAELDQHLQTRQYLTGDTFTVADAYC
FT                   FTIVGWARILKLPLNDYPALQQYLSRVAARPAVQEAMRAEGLVRD"
FT   gene            complement(29655..30383)
FT                   /locus_tag="RALTA_A0028"
FT   CDS_pept        complement(29655..30383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0028"
FT                   /product="putative Arylmalonate decarboxylase / malonate
FT                   isomerase"
FT                   /function="1 : Metabolism"
FT                   /EC_number="4.1.1.76"
FT                   /EC_number="5.2.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62701"
FT                   /db_xref="GOA:B2AFZ6"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:B2AFZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62701.1"
FT                   /translation="MTKQIRLGMLTPSSNTALEPITSAMVAGLPHVSAHFSRFTVTEIS
FT                   LRDQALGQFNLDKILAAASLLADARVDVIAWNGTSSGWLGFDKDEALCKQITEATGIPA
FT                   TTSVLALNEILEKTGARNFGLATPYLDDVQQRIIANYERSGFHCVAESHLDLHVNYSFA
FT                   EVEEDTIREMVLGLAQHQPQAITTFCTNLRAAHLAEALEAETGIPLYDTISTVVWKSLR
FT                   LCGVDTRELRGWGRLFREVE"
FT   gene            complement(30481..31779)
FT                   /locus_tag="RALTA_A0029"
FT   CDS_pept        complement(30481..31779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0029"
FT                   /product="putative transporter, MFS family; putative Sugar
FT                   phosphate permease"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62702"
FT                   /db_xref="GOA:B2AG03"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62702.1"
FT                   /translation="MQTTTRATVMTEARTSVRWKIFLMMLFLIAINYIDRASLSVAMPL
FT                   IAKEFDLSPTMQGLILSSFFWTYALMQVPGGMLADKYKPRIVIACATVFWGIAQAVAAF
FT                   TTNSTQLLLTRLGLGAAEAPIYPAGGKLNAIWMTQNERGRGATLLDGGAPLGAALGAII
FT                   ITWLIASLGSWRLAFIVAGVGTVLAGVLAWYYVRNSPREHRGVNELEARYIEDALANEH
FT                   RAEPANLSGRSLDFFKYRSVWCMAIGWMCFNTVFYGLLTWMPNYLNKVHGFDIKQMGGA
FT                   SFIIFFSGFVGELIGGWIADKWKEAGGRPNVVMRTLFGIAAVVATASIFSVAYVTDPVV
FT                   VVVLLSSTLFFLRWCGLFWCVPSMLGTRNKVGFLGGVMNLGGNIGGISVPIIVGMIVQF
FT                   TGSYFLALMFFAAAGVGLLLASTAIDYETKIPV"
FT   gene            31970..32689
FT                   /locus_tag="RALTA_A0030"
FT   CDS_pept        31970..32689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0030"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62703"
FT                   /db_xref="GOA:B2AG04"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62703.1"
FT                   /translation="MTQTLSPSARLRTLGMSAEIAARLRTMIEEGELPPGARIDERAFC
FT                   ETFDVSKTPLREALKVLVSEGLVLHRQYIGYRVAPLDLEELRATFETLHGLEALAGELA
FT                   AQRLGPAAMAKLERRHQAMIDAHAAGRRTDYFRINQEIHQLIIDGAANPVLAGVYAALM
FT                   SKVHRARGAANADTLRWQESHEEHEAIMAALREPGRPRLAQVLRSHSENTAREVLTVVA
FT                   QTLAEGTARNGALKQSA"
FT   gene            32722..33570
FT                   /locus_tag="RALTA_A0031"
FT   CDS_pept        32722..33570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0031"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   protein: 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase ;
FT                   5-carboxymethyl-2-oxo-hex-3-ene-1,7-dioate decarboxylase"
FT                   /function="1.5.1.14 : Tyrosine"
FT                   /function="1.1.3.15 : Phenylalanine, tyrosine degradation"
FT                   /EC_number="5.3.3.10"
FT                   /EC_number="4.1.1.68"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8550403; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62704"
FT                   /db_xref="GOA:B2AG05"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62704.1"
FT                   /translation="MKLVRVGNPGAERPGLIDAAGRVRDLSGVIPDVDAAQLAPAALEA
FT                   LARLDPQTLPVIEGARFGVPWTGIGKIVAIGLNYADHAAEAGMPLPAEPIVFLKANSSL
FT                   NGPNDAVMLPFGSHKTDWEVELGVVIGTTARNVSREQALEHVAGYCVVNDVSEREFQIE
FT                   RGGTWDKGKGCDTFCPAGPWLVTRDEVPDAQALGLWLEVNGERVQQGTTATMVFDVATL
FT                   VSYVSRFMTLLPGDLIATGTPPGVGMGCKPPRFLKAGDTMRLGVDGLGEQVQRVVAYGE
FT                   R"
FT   gene            33775..35019
FT                   /locus_tag="RALTA_A0032"
FT   CDS_pept        33775..35019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0032"
FT                   /product="putative HIPPURATE HYDROLASE"
FT                   /function="1.5.1.13 : Phenylalanine"
FT                   /function="1.1.3.15 : Phenylalanine, tyrosine degradation"
FT                   /EC_number="3.5.1.32"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62705"
FT                   /db_xref="GOA:B2AG06"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62705.1"
FT                   /translation="MSEHAPEIESYLGATLQSPASPLKHRYCALADTLDSRAELEAIRR
FT                   NIHQHPELAFDEVRTAGLVATLLEGWGYAVTRGVGGTGVVGTLRCGESGHSVGIRADMD
FT                   ALPIHERTALPYASVNAGRMHACGHDGHTAILLGAARQLARTRNFNGTVHLIFQPAEEI
FT                   GAGGGAERMLTDGLFERFPCDAIFGLHNHPGVEQGTFLFRSGPFMAACDTVTITIRGKG
FT                   GHAARPHQSVDPILVAGSLVMALQSVVSRYVDPNETAVVTIGTLHAGHAPNVIPDSARM
FT                   ELSVRSFSPDVRASLEHRIRQLATAHAEGYGAVAEIDYVRGYPVLVNSERETEFARQVA
FT                   EELVGTGKVVDQAARIAGSEDFAYFLQQRPGCFVRLGNGANQPLLHNAGYDFNDDNLTV
FT                   GAAYWTRLVERYLGH"
FT   gene            complement(35044..35916)
FT                   /locus_tag="RALTA_A0033"
FT   CDS_pept        complement(35044..35916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0033"
FT                   /product="putative transcriptional regulator, Arac family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62706"
FT                   /db_xref="GOA:B2AG07"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62706.1"
FT                   /translation="MARAPRPLSAAAPDSRRSRQPLPDPTPETLALGDTYADPPPYFRF
FT                   DRSPLPVTAMAADYLPGHVTQPHQHPHAQLIHAVHGVMVVATAEGQWIVPPTRGMWMPG
FT                   GTTHWIRMVGRVQMRTAYIRPDAAPDLPQRCTVLGISPLLRELILAAVEIALPYAPDTR
FT                   DARLMRLLLDEVMLVPSLPLHLPRPADASLRQICEAIADAPDTALTLADWGARLGLDPK
FT                   TIQRRFARETGMTFGQWRQQARLLAALEKLAAGSKVVDVALDLGYDSPSAFATMFRRQF
FT                   GVPPSAFFR"
FT   gene            36044..37291
FT                   /gene="fsr"
FT                   /locus_tag="RALTA_A0034"
FT   CDS_pept        36044..37291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="RALTA_A0034"
FT                   /product="fosmidomycin/multidrug transporter, MFS family"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62707"
FT                   /db_xref="GOA:B2AG08"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62707.1"
FT                   /translation="MSTTIDSAPAGAAPATPSLSPSPQAERTGFRVLSAISFAHFLNDM
FT                   IQSLILAIYPMLKGGFNLSFTQIGLLTMTYQVTASLLQPVVGLYTDKHPKPHSLSVAMG
FT                   FTLAGLLLLSVAPSYGVLLVAAALVGTGSSIFHPESSRVARMASGGQHGLAQSIFQVGG
FT                   NGGSAMGPLLAALIVHQQASLAWFSLAALVGIVVLWRIGGWYARQLAQGARKRKAAGAT
FT                   ASPVATRVVVRAMVVLMVLVFSKYFYMASLTSYYTFYLMERFALARQDAQLHLFLFLFA
FT                   VAAGTILGGPIGDRIGRKRVIWASILGVAPFTLLLPHVGLFWTTVLTFIIGFILASAFS
FT                   AILVFAQELIPGKVGMVSGLFFGFAFGMGGIGAAVLGGMADTHGIRAVYEYCAYLPLLG
FT                   LLTVFLPDLREGPQRA"
FT   gene            complement(37328..37879)
FT                   /locus_tag="RALTA_A0035"
FT   CDS_pept        complement(37328..37879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0035"
FT                   /product="putative TRANSCRIPTIONal REGULATOR, MarR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62708"
FT                   /db_xref="GOA:B2AG09"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62708.1"
FT                   /translation="MTSRRKPEDAPDHVDGILAQWARERPDLDTSPMGILGRLGRLNRH
FT                   TGRAIEAALGATGLQPWEFDVLATLRRAGPPYALSPGALIGSLMITSGTMTNRLDHLER
FT                   AGLVRREPKPDDRRGLLVALTDAGRARVDHALALHVANEHRLLEGLTATERAQLAALLR
FT                   RWLRMFEPPPGDGGEGKSGD"
FT   gene            37970..38881
FT                   /locus_tag="RALTA_A0036"
FT   CDS_pept        37970..38881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0036"
FT                   /product="TRANSMEMBRANE PROTEIN, similar to pecM, Involved
FT                   in pectinase, cellulase, and blue pigment regulation"
FT                   /function="3.1.4 : Regulation level unknown"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8022282; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62709"
FT                   /db_xref="GOA:B2AG10"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62709.1"
FT                   /translation="MKANANSTTGIAGSSLKDILLTGLAPAIWGSTYLVTSQWLPPGQP
FT                   LLSGVIRALPAGLAMLAFGRQLPRGGWWWRAAVLGVLNIGFFQAMLFIAAYRLPGGVAA
FT                   TVGAIQPLIVVVLAWAWLGARPRPAAWMAGAGGLLGVALLVLGPAARLDAVGVAAAAAG
FT                   AVSMAVGTVLTRHWRPPVSPLVLTAWQLCAGGLFLLPFALVLEPLPGHFTPVNWLGYAW
FT                   LSVVGAGFSYALWFRGVARMAPAAVAALGLLSPVSATVLGFLVLGQSLTAVQAAGALLV
FT                   LASVWLGQRATAPATAARTQAA"
FT   gene            38979..39242
FT                   /locus_tag="RALTA_A0037"
FT   CDS_pept        38979..39242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62710"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62710.1"
FT                   /translation="MPAAPDPSAPATPPCERCLALADDPRRREPPACLALRGTAPVVTQ
FT                   SAAGVPYSMLSFCCRDCGTGWRLYDRANELFVSWVPERALER"
FT   gene            39356..40339
FT                   /locus_tag="RALTA_A0038"
FT   CDS_pept        39356..40339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0038"
FT                   /product="conserved hypothetical protein, UPF0065"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12562821"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62711"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62711.1"
FT                   /translation="MAFPFRTSLLAAACVVSAAASAPAAAADAYPSRPIRLIVAYPTGG
FT                   ISDTVARALGERLSAQMGTSVVVENKAGAGGSIGIDAVAKAAPDGYTLGFAATSPLTLN
FT                   PHVGRVNYDPQKDVAPVMSVMYSPVLVVATSAFSGKSFADVVGQASAKPGSVRWATSGL
FT                   GTVGHVVLEQIKQKSKADIVLIPYKGAGQQMNDALGGQFEVMSTNASPVLSQHMQAGRL
FT                   RALAVGAPKRLESLPAVPTLAELGYPKANLTSTFGIFAPGKTPAAIINRLNAELNKALA
FT                   EPEVHERLLKGGEVPTGGTPAQFAKAIREESAENARIVREAGIKAD"
FT   gene            complement(40372..41052)
FT                   /locus_tag="RALTA_A0039"
FT   CDS_pept        complement(40372..41052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0039"
FT                   /product="putative RESPONSE REGULATOR"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62712"
FT                   /db_xref="GOA:B2AG13"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62712.1"
FT                   /translation="MKIAALQADPTLAVSIEQTLRLNGHQCTRYLNGRALIGALRGKSF
FT                   DLLMLDCDTPGIPALEVLAWVRRTLGHEMPVMLTGTSNEEGFVAACLAQGADSYVPKPL
FT                   RTAELGARVLALLRRARPASADCDLEHGPFRFATAERQVWVKGKPVLLAPKEFDLAVLL
FT                   FRNLGSLVLRQTMVDHVWRYHMDAASRTVDSHLSRVRTKLALWPHNGVRLSSVYGLGSR
FT                   LDAA"
FT   gene            41283..42011
FT                   /locus_tag="RALTA_A0040"
FT   CDS_pept        41283..42011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0040"
FT                   /product="putative RESPONSE REGULATOR"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62713"
FT                   /db_xref="GOA:B2AG14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62713.1"
FT                   /translation="MGKKTASRIASLEDAPADAALIRQVVASAGFECVSFGESRRLLLA
FT                   LRDAGFDLLLLDWQMPDLSGREVLAWVRTHLDRRIPVMFLSCRDAEHDIVSALAAGADD
FT                   YMVKPIRPAELAARIEALLRRAYPAQASPHAPLRLGDYAFDCALRKVTCNGQPIGLTPK
FT                   EFDLAVLLFRHEGRIVTRDHITAAVWGREISPMSRTIDTHVSRVRSKLGLQAEHGMRLT
FT                   PVYTHGYRLERMAHAERAAA"
FT   gene            42008..42775
FT                   /locus_tag="RALTA_A0041"
FT   CDS_pept        42008..42775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0041"
FT                   /product="hypothetical protein; putative exported protein;
FT                   putative histine kinase of the two-component system"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62714"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62714.1"
FT                   /translation="MTARPLRHALVAAALCLGGCWLARRSRGAAAVPAPASEGRGDVRD
FT                   PDAVRDMLLHVLGHDLREPNASLLAWLALRQTRSQADAALLAQVEGHARRSLRHIDDLN
FT                   RLLRETRHAYRMRRLAMDTLLDEALDRVWTEAGEAGIRLERPAGRLPRLGGDAAMLAAT
FT                   LEWLLTSAIGAAAPGTAVRTACRGHAGGVALSIVFRPADDAGAAHLARPGPALLCAQRV
FT                   VARHGGLLVPLQPMHGPAAQAGWYLWLRRRPRP"
FT   gene            complement(42827..43924)
FT                   /locus_tag="RALTA_A0042"
FT   CDS_pept        complement(42827..43924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0042"
FT                   /product="putative OUTER MEMBRANE PORIN"
FT                   /function="4.1.B : Beta barrel porins (The Outer Membrane
FT                   Porin (OMP) Functional Superfamily)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62715"
FT                   /db_xref="GOA:B2AG16"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62715.1"
FT                   /translation="MKKSAIVLAAGSLLAGSAFAQSSVTLYGIVDQSIRFQTNANANND
FT                   NSWELTNGAVTNSRWGLKGSEALGNNLKAIFQLEGGFDPDTGRSNQASATNPNGRLFGR
FT                   QAYVGLSGDFGTIKLGRQYTEGFNFFGDFDPLTIGNYTNNAWPFFLTNFRNDNVVSYGG
FT                   KFGGLDVGASYGFGEQPGSMSQNQYWGTRAAYTFGPFGIGGVYQEVRNTTGEKQQMWGA
FT                   AGKYSIGPAKIFLGYIGGKDRTGSVDASLNFTGGATLNPIPAGGNAAANPRKDTIGYIG
FT                   VTYQATPALALTGVFYGDYVENVNGVNDNNGRRYTGVLLAEYSLSKRTQVYGTVDFNKV
FT                   SGGTITEMPGRNNQTGAALGIRHIF"
FT   gene            complement(44263..44517)
FT                   /gene="minE"
FT                   /locus_tag="RALTA_A0043"
FT   CDS_pept        complement(44263..44517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="RALTA_A0043"
FT                   /product="cell division topological specificity factor,
FT                   reverses MinC inhibition of FtsZ ring formation"
FT                   /function="5.1 : Cell division"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12897015; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62716"
FT                   /db_xref="GOA:B2AG17"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62716.1"
FT                   /translation="MSILSFLLGEKKKSASVAKERLQIILAHERTGHSAPADYLPALQR
FT                   ELVAVISKYVKIGDQDLRVSLERQDNLEVLEVKIEIPQH"
FT   gene            complement(44539..45354)
FT                   /gene="minD"
FT                   /locus_tag="RALTA_A0044"
FT   CDS_pept        complement(44539..45354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="RALTA_A0044"
FT                   /product="membrane ATPase of the MinC-MinD-MinE system"
FT                   /function="5.1 : Cell division"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11248256; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62717"
FT                   /db_xref="GOA:B2AG18"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62717.1"
FT                   /translation="MAKIIVVTSGKGGVGKTTTSASFAAGLALRGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVVQGEANLRQALIKDKKCENLFILPASQTRDKDALTREGVEK
FT                   VINGLIEMDFEYIVCDSPAGIESGALMAMYFADEALIVTNPEVSSVRDSDRILGILASK
FT                   TKRATEGGEPIKEHLLITRYNPKRVHGGEMLSLTDIQEILRIKLIGVVPESEAVLHASN
FT                   QGTPAIHLEGSDVSDAYSDVVDRFLGKDKPMRFTDYQKPGLFSRIFGNK"
FT   gene            complement(45421..46248)
FT                   /gene="minC"
FT                   /locus_tag="RALTA_A0045"
FT   CDS_pept        complement(45421..46248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="RALTA_A0045"
FT                   /product="cell division inhibitor, inhibits FtsZ ring
FT                   formation"
FT                   /function="5.1 : Cell division"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10869074; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62718"
FT                   /db_xref="GOA:B2AG19"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62718.1"
FT                   /translation="MWHFHGHPAMSQKKSPRFELRSGNVDALLLALQTADMAALRDDLL
FT                   TRFEATPDFFSNDVIALDLRALDDDGEVALGTVIDTLATLKARAIGVVARAGQREWAER
FT                   FGLPLLDSQARRNGAAERAAEARAAAAAEQAAAEQAAREEAARAAAQAATDAAVAAAVR
FT                   QHQTLLIDKPLRSGQQVYAQGDVVIMDVVSYGAEVIAEGNIHIYAPLRGRALAGVKGNT
FT                   AARIFSTCMEPELISIAGIYRTAEQTLPADVHGKTAQVRLADEKLILEALRLK"
FT   gene            46461..47411
FT                   /locus_tag="RALTA_A0046"
FT   CDS_pept        46461..47411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0046"
FT                   /product="putative Mg2+ transporter protein, CorA-like"
FT                   /function="4.S.121 : Mg2+/Ni2+/Co2+"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62719"
FT                   /db_xref="GOA:B2AG20"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62719.1"
FT                   /translation="MAYRQGKRLGTVSMEEIPAVLAVPGTFVWLGLHEPELALLRQAQQ
FT                   AFGLHDLAVEDATNAHQRPKLEAYGDSVFVVLNTAQLVQDEVVVGETHLFVGPNYVVSV
FT                   RHGASSTYAPVRERCEHDPQGLANGPGYVLYALMDFVVDHYLPIVTRLEDTFEALEQGI
FT                   FRDEFDRAAIERLYQIKRQVLRLRNAVSPVEDMCGQLIRLHEELVPKELRAYFRDIEDH
FT                   ASRLVRTLDVVREMLTTAVQVNLALVTVGQNEVVKRLAGWGAILAIPTVVFSLYGMNFD
FT                   FMPELKVHYAYPAVIGVTALACGALWRRLHRAGWI"
FT   gene            47557..48258
FT                   /locus_tag="RALTA_A0047"
FT   CDS_pept        47557..48258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0047"
FT                   /product="conserved hypothetical protein, tetratricopeptide
FT                   repeats; putative exported protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62720"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62720.1"
FT                   /translation="MSKAHPSRAAMLAGMLCAWLLVPTAAGAPQPPPPAQAQTRDAVAA
FT                   YESGRFDEALRGFAGAARQGNRLAQFNYAMMLLRGEGTAARPQEALVWLRKAADNGMTH
FT                   AQYTWGDLYERGQLVPKSLEEANRWYERAAQGGHVQAQMELATNYFTGRGVPRDYGQAF
FT                   AWYQRAASAGDGGAQYIVGSFYERGEPGVVDQDIEQAKIWYARAAARGDTGALAKLRSL
FT                   LEETVKGRAGM"
FT   gene            complement(48458..49915)
FT                   /gene="gatB"
FT                   /locus_tag="RALTA_A0048"
FT   CDS_pept        complement(48458..49915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="RALTA_A0048"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B (Asp/Glu-ADT subunit B)"
FT                   /function="2.2.5 : tRNA"
FT                   /EC_number="6.3.5.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62721"
FT                   /db_xref="GOA:B2AG22"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62721.1"
FT                   /translation="MQWEVVIGLETHAQLSTASKIFSGTSTAFGAEANTQASPVDLALP
FT                   GVLPVLNQGAVERAIQFGLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGT
FT                   ITIQVEGRKGEFYEKTVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPD
FT                   MRSAAEAVAYAKALHSLVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRREIKNLN
FT                   SFRFLQQAIEYEVQWQIAEIEDGRKIQQATVLFDPDTGETRAMRTKEDAHDYRYFPDPD
FT                   LMPLEIEPAWVERVRDALPELPAAMQARFVSQYGLSAYDATTLTATKAFAAYYEAVVAD
FT                   AGAANAKPAANWLMGDVSSQLNREGIAIDDAPVRPAQLAKLLARIADGTVSNNTAKKDV
FT                   FPAMWAGEHDGDADAIIAAKGLKQMSDSGELEKIIDDVLAANAKSVEEFRSGKEKAFNA
FT                   LVGQAMKATRGKANPAQVNELLRKKLG"
FT   gene            complement(50005..51120)
FT                   /locus_tag="RALTA_A0049"
FT   CDS_pept        complement(50005..51120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0049"
FT                   /product="putative enzyme, Dienelactone hydrolase family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62722"
FT                   /db_xref="GOA:B2AG23"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62722.1"
FT                   /translation="MVHAPVTPQHAPRPARPAGAWLSAAVALGCSAWLAGAAAHTPDLP
FT                   APALDAPAPLTPAGVLAPNAVSRAAPASSAAARAAVAPVPAQRVQLRGDAATPALTAYW
FT                   FLPREGATPRALPVVVALHGCGGLLAQGARRDGTTAATSTVAGTTDVSALLQQRYREYA
FT                   HWLTERGYAVLMPDSFSARGKPHGICAEPIDNRAIDERTRRADALAALRWVAQQPAVDA
FT                   SRIVLLGWSNGAQAVLATVDASRPWPAGTPPVERAVAFYPGCKRAVQQHSFRLRSPLLL
FT                   MIGGADDWTPATRCAMLQSAVQARQPGARFRLEIYPGAYHGFDGTSELHRRTDVPAAAM
FT                   RKSQSVTVGGDAVARVAALAQLDSWLASPDP"
FT   gene            complement(51147..51605)
FT                   /locus_tag="RALTA_A0050"
FT   CDS_pept        complement(51147..51605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0050"
FT                   /product="putative lipoprotein; putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62723"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62723.1"
FT                   /translation="MNPTFLRLLAALVFATLAAGCIQLPIIGKPTPIASRDIDLAGDCR
FT                   RTEEDGFREDAQLRISDNSVQQLSWKLWVGKRGSCSFNLAEFRQVQKKPHIELRANDGS
FT                   GCKLMVWQDPRRVTLAHANCQQRCTPGIYEQAWPVMFEPGSGGCAATR"
FT   gene            complement(51608..53113)
FT                   /gene="gatA"
FT                   /locus_tag="RALTA_A0051"
FT   CDS_pept        complement(51608..53113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="RALTA_A0051"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit A
FT                   (Glu-ADT subunit A)"
FT                   /function="2.2.5 : tRNA"
FT                   /EC_number="6.3.5.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62724"
FT                   /db_xref="GOA:B2AG25"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62724.1"
FT                   /translation="MPFSADSVTSLRQLADALAARTVSAEELAREYLARIEQAAALNAF
FT                   IHVDAELTLAQARAADERRARGEAAPLTGVPVAHKDVFVTRGWRATAGSKMLGNYESPF
FT                   DATVVERMAAAGMVTLGKTNMDEFAMGSSNENSHFGPVRNPWDAGRVPGGSSGGSAAAV
FT                   AAGLAPAATGTDTGGSIRQPASFSGITGIKPTYGRVSRYGMIAFASSLDQGGPMAHTAE
FT                   DCALLLNAMAGFDPKDSTSIPPAQGGVDEDYTRLLGQPRAGATAERPLAGLRIGLPREY
FT                   FGKGLSADVEQAVRAALAEYEKLGATLVEVSLPKTELSIPVYYVIAPAEASSNLSRFDG
FT                   VRYGHRAAEYRDLLDMYKKTRAEGFGAEVKRRILVGTYVLSHGYYDAYYLQAQKIRRII
FT                   ADDFQRAFAQCDVIMGPVAPTVAWKLGEKTSDPVQMYLADIFTLSTSLAGLPGMSVPCG
FT                   FGEGNMPVGLQLIGNYFDEARLLQAAHAFQQATDWHLRRPAKA"
FT   gene            complement(53186..53485)
FT                   /gene="gatC"
FT                   /locus_tag="RALTA_A0052"
FT   CDS_pept        complement(53186..53485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="RALTA_A0052"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit C
FT                   (Glu-ADT subunit C)"
FT                   /function="2.2.5 : tRNA"
FT                   /EC_number="6.3.5.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62725"
FT                   /db_xref="GOA:B2AG26"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62725.1"
FT                   /translation="MALDLSDVKRIAHLARIETSDDEAAQTLAQLNNFFSLVEQMQAVD
FT                   TTGIEPQAHPLSAVRDMVQRLREDVVTETDRRADYQRPAPATENGLYLVPKVIE"
FT   gene            54109..55152
FT                   /gene="mreB"
FT                   /locus_tag="RALTA_A0053"
FT   CDS_pept        54109..55152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="RALTA_A0053"
FT                   /product="cell wall structural complex MreBCD, actin-like
FT                   component MreB"
FT                   /function="5.1 : Cell division"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14517265, 17276920; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62726"
FT                   /db_xref="GOA:B2AG27"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62726.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRDKGIVLDEPSVVAIRQEG
FT                   GPNAKKTITAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMLKQFIKMVHDSKL
FT                   LRPSPRIIICVPCGSTQVERRAIRESALGAGASQVYLIEEPMSAAIGAGLPVSEPSGSM
FT                   VVDIGGGTTEVGIISLGGMVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVREMEVKGRNLSEGIPRAFTVSSNEILEALTDPLNQIVSAVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
FT   gene            55349..56314
FT                   /gene="mreC"
FT                   /locus_tag="RALTA_A0054"
FT   CDS_pept        55349..56314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="RALTA_A0054"
FT                   /product="cell wall structural complex MreBCD, actin-like
FT                   component MreC"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /function="6.2 : Peptidoglycan (murein)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2687239, 17276920; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62727"
FT                   /db_xref="GOA:B2AG28"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62727.1"
FT                   /translation="MDYSPPPLFKQGTSAVARLVLYVGIALALLVVDARFDALRVGRQV
FT                   AATVLMPVERLVLAPRDALRTMFDYAQSSATLATENRELRQNAVQQAQASVRQAQLEAE
FT                   NNQLRKLLGLAQQSATPVTAAEILYDARDPYSQRIVIDKGSQHGLRAGYPVIDERGVVG
FT                   QVTRVSPFQSEVTLLTDKDQAIPVQVVRNGLRSVAFGGARAGHLDLRFMAAAADLQQGD
FT                   LLVTSGLDGTYPPGLPVAKIVQIERKADTAFSRVYCEPVAGVRAHRQLLVVRYDANIPA
FT                   REAVEARPEAPVKGAKSAAARAAADSAAAAKASPAKEAPR"
FT   gene            56311..56823
FT                   /gene="mreD"
FT                   /locus_tag="RALTA_A0055"
FT   CDS_pept        56311..56823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="RALTA_A0055"
FT                   /product="cell wall structural complex MreBCD transmembrane
FT                   component MreD"
FT                   /function="5.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2687239, 17276920; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62728"
FT                   /db_xref="GOA:B2AG29"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62728.1"
FT                   /translation="MTNPQYLLRPVNPAFIAFSFVLAFLFNLMPWGTTLWIPDMVALVL
FT                   VFWNIHQPRKVGMGVAFLLGLLMDVHDARLLGEHALAYTLLAYFAITIHRRVLWFTVYT
FT                   QALHVLPLLFIAHAVPVLIRLAMGAPLPGWPLLLAPAIEALLWPLATSLLLAPQRRSTD
FT                   VDETRPI"
FT   gene            56896..59202
FT                   /gene="mrdA"
FT                   /locus_tag="RALTA_A0056"
FT   CDS_pept        56896..59202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="RALTA_A0056"
FT                   /product="Peptidoglycan glycosyltransferase
FT                   (penicillin-binding protein 2)"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /function="5.1 : Cell division"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /function="6.2 : Peptidoglycan (murein)"
FT                   /function="7.3 : Inner membrane"
FT                   /EC_number="2.4.1.129"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2644207; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62729"
FT                   /db_xref="GOA:B2AG30"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62729.1"
FT                   /translation="MTEIRNVELEIGRFRIRVAAAALFTVICFGLLFSRFLWLQWYKHD
FT                   QYSAKAEDNRISVAPIEPNRGIIMDRNGIVLARNYSAYTLEITPSKLTDTLENTIEGLS
FT                   ALVEIQPRDRRRFKRLMEESRSFESLPIRSQLTDEEVARFSAQRFRFPGVDVRARLFRQ
FT                   YPLGESASHVIGYLGRISQRDQERIEAMDEANDADGAKYDPRKDADNYKGTNYIGKIGL
FT                   EQSYESELHGLTGFEEVEVSAGGRPIRTLSTSPATPGNNLILSLDIRLQQLAEALYGNR
FT                   RGALVAIEPSTGDILAFVSKPTFDPNLFVEGIDTTTWNELNGSPDKPLLNRPLRGTYPP
FT                   GSTYKPFMALAALTTGKRTAAWGMSDPGYFTLGNHTFRDDKPGGHGWVDMHSSIVHSCD
FT                   TYYYALARDMGVNGIHDFMKPLGFGQITGIDIEGESRGILPSTDWKRKAYRKPEQQKWY
FT                   DGETISLGIGQGYNSFTILQLAQATSVIVNDGKVMKPHLVKAIEDAVTRKRTLTVPKES
FT                   YTIPLKQSDINVIKRAMVAVTHSGTAARVFAGAAYESAGKTGTAQTYSLSKGEKYNHHA
FT                   LAEHKRDHSLYTAFAPADNPRIAIALIVENAGFGAAVAAPIARKVMDYYLTGKWPAELE
FT                   AIAPPAGERLAGRAPVDTPSVFTTGQTASIASATVMSGGGAPASGAAASAVAAASAAQL
FT                   PTPEAIAATLDPDAIAPASAVQTLDQRMLQALGHSKPQTPAPASATVVPAKAPAPKPRV
FT                   KPVAAKAASGADATR"
FT   gene            59232..60356
FT                   /gene="mrdB"
FT                   /locus_tag="RALTA_A0057"
FT   CDS_pept        59232..60356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="RALTA_A0057"
FT                   /product="cell wall shape-determining protein"
FT                   /function="4.9.B.3 : The Putative Bacterial Murein
FT                   Precursor Exporter (MPE) Family"
FT                   /function="5.1 : Cell division"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2254246; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62730"
FT                   /db_xref="GOA:B2AG31"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62730.1"
FT                   /translation="MSLVKTALTGFDKPLSLIVFLLFATGIVALYSAAIDMPGRVEDQL
FT                   RNILLSYVVMFVIAYLPTQTLMRVAVPIYTVGVALLIAVAMFGLIRKGARRWLYVGMVI
FT                   QPSEIMKISMPLMLAWYFQKREGVIRWFDFIVALGLLLIPVGLIAKQPDLGTALLVMAA
FT                   GLYVIYFAGLSWKLILPLMGILVVAITLLITFQNDICAPGVNWPVLHDYQQHRVCTLLD
FT                   PTSDPLGKGFHTIQSIIAIGSGGVQGKGWLKGTQTHLEFIPEKHTDFIFAVYSEEFGLI
FT                   GNAVLLVLYLLLIFRGLFIAANAPTLFSRLLAGSITLIFFTYAFVNMGMVSGILPVVGV
FT                   PLPLLSYGGTALVTLGAGIGILMSISRQKRLIQT"
FT   gene            60498..61184
FT                   /locus_tag="RALTA_A0058"
FT   CDS_pept        60498..61184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0058"
FT                   /product="conserved hypothetical protein, DUF484"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62731"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62731.1"
FT                   /translation="MNAQDVAAYLQSHPEFFEEHAELLAAVQLTSPHSHRAVSLQERQM
FT                   EILREKNKGLELRLADLVRHGHENDRTQQRLHDWQLRLLAEADSHALPYAVQDGLQQVF
FT                   DVPAVALRLWDVAEQYAHMEVAQGASEDLRIFAEGLRAPYCGSNSGFEAASLLERDDVT
FT                   SLAMVTLRVPVRAGEAEAGADVRGAAFGLLVLGSPDPRRFHDGMGTAYLSQIGAVAGAA
FT                   LNRLRD"
FT   gene            61235..62284
FT                   /gene="xerC"
FT                   /locus_tag="RALTA_A0059"
FT   CDS_pept        61235..62284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="RALTA_A0059"
FT                   /product="site-specific tyrosine recombinase"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="5.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9268326; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62732"
FT                   /db_xref="GOA:B2AG33"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62732.1"
FT                   /translation="MVPSSAPADGEAPPPDPLVTRYLDWLRGSRKLAEHTLSGYARELR
FT                   VLQAHAAQHAPGVALLALQTHHIRNFAARLHAAGLVGTSIGRALSAWRGFYLWAARHGH
FT                   GVSVNPVDGVRAPRSGHALPKALSVEHAVALVAHPAGTDAEALRDQAVYELFYSSGLRL
FT                   SELVQLDLRYAEADGYRSSGWLDLAGAEVTVTGKGSRRRTVPVGGRAIAALQAWLAVRD
FT                   GLLRPGAAPEDAHALFLGPRGRRLSMRTVQLRLKQQALRAGVPADVHPHMLRHSFATHM
FT                   LQSSGDLRAVQEMLGHASISTTQVYTALDFQHLAKVYDKAHPRAGRARAKPAADAAASA
FT                   ARVDDTPED"
FT   gene            complement(62286..63212)
FT                   /gene="gcvA2"
FT                   /locus_tag="RALTA_A0060"
FT   CDS_pept        complement(62286..63212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvA2"
FT                   /locus_tag="RALTA_A0060"
FT                   /product="transcriptional regulator of Glycine cleavage
FT                   system operon, LysR family"
FT                   /function="1.1.3 : Amino acids"
FT                   /function="1.7.17 : Formyl-tetrahydrofolate biosynthesis"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2.2 : Activator"
FT                   /function="3.1.2.3 : Repressor"
FT                   /function="3.3.1 : Operon (regulation of one operon)"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11495998; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62733"
FT                   /db_xref="GOA:B2AG34"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62733.1"
FT                   /translation="MPRGWHRELPRLPALTALRAFEAAARHESFSRAATELFVTHGAVS
FT                   HQIRALEDELGMPLFERHGKRVALTPAGRLYAERVRDALLQIADATRALQAGNRDKRLT
FT                   ISTMPSFAARWLTPRIGSFIERHPELDVELLSSNTLVNFAHEEVDIALRMGSGDYPGLY
FT                   VERLLDDVFFPVCSPAFNGGRLPGRPQDMAGMPLLRGEGDPWKPWFDAAGLDWPEPRKG
FT                   LLLEDSSLLLQAASEGQGIALIRSSLACNDLLSGRVVRLFDVSIPCPWLLYFVCAPGSL
FT                   NLPKVQAFRGWLLPEIERFREVLAQWE"
FT   gene            63490..63858
FT                   /locus_tag="RALTA_A0061"
FT   CDS_pept        63490..63858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62734"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62734.1"
FT                   /translation="MKTVLTTTEFTLNPGEVTALSVHAAQRLHVADARGTDVWLTREND
FT                   SEDYWLRCGGSLLLRAGDEVVISIDPRAVHPVRLALIAEARRPVLALADLPHLVYRSLR
FT                   RLVRGTEWTPNQDRVTAS"
FT   gene            64013..64741
FT                   /gene="lipB"
FT                   /locus_tag="RALTA_A0062"
FT   CDS_pept        64013..64741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="RALTA_A0062"
FT                   /product="Lipoyltransferase (Lipoyl-[acyl-carrier
FT                   protein]-protein-N-lipoyltransferase) (Lipoate-protein
FT                   ligase B)"
FT                   /function="1.5.3.3 : Lipoate"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12591875, 20525439, 93186699; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62735"
FT                   /db_xref="GOA:B2AG36"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62735.1"
FT                   /translation="MHPIQVIERGREDYQPCFDAMRAFTAARTPETPDQVWLVEHPPVY
FT                   TLGQAGDPAHLLAPDERIPVVQIDRGGQITYHGPGQVVAYLLLDLRRRRLMVRELVHGI
FT                   EQAVLDTLAAYNLAAERKAGAPGIYLSGGPHRGAKIAALGLKIRNGCSYHGVSLNVQMD
FT                   LSPFLRINPCGYAGLETVDMATAGATCPVADADGAPVPVTAATQPEIAQRLAAALCEVL
FT                   AAHEARVLAAEEPAAPALAS"
FT   gene            64782..65786
FT                   /gene="lipA"
FT                   /locus_tag="RALTA_A0063"
FT   CDS_pept        64782..65786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="RALTA_A0063"
FT                   /product="lipoyl/lipoate synthase, an iron-sulfur enzyme"
FT                   /function="1.5.3.3 : Lipoate"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.8.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12591875; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62736"
FT                   /db_xref="GOA:B2AG37"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62736.1"
FT                   /translation="MSDALIAPNASSSEAPQSPAEHYDPTRKQKSADKTARIPIKIVPA
FT                   EKLKKPDWIRVKAATGNSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMG
FT                   DKCTRRCPFCDVGHGRPDPLDVNEPGNLARTIAQLKLNYVVITSVDRDDLRDGGAQHYV
FT                   DCISQTRELSPATRIEVLVPDFRGRLDKALDILQACPPDVMNHNMETVPRLYKQARPGA
FT                   DYAHSLKLLQEFKRRNPNVPTKSGLMVGLGETDEEILEVMRDMRAHDIDMLTIGQYLAP
FT                   SNHHLPVLRYVHPDTFKMFEEEAYKMGFTHAAVGAMVRSSYHADQQAHQAGFA"
FT   gene            complement(65888..66163)
FT                   /gene="kluB"
FT                   /locus_tag="RALTA_A0064"
FT   CDS_pept        complement(65888..66163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kluB"
FT                   /locus_tag="RALTA_A0064"
FT                   /product="toxin of a toxin/antitoxin system"
FT                   /function="5.10 : Defense/survival"
FT                   /function="8.2 : Plasmid related"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15528648; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62737"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62737.1"
FT                   /translation="MEQLESLYDYIAEEASPYIAARYTDAIVEYCESLSTFPHRGTQRD
FT                   DVRPGLPITHYKKRAVIAFAVDTDKVSIIGLFYGGRDYETMLNESD"
FT   gene            complement(66197..66475)
FT                   /gene="kluA"
FT                   /locus_tag="RALTA_A0065"
FT   CDS_pept        complement(66197..66475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kluA"
FT                   /locus_tag="RALTA_A0065"
FT                   /product="antitoxin of a toxin/antitoxin system"
FT                   /function="5.10 : Defense/survival"
FT                   /function="8.2 : Plasmid related"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15528648; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62738"
FT                   /db_xref="GOA:B2AG39"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62738.1"
FT                   /translation="MRTTQQLSVTLPTEMAQAVKDKVRSGEYASESEVIRDGLRALLAR
FT                   DRAVDAWLLQQVGPAYDALQTDPSRAVTADDVRARLAARQAGKAKGR"
FT   gene            66687..67334
FT                   /locus_tag="RALTA_A0066"
FT   CDS_pept        66687..67334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0066"
FT                   /product="Allophanate hydrolase subunit1 (ahs1)"
FT                   /function="1.7 : Central intermediary metabolism"
FT                   /EC_number="3.5.1.54"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62739"
FT                   /db_xref="GOA:B2AG40"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62739.1"
FT                   /translation="MNCTVHRLAEQALLYSVAPPASLAVQRRIWAMAARAADWRGVVDV
FT                   VPGMNNLTVIFDESADADALERNLKLAWASGEASNATGKLVEIPVRYGGEHGPDLGDVA
FT                   AHTGLTPQEVVRRHAAGEYVVYFLGFQPGFAYMGGLAPELATPRRREPRLAVPAGSVGI
FT                   GGEQTGIYPAVLPGGWQLIGRTDAELFVADRDPPSLFAPGDTVRFVAEEIIA"
FT   gene            67331..68350
FT                   /locus_tag="RALTA_A0067"
FT   CDS_pept        67331..68350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0067"
FT                   /product="allophanate hydrolase, subunit2 (ahs2)"
FT                   /function="1.7 : Central intermediary metabolism"
FT                   /EC_number="3.5.1.54"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62740"
FT                   /db_xref="GOA:B2AG41"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62740.1"
FT                   /translation="MIEILRPGALASVQDLGRTGFRRFGVGRCGAMDMLAVEVGNRLLG
FT                   NAPGCAAIEFTLGRAAVRFHADMRVALAGAECGANLDGMPVWSWHAFDAHKGETLTLPS
FT                   TRGGTRVYLCVAGGIAVEPVMGSRSTDLKSGFGGLGGRALQEGDRLPAGCPGLGAETDW
FT                   IGVQAPAWALPVAVDGKATAIRMLPGPEYEDFDAASQAALWQADWTVTPNSNRMGLRLA
FT                   GPALARRPERSADLLSHGVMPGVMQVPPAGQPIALMADAQTTGGYPKIGVVIGADLWRL
FT                   AQVPLGAPVRFVQVSLAQARAAQEELARYLRQIEQALRWQGDGMPIAARRRTRTRAAA"
FT   gene            68390..69130
FT                   /locus_tag="RALTA_A0068"
FT   CDS_pept        68390..69130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0068"
FT                   /product="putative lipoprotein, LamB/YcsF family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62741"
FT                   /db_xref="GOA:B2AG42"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62741.1"
FT                   /translation="MQIDLNADLGEGCGNDEALLALISSANIACGWHAGDAATMVQTVK
FT                   WALARGVAIGAHPSYPDRENFGRTEMQRDPEHVYADVLYQIGALDAIVRAQGGVLHHVK
FT                   PHGALYNQAVRDPALARAIVRAVRDFDADLVFFGLAGSQMIDVAKEAGLRVKQEVFADR
FT                   GYNADGTLVRRGTPGALHEDEEVALDQTLTMVREQRVRAIDGTWVPIRAETVCLHGDGA
FT                   HALAFARRIRERLGAEGIAIRAGD"
FT   gene            69238..69966
FT                   /locus_tag="RALTA_A0069"
FT   CDS_pept        69238..69966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0069"
FT                   /product="conserved hypothetical protein, DUF969; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62742"
FT                   /db_xref="GOA:B2AG43"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62742.1"
FT                   /translation="MEQAVNLWPLVGVGVIVVGFVLRFNPMLVVVLAALATGLAAPMPL
FT                   MQIFSAIGTAFVKARNLPLIILLPLAVIGLLERHGLREHAQAWIARIASATVGRLLIVY
FT                   LGVRELTAAIGLTSLGGHPQMVRPLLAPMAEGAAENRFGHLPEPVRQRVLAFCAATDNV
FT                   GLFFGEDIFVAFGAIALMHTFLLSSNIEVEPLHIAVWGIPTAICAFLIHAVRLKRLDGW
FT                   LERELGGKAARAAVPAQSAE"
FT   gene            69977..70927
FT                   /locus_tag="RALTA_A0070"
FT   CDS_pept        69977..70927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0070"
FT                   /product="conserved hypothetical protein, DUF979; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62743"
FT                   /db_xref="GOA:B2AG44"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62743.1"
FT                   /translation="MIISIEYLYWLAGLVLAITALMTFTDRAHPRRLSTGLFWLLYAIV
FT                   FLAGDRLPPAAVGIGAVVMALIAGFGGVGHGKHESLPEAERRASASRLGNKLFIPALLI
FT                   PLVTVIGTMLFKDVRIAGVPLLDPKNVTFVSLGIGCLISLAVVCWLTRDTVAQGLRESR
FT                   RLTESLGWALVLPQMLAMLGLVFADAGVGKAVAHLTTAYINLDYKLVAVAVYCVGMALF
FT                   TVIMGNGFAAFPVMTGGVGVPILVGMFGGNPAVMAAIGMFSGYCGTLMTPMAANFNIVP
FT                   AALLELDDKNAVIRAQVPTALAILAANIVLLYWLM"
FT   gene            70944..71594
FT                   /gene="pcp1"
FT                   /locus_tag="RALTA_A0071"
FT   CDS_pept        70944..71594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp1"
FT                   /locus_tag="RALTA_A0071"
FT                   /product="PYRROLIDONE-CARBOXYLATE PEPTIDASE
FT                   (5-OXOPROLYL-PEPTIDASE) (C15 exopeptidase)"
FT                   /EC_number="3.4.19.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62744"
FT                   /db_xref="GOA:B2AG45"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62744.1"
FT                   /translation="MPTVLLTGFEPFEDEPINPSWEAVRALDGERVGDAVIVARQLPCV
FT                   FGAAIDAIGELLDTLRPALVIAVGQAGGRAEMSVERVAINVDDARIADNAGAQPIDTAI
FT                   VADGPAAYFATLPIKAMVRDMRAAGVPASVSQTAGTFVCNHVFYGLMHRLARHPAGTVR
FT                   GGFIHIPYLPEQAARHPGQPSLALETLVKGLRTAVATALSTRADVREQGGQLH"
FT   gene            complement(71621..72871)
FT                   /locus_tag="RALTA_A0072"
FT   CDS_pept        complement(71621..72871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0072"
FT                   /product="conserved hypothetical protein; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62745"
FT                   /db_xref="GOA:B2AG46"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62745.1"
FT                   /translation="MEPAPPPLSAPPPAAPPAPPDTAPLHSPLARVGLLCFTLLVVYAS
FT                   LYPFSGWVDNGISPFAFVSAPKPRYITDFDLLTNVLGYFPFGALVVLSLHPRLSGGRAT
FT                   LVALVAGALLSACMEAFQTWLPSRISSNIDLITNALGALLGGAVVAPFTRALIDDGRLT
FT                   RLRHAWFEPHASFAIILLLLWPFAQVFPQEHLFGMGGIVREWLTDPESWPMQVLQMVFP
FT                   QLESWQDHIGLRPEDMQSQQLLESLVTASSWIGTGLFASIAMRRSAPMLRILAGLLAAA
FT                   LLLKATAAELQFPTESAFVWLSEGGRFALLTSSLVLALLLYLPRWLRAVLAMAALVVLV
FT                   GLTNVLPSNPYAWISEQGWRMGRFIHFNSLAQWLGWLWPFLAFCYVIWRFEQVSLRRHA
FT                   MKKAAARREAAAANLQE"
FT   gene            complement(72890..73543)
FT                   /locus_tag="RALTA_A0073"
FT   CDS_pept        complement(72890..73543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62746"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62746.1"
FT                   /translation="MNPATEMPRFLRPAPARLRAALLLAAAGLALLSGCALTRGEPTIT
FT                   YDLGPALAGPAASATGNPAPAPLPKLRVAQTDGPNWLEGNALFYRLQYAQAQRLQAYAT
FT                   QRWVMSPTRLFDERLRDAVAARGTLGWSGDGSVPALKVDLLEFDQVFHSATASEGVVRL
FT                   RATVYRHGMLGQQTFEVRRPAPSADGAGGVKALAEASDAAIAALLDWIGTLQLK"
FT   gene            complement(73609..74553)
FT                   /locus_tag="RALTA_A0074"
FT   CDS_pept        complement(73609..74553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0074"
FT                   /product="putative ABC-type transporter, periplasmic
FT                   component"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62747"
FT                   /db_xref="GOA:B2AG48"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62747.1"
FT                   /translation="MMENKSHAFLAGVFTIGLAVLVLFAIFWFSSDHAVRVPYDLITRS
FT                   TVNGLGPQADVKYRGLAVGKVESIKFDPQVPGQIIVRVNVNRETPITRTTYATLGFQGV
FT                   TGIAYVQLDDSAAHDGAGASPPLPTSPRAVARIAMRPGFFEELEKRGDSLLTQAETLMG
FT                   SLNDMFRGANRDELMAAIRSVRKTAEDYSRLSDSLAPAAQRLPKVAENLNATLESTRRL
FT                   TQELANPNGTVMRTVDSVGRDLQGAAASVQSAAGTFHEETLPQLNGLARDARQTARSFE
FT                   RAAGQFNESPSSVLFGAPAPTPGPGEPGFSAAP"
FT   gene            complement(74550..75410)
FT                   /locus_tag="RALTA_A0075"
FT   CDS_pept        complement(74550..75410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0075"
FT                   /product="putative ABC transporter, ATP binding component"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62748"
FT                   /db_xref="GOA:B2AG49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62748.1"
FT                   /translation="MSAAPANANPPGAPQHAPQRTPVIEVRDLVKRFGKAVVHDHVNLD
FT                   VYRGEVLSIVGGSGSGKTVLLRQIVGLERPTSGTIKVFGEDPARLRPAQLQALRSRWGL
FT                   QFQRGALFSALSVIDNIALPLRELRALPDNLICQAALLKLQLVGLSARDADKMPSDLSG
FT                   GMIKRVALARALSLEPELLFLDEPTAGLDPMASDDYVALIRELRRELGLTVVMITHDLD
FT                   TLVALSDRVAVLADHKVIAAAPIPQVVKVDHPFIREYFLGERAQRALQALPRPGQPAAP
FT                   PPGEA"
FT   gene            complement(75407..76537)
FT                   /locus_tag="RALTA_A0076"
FT   CDS_pept        complement(75407..76537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0076"
FT                   /product="conserved hypothetical protein, DUF140; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62749"
FT                   /db_xref="GOA:B2AG50"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62749.1"
FT                   /translation="MERQTTPDFQITRGDGTVSVQLRGDWTALALAGCHQARQLRAQLH
FT                   ELAQAPDHAQWSLAGVERLDHIGGQLLWQAWNGALPQRLEASEGQRRVFARIAAVQDEG
FT                   WKKHMVDRFNPVTLLGANVMSFGVQLGNGITMLGQLAFDLLRFARMPQRGPWREISANI
FT                   YNVGYKALGITALVGFLIGIVLSYLSANQLRTFGASTFIVNILGMAVIRELGPVLAAIL
FT                   IAGRSGSAITAQIGVMRVTEELDAMRVMGISHGFRLIMPRVIALAIAMPLLVAWTDVMA
FT                   LAGGMLAARMQLGISATFFLRELPDAVPVANLWLGLGKGVVFGILIALTACHFGLRIKP
FT                   NTQSLGEGTTASVVTAITIVILADAVFAILFKDVGL"
FT   gene            76769..77602
FT                   /locus_tag="RALTA_A0077"
FT   CDS_pept        76769..77602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0077"
FT                   /product="BIOTIN-[ACETYL-COA-CARBOXYLASE] SYNTHETASE"
FT                   /function="1.5.3.1 : Biotin"
FT                   /EC_number="6.3.4.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1409631; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62750"
FT                   /db_xref="GOA:B2AG51"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62750.1"
FT                   /translation="MSWRIDAGALRAMLSPALRDWSLELVEETGSTNADLTARCRQAPW
FT                   SDAGKLRLAYRQTAGRGRQGRPWQGQAGMTFSVALPLALAPARLSGLSLAVGLALAEAL
FT                   RDVAPALGARVGLKWPNDLQIDGRKLAGILIESVPAGPQRVWAVIGIGLNLVRDAQMEA
FT                   ALGRELAGVAEAMPGFDAGRDAPRLLAAVLERLAAMRADFLAHGFGPMARRWSAADAYR
FT                   DQPVRLLHDGQVIAEGMARGVDEAGHLLLETPAGLERIASGELSLRPAPGQEGGA"
FT   gene            77599..78450
FT                   /locus_tag="RALTA_A0078"
FT   CDS_pept        77599..78450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0078"
FT                   /product="TRANSCRIPTION REGULATION ACCESSORY FACTOR,
FT                   similar to B.pertussis bvg"
FT                   /function="3.1.2.4 : Complex regulation"
FT                   /function="5.13 : Virulence associated"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7601846; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62751"
FT                   /db_xref="GOA:B2AG52"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62751.1"
FT                   /translation="MNAPRLLVDIGNTRLKWAWCEAGAPLPASTGTTVLPTPWQHAGAV
FT                   AHAADGALRTLAAELRALRAGGPMPSVWISNVAGPVIAAAVDAALADAFGGCAPVQWVR
FT                   SAAAHGDLVNGYREPTQLGVDRWVGAVGAHRWLPRDTLLVVTAGTATTLDIVTVAAEGG
FT                   ARFEGGLILPGLALMLGTLARNTAQLPALDVGEAGSVAGAQRRWADNTHDAIAAGCLAA
FT                   QAGAIERTWRALGERGDAARPPRCLLSGGARGALAGALAVPFEMHDNLVLLGLHAMAMA
FT                   DA"
FT   gene            78484..78696
FT                   /locus_tag="RALTA_A0079"
FT   CDS_pept        78484..78696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0079"
FT                   /product="conserved hypothetical protein; PUTATIVE SIGNAL
FT                   PEPTIDE PROTEIN (fragment)"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62752"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62752.1"
FT                   /translation="MTPRSLRIALLLLLFANAMLLAAVLGAFGAEPLSGWFESPREPHR
FT                   LEQQVRGERMRLQPHPATPASAPAA"
FT   gene            complement(78713..79207)
FT                   /gene="aut"
FT                   /locus_tag="RALTA_A0080"
FT   CDS_pept        complement(78713..79207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aut"
FT                   /locus_tag="RALTA_A0080"
FT                   /product="aut gene, putative Cytidylyltransferase"
FT                   /function="1.3.1 : Glycolysis"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8071217; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62753"
FT                   /db_xref="GOA:B2AG54"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62753.1"
FT                   /translation="MSVPAFESKLTPADDPAVLAARIAALPRPLVFTNGVFDILHRGHA
FT                   TYLAQARALGASLVVGVNSDASVKMLGKGDDRPLNHESDRMALLAALASVDLVAMFREQ
FT                   TPVELIRLVRPDIYVKGGDYDIDTLEETRLVRSWGGQAYAIPFLHDRSTTKLLTKVRQA
FT                   G"
FT   gene            79242..79505
FT                   /locus_tag="RALTA_A0081"
FT   CDS_pept        79242..79505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0081"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62754"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62754.1"
FT                   /translation="MAEPACLPEWYLFLRLAPGTVAADAPAPPHWRGHGTDVVTGYYLR
FT                   VRWRAYHPRHRISGNRKTALHPTRQGRTGSGAPQRAAFVGNA"
FT   gene            complement(79575..80438)
FT                   /locus_tag="RALTA_A0082"
FT   CDS_pept        complement(79575..80438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0082"
FT                   /product="Putative ferritin/ribonucleotide reductase-like
FT                   protein"
FT                   /function="1.4 : Energy production/transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62755"
FT                   /db_xref="GOA:B2AG56"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62755.1"
FT                   /translation="MLYPELFKSLEAVRWHMDKDIPWESFDATMLTDDQAKTIRMNAIT
FT                   EWSALPATEMFLRDNRHDSDFSAFMSIWFFEEQKHSLVLMEYLRRFRPDLVPTEEELHA
FT                   VRFEFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHTEPVIKHIYRTLSQDEARHGGAYL
FT                   RYMKKYLAQFGDSARAAFAKIGVLMASARRTEKPLHPTNLHVNKALFPNDTVQSRLPDP
FT                   DWLEHWLDEQIRFDEGWEKKVIERILHNMSLLFERTFETVQDLNRYRKELNASLQGAGA
FT                   ARPAQA"
FT   gene            complement(80640..81917)
FT                   /locus_tag="RALTA_A0083"
FT   CDS_pept        complement(80640..81917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0083"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62756"
FT                   /db_xref="GOA:B2AG57"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62756.1"
FT                   /translation="MHRDSLPLPPAAPASGPNPAATALIMMGGGARAAYQAGVLNGVAR
FT                   IAARLGKVQAALPFGIIAGTSAGAINGAGLAIHAGDFQAATQSLGALWHSIHADEVYRT
FT                   DVLRVGVSGARWLSTLALGWVTQRRAPRALFDNTPLGSMLGELFEPARVQASLDSGALQ
FT                   AFAVTALSYSTGRHVTFYQSHHRIHPWHRSQRIAVPAQITVDHLLASSSIPFLFPAMPL
FT                   ELDGHHEWFGDGTMRQMSPLSPAIHLGASRILAIGAASRQRSGWFDTMPGGGYPSLAQV
FT                   GGQALASIFLDGLNADLERLQHINRLLARMPEVAGDREGWRPVQVMTVAPSEPIEAIAA
FT                   EHQKQLPRTVRALLAPLGGTEARGAAFASYLLFEPAFTQALIALGERDAAAQADELAAF
FT                   LYGVVPGTAPAAPGAGDRAAEQAVSP"
FT   gene            complement(81955..82764)
FT                   /locus_tag="RALTA_A0084"
FT   CDS_pept        complement(81955..82764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62757"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62757.1"
FT                   /translation="MFGQIPDFTNGFDFMRRLWGGGAGMPAGLMPGLQAMTPPMDLEDL
FT                   DKRIADLKAVESWLQLNTNLLRTTIQGLEVQRATLVALQTFGNALSPEAMQSAMENVAR
FT                   AANAPSAEAPQRTGADTGSGGGAPAEPPAAEPAQAAADEGDAADAAPAPNAALWWDMLQ
FT                   QQFNQIASSAAAASMVPFGMGGFGATGAAAAAAPAGAAQAAPETPKPAAAGKAPSAGTA
FT                   RPAAKKAPAKKAAARKSANAKPARKDSEGGEGSGNGSNNGAGGSVTN"
FT   gene            complement(82830..83705)
FT                   /locus_tag="RALTA_A0085"
FT   CDS_pept        complement(82830..83705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0085"
FT                   /product="putative ENOYL-COA HYDRATASE / isolerase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62758"
FT                   /db_xref="GOA:B2AG59"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62758.1"
FT                   /translation="MLAAPALASTEKAPMTTSTADTAALSPRYARYRALTLRRHGPILE
FT                   IVMGAAQSANQKLATADANMHRELAEIWRDVSADPDVRVALIRGEGKGFSAGGDLALVE
FT                   DMANDFDTRTRVWHEARDLVYNVINCDKPVVSAMHGPAVGAGLVAGLLADISIAAKTAR
FT                   IVDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLMLCESVSGEEAERIGLVSLAVDEDEL
FT                   VARAFEVANRLAAGSQSAIRWTKYALNNWLRMAGPAFDTSLALEFMGFAGPDVHEGMAS
FT                   LREKRPPQFR"
FT   gene            complement(83782..84762)
FT                   /locus_tag="RALTA_A0086"
FT   CDS_pept        complement(83782..84762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0086"
FT                   /product="putative 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway): COG0179"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62759"
FT                   /db_xref="GOA:B2AG60"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62759.1"
FT                   /translation="MKLATLKDGSRDGQLVVVSRDLKTAHYATDIAGKLQTVLDDWQFY
FT                   APQLQDLYDALNGGRARHPFPFVPKDCMAPLPRAYQWADGSAYVNHVELVRKARGAEMP
FT                   PEFWTDPLMYQGGSDDFLGPHDDIVCASEAFGIDFEAEVAVITGDVKMGATPEQAGEAI
FT                   RLVMLANDVSLRNLIPAELGKGFGFFQSKPATAFSPVAVTPDELGEAWRERKVHLPMTV
FT                   HWNSKKVGQPDCGTDMVFDFGQLIAHICKTRNVRAGSIVGSGTISNVDRKKGYCCIAEK
FT                   RMLETIDEGKPVTEFMKFGDAVKIEMFDAQGHSVFGAIDQVVAAP"
FT   gene            complement(84839..85837)
FT                   /locus_tag="RALTA_A0087"
FT   CDS_pept        complement(84839..85837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0087"
FT                   /product="conserved hypothetical protein, UPF0065"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12562821"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62760"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62760.1"
FT                   /translation="MRPPGYFRPVLAALSAVPLLALLGTASAPARADNWPSQPIRWVVP
FT                   YPAGGGTDVVARTVAQAITPGLGKQVVIDNRPGAATIVGADAVAHAKPDGYTVLTADTA
FT                   TLAANPSLYKKLPYNADKDFVYIGQLARFPLVLVANPNFPARTLKEAIDYAQKHPGKVN
FT                   FASPGAGSPHHLAMELFMDQTRVKMTHVPYKGAAPAVQDLLAGQVDLMFLDLASGQQNV
FT                   QAGKLRALGVATPRRLTVLPSVPTVAEGGVAGFEAYAWQGMVAPAGTPKAVVTRLNAEL
FT                   VKALKTPEVQKKLEGVGVEAVSSTPEEFASYARAEAERWGKLIKAKGITVD"
FT   gene            86017..86850
FT                   /locus_tag="RALTA_A0088"
FT   CDS_pept        86017..86850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0088"
FT                   /product="putative TRANSCRIPTIONal REGULATOR, IclR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62761"
FT                   /db_xref="GOA:B2AG62"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62761.1"
FT                   /translation="MSEIEEEDAKLRSGIQSIEVGFRLLQALAASPRAMMLRDLAAAAD
FT                   MNPAKAHRYLVSFMRLGAVAQDPVSGRYDLGPFALQLGLAGLNRLDPVKKARPILSQLR
FT                   DELDLTAGIAVWGNHGPTVVHWEESSHPVTVSLRLGDVMPMLNSATGRLYGAYLPRKQT
FT                   LPLIERELGARGHDVMPDMPRTLADYDAICAEVRKHGAARTLGGVLPGINAFSMPVFDA
FT                   NGHLAMGLIVLGAQSIFDAEWGGTMDRRVRAIAQQLSSELGYLGAATLAGQTGPA"
FT   gene            86936..87916
FT                   /locus_tag="RALTA_A0089"
FT   CDS_pept        86936..87916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62762"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62762.1"
FT                   /translation="MLAVVGLVRMPGPLIPVDVSNTPTLEAVLLPPPAPPAPPKPRPIA
FT                   RAPRPQPKPAAPRAEPEVPAPAPEPAPPLATSPQGTAAMAAGSGGEGSAAAPAAAAPAP
FT                   SGGPQGGVNGVRYSAPPSATMHYASFVNGVQNPDGLIRWEQDGSRYRLAVETRVLWFRF
FT                   AFQSSGALAEQGLLPERYEERRRNKVEASRIDAAAGTVAFASGAQAPFPPGAQDRFSVF
FT                   LQLVGLVRGNPQRYVTPGVTESFQVADTRDVEPMQVQYVGEVELDTGQGVVRAKHFVRL
FT                   PRRANDRRRVEVWLAQSLGWMPVRLRQTEPDGTQIDLVYRGKEGP"
FT   gene            87967..88809
FT                   /gene="pcaD2"
FT                   /locus_tag="RALTA_A0090"
FT   CDS_pept        87967..88809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD2"
FT                   /locus_tag="RALTA_A0090"
FT                   /product="B-KETOADIPATE ENOL-LACTONE HYDROLASE (putative)"
FT                   /function="1 : Metabolism"
FT                   /EC_number="3.1.1.24"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62763"
FT                   /db_xref="GOA:B2AG64"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62763.1"
FT                   /translation="MTVATPPTETRRIHADGAELHVRLDGADGPWVILAHALAADHTLW
FT                   DITARHLAGRYRVVRPDLRGHGASDAPLGPYTMTRLADDVVAVMDALQIPQAHFCGISV
FT                   GGMVGQSMGLRHPERLLSLTLVATNSQTPMEAHPMWHNRIGQAEAHGMASLADATLGRW
FT                   LTPAFHASHPDEVLRIRDMLVATPIRGYVGVAEAIMAFDLAGALSRIHCPTLVVAGEQD
FT                   QGATVAMAQSIAAAIAGSRLEVVPQAAHLVHVEQPERFHAALDAFLGSAACGGQCDVP"
FT   gene            89048..89305
FT                   /locus_tag="RALTA_A0091"
FT   CDS_pept        89048..89305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62764"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62764.1"
FT                   /translation="MQMIYNSDNYCIVEFGADVEQAPLEFGGYEIVDKNLKREIFLGGQ
FT                   LAESFRADVKRLIESEPSVEEVDDFLGKFDNVMTHPLVMH"
FT   gene            complement(89411..89803)
FT                   /locus_tag="RALTA_A0092"
FT   CDS_pept        complement(89411..89803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0092"
FT                   /product="conserved hypothetical protein, weak
FT                   Rhodanese/Cell cycle control phosphatase domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62765"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62765.1"
FT                   /translation="MQHLSPTDANALLAQSPETLFIDCRSEMEYLFVGHPKGAHNVPWN
FT                   DGPDWEVNPHFVQMVKKLAGQASARPVLLICRSGNRSSAAARALEGAGFSNVQYVLHGF
FT                   EGDLDAQRHRNTLNGWRHDGLPWEQY"
FT   gene            90000..91061
FT                   /gene="metHa"
FT                   /locus_tag="RALTA_A0093"
FT   CDS_pept        90000..91061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metHa"
FT                   /locus_tag="RALTA_A0093"
FT                   /product="5-METHYLTETRAHYDROFOLATE--HOMOCYSTEINE
FT                   METHYLTRANSFERASE (METHIONINE SYNTHASE, VITAMIN-B12
FT                   DEPENDENT ISOZYME) PROTEIN"
FT                   /function="1.5.1.9 : Methionine"
FT                   /function="1.5.3.13 : Cobalamin (Vitamin B12)"
FT                   /function="1.7.17 : Formyl-tetrahydrofolate biosynthesis"
FT                   /function="1.7.20 : S-adenosyl methionine biosynthesis"
FT                   /EC_number="2.1.1.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62766"
FT                   /db_xref="GOA:B2AG67"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62766.1"
FT                   /translation="MSAPESRAAAPRPYTRAAELPRLLQERILILDGAMGTMIQRYKLS
FT                   EADYRGTRFAEHKVDVKGNNELLLLTRPQVISEIHEQYLAAGADLIETNTFGATRVAQE
FT                   DYKMADLAYEMNVEAARLARAACDKYSTPDKPRFVAGAFGPTPKTASISPDVNDPGARN
FT                   VTFEELRQSYYEQGKALLEGGADVFLVETIFDTLNAKAALFAIDQLFEDTGERVPVMIS
FT                   GTVTDASGRILSGQTVEAFWNSLRHARPVTFGLNCALGATLMRPYIAELAKVCDAAVSC
FT                   YPNAGLPNPMSDTGFDETPEVTSALVEEFAASGLVNLVGGCCGTTPEHIAAIAQRVADK
FT                   KPRTWPGQYRDAA"
FT   gene            91079..93826
FT                   /gene="metHb"
FT                   /locus_tag="RALTA_A0094"
FT   CDS_pept        91079..93826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metHb"
FT                   /locus_tag="RALTA_A0094"
FT                   /product="5-METHYLTETRAHYDROFOLATE--HOMOCYSTEINE
FT                   METHYLTRANSFERASE (METHIONINE SYNTHASE, VITAMIN-B12
FT                   DEPENDENT ISOZYME) PROTEIN"
FT                   /function="1.5.1.9 : Methionine"
FT                   /function="1.5.3.13 : Cobalamin (Vitamin B12)"
FT                   /function="1.7.17 : Formyl-tetrahydrofolate biosynthesis"
FT                   /function="1.7.20 : S-adenosyl methionine biosynthesis"
FT                   /EC_number="2.1.1.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62767"
FT                   /db_xref="GOA:B2AG68"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62767.1"
FT                   /translation="MSENKLPPRPMRLSGLEPFTIDDDTLFVNVGERTNVTGSKAFARM
FT                   ILNGQFDEALAVARQQVENGAQIIDINMDEAMLDSKAAMVRFLNLIASEPDIARVPIMI
FT                   DSSKWEVIEAGLQCVQGKPVVNSISLKEGEEQFRHHAELIRRYGAASVVMAFDEKGQAD
FT                   TFARKTEICQRSYDILVNEVGFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEATRWIKQ
FT                   NLPYAKVSGGVSNVSFSFRGNDVVREAIHTVFLYHAIAAGMDMGIVNAGQLGVYDQLDP
FT                   ELRERVEDVVLNRRDDATDRLLEIADKFKGGGAKKEENLAWRGTPEQPVPVGERLAHAL
FT                   VHGITTFIVEDTEEVRQQIAARGGRPIEVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSA
FT                   RVMKQAVAHLLPFIEEEKRLLAEAGGDVKARGKIVIATVKGDVHDIGKNIVSVVLQCNN
FT                   FEVVNMGVMVPCNEILAKAKVEGADIVGLSGLITPSLEEMAYVASEMQRDDYFRVKKIP
FT                   LLIGGATTSRVHTAVKIAPNYEGPVVYVPDASRSVSVASSLLSDEGAAKYLDELKSDYE
FT                   RIRTQHANKKATPMVTLAQARANKTPIDWSGYVPPKPKFIGRRVFRNYDLAELANYIDW
FT                   GPFFQTWDLAGKFPDILNDEIVGESARKVFSDGKAMLSRLIQGRWLSANGVIALLPANT
FT                   VNDDDIEIYTDETRSKVALTWHNLRQQSERPVVDGVRRPNRCLADFVAPKDSGIADYVG
FT                   LFAVTAGLGVDKKEAQFEADHDDYSAIMLKALADRLAEGFAECLHERVRKDLWGYDAAE
FT                   ALSNDELIAEQYRGIRPAPGYPACPEHTVKGPMFEFLDAAEIGMGITESLAMTPAASVS
FT                   GFYLAHPESTYFTIGKIGQDQLDDMAARRHEDRATLARALAPNL"
FT   gene            94089..94550
FT                   /locus_tag="RALTA_A0095"
FT   CDS_pept        94089..94550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0095"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62768"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62768.1"
FT                   /translation="MKKLLLSLSALSIAAASSLAMAQGTGAAVGAKADVGASVTTPSPA
FT                   AAAQGGLNAVGGAATGAAGAAEKGLSTAGAATDKGLSAAGTAADKGLSTAGAAVDKGVG
FT                   TAADATGSAKAEAGSKARHGKHAAKSTKKSKADANVGVSAGAEAGAKAQ"
FT   gene            94870..95502
FT                   /gene="vsrD"
FT                   /locus_tag="RALTA_A0096"
FT   CDS_pept        94870..95502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vsrD"
FT                   /locus_tag="RALTA_A0096"
FT                   /product="RESPONSE REGULATOR, LuxR family"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /function="3.1.2.4 : Complex regulation"
FT                   /function="5.13 : Virulence associated"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7868600, 11073909; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62769"
FT                   /db_xref="GOA:B2AG70"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62769.1"
FT                   /translation="MIRVLIADDHEIVRAGLRQFISEEPDIQVTGEAGSGDEVMAQLRD
FT                   GEFDVLVLDISMPDRNGIDVLKLIRQRKPDLPVLILSTYPEDQYAINLIRAGASGYLTK
FT                   ESAPDDLVKAIRTVAQGRRYVSATVADLLIGGLDKPTEQPVHQMLSEREFQIFCKLSRG
FT                   QSVSVIADELFLSVKTVSTYRSRILEKMGMKTNADLTYYAIKNGLVE"
FT   gene            95558..95965
FT                   /locus_tag="RALTA_A0097"
FT   CDS_pept        95558..95965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0097"
FT                   /product="putative response regulator, CheY family"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62770"
FT                   /db_xref="GOA:B2AG71"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62770.1"
FT                   /translation="MSEQDSNTSYRALNVLLIEDSAVLRGMLLEYLKDFPFIENVDWAD
FT                   TEALALRLLAAGSYDVAIVDLQLRQGNGINVLRAMQRDGSDTVRIVYTNHAQLEMYRRQ
FT                   CAEAGADYFFDKSLELEQVFRVIEEHAAPQG"
FT   gene            complement(95970..97373)
FT                   /gene="vsrA"
FT                   /locus_tag="RALTA_A0098"
FT   CDS_pept        complement(95970..97373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vsrA"
FT                   /locus_tag="RALTA_A0098"
FT                   /product="sensor histidine kinase"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /function="3.1.2.4 : Complex regulation"
FT                   /function="5.13 : Virulence associated"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7868600, 11073909; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62771"
FT                   /db_xref="GOA:B2AG72"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62771.1"
FT                   /translation="MFKQSFLPHTLLLAGGILLTLAVLVASETGNIRLRESYTDVIRSQ
FT                   RLQTELAALNGELVNAEAGQRGFLLTGKESYLEPYYKALPRIAELMAQIRAGYANDPEG
FT                   LKQFGDTSKLVNSKLNEMALTLVYGKRDLEVALDLIRTDYGKQTMDNARRGLDQLQARE
FT                   AGAVSHRLEGAENDVQLSRYGIGLLTAINIILLMAVGIGHAKRLAMAEAVRTQLEEESV
FT                   RLDRKVRARTRQLSALAGHLQRVTEDEKTRLARELHDELGAILTAIKLDLHWVRRKVQA
FT                   DHPVAAERLTRVMLHVDQGIQIKRRLIEDLRPTVLLNLGLRAAVCQLVEEVGARNNWET
FT                   EVSVPEDLPALRDEAAIALYRIVQESLTNASKYSQARHVEVSLDCEGELLTLTVRDDGK
FT                   GLPPDFDASSQAGHHGLLGMEQRVTALGGSMRIDSSPDAGVRIRIEVPLTASVLAPAEE
FT                   PESPEPARA"
FT   gene            97695..97862
FT                   /locus_tag="RALTA_A0099"
FT   CDS_pept        97695..97862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0099"
FT                   /product="conserved hypothetical protein, DUF1328"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62772"
FT                   /db_xref="GOA:B2AG73"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62772.1"
FT                   /translation="MLQYALVFFVIALIAAIFGFGGIAAGAVEIAKILFFIFLVVALVA
FT                   AVMGLVRRGR"
FT   gene            97915..98343
FT                   /locus_tag="RALTA_A0100"
FT   CDS_pept        97915..98343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0100"
FT                   /product="conserved hypothetical protein, DUF883"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62773"
FT                   /db_xref="GOA:B2AG74"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62773.1"
FT                   /translation="MLTQNPKVRKELNHLSDSADSAIRHIKHAARDTREAAAPVSSEVK
FT                   SLISQLEHTIQVLAREGSAESLQAGHRLRERASDMAHRLRAQTADGMMRARERVDGAVV
FT                   QAQHRVAESPLKAVAIAAAVGALIGLLLANGRHHADEE"
FT   gene            complement(98521..98844)
FT                   /locus_tag="RALTA_A0101"
FT   CDS_pept        complement(98521..98844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62774"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62774.1"
FT                   /translation="MLITFKSHAAQDLIMMKDLAVTLLGIIGKHLGERGVITVEELPQA
FT                   IHKLEAAVADARRVHPADTAVEARPDAEEDEEEPLHLGQRAYPFLDMLRASQREGANVL
FT                   WGV"
FT   gene            99122..100909
FT                   /gene="argS"
FT                   /locus_tag="RALTA_A0102"
FT   CDS_pept        99122..100909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="RALTA_A0102"
FT                   /product="ARGINYL-tRNA SYNTHETASE (ARGININE--tRNA LIGASE)
FT                   PROTEIN"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /EC_number="6.1.1.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62775"
FT                   /db_xref="GOA:B2AG76"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62775.1"
FT                   /translation="MLPVQTSNLAAAFTDAVRALAPADATLPAVTFERPKVAAHGDLAC
FT                   NVAMQVARALKSNPRELAQRIVAAVEADARAQGLVAGMDIAGPGFINLRLTPSAKADVL
FT                   RAVLNEGDHYGARERGVHGQVLVEFVSANPTGPLHVGHGRQAALGDALANLLSWQGWHV
FT                   HREFYYNDAGVQIQTLALSVQARARGLKPGDASWPEAAYNGDYIADIAADFLAGKTVSA
FT                   SDGEPVTASGNVEDIDSIRKFAVTYLRNEQDIDLQAFGVKFDRYYLESSLYSDGRVDAA
FT                   VQSLIDKGKTYESEGALWLRTTDDGDDKDRVMKKSDGTYTYFVPDVAYHTTKWERGFTK
FT                   VINVQGSDHHGTIARVRAGLQGLDIGIPQGYPDYVLHKMVTVMKNGEEVKISKRAGSYV
FT                   TVRDLIEWSNGGDETIRGCLEQGVADWPAHFTRGRDAVRFFLLSRKADTEFVFDVDLAL
FT                   KQNDENPVYYVQYAHARICSIFESWGGADWESRLAELAGADLSAVTGADASAQALALGR
FT                   RLAEFPDMLAAAAAELAPHAVAFYLRDLAGDFHAFYNADRVLVDDEAVKRARLALLAAT
FT                   RQVLRNGLAVIGVSAPRRM"
FT   gene            101034..101750
FT                   /locus_tag="RALTA_A0103"
FT   CDS_pept        101034..101750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0103"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62776"
FT                   /db_xref="GOA:B2AG77"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62776.1"
FT                   /translation="MQQQRKRESRNVRRSQQRGGTFLGLVLGLIVGLAIAVVVALYITK
FT                   SPTPFQQKHAPRPSEPGNVASQLPAPAQRPDEGPSDPNKPLWSKTPAKPVGQAPEPEPR
FT                   QNGQPPVATTRPAEKPLDKPMEKPVEKPADKPLASKPAEKPVSDPIAEIAQADAHKVGY
FT                   LLQVGAFRSSDDADRQKANLAMQGFEARITERDVNGVKMYRVRLGPFNRIEDMNKARDR
FT                   LQSSGFEASVIRFTKQ"
FT   gene            101889..102524
FT                   /gene="dsbA"
FT                   /locus_tag="RALTA_A0104"
FT   CDS_pept        101889..102524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="RALTA_A0104"
FT                   /product="periplasmic protein disulfide isomerase I"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10711598, 12498799; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62777"
FT                   /db_xref="GOA:B2AG78"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62777.1"
FT                   /translation="MKKLAALFAMFAAVGGLLMSAPSQAAPTEGKEYQVLKTPQPVAAG
FT                   KIEVTEFFWYGCPHCYDFEPDLEAWVKKQGGNVVFKRVPVAFRDDLLPHTKIFYALEAI
FT                   GKLDAMHMKVFNAIHVDRKRLTDTNEIADFMAKNGVDRKAFLDAYNSFTVTTNSQRANK
FT                   IADAYKIDGVPTVVVQGKYVTSPSIAGNKQGAVQTMDYLVEQIKAKKM"
FT   gene            102641..103444
FT                   /locus_tag="RALTA_A0105"
FT   CDS_pept        102641..103444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0105"
FT                   /product="putative DEHYDROGENASE/REDUCTASE OXIDOREDUCTASE"
FT                   /function="1.4 : Energy production/transport"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62778"
FT                   /db_xref="GOA:B2AG79"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62778.1"
FT                   /translation="MRPLKVFLTGASSGLGQALAREYASQGAILGLVARREDALREFVA
FT                   TLPNPGAVRVYGADVRDADAMARAAEDFLGHFGCPDVVIANAGVSVGTVASEREDLDAF
FT                   RQVMDTNWFGVLTTFQPFMHAMQQREPGPGGRRGTLVGIASVAGVRGLPGAGAYSASKS
FT                   AVIKLLESLRLEQRPLGIRVVTIAPGYIRTPMTAKNPYRMPFLTDADVFARKAARVIAA
FT                   GRRFRVIPWQMGVVAGLMHVMPRWLYDMLATGAPRKPRRGDSKEP"
FT   gene            103447..104280
FT                   /locus_tag="RALTA_A0106"
FT   CDS_pept        103447..104280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0106"
FT                   /product="putative periplasmic metal binding protein"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62779"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62779.1"
FT                   /translation="MWTDAIGQQHAAASGEVRIASLVPSVTELLFALGLESQLVARTGF
FT                   CIHPEPAVRAVPKVGGTKDVRVARLRELAPTHVVVNIDENRRETVDEIRAFVPNVIVTH
FT                   PCAPDDNLPLYRLLGGIFGRHAEAESLCAALQAELDAIRARAWPARHVLYAIWQDPWMT
FT                   VSRDTYISRMLALANWQTWPGGAGAVQACEGGDCSRPNAPGERYPTFRWSDALVRELDL
FT                   VLLSTEPYRFTEDHADALERQLGKPVLLVDGEMLSWYGSRAVDGVRYLAALAAAN"
FT   gene            complement(104427..105503)
FT                   /locus_tag="RALTA_A0107"
FT   CDS_pept        complement(104427..105503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0107"
FT                   /product="putative enzyme, Metallo-beta-lactamase
FT                   superfamily"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62780"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62780.1"
FT                   /translation="MNALEHQLQYPFGDTMPAPGAKQEVAPGVYWLRMPLPFALDHINL
FT                   WLLRDRLDGRDGWTIIDCGITNDTIKAHWETIFANELEGLPVVRVLVTHSHPDHVGLAH
FT                   WLCRRFGVRLWMSLGDYMSARVMGSGTGAGSSAGGEAAAAHFALHGLTDADSQEKLRAR
FT                   KTYYPSLVPDLPAQYRRLMEGDTVRIGTDAATSGWRVITGFGHSPEHVALYNAATNVLI
FT                   SGDMVLPRISTNVSVFDMEPEGNSLQLYLDSLGKYEPLPQDVLILPSHGRPFRNLHTRI
FT                   MQLREHHADRLAETLQACREKPCSAHDIVSVIFKRQFDIHQMTFAMGESLAHLHCLWHR
FT                   GELVRQLDDDGVYRFRAA"
FT   gene            105710..106150
FT                   /locus_tag="RALTA_A0108"
FT   CDS_pept        105710..106150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0108"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62781"
FT                   /db_xref="GOA:B2AG82"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62781.1"
FT                   /translation="MSATPAAATATYTITDLAREFDVTPRAIRFYEDQGLLSPQREGPG
FT                   GRKRVYNGRERTRLKLTLRGKRLGLTLNEIREILDLYESPRDTAPQLDRFLVALAAHRR
FT                   TLERQMEDLQAQLAEIDQHERQCRALLAAQSGDDAPDKTHAA"
FT   gene            106274..106750
FT                   /locus_tag="RALTA_A0109"
FT   CDS_pept        106274..106750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0109"
FT                   /product="putative Thioesterase/thiol ester
FT                   dehydrase-isomerase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62782"
FT                   /db_xref="GOA:B2AG83"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62782.1"
FT                   /translation="MTASLAHAVPAEPEPLSAARAGAIATSFSRQGLMRTFGAELARVQ
FT                   RGEVELAMPWSEGVTQQHGFFHGGVVGALADSACGYAALTLVGEEEAGLTAEYKINLLS
FT                   PAQGERLVAVGRVLKPGRTLIVAQGDVYVEQDGRRKPVATMLMTLCVVKTLGHV"
FT   gene            106826..108007
FT                   /locus_tag="RALTA_A0110"
FT   CDS_pept        106826..108007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0110"
FT                   /product="putative ACYL-COA DEHYDROGENASE OXIDOREDUCTASE"
FT                   /function="1.4 : Energy production/transport"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62783"
FT                   /db_xref="GOA:B2AG84"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62783.1"
FT                   /translation="MTELPGLKFDLGEDIEMLRGAVRDWAQAELAPRAGEIDRTDQFPM
FT                   DAWKKMGDLGVLGITVAEEYGGANMGYLAHMIAMEEISRASASVGLSYGAHSNLCVNQI
FT                   HRNGTAAQKAKYLPKLVSGDWIGALAMSEPNAGSDVVSMKLRAQLKGDRYVLNGTKMWI
FT                   TNGPDCDVLVVYAKTEPELGARGMTAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFED
FT                   VEVPVENILGAENGGAKVLMSGLDYERAVLSGGPVGIMQACMDVVTPYIHDRKQFGQSI
FT                   GEFQLIQGKVADMYTTLQAARSYLYTVGKNLDALGSDHVRQVRKDCAAVILYTAEKATW
FT                   MAGETVQILGGNGYINEYPAGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETM"
FT   gene            108134..109981
FT                   /gene="aceK"
FT                   /locus_tag="RALTA_A0111"
FT   CDS_pept        108134..109981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceK"
FT                   /locus_tag="RALTA_A0111"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /function="1.7.2 : Glyoxylate bypass"
FT                   /function="2.3.3 : Posttranslational modification"
FT                   /function="3.1.3.2 : Covalent modification, demodification,
FT                   maturation"
FT                   /EC_number="2.7.11.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12193617; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62784"
FT                   /db_xref="GOA:B2AG85"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62784.1"
FT                   /translation="MSHFPKLLSSQIAYDVARTMLDGFDKHYRLFREVSHQAKLKFEAG
FT                   DWHGLQQIQRDRIAFYNERVRESSVILEDEYDAENIEDEIWQQIKLHYIGLLTNHHQPE
FT                   LAETFFNSVCTRILHRSYFNNDFIFVRPAISTEYIENEESPTRPTFRAYYPGSREGMAA
FT                   CFERIVHNFQLERPFEDLQRDIGYVVRAVGEHFGDLRIAPNFQIHTLSSLFFRNKAAFI
FT                   IGRILNGDRTFPLAIPILHGPSGKLVLDTVLLKKEQLLILFSFTHSYFMVDMEIPSAYV
FT                   TFLRDIMPRKPRAEIYTSLGLQKQGKNLFYRDFLHHLQHSSDKFIVAPGIRGLVMLVFT
FT                   LPSYPYVFKVIRDVFPAPKETTRELVKSKYQLVKQHDRVGRMADTLEYSDVAFPLSRFD
FT                   EALVREFEQHAPSMIEYQRAKDGGEEIVVRHVYIERRMTPLNIYLQEGSDAQVEHGVIE
FT                   YGNAIKELIAANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNIRHVPQPRNEEEE
FT                   MSGEVWYTVRPHDIFPETFRTFLLGDPRVGAAFLRHHADFFDPAMWQSHKDRLLAGHVH
FT                   DFFAYHASDRFIHRYGAAAEPPATPPVKQPDAGPARRVA"
FT   gene            109978..110649
FT                   /gene="can1"
FT                   /locus_tag="RALTA_A0112"
FT   CDS_pept        109978..110649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="can1"
FT                   /locus_tag="RALTA_A0112"
FT                   /product="carbonic anhydrase"
FT                   /function="1.7 : Central intermediary metabolism"
FT                   /EC_number="4.2.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62785"
FT                   /db_xref="GOA:B2AG86"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62785.1"
FT                   /translation="MNDAIAQLFRNNRDWVDRVNAEDPAFFTRLANQQAPEYLWIGCSD
FT                   SRVPANQILGLAPGEVFVHRNIANVIAHSDLNALSVIQFAVEVLKVRHITVVGHYGCGG
FT                   VKVALKRERIGLADNWLRHVRDVADKHESYLGTILREEDAHTRLCELNVIEQVNNVCQT
FT                   TVIQDAWARGQAITVHGWIYGVSDGLLRDLGMAASNNDELHEQLAAAYRQYGEPPQASI
FT                   R"
FT   gene            110704..111882
FT                   /locus_tag="RALTA_A0113"
FT   CDS_pept        110704..111882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0113"
FT                   /product="putative acetyl-CoA acetyltransferase with
FT                   thiolase domain"
FT                   /function="1.1.2.1 : Degradation of short-chain fatty
FT                   acids"
FT                   /EC_number="2.3.1.9"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62786"
FT                   /db_xref="GOA:B2AG87"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62786.1"
FT                   /translation="MEEIVIVSAARTPMAAFQGEFASVTAPQLGAVAIRAAVERAGLKP
FT                   EQVEEVVFGCVLPAGQGQAPARQAALGAGLPLGTGCTTVNKMCGSGMRAAMTVYDGLVA
FT                   GSFEIAVAGGMESMTNAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYDKGRAMGTFGE
FT                   DCAAKYGFTRQQQDEFAMESVRRAQQATENGDFRWEIAPVTVSGKGGDTVIDTDEGPRR
FT                   IKLDKIPSLKPAFAKDGTITAASSSSINDGASALVMMRASTAKKLGLQPIARMLGHTTH
FT                   AQAPGWFTTAPVEAIAKLYRKLDWNTGSVDLFEINEAFAVVPMAAMHDLKIPRDKVNIH
FT                   GGACALGHPIGASGARIMTTLIGALRKTGGKRGVASLCIGGGEATAVGIEIL"
FT   gene            112057..112737
FT                   /locus_tag="RALTA_A0114"
FT   CDS_pept        112057..112737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0114"
FT                   /product="putative Short-chain dehydrogenase/reductase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62787"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62787.1"
FT                   /translation="MPTALILGASRGIGLEFVRQYRADGWRVIAAARTPEGVGALQALG
FT                   AEAHQADLSDAGAVAGLGWKLDGEALDVAVYNAGVMGPRTDSAQPVTPPEFDRVMHVNV
FT                   LGPMMALPLLLPYVEAGQSGHGGVLAVLSSRMGSIGAMEHSTSWLYRVSKAGANAALRA
FT                   VSLDARHATCIALHPGWVKTDMGGQEADLTVQQSVKGMRQVLASVKRRDNGTFHNYDGT
FT                   PIPW"
FT   gene            112768..113898
FT                   /locus_tag="RALTA_A0115"
FT   CDS_pept        112768..113898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0115"
FT                   /product="putative ACYL COA DEHYDROGENASE OXIDOREDUCTASE
FT                   PROTEIN"
FT                   /function="1 : Metabolism"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62788"
FT                   /db_xref="GOA:B2AG89"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62788.1"
FT                   /translation="MLLTPEQEMIRDAVRQFAQEVIAPQAAQWDRDKTFPKDVHRELAA
FT                   LGAYGVAVPEQYGGAGLDYLSLALILEEIAAGDGGTSTVISVNNCPVCSMLMSFASEAQ
FT                   KQQWLVPLARGEMLGAFCLTEPHVGSDAAALRTSAVRDGDHYVLNGVKQFITSGQNADV
FT                   AIVLAVTDKAAGKRGISAFIVPTSTPGYVVARLEDKLGQHSSDTAQILFEDCRVPAANL
FT                   LGDEGGGYKMALSGLEGGRIGIASQSIGMARAAFEAALAYAKERESFGQPLFQHQAVQF
FT                   RLAEMATRIDVARQMVWHAAALRDAGRQCLKEAAMAKLFASEMAERVCSDAIQVFGGYG
FT                   YVSDFPVERIYRDVRVCQIYEGTSDIQKILIARALA"
FT   gene            114000..114656
FT                   /locus_tag="RALTA_A0116"
FT   CDS_pept        114000..114656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0116"
FT                   /product="putative thioredoxin oxidoreductase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62789"
FT                   /db_xref="GOA:B2AG90"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62789.1"
FT                   /translation="MTAAIDFYFDFSSPYGYFASTRIDDLAQKYGRNVAWHPILLGVVF
FT                   KTTGASPLPQLPLKGDYSWRDFERTARFHGIEYKRPTHFPLPTTHAARAMLWLQNHHGD
FT                   DLAAAFARSVYRALFVDDINIAEPAEIMKLAEPLGVDVQALDAGATSYQIKDQLKAEIE
FT                   VAMAKGVFGSPFVIVDGEPFWGFDRFDQIEAHLKSRRQTELRAVPNPDTKEKKPA"
FT   gene            114653..115339
FT                   /locus_tag="RALTA_A0117"
FT   CDS_pept        114653..115339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0117"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62790"
FT                   /db_xref="GOA:B2AG91"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62790.1"
FT                   /translation="MTAATPGHSGRFDCVIFDCDGVLVDSEPIVNRVLNQMLNELGIEI
FT                   SLEDSTRLFLGRAVREELDMIERMRGAPLPENWLSTWLARRNAVLEEEVAAVAHVREAI
FT                   RAVAATGMPVCVASGADRVKVKLQLTKTGLVELFQQDEREHIFSATEVARSKPAPDVYL
FT                   LAARTMGVEPARCAVVEDSPTGVTAGVAAGMTVFGYAARNDAAQLREAGARTIFTDMRE
FT                   LPELVG"
FT   gene            115336..115794
FT                   /locus_tag="RALTA_A0118"
FT   CDS_pept        115336..115794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62791"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62791.1"
FT                   /translation="MTGMKAARATRAAQRLPKAGPVPCPCGSADYDACCGRFHRGEALP
FT                   PNAEALMRSRYSAYVLNDMDWLRQTWHASTCPADLVPDTATRWLGLAVKGHAQQDDTHA
FT                   EVEFVARYKVGGRAWRLHERSRFVCEARAPGEAPRWLYVDGDIIGEAP"
FT   gene            115791..116468
FT                   /locus_tag="RALTA_A0119"
FT   CDS_pept        115791..116468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0119"
FT                   /product="putative Glutathione S-transferase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62792"
FT                   /db_xref="GOA:B2AG93"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62792.1"
FT                   /translation="MSTDKRHEPEYLLYCFAQSGNAYKVAQLLETVGVQRGQPLWQARF
FT                   VDFFNGETRTPEYRAINVMGEVPVLEFGGQRLSQSGAILETLAARLDAFGPRNEAERAE
FT                   VLRWLLFDNHKFTSYTATYRFMRTFARSPDPAVLDFFRARCEGAWNVLNAHLAGRDFVL
FT                   GERTTIADFSLAGYVFFDDEIGVHWRKEYPHIHAWTERMRALPGWKHPYELMPGHPLPK
FT                   AAG"
FT   gene            116533..118140
FT                   /locus_tag="RALTA_A0120"
FT   CDS_pept        116533..118140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0120"
FT                   /product="putative PROPIONYL-COA CARBOXYLASE"
FT                   /EC_number="6.4.1.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62793"
FT                   /db_xref="GOA:B2AG94"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62793.1"
FT                   /translation="MPTLESKLNARSESFKANAEAMRALVADLKAKIAKLAEGGGADAR
FT                   AKHLARGKLLPRERVQQLLDPGTPFLELSQLAAYDMYDDAAPGAGIITGIGRVAGQECV
FT                   IVCNDATVKGGTYYPMTVKKHVRAQEIAEENHLPCIYLVDSGGANLPNQDEVFPDRDHF
FT                   GRIFYNQANLSKRGIPQIAVVMGSCTAGGAYVPAMSDESIIVKNQGTIFLGGPPLVKAA
FT                   TGEEVSAEDLGGADVHTRLSGVADYFAQNDHHALSLARNIVQHLNRRKPDQIRLHEPVE
FT                   PLYPVEELYGVIPTDTRKPYDVREVIARIVDGSEFDEFKARYGTTLVCGFARIWGYPVG
FT                   IVANNGILFSESALKGAHFIELCCQRKIPLVFLQNITGFMVGRKYENEGIARNGAKMVT
FT                   AVATAQVPKFTVIIGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVR
FT                   RDGIEAKGGQWSAEEEEAFKQPIRDQYEHQGHPYYASARLWDDGVIDPAQTRTVLGLGL
FT                   SASLNAPIDEMKFGVFRM"
FT   gene            118172..119068
FT                   /locus_tag="RALTA_A0121"
FT   CDS_pept        118172..119068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0121"
FT                   /product="putative lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62794"
FT                   /db_xref="GOA:B2AG95"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62794.1"
FT                   /translation="MRRTACLFRRLALATVLAMLAPLCGHAQMADGNGQSAARVRFQEQ
FT                   VVMLPKAAIPSRIDLEATVFKPAGAGPFPLVVINHGKAPGRPAMQGRARFPAQSVEFLR
FT                   RGYAVVLPMRQGFARSGGAYVGGSCDIETNGMMQADDVVATLDYMATQPYVDMDRIVVI
FT                   GQSHGGLTTMAFSTIAYPGVRGVVNFAGGLRNLNCPDWEERLVDAFASYGSVARYPSLW
FT                   IYGENDSYWPVPLPGRMFNAFKARATGPAAQARLVDVGEFGADSHRLFSAREGIPVWLP
FT                   EVGDFFRSLGLPFDPGT"
FT   gene            119121..119909
FT                   /locus_tag="RALTA_A0122"
FT   CDS_pept        119121..119909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0122"
FT                   /product="putative ENOYL-COA HYDRATASE PROTEIN"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62795"
FT                   /db_xref="GOA:B2AG96"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62795.1"
FT                   /translation="MEFTALTVNIANHVATVTLNRPDVRNAFNETVIAELTGAFRALGD
FT                   MDEVRAIVLAGNGPAFCAGADLNWMKKMAGYSDDQNRADALTLAQMLHTIWSCPRPVIA
FT                   RIQGDTYAGGMGLVAACDIAVAAEHAHFCLSEARLGLLPATISPYVIRAMGEQAARRYF
FT                   ITAERFDAAEALRLGLLHAVVPAEALDAKVAELTAALVANSPNAVRESKRLVQDIAGRA
FT                   IDNDLLADTAERIAKIRASEEGREGVKSFLEKRTPSWRPA"
FT   gene            120150..121568
FT                   /gene="bioA"
FT                   /locus_tag="RALTA_A0123"
FT   CDS_pept        120150..121568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="RALTA_A0123"
FT                   /product="7,8-diaminopelargonic acid synthetase,
FT                   PLP-dependent"
FT                   /function="1.5.3.1 : Biotin"
FT                   /EC_number="2.6.1.62"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14756557, 3058702; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62796"
FT                   /db_xref="GOA:B2AG97"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62796.1"
FT                   /translation="MDHLSLSPGSGAAGLGERSRAAVWHPCTRLRPDDDAVPLAIVRGE
FT                   GPWLHDADGQRYFDATSSWWVNLFGHANPRINAALASQLEALEHVMLAGCTHAPAVELA
FT                   ERLSALTGGALGNVFYASDGASAVEIALKMSFHYWRNTGLPAKREFVCLRHGYHGETVG
FT                   ALAVTDMEIFRDAYDALIRRAHVVMSPDARQARRGESAADVAARALAELEALLRERAGA
FT                   IAALIVEPLVQGAAGMAMHDPSYLDGVRALCDRYRVHLIADEIAVGCGRTGTFFAWEQS
FT                   RGTEAPLPAHAWPDFLCLSKGISGGYLPLSLVLSRPDIQRAFVADELARSFLHSHSYTG
FT                   NPLACRAALATLDLFAQDDVLARNRERAQWLADGMAALAADARVRHVRQRGLIWAADVC
FT                   DDVAGADFAARFHHAARARELLVRPIGNTLYVMPPYVFDAAQARWLGQQLLATLDDVTT
FT                   NAIDTAGKEVRHAA"
FT   gene            121558..122772
FT                   /gene="bioF"
FT                   /locus_tag="RALTA_A0124"
FT   CDS_pept        121558..122772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="RALTA_A0124"
FT                   /product="7-keto-8-aminopelargonic acid synthetase"
FT                   /function="1.5.3.1 : Biotin"
FT                   /EC_number="2.3.1.47"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3058702; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62797"
FT                   /db_xref="GOA:B2AG98"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AG98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62797.1"
FT                   /translation="MLLEQLKQAAEQRHALALTRRRRIAHTACAPHQAVGEEGTESESL
FT                   LTFCSNDYLGLANHPQVIAALVEGAQRYGAGSGASHLVSGHSLAHAQLEAELARWFAPH
FT                   IAQARTLYFCTGYMANMAVLTALGAAGATLFCESLNHASLIDGARLARADVQRYPHCDT
FT                   DALQALLAASTSARKLIVTDSVFSMDGNVAPLRRLLELAERHDAWIVVDDAHGFGVLGE
FT                   QGHGVLEALGLSSERLIYIGTLGKAAGVAGAFVAAHATIIEHLVNTARPYIYTTAAPPA
FT                   VAHALLASLAIIEGDEGRQRRAQLARCIATLREGLAQLAASAGWTLGDSQTAVQPLIVG
FT                   DNGAALALSAALEADGIRVGAIRPPTVPEGTARLRITLSAAHTEADVRRLLEALSAAVA
FT                   QREAA"
FT   gene            122769..123524
FT                   /gene="bioD"
FT                   /locus_tag="RALTA_A0125"
FT   CDS_pept        122769..123524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="RALTA_A0125"
FT                   /product="dethiobiotin synthetase"
FT                   /function="1.5.3.1 : Biotin"
FT                   /EC_number="6.3.3.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3058702; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62798"
FT                   /db_xref="GOA:B2AG99"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AG99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62798.1"
FT                   /translation="MNPRAPASLVAPFACFVTGTDTGVGKTHASATLLHALHAAGYRTA
FT                   GMKPVASGSEWRDGHWHNDDVAQLRAASSVAVPLGQTCPFLLRTPCAPHLAAAQEGVRI
FT                   TRAPIRDAFDALRRQADAVVVEGVGGFNVPLDAGAVRWNTADLAVMLSVPVVLVVGIRL
FT                   GCLNHAMLTAEAIRARGLPLAGWIANRVDPDMLLADENIATLHAALDAPCLGELPWQLG
FT                   PAAAADRLDLAPLLAAATRYQAEAAGLAA"
FT   gene            123544..124566
FT                   /gene="bioB"
FT                   /locus_tag="RALTA_A0126"
FT   CDS_pept        123544..124566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="RALTA_A0126"
FT                   /product="biotin synthetase"
FT                   /function="1.5.3.1 : Biotin"
FT                   /EC_number="2.8.1.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3058702; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62799"
FT                   /db_xref="GOA:B2AGA0"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62799.1"
FT                   /translation="MTQAHTVTTISAESLRQTARPHALPDDAKWRVDDVAALFALPFND
FT                   LLFRAQQVHREHFDANTVQLSTLLSIKTGGCEEDCGYCPQSAHHDAGVKAEKLMALEEV
FT                   LDAARAAKANGATRFCMGAAWRSPKDRHLEPVMDMVREVKAMGLETCVTLGMLKAEQAQ
FT                   QLKEAGLDYYNHNLDTSPEFYGKIITTRTYQDRLDTIGYVRDAGINVCCGGIVGMGESR
FT                   EARAGLIAQLANMDPYPESVPINNLVQVEGTPLAGTEALDPFEFVRTIAVARITMPRAM
FT                   VRLSAGREAMDEALQALCFMAGANSIFYGEKLLTTGNPQADRDRALLARLDIRAEGYAG
FT                   "
FT   gene            124637..126655
FT                   /locus_tag="RALTA_A0127"
FT   CDS_pept        124637..126655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0127"
FT                   /product="putative Methylcrotonoyl-CoA carboxylase alpha
FT                   subunit"
FT                   /function="1.1.3.14 : Valine degradation"
FT                   /function="1.1.3.12 : Leucine degradation"
FT                   /function="1.5.3.1 : Biotin"
FT                   /EC_number="6.4.1.4"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62800"
FT                   /db_xref="GOA:B2AGA1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62800.1"
FT                   /translation="MFNKILIANRGEIACRVAATCRRLGIRTVAVYSDADAEARHVAFC
FT                   DEAVHIGGAAARDSYLRADHIIEMAKETGAQAIHPGYGFLSENEAFAEACAAAGLVFIG
FT                   PPASAIHAMGSKSAAKQLMEKASVPLVPGYHGEDQDPALLRREADRIGYPVLLKASAGG
FT                   GGKGMRVVESGDGFEAALASVKREASASFGDDKVLVEKYLTRPRHIEIQVFADTHGNCV
FT                   YLFERDCSVQRRHQKVLEEAPAPGMTEERRRAMGEAAVAAAKAVGYVGAGTVEFIANQN
FT                   GSFYFMEMNTRLQVEHPVTEMITGQDLVEWQLRVAAGEPLPLAQEQLRIDGHALEARIY
FT                   AENPDKQFLPSTGTLRFLRTPPAVQFMRGEDAHGPAGVRIDAGVREGDTISPFYDPMIA
FT                   KLIVWGKDRDEALARMRQALAAYHVVGLSTNVAFLQRLVKSEAFRTADLDTGLIARNEA
FT                   VLFPPPAPVGMEVIALAVAALLDREARELRVDAADPHSPWTRAGAWRLNGGMSRTLRFG
FT                   YGEQVLDVKLDSNARGSTLIYADQAAPFAYTCQADDLRVNLGTRRTHGQVHADGDTFHV
FT                   FYAGRHVSLAWLDPLAHAGETEGEGGKLTAPMPGKVIAVMVEAGSTVTRGTPLLVMEAM
FT                   KMEHTISAPADGVVSEILYGVGEQVAEGAQLLAFAGK"
FT   gene            126848..127789
FT                   /locus_tag="RALTA_A0128"
FT   CDS_pept        126848..127789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0128"
FT                   /product="putative 2-ketoacid reductase"
FT                   /function="1.7.21 : Glyoxylate degradation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.1.1.79"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62801"
FT                   /db_xref="GOA:B2AGA2"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62801.1"
FT                   /translation="MKLQLYVPDGRYQPWIEGFAEALPEATCVTWDDSRGESADYAVVW
FT                   RPPADMLRGRTDLKAVFNLGAGVDGILRLRDEDPQALPAGVPIVRLDDAGMAAQMAEYV
FT                   TSAVLRYFRRLDEYAAQAQAGKWKFLKPHRRSDFTIGVMGIGTLGTHIARTLAGFGFPV
FT                   RGWSRTARAVEGVVGFHGDAGRAPFLDGLRVLVNVLPLTPQTENILNGELFGKLAQGAY
FT                   VINVARGQHLVEADLLAAVQAGQIAGATLDVFRTEPLPAEHPFWQEPRITMTPHISALT
FT                   LREDSIAQIAGKIRALRAGQPIAGVVDLQRGY"
FT   gene            127839..128774
FT                   /locus_tag="RALTA_A0129"
FT   CDS_pept        127839..128774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0129"
FT                   /product="HYDROXYMETHYLGLUTARYL-COA LYASE PROTEIN"
FT                   /function="1.1.3.12 : Leucine degradation"
FT                   /function="1.1.3.14 : Valine degradation"
FT                   /EC_number="4.1.3.4"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62802"
FT                   /db_xref="GOA:B2AGA3"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62802.1"
FT                   /translation="MTMPNYVKIVEVGPRDGLQNEKAMVPTDVKVALINQLTDAGFVNI
FT                   EAASFVSPKWVPQMADGAEVMARIQRRAGTLYSALTPNMKGFEGAIAAGADEVVIFGAA
FT                   SEAFSQKNINCSIAESIARFAPVAAAAKEQGVRLRGSISCALGCPYQGEVPVSSVVDVV
FT                   RRMRELGCDEIDIADTIGVGTPGRVQEVMRAAAAEFALDRISGHFHDTYGQALSNILAS
FT                   LEVGVAIFHASVAGLGGCPYAKGATGNVATEDVLYMLHGMGIHTGIDLEAVVRAGDYIS
FT                   QAIGRANSSRVGRALLTKWAAASDAAPACV"
FT   gene            128800..129318
FT                   /locus_tag="RALTA_A0130"
FT   CDS_pept        128800..129318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0130"
FT                   /product="conserved hypothetical protein; YbaK/prolyl-tRNA
FT                   synthetase associated region"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62803"
FT                   /db_xref="GOA:B2AGA4"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62803.1"
FT                   /translation="MTMPDQALPESAQRVADLLAGIGHDRPVVMLPATGKTSAEAAAGL
FT                   GCSVAEIAKSIIFRRVADDAPVLVIASGSNRVDEAKVAARVGALGKADARFVREKTGYA
FT                   IGGVCPIGHAVAPVMLLDQDLFRYDSLWAAAGHPHAVFNLTPHQLQQMTGAEVADVAIA
FT                   AAGTPGAAA"
FT   gene            129315..129743
FT                   /locus_tag="RALTA_A0131"
FT   CDS_pept        129315..129743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62804"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62804.1"
FT                   /translation="MSPDLRPGLAFSWQYTVPPKATVPRLYDDIPGCPEMPDVLATGYL
FT                   VGIMECACLQMLREHLDWPREQSLGTLVSFSHLAPTPPGMTVTVKGELVEVDGRRLRFQ
FT                   LSAWDGEDKISEGVHERHLIDAGRFNQKVAAKAARAAG"
FT   gene            129744..130007
FT                   /locus_tag="RALTA_A0132"
FT   CDS_pept        129744..130007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0132"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62805"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62805.1"
FT                   /translation="MASARNAMALTPAELAAQADAAQRASPVPSPCRNVCRMDPATGYC
FT                   AGCLRTIEEIAGWSSAGDEDKRRIWAQLPQRAAWLAGEETSP"
FT   gene            130040..130933
FT                   /locus_tag="RALTA_A0133"
FT   CDS_pept        130040..130933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0133"
FT                   /product="putative Metallo-hydrolase/oxidoreductase, BETA
FT                   LACTAMASE superfamily"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62806"
FT                   /db_xref="GOA:B2AGA7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62806.1"
FT                   /translation="MRVFERGWLSANNILFAEGDDTVLVDTGYVTHAPQTVALVATALQ
FT                   GRPLARVINTHLHSDHCGGNAALQARWQPRTAIPAAEAAAVAAWDTEALSYKATGQQCD
FT                   RFSFDSVLSDGDTLRLGGIDWQVVAAPGHDPHAVMLFAPAERILISGDALWENGFGVIF
FT                   PELEGESGFAEQAAVLARIAQLDVRVVIPGHGSMFTDVAAAVERAQGRLAYLSADPSRN
FT                   AAHAVKVLVKFKLLEAQRMTLAALAAWMEAAPLMAHMRERFMPEQQMAEICAQTVGALA
FT                   RVGAAQIEGEWVVNRD"
FT   gene            complement(131150..133345)
FT                   /locus_tag="RALTA_A0134"
FT   CDS_pept        complement(131150..133345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0134"
FT                   /product="putative TonB-dependent receptor"
FT                   /function="4.2.C.1 : TonB Family of Auxiliary Proteins for
FT                   Energization of OMR-mediated Transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62807"
FT                   /db_xref="GOA:B2AGA8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62807.1"
FT                   /translation="MSKNRYTARRYTRSVAPRLTPLAALAASLTTTLATAFVAPAALAQ
FT                   TATAPAADAAPATPASAPAAATLREVVVTANPLGSDLNDMVAPVSTLGGDALTVRQAST
FT                   LGETLDKLPGVSSTYFGPNASRPVIRGLDGDRIKVLQNGGTTVDASTLSYDHAVPVDPL
FT                   VAERIEVVRGPAALMYGGNAIGGVVNVIDNRIPKEPIEGVGGAVDASATAGGDQARNAS
FT                   ALIEAGNGKFAVHADAFARKTSDLRIPGYARSDRLRNAEPLPEGEAEPYGRLPNTSADQ
FT                   QGGSLGGSYTWADGFLGANYSAYRNDYGTPAEDAVRLKMKQDRFALEGEARNLAGNTGG
FT                   WFESVKGKVSFTDYEHREIEDGETGTIFKNRGWDARFEARHAKIGNMTGVVGTQFGHTN
FT                   FSALGEEAFVPSTNTDNAALFLFEELPLTAGGDLKLNFGGRLDHSSVKASANGNDRFAD
FT                   ASRSFNATSASAGLLYKMNPAWSLTSNLSYTERAPTFYELYANGPHVATGAWEVGDPNA
FT                   NKERATSIDLGVRFKSGAHSAGVSGYYSRFANYLALSATGRARDEAGDVVAAGSPDALP
FT                   EFQYLGVPATLYGFEAEGKTRLLQKMLTSSDTLDFEARADYVRGENRDTGEPLPRLAPL
FT                   RLGGALVYGAGPWGARVDVTYAAKQTRVPSNDTPTDAYTLLSLALTYKFKAAGTQTLVY
FT                   LRGDNLTNQDARNAASILRDIAPMAGRSVKVGFRTSF"
FT   gene            complement(133503..133916)
FT                   /locus_tag="RALTA_A0135"
FT   CDS_pept        complement(133503..133916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62808"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62808.1"
FT                   /translation="MRTDWLARLRVHGPGLWSALWLALCLLLAQHAGLTHRIVHGGLPA
FT                   PAGAAAVVDTTASTTAASDPDPHPLAQVFGAHSCVLFDGATVADMHSGKLPPLQLAFGK
FT                   PVKPASLAWRWPDLPTAHPFQSRAPPALAIVLA"
FT   gene            complement(133906..135195)
FT                   /locus_tag="RALTA_A0136"
FT   CDS_pept        complement(133906..135195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0136"
FT                   /product="conserved hypothetical protein, similar to E.
FT                   coli yjiA and P.chlororaphis P47K"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 2013568, 14696199"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62809"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62809.1"
FT                   /translation="MADRLPVTVLSGFPGAGKTSLLNHLLAHGVGGRVGVLVCGAQDGQ
FT                   ALAPLPPGCEATLLPSGEPLLAEAARLAATGRFDTLLVEADGLDEPLAIAEGFLFEAEH
FT                   GAGPDAAVQPDTLVTVVDAATVLRDLNEAEFLADRGLAQGQDDDRTVAEVLVAQIEACD
FT                   VIVLNKADLVGAAELARLRAALQALNPRADIVEASFGKVPPGRVQGTGRFDFEAVADGA
FT                   GWLAALRGQVPAADAASGVSTLVYRRRRPFHPQRFADLIHTEWLREHGSVLRSKGLFWL
FT                   AGRMETAGDWSQSGGVCRHGGAGAWWVALDPAEWPADAAERAEVEADMQDGGVPAPFGD
FT                   RRQELVLIGLDLDHAALQARLDACLLSDAEMAAGVEAWAAYPDPFPAWVDDFDDDHDHS
FT                   HDHGHRHGDDCGCGDPGHDHGHPHGHPHAH"
FT   gene            complement(135430..136116)
FT                   /locus_tag="RALTA_A0137"
FT   CDS_pept        complement(135430..136116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62810"
FT                   /db_xref="GOA:B2AGB1"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62810.1"
FT                   /translation="MTAATKTKESRSKTGSAAAETLKAQPVKAAPAPRGSTANAEAGAR
FT                   KGGPRSSKTAASQSETTVARKRSDSAPARTETPPAASTRESAATMSSNKLLTEAEILKM
FT                   SDKDYMNEAQLAFFKHRLEQLRDEILKNADQTTEHLRETVIVPDPADRATIEEEHALEL
FT                   RTRDRERKLLKKVEQSLQRIESGDYGWCEETGEPIGVPRLLARPTATLSLEAQQRRELR
FT                   QKLFGD"
FT   gene            complement(136460..137557)
FT                   /locus_tag="RALTA_A0138"
FT   CDS_pept        complement(136460..137557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0138"
FT                   /product="conserved hypothetical protein, similar to E.
FT                   coli yjiA and P.chlororaphis P47K"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 2013568, 14696199"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62811"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62811.1"
FT                   /translation="MSKLIPVTILTGFLGSGKTTLLKRILNEQHGMKIAVIENEFGEEN
FT                   IDNEILVQDGREQIVQMSNGCICCTIRGDLVQALSTLLTRRDAGEIEFDRVVIETTGVA
FT                   NPGPVAQTFFMDEEIASRYLLDAVITLVDAKHAHLQLDKQEEAQRQVGFADAIFITKSD
FT                   LVGEGDVAELRHRLLHMNPRAPIRQVNFGEAPIDAIFDLRGFNLNAKLEIDPEFLRAEE
FT                   HDHAHDHEHDHEHGDHCGNDCGHDHDHDHGHAHGHAHDHHHHHHHTDRIASFVFRSDKP
FT                   FHYGKLEEFLSGILAVYGEKLLRYKGVLYMEGVDRKVVFQGVHQLMGSDIGAKWEDETP
FT                   GTRMVFIGVDLPRDAILKGLENCLA"
FT   gene            complement(137586..138107)
FT                   /locus_tag="RALTA_A0139"
FT   CDS_pept        complement(137586..138107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0139"
FT                   /product="putative transcriptional regulator, FUR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62812"
FT                   /db_xref="GOA:B2AGB3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62812.1"
FT                   /translation="MTRPSPDRPAVAPEPAIPTQAALEAAHERLRRLGARVTQPRLCIL
FT                   ACLIGSDDALTHQAVIDRLPEAGETIDRVTVYRVLDWLVDQGVAQKRAGNDRVFRFSLV
FT                   EHEAARAQEHRQHSHFHCTRCDRTFCLDDAGAPAQPAAPRVPSGFAIEHVELTVNGVCA
FT                   ECGKRTRAAH"
FT   gene            138213..139112
FT                   /gene="dehH"
FT                   /locus_tag="RALTA_A0140"
FT   CDS_pept        138213..139112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dehH"
FT                   /locus_tag="RALTA_A0140"
FT                   /product="Haloacetate dehalogenase"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /EC_number="3.8.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1512562; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62813"
FT                   /db_xref="GOA:B2AGB4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62813.1"
FT                   /translation="MLNDASALLFPNFEPFRQQVGEVEIAGVRGGSGPPLLLLHGHPQS
FT                   HLIWHRVAPALADHFTVIATDLRGYGSSSAPPGNAGHERYSKRTMAQDQVALMAALGYR
FT                   RFALCGHDRGARVSHRLCMDHPDAVSRAMLLDIAPTLAMYERTSMAFAAAYWHWFFLIQ
FT                   PAPFPETLINAEPDFYIQKLMGLRHAGLAAFAPDAMAAYTAAMRDPARVHAMCEDYRAA
FT                   ATIDLEHDRADREAGRRLALPLRVLWGEHGVVARCFEPLALWQEVAADVSGRALPCGHY
FT                   IPEEAPEPLLEEMLGFFR"
FT   gene            139395..140381
FT                   /locus_tag="RALTA_A0141"
FT   CDS_pept        139395..140381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0141"
FT                   /product="conserved hypothetical protein, UPF0065"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12562821"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62814"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62814.1"
FT                   /translation="MKRVAKTIAAALAVGVMGVAAGAYAQEFPGGKPISAVVPFSAGGP
FT                   TDKVSRELTAIMSKHLGSTIVIENLGGAGGTIGAKKVAQAKNDGHTVLIHHIGMATAPA
FT                   LYRNLGFDPLKDFEMVGEIADVPMILVGNKQLPPNTFKELLPYIKANAAKLSLANAGIG
FT                   SASHLCGLLFQSAIQTELTTVPYKGAAPALTDILGGQVNLLCDQTTNLAGHLKAHSVKP
FT                   YAAMQAKRVEAFKDVPTAAEQGMPNVEVKVWHAMYAPKGTPKPVIDKLSAALQKAVADP
FT                   AFRAKMAELGAEAVPAQRATPESLRTYLSAEINKWTPVIKKAGVYAD"
FT   gene            140604..141140
FT                   /gene="hslV"
FT                   /locus_tag="RALTA_A0142"
FT   CDS_pept        140604..141140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="RALTA_A0142"
FT                   /product="peptidase component of the HslUV protease"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="2.3.6 : Turnover, degradation"
FT                   /function="3.1.3.4 : Proteases, cleavage of compounds"
FT                   /function="5.1 : Cell division"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.4.25.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10693812; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62815"
FT                   /db_xref="GOA:B2AGB6"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62815.1"
FT                   /translation="MEQYHGTTIVSVRRGNQVALGGDGQVTLGNIVMKGTARKVRRIYN
FT                   GKVLVGFAGSTADAFSLLDRFEAKLEKYQGNLTRAAVDLAKDWRSDRALRRLEAMLITA
FT                   DRDTTLVITGNGDVLDPEGGIAAIGSGGAYAQSAAKALMENTEMAPKDVVEKALTIAGE
FT                   LCIYTNTNFVIETLE"
FT   gene            141209..142540
FT                   /gene="hslU"
FT                   /locus_tag="RALTA_A0143"
FT   CDS_pept        141209..142540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="RALTA_A0143"
FT                   /product="ATPase component of the HslUV protease, molecular
FT                   chaperone"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="2.3.6 : Turnover, degradation"
FT                   /function="3.1.3.4 : Proteases, cleavage of compounds"
FT                   /function="5.1 : Cell division"
FT                   /function="5.5.2 : Temperature extremes"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10693812; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62816"
FT                   /db_xref="GOA:B2AGB7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62816.1"
FT                   /translation="MSHTMTPSEIVSELDKHIIGQNKAKKAVAVALRNRWRRQQVAEPL
FT                   RQEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDTIVRDL
FT                   AEMAIKQTRESEMKKVRTKAEDAAEDRLLDVLLPPPRDIGFSQPEEKDSNTRQVFRKKL
FT                   REGQLDDKDIELEVSAGMPSMDIMGPPGMEDMTEQIRTMFAGLGQGKKARRKMKVKEAF
FT                   KLLIDEEAAKLVNDEELKHKAIANVEQNGIVFLDEIDKIASRSDIGGGEVSRQGVQRDL
FT                   LPLVEGTTVNTKYGMIKTDHILFIASGAFHLSKPSDLIPELQGRFPIRVELESLSVQDF
FT                   EAILTQTDASLTKQYQALLNTEEVNLVFAPDGIRRLAEIAFSVNEKVENIGARRLYTVM
FT                   ERLLEDLSFHASKSSGETVTIDAAYVEERLGDLAGNEDLSRYVL"
FT   gene            142752..143045
FT                   /locus_tag="RALTA_A0144"
FT   CDS_pept        142752..143045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0144"
FT                   /product="putative membrane lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62817"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62817.1"
FT                   /translation="MVHYKTRRVVLATGGLLAALAAATAFLCIRPATPAAEAAQSGTIG
FT                   AAAAAAATLALDSGALFTLADRHAGDAMRIADSGTPPDGADGLDWDYVQLRL"
FT   gene            complement(143123..143734)
FT                   /locus_tag="RALTA_A0145"
FT   CDS_pept        complement(143123..143734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0145"
FT                   /product="putative response regulator, RegA/PrrA/ActR
FT                   family (CheY-like receiver domain + Fis-type HTH domain)"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62818"
FT                   /db_xref="GOA:B2AGB9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62818.1"
FT                   /translation="MTEALTPVPEATAPAGTPFLVIDDDEVFAGTLARALTRRGYAVAV
FT                   AHDGRTALALAARTDFAYVTLDLHLEPPPEAGSTAPAESGLQLVAPLRQALPDARILIL
FT                   TGYASIATAVAAVKQGADEYLAKPANVDSILTALMAGVSEDAAQAALEEPVPLSVARLE
FT                   WEHIQRVLAEHGGNISATARALNMHRRTLQRKLGKRPVSR"
FT   gene            complement(143731..145125)
FT                   /locus_tag="RALTA_A0146"
FT   CDS_pept        complement(143731..145125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0146"
FT                   /product="putative sensor histidine kinase"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62819"
FT                   /db_xref="GOA:B2AGC0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62819.1"
FT                   /translation="MRPAPALTRLPDFPFLSPLPAGSSARHGQVTLRRLFWLRWALLGG
FT                   QALTVLVCEPIAGIRLPYAPLLVVLGLQALFNLLTGLRLRQHTRRNSAPGEAELMGQLL
FT                   VDLTALSAILFYTGGATNPFVSFYLPGLAIAAAILPWRQVIALALYALACYTVLLIEYV
FT                   PLDLHNPDNAVNYHLAGMWLNFVASAVMIALFVARLSGVLRQREAQLNLAREQLLREAR
FT                   VEDLNGQAAAVAHEIGTPLATLAVIAGELRADASAPGRGATAISGYLADLQTMEQQLAL
FT                   CRSILARLREDPATLAPQRIDGWLPAFAERWQLRHPNASLQAVATPGAGAQAVETARVG
FT                   QILTILLDNAARSQQAAGRGAQPLQLQIAMAPGNTAPWLSFRVADHGDGIPEALRGQLG
FT                   ETPVASQHGGQGIGLYLAQSAARQMGGELAWHDRPGGGTVAELRLPALSTLSASAAPAA
FT                   TAPSAL"
FT   gene            145312..145803
FT                   /locus_tag="RALTA_A0147"
FT   CDS_pept        145312..145803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0147"
FT                   /product="conserved hypothetical protein, DUF461; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62820"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62820.1"
FT                   /translation="MQAKFRPATLAATFALAAALASGAALAQVDVSNAWVRGTVPTQTA
FT                   SGAFMVLHAHENAKLVGVSSPVASAELHEMKMEGNVMRMRQLKSLDLPKMQNVELKPGG
FT                   YHVMLMDLKAQLKPGDTVPITLKIEQGGKVIEQKVTAEVRSMVPGAASGGHAGHGDHKH
FT                   "
FT   gene            complement(145829..146764)
FT                   /locus_tag="RALTA_A0148"
FT   CDS_pept        complement(145829..146764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0148"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62821"
FT                   /db_xref="GOA:B2AGC2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62821.1"
FT                   /translation="MNSLRGIDLNLLVVLEALLAERHISRAALRLHLSQPAVSHALGRL
FT                   RQLLDDPILVRGKGGLVLSARAHELSGPLAEALAQVRILLGPSGFQPATARRSFRLAMS
FT                   DYGALVVLPRLLRAVRKAAPNIDLVVSQASREGMTAQVADGEIDMALGVFSHQPEGVQS
FT                   AELFRESYACAVDAATVRDTGRLDQVAYLARSHVLVATHSERMDAIDTAVAKLGGRRKI
FT                   ACVVPHWSVAPALIAGTNLVLTTARRSLAALEDDPRYAVFAPPFALDDFTFSMIWHERT
FT                   EADPAHAWLRERVLAAASSPEADEPISLRG"
FT   gene            146858..147418
FT                   /locus_tag="RALTA_A0149"
FT   CDS_pept        146858..147418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0149"
FT                   /product="conserved hypothetical protein, DUF606; putative
FT                   membrane protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62822"
FT                   /db_xref="GOA:B2AGC3"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62822.1"
FT                   /translation="MSGTQLSFSIPASLWLPLGTAVLAGAAIPFQAGANATLGRMLGHP
FT                   LSATLVSLLVSLVALLPVLWLMRVPLPSPAALAQAPAWLWSGGVLGVFYISAALIMAPR
FT                   LGAAGFIAAVVAGQVLAALLVDQFGLAGFAVRALTPARIAGAALIVAGMLAMQWDSGAA
FT                   AAPARQPTAGSGAEAGTGAESGA"
FT   gene            complement(147361..147621)
FT                   /locus_tag="RALTA_A0150"
FT   CDS_pept        complement(147361..147621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62823"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62823.1"
FT                   /translation="MSDAAAVLTGQLRPVEHCSRCGAGFVCGYVAGLPECWCASQPLLP
FT                   ARQIVPGQHCLCPACLADRRQASQAPDSAPVPASAPDPAVG"
FT   gene            147949..148875
FT                   /gene="argB"
FT                   /locus_tag="RALTA_A0151"
FT   CDS_pept        147949..148875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="RALTA_A0151"
FT                   /product="ACETYLGLUTAMATE KINASE (putative precursor)"
FT                   /function="1.5.1.3 : Arginine"
FT                   /EC_number="2.7.2.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62824"
FT                   /db_xref="GOA:B2AGC5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62824.1"
FT                   /translation="MSPMNADNPGPAATAVAAIAPALKAEILAEALPYIRKFHGKTIVV
FT                   KYGGNAMTEEKLKHGFARDVILLKLVGMNPVVVHGGGPQIDEALKKVGKVGTFVQGMRV
FT                   TDEETMEVVEWVLGGEVQQDIVMLINQYGGQAVGLTGKDGGLIRAKRLQMPDRENPGAF
FT                   IDIGYVGDIEAINPAVVKALQDDAFIPVISPIGFSDDGQAYNINADVVAGKMAEILKAE
FT                   KLVMMTNIPGVMDKKGNLLTDLSAREIEELFADGTISGGMLPKISSALDAAKSGVHSVH
FT                   IIDGRIEHSLLLEILTEQAFGTMIRSH"
FT   gene            148939..149898
FT                   /locus_tag="RALTA_A0152"
FT   CDS_pept        148939..149898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62825"
FT                   /db_xref="GOA:B2AGC6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62825.1"
FT                   /translation="MSGVPSSLPAPRRVRARLCRRPAGNTSGGTVWLFDLDNTLHDASH
FT                   AIFPAINRLMTAYVARVLGCDEATASRVRVDYWQRYGATLLGMIRHHGVDPADFLRAAH
FT                   EFPALADMVRVRRGLAAHLRRLPGRKILVTNAPQDYARAVLEIAGIRHCFERVVAIEQM
FT                   WVHGHLRPKPDRRMLRRLLAQARIAPHRAVLVEDTVSHLKRYAGTGIRTAWVTGYLRTV
FT                   APSRPHVVPAAPAAGHDDGSRRDAAVRSTLQAEDRSHAAHAVQERSVTLVAAETQAPQA
FT                   QPDNVPRVRARVPNRPAYVDIKVQSMHQLQRRMRRTGS"
FT   gene            149895..150569
FT                   /locus_tag="RALTA_A0153"
FT   CDS_pept        149895..150569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0153"
FT                   /product="putative transcriptional regulator of dUTPase
FT                   subunit (TetR/AcrR family); similar to E.coli ttk"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2.2 : Activator"
FT                   /function="3.1.2.3 : Repressor"
FT                   /function="4.9.B : Putative uncharacterized transport
FT                   protein"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62826"
FT                   /db_xref="GOA:B2AGC7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62826.1"
FT                   /translation="MTQSNGREPEAVITGSAQGSEPDADQQPAMPARKRPRPGERRVQI
FT                   LQTLATMLEHPRGEKITTAALAARLSVSEAALYRHFASKAQMYEGLIGFIEQTVFGLIN
FT                   QITDKEEHGLRQAHAIVRMLLSFAEKNPGMTRVLTGEALVGEHERLQERINQVVDRIEA
FT                   SLRQCLKVAVTQAAFPADADIPARAALIMAAVQGQWHRYAKSGFRKSPSDHAESHLRVL
FT                   LA"
FT   gene            150845..152026
FT                   /gene="metX"
FT                   /locus_tag="RALTA_A0154"
FT   CDS_pept        150845..152026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="RALTA_A0154"
FT                   /product="HOMOSERINE O-ACETYLTRANSFERASE PROTEIN"
FT                   /function="1.5.1.9 : Methionine"
FT                   /function="1.5.1 : Amino acids"
FT                   /function="1.8.2 : Sulfur metabolism"
FT                   /EC_number="2.3.1.31"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62827"
FT                   /db_xref="GOA:B2AGC8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62827.1"
FT                   /translation="MTDVALPTAAPAAFDLPPDSVGVVAPQRMHFAEPLKLRNGSSIAG
FT                   YDLMVETYGTLNADRSNAVLVCHALNASHHVAGVYADDRRNVGWWDNMVGPGKPLDTNR
FT                   FFVIGINNLGSCFGSTGPMSLNPATGAPYGAAFPVVTVEDWVNAQARVADAFGITQFAA
FT                   VMGGSLGGMQAVAWSLMYPDRLRHCIVIASTPKLSAQNIAFNEVARSAILSDPDFHGGN
FT                   YYAHGVKPKRGLRVARMIGHITYLSDEDMAEKFGRELKSEDIRFSFDVEFQVESYLRYQ
FT                   GDKFAEYFDANTYLLITRALDYFDPALAHGGDLTRAMAQTQASFLVASFGTDWRFAPSR
FT                   SRELVKALLDNKRPVSYAEIDAPHGHDAFLLDDPRYHNLMRAYYDRIAEEIGA"
FT   gene            152023..152634
FT                   /gene="metW"
FT                   /locus_tag="RALTA_A0155"
FT   CDS_pept        152023..152634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="RALTA_A0155"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /function="1.5.1.9 : Methionine"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11479715; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62828"
FT                   /db_xref="GOA:B2AGC9"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62828.1"
FT                   /translation="MNALANPNILALRPDFRAIARWIEPNSTVLDLGCGDGSLLRVLQD
FT                   ELDVQAYGIEIRDEGVLACAQKGVHVIQQNLEGGLALFEDKSFDTVILSQTLQTIHNTA
FT                   QVLRDTLRVGRECIVSFPNFGYWPHRLSVFRGRMPVSESLPYQWYNTPNVRVLTISDFE
FT                   ALAPKVGLRVIDRVVMHEGVTVSWGVNWRGSLAVYRVCAA"
FT   gene            complement(152648..153076)
FT                   /locus_tag="RALTA_A0156"
FT   CDS_pept        complement(152648..153076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0156"
FT                   /product="putative antibiotic resistance protein;
FT                   GlyoxalaseI/dioxygenase domain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62829"
FT                   /db_xref="GOA:B2AGD0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62829.1"
FT                   /translation="MKVTSYNPVIMTADVAGTAAFYQQHFGFTALFTSDWYVHLQLADD
FT                   PTVNIAVLDGSHETIPAPARGQRAQGLLLNFEVEDPDAIHDRLRTAGLPIVQPLRDEAF
FT                   GQRHFITADPNGVLIDIIKPIPPSAEFAAQYRAGALPG"
FT   gene            153141..153728
FT                   /locus_tag="RALTA_A0157"
FT   CDS_pept        153141..153728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0157"
FT                   /product="putative TRANSCRIPTIONal REGULATOR, TetR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62830"
FT                   /db_xref="GOA:B2AGD1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62830.1"
FT                   /translation="MFARSPNVARTNRERTETTRQALTEAARALFVSRGYAETSTPDVC
FT                   AAAGITRGALYHHFADKRDLFRHVLAEEAAAVAADIEAATPAGQDAAEALLDGAQAYLQ
FT                   AMTVPGRTRLLLVEGPAVLGLREMLALDEANAARTLREGLEAAGIDAGGVAPLLSAAFD
FT                   RAALEIEAGANAGQVRDAMLWLLRRVLGQAEG"
FT   gene            complement(153750..154664)
FT                   /locus_tag="RALTA_A0158"
FT   CDS_pept        complement(153750..154664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0158"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62831"
FT                   /db_xref="GOA:B2AGD2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62831.1"
FT                   /translation="MLDTPLNAMAVFARVVECGSFSAAAQDLGMTPSAVSRHVSRLEGR
FT                   LGASLLQRTTRAFALTELGQSVYAACARMTAAAREVTALAGEHGGAPHGVLRVSAPVSF
FT                   GQAWLAPRLPPLLAKYPGLDLQLTLADRMVDLVEEGLDVAVRIARELAPGLAARPLREV
FT                   RYRLVASPAYLARHGAPATPADLPAARCLYLGYGNFGERWTLRHHAGGDKVEVRIPPRL
FT                   TLNNSLAIMSMVERDAGIGLVPDFSLGDALERGRVVTVLGDWDILEPYIGTAYAVYTPT
FT                   RHVPPKVRAFVDHLAASAGDAPR"
FT   gene            154776..155663
FT                   /locus_tag="RALTA_A0159"
FT   CDS_pept        154776..155663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0159"
FT                   /product="conserved hypothetical protein, DUF6; putative
FT                   membrane protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62832"
FT                   /db_xref="GOA:B2AGD3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62832.1"
FT                   /translation="MPSQQPQRGGAWRMVAAMVLSGTIGWFVVTSGQPPLDVVFFRCLF
FT                   GGAALLGVLTLQRGWVRMTRAQAGWLVLGGVTLVLNWLALFSAYAYSGIAIATVVYHTQ
FT                   PFFLLMLTSVLQREPFPFARLPWLVLAFAGVMLITGLEHGAGGASMLAGIGLGLLAALL
FT                   YAVTTLATRRLQAIPPGQIAGLQMVLGVLMLAPLAHPAAGSYGGGTWGALLALGLVHTG
FT                   VMYTLLYGAFQRLSVVSIATLSFIYPLVAIVIDVMVFGVVLGPLQVAGMALVLLGVVAN
FT                   QLGWALPLRRRARG"
FT   gene            155784..156632
FT                   /locus_tag="RALTA_A0160"
FT   CDS_pept        155784..156632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62833"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62833.1"
FT                   /translation="MSTAPQIHAAAAASQLHPFDDALALVPAGEHRFQGRTTPAYWNMI
FT                   GPFGGITAATLLQAAMNHPQRLGEPVSLTVNFAGPIAEGPFEIEARPVRTNRSTQHWTL
FT                   ELRQGDAVATTATAMFAVRRDTWACGEAVMPDVPAADALPAMGGFAPVRWLKAYDMRPV
FT                   RGAKPLAEAGTEHPDSLTQFWLRDAPARTPDFAAVAAWADSFYPRIFLKRAGFVPAGTV
FT                   SMTTYFHADAATLAALGDTHVLASAQAQVFRQGFFDQRAQLWSAAGELIASSHQIVYYK
FT                   E"
FT   gene            complement(156643..157902)
FT                   /gene="ampG"
FT                   /locus_tag="RALTA_A0161"
FT   CDS_pept        complement(156643..157902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="RALTA_A0161"
FT                   /product="muropeptide transport protein (MFS family)"
FT                   /function="1.7.34 : Peptidoglycan (murein) turnover,
FT                   recycling"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /function="6.1 : Membrane"
FT                   /function="6.2 : Peptidoglycan (murein)"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12426329; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62834"
FT                   /db_xref="GOA:B2AGD5"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62834.1"
FT                   /translation="MNFQTYLDIFRNRRIGAMLMLGFASGLPLALTSGTLQAWMTVEGL
FT                   DIKTIGFFSLVGQAYIFKFLWAPLMDRYTPPLMGRRRGWLLLTQVGLVLGIAGMAFCPP
FT                   QQALWMLAALATLVAFLSASQDIVFDAYSTDVLRPAERGAGAAVKVLGYRLAMLVSGGL
FT                   ALWLADRVLGWQQTYLLMAALMGVGILTLLWAPEPDVPARAPRSLEEAVVGPLRDFFAR
FT                   PGAWWLLLLIVLYKLGDAFAGSLSTTFLIRGAGFSAGEVGIVNKTLGLAATILGALFGG
FT                   TLMVRLGLYRSLMLFGVLQAVSNLGYWILAVTPPHLWTMGATIAVENLCGGMGTAAFVA
FT                   LLMTLCNRSFSATQYALLSALASVGRVYVGPTSGYMVEAWGWAPFYLGTVAVALPGVML
FT                   LWAMRHTVHRYEAQAREAIA"
FT   gene            158003..158971
FT                   /locus_tag="RALTA_A0162"
FT   CDS_pept        158003..158971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0162"
FT                   /product="putative membrane-associated zinc
FT                   metalloprotease, Peptidase M48, Ste24p"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62835"
FT                   /db_xref="GOA:B2AGD6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62835.1"
FT                   /translation="MRRRLQGVQRPYRLRLARALALAAVVLPLGWSQPAPAQPQDGGAG
FT                   GIRLNPGGSAVRNIVPAEVIEQQAVQEYEQLKQEAIAKRALAPDNHPQLVRLRAIGKRL
FT                   LPQTARWNERARQWQWEINLIGSKQVNAFCMPGGKIAVYTGLLDQLKLTDDEVAMVMGH
FT                   EIAHALQEHARERAAKSEITNLGANVISQLFGFGNLGNMALGTGAHLLTLRFSRSDESE
FT                   ADLIGMDVAARAGYDPRAAVSLWQKMGKVSQSGAEFLSTHPSGRSRIADLEKHLPEVLP
FT                   LYARAIHTTVDKLPPYRPNMTGLGDAPVDAGDEDRQKPLKR"
FT   gene            159063..161141
FT                   /locus_tag="RALTA_A0163"
FT   CDS_pept        159063..161141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0163"
FT                   /product="putative Peptidase, S8 family (subtilisin)"
FT                   /EC_number="3.4.21.62"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62836"
FT                   /db_xref="GOA:B2AGD7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62836.1"
FT                   /translation="MSLNRMSPSEQRAAYKLIFAGCEAEPDRFTSDLPVSSEVWLLYAS
FT                   GESFEVPRGLLLTPHHGAGIAALRAAVLRRLPALAGPAADQAGPRFLAANESHLLAQID
FT                   FFDMLRLLPLTAWWHREVRMPMAGMPWTPAARRALALSLTGDALVRWLGESVLAHVGSE
FT                   AALARFKDIGYTAARTRFGGLAAPAGQALGRLVNVAAQYVALTLLGLHDDSFPPGGLMR
FT                   RVAQESRKVLETLWDCVRDDHAEAAAPVAGTTAGMTAGDVAAAAAISPLWRISVNRPAE
FT                   HAVFASRKTVKADAAIRVFDTGGQGVRWAVIDSGVDARHPAFFDPLKLDGPLPVRDGLI
FT                   APRLSRVVRTLDFTRLSAITSGRLPPMPKGKRGPGEAELRQRVAAIADDLSHGRIIDWS
FT                   VIEPLLDISHDDPAQYVPPGGSHGTHVAGIIGAGWPSSVYLARPDPMPLPSELAESGDV
FT                   SGICPRIELLDLRIFDAQGRGDEFGILGALQYVRWLNQSRDRQSVHGINLSVALRHDVR
FT                   SYACGSTPVCVECDRLVASGVIVVAAAGNYGYDEAFAAEHMGAGFRGQTITDPGNARAV
FT                   ITVGATHRTDPYRFGISYFSSHGPTGDGRIKPDLVAPGEKITSTVPGGTLASMDGTSMA
FT                   APHVSGVAALLLSRNNELMGQPETVKTILCAAATDLGRERAFQGAGLVDALRALQRV"
FT   gene            complement(161211..162158)
FT                   /gene="argC2"
FT                   /locus_tag="RALTA_A0164"
FT   CDS_pept        complement(161211..162158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC2"
FT                   /locus_tag="RALTA_A0164"
FT                   /product="N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE
FT                   (N-acetyl-glutamate semialdehyde dehydrogenase) (NAGSA
FT                   dehydrogenase)"
FT                   /function="1.5.1 : Amino acids"
FT                   /function="1.5.1.3 : Arginine"
FT                   /EC_number="1.2.1.38"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7929012; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62837"
FT                   /db_xref="GOA:B2AGD8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62837.1"
FT                   /translation="MVFKVFVDGQEGTTGLRLLDYLSGRSDVELLRIAEDKRKDPAERA
FT                   RFLNAADVAFLCLPDVASREAVSLVTNPDTCVIDASTAFRTADNWAYGLPELVRGQRDK
FT                   IRASKRIAVPGCHASAFVLAVRPLVDAGVLPADYPLSAFSLTGYSGGGKSMIAEFEAGG
FT                   NPKLNSPRPYALGLEHKHLPEMRVQAGLAQAPIFNPIVGNFLKGLAVTVPVFAERLARK
FT                   VSPEQIVEIYRQHYEGEQFVRVMPYNGDDNLDRGFFDVQANNDTNRVDLFVFGNAERLN
FT                   LVARLDNLGKGAAGAAVQCMNVHVGADEASGLRA"
FT   gene            162330..162626
FT                   /locus_tag="RALTA_A0165"
FT   CDS_pept        162330..162626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0165"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62838"
FT                   /db_xref="GOA:B2AGD9"
FT                   /db_xref="InterPro:IPR031451"
FT                   /db_xref="InterPro:IPR038493"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62838.1"
FT                   /translation="MEKGTAHYKLRHVKALLLAGKMDMTFAAYSHAAMMGLRWTGVRDI
FT                   LARLEPADFYKSMTTYEDHRIWQDVYRPVTPHGALYVKLTVANEVLVVSFKTR"
FT   gene            162659..163057
FT                   /locus_tag="RALTA_A0166"
FT   CDS_pept        162659..163057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0166"
FT                   /product="putative transcriptional regulator, HTH
FT                   cro/C1-type DNA-binding domain"
FT                   /function="3.1.4 : Regulation level unknown"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62839"
FT                   /db_xref="GOA:B2AGE0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022452"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="InterPro:IPR032758"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62839.1"
FT                   /translation="MKCPECGGAELVGGMRDMPYTYRGETTVIPNVSGQWCPKCGEGVL
FT                   PRDSDWVSEAMLAFNRQVNAALVDPAYITQVRRKLRLDQREAAEIFGGGVNAFSRYETG
FT                   RTKPPLALVKLLRLLDRHPELLDEIRAA"
FT   gene            complement(163066..163842)
FT                   /locus_tag="RALTA_A0167"
FT   CDS_pept        complement(163066..163842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0167"
FT                   /product="putative EXODEOXYRIBONUCLEASE
FT                   III/endonuclease/phosphatase"
FT                   /function="5 : Cell processes"
FT                   /EC_number="3.1.11.2"
FT                   /EC_number="4.2.99.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62840"
FT                   /db_xref="GOA:B2AGE1"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62840.1"
FT                   /translation="MLRIISANLNGIRSASKKGFFDWMGKQDADMVCVQELKAQAADMT
FT                   EAFLAPHGYHGFFHYAEKKGYSGVGLYTRHKPERVITGFGNAEFDNEGRYVEVQYPHLA
FT                   VISVYVPSGSSGEERQLAKFRFLEAFLPHLLQLKASGREIVLCGDVNIAHKEIDIKNWK
FT                   GNLKNSGFLPEERAWIGELFDVHGYVDVFRKLDPRPDQYTWWSNRGQAYAKNVGWRIDY
FT                   HLATPKIADTAQLCSIYKDEKFSDHAPLSIDYNFPL"
FT   gene            163870..164565
FT                   /gene="pyrE"
FT                   /locus_tag="RALTA_A0168"
FT   CDS_pept        163870..164565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="RALTA_A0168"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /function="1.5.2.2 : Pyrimidine biosynthesis"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.4.2.10"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8620002; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62841"
FT                   /db_xref="GOA:B2AGE2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62841.1"
FT                   /translation="MMTQQTPAPGTAGNDLSQTFIRFALDAGVLSFGEFVTKAGRKSPY
FT                   FFNAGLFNQGGMLGQVAQFYAKTLLASGVQFDVLFGPAYKGITLASATAVALAGMGRDV
FT                   GFAYNRKEAKDHGEGGTLVGAKLQGKVVIVDDVISAGTSVRESVNLIRAAGAEPAAVLI
FT                   ALDRMEKSGTAEQVGTHSAVQDVQREFGIPVIAIASLKDLLAYLDASQDPALGASREAV
FT                   AAYRQRYGV"
FT   gene            164686..165963
FT                   /locus_tag="RALTA_A0169"
FT   CDS_pept        164686..165963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0169"
FT                   /product="putative Patatin-like phospholipase"
FT                   /function="1 : Metabolism"
FT                   /function="6.1 : Membrane"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62842"
FT                   /db_xref="GOA:B2AGE3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62842.1"
FT                   /translation="MRQAATPSPTAESAGNGESLAERGAQVRPRKPVRKAAKAPDRPAH
FT                   EAYAVRALVLQGGGALGAYQAGVYQGLADGGIFPNWVAGISIGALNAAIIAGNPPRRRV
FT                   EQLRAFWEHICAQPWLPSLSYTWFADEAASWPEPMRIWFDGLHAARAMLEGQRGFFQPR
FT                   SWAALMSRYSDPTHASFYDTKPLKATLERFADFDLINHRPDLMRVSVGAVNVRTGNFAY
FT                   FDNTRDKLCAEHFMASGALPPGFPAVEIDGEYYWDGGLVSNTPLAEVLTAQPRRDALIF
FT                   QVDLWSARGKLPHDLIDVAERQKDIQYSSRTRAITDYMREQQNLRRMLNEVMALVPQSK
FT                   RDNDWYRRAAEQSCDARRNVIQLIYRDKSFENLAKDYQFGPLTMHEHWTSGLEDIRQTL
FT                   RHPQWLAMPSREQPFVTHDVHRGNGG"
FT   gene            complement(165985..166794)
FT                   /locus_tag="RALTA_A0170"
FT   CDS_pept        complement(165985..166794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0170"
FT                   /product="conserved hypothetical protein; putative
FT                   polyphosphate kinase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62843"
FT                   /db_xref="GOA:B2AGE4"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62843.1"
FT                   /translation="MPLDDFRITSGKRFRLADFDPGSKPLSCGKKEEDLARIIELSNAL
FT                   DAQQDIFYAEHRRKLLVVLQGMDTSGKDGTVRGVFRSFDPLGIRVVGFKAPSPEELARD
FT                   FLWRIHLQVPKSGEIVVFNRSHYEDVLITRVHDWIDAAECERRYRQIREFESMLTETGT
FT                   TIIKCFLHISRDEQKSRLEARLADPEKHWKFDTQDLAERKHWKAYMDAYEAAITATSTP
FT                   ECPWYVVPADSKTHRNLMVAEIMTKVFADLKPAYPPARPELAGIKVD"
FT   gene            complement(166891..167757)
FT                   /gene="dapF"
FT                   /locus_tag="RALTA_A0171"
FT   CDS_pept        complement(166891..167757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="RALTA_A0171"
FT                   /product="diaminopimelate epimerase"
FT                   /function="1.5.1.7 : Lysine, diaminopimelate"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="5.1.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62844"
FT                   /db_xref="GOA:B2AGE5"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62844.1"
FT                   /translation="MKLKFTKMHGAGNDFVVLDGIHQQIDLTPAQWRALASRHFGVGAD
FT                   QILIVEKPTRPDVDFRYRIVNADGSEVEHCGNGARCFVRFVTEQGMTDKRSVRVEVMNG
FT                   VITLTLQDDGQVTVDMGAPELEPARVPFRAQGLPTHAEGADALYGLEVNGRTEWISAVS
FT                   MGNPHAVQVVDDVENFPVLQDGPVIEHHPAFPNRVNAGFMQVVDRHAIRLRVYERGAGE
FT                   TLACGTGACAAVVAGIRRGLLDSPVRVHTHGGELTIAWDGGAEPVRMTGPATTVFEGSI
FT                   DLAALPA"
FT   gene            complement(167810..168703)
FT                   /locus_tag="RALTA_A0172"
FT   CDS_pept        complement(167810..168703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0172"
FT                   /product="putative lipid A biosynthesis acyltransferase"
FT                   /function="1.6 : Macromolecules (cellular constituent)
FT                   biosynthesis"
FT                   /function="1.6.3.3 : Lipid A"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62845"
FT                   /db_xref="GOA:B2AGE6"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62845.1"
FT                   /translation="MSRVFTWLGIGLLTVLGKLPYPFVARFGEALGSLLYRIPSERRKV
FT                   VQANLRLCFPDRTEAEIDALSRQSFRLLFRSFAERGIFWTGSEAQMRRWVQIDDQAGLV
FT                   ALDGTPHILVTLHLSGVEAGAIRLTIHLREHVGRSGASLYTKQKNALFDGFLKQARGRF
FT                   GANMISRNDSARDILRCLKKGEALQLIADMDFGERDSEFVPFFGVQALTLTSVSRLARL
FT                   TGARVVPIYTEMLPDYQGYVLRVLPAWEDYPGASVTDDTRRMNAFFEDCIRPRVPEYYW
FT                   VHKRFKHRLPGEPEIY"
FT   gene            complement(168700..169614)
FT                   /locus_tag="RALTA_A0173"
FT   CDS_pept        complement(168700..169614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0173"
FT                   /product="putative lipid A biosynthesis acyltransferase"
FT                   /function="1.6 : Macromolecules (cellular constituent)
FT                   biosynthesis"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62846"
FT                   /db_xref="GOA:B2AGE7"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62846.1"
FT                   /translation="MTFLFWLISRFPLRLLQAAGGALGLLIARLPGRYGQRLRENFRLA
FT                   FPDATEAMIDEAARSAGRMIIEMPYFWSRRRIGARLYGFDDHLWPELGALQARGKGIII
FT                   LTPHLGCFEVLPQSHALHRPVTALFKPPHQPWLRDWIEKMRTRPNMHMAPATPRGVRML
FT                   VKALKRGQAVGILPDQVPSGGEGNWAPFFGKPAYTMALVHRLQQLTGAPVVAVFAERLP
FT                   RGAGYRGHLRVIEDGGMLPDDPAAAAAVINRTIEELVRLCPTQYLWGYNRYKQPAGAGT
FT                   PGTPDTPATEGTDSAPATDRSIS"
FT   gene            169845..171056
FT                   /gene="metK"
FT                   /locus_tag="RALTA_A0174"
FT   CDS_pept        169845..171056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="RALTA_A0174"
FT                   /product="methionine adenosyltransferase 1 (AdoMet
FT                   synthetase)"
FT                   /function="1.7.20 : S-adenosyl methionine biosynthesis"
FT                   /function="1.5.1.9 : Methionine"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.5.1.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62847"
FT                   /db_xref="GOA:B2AGE8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62847.1"
FT                   /translation="MDRTGWHAIANLENKFVANDFLFTSESVSEGHPDKVADQISDAVL
FT                   DAILAQDKYARVAAETLCNTGLVVLAGEITTTANVDYIQIARDTIKRIGYDNTDYGIDY
FT                   KGCAVLVAYDKQSPDIAQGVDRASDDYLNQGAGDQGLMFGYACDETPELMPFPIYYAHR
FT                   LVERQSLLRRDGRLPWLRPDAKSQVTVRYVDGKPHSVDTVVLSTQHAPDITQAQIREAV
FT                   IEEIIKPVLPAEMLKETKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGASPHGGGAF
FT                   SGKDPSKVDRSAAYAARYVAKNVVAAGLARQCQVQVSYAIGVARPINVTVYTEGTGKIP
FT                   DAKIAELVQEHFDLRPKGIVQMLDLLRPIYEKTAAYGHFGREEPEFSWEATDKAAALRA
FT                   AAGL"
FT   gene            171260..172201
FT                   /locus_tag="RALTA_A0175"
FT   CDS_pept        171260..172201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62848"
FT                   /db_xref="InterPro:IPR021266"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62848.1"
FT                   /translation="MSEAPVLAPSPPARPSTAGQLDLIRPQPYTEWAPEVSAEERATLR
FT                   RELEQGAVLYFPNLKFQFQRGEERFLDARYSDGKSKNINLRADDTAVRGAQGSPQDLAD
FT                   LYTLIRRYADSSESLIRTLFPEYIPHMTRAGTSLRPSEIAGRPVSWRKDDTRLHVDSFP
FT                   SNPMLGKRLLRVFHNIDPAAPRVWRVGEPFGDFAQKFVPKTHGMWPGQAALMKLLHITK
FT                   RRRSEYDHRMLQLHDLAKADLDYQANVPQQEFHFPPGATWIVFSDQLLHAAMRGRAMME
FT                   QTIYLAPQAISDHTHSPEAVLSRMLGRPMLVS"
FT   gene            complement(172225..173628)
FT                   /locus_tag="RALTA_A0176"
FT   CDS_pept        complement(172225..173628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0176"
FT                   /product="coniferyl aldehyde dehydrogenase (CALDH)"
FT                   /function="1.1.5.3 : Eugenol catabolism"
FT                   /EC_number="1.2.1.68"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9721273; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62849"
FT                   /db_xref="GOA:B2AGF0"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62849.1"
FT                   /translation="MREVPDLSSVFGAMHAASRRDQLPAWPVRADRLQRLRRLVTENQA
FT                   EIAAAIHADFTNRPRQETALLEVFPSLAGVDDALRHGKRWMRVRRAPTGFWFRPGSSRL
FT                   VPQPLGVVGIVVPWNYPLYLTVGPLAGALAAGNRAMVKLSEYTPRFAALFARLVPQHFA
FT                   PDEIVVINGDADVASAFTALPFDHLLFTGSTAVGHHVMRAAAANLTPVTLELGGKSPAI
FT                   IGAGADLERAVERILVGKLMNAGQTCIAPDYVLVPEDLRGQMVDAARRCVVRLYPDLAH
FT                   NPDYTSIISPRHFARLAALVDEAAAQGATVVPLSDAQPDAQARRLPPVLLLDVPQGVTA
FT                   LREEIFGPVLPVVTYRTLDEAVDYINARPRPLALYVFERDRGAIAHVMQQTVAGGVTVN
FT                   DTLFHIAQDGLPFGGVGASGMGAYHGQAGFDTFSKVKPVFHQASLNGAGLLKPPYGKTF
FT                   DTMLRLLLR"
FT   gene            173843..175606
FT                   /locus_tag="RALTA_A0177"
FT   CDS_pept        173843..175606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0177"
FT                   /product="soluble choline dehydrogenase"
FT                   /function="1.7.18 : Betaine biosynthesis"
FT                   /function="1.5.1.10 : Glycine"
FT                   /function="1.5.1.11 : Serine"
FT                   /function="1.5.1.8 : Threonine"
FT                   /EC_number="1.1.3.17"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62850"
FT                   /db_xref="GOA:B2AGF1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62850.1"
FT                   /translation="MPSAGRTGRAPARPGSRMRAACGIAGRQMETTYDYVIVGAGSAGC
FT                   ALAGRLADSGDDTIALVEAGHHDHHVLVRTPAGLAAMLPHAGARNYGYQTVPQPGLNGR
FT                   RGYQPRGRGLGGCSSINAMIYTRGRPADYDAWADAGCDGWSWDDVLPYFRRAECNERLA
FT                   GSDDDPLHGGNGPLHVSDLRTPNPFAERFIEAAQQAGFPRNDDFNGEEQEGIGWYQVTQ
FT                   HAGERWNAARAYLHGGNPRDRACNGGRARLHVLTDTQALRIVFEGRHAAGVLVQRDGRQ
FT                   QLLRARRDVIVCAGTFGSPQLLMVSGVGPAAHLREHGIDVVHDLPGVGANLQDHLDVVL
FT                   HKRTAVPELFGVSFGGVARLLSEMLRYRRERAGMMSSNFAEAGGFVRSHPALPEPDLQL
FT                   HFVVGLADDHMRKLNLGHGYSCHVCLLRPRSRGEVRLATADIRRAPLIDPNYLSDARDL
FT                   DDMVAGVRIVRSILSQPQLACFGGRELYTAGLRADGSDDAAVRALIRARADTIYHPVGT
FT                   CRMGMDAMAVVDPQLRVRGVEGLRVVDASVMPTLIGGNTNAPAIMIGERAHDLIRYAPR
FT                   VMLRVLESMEA"
FT   gene            complement(175603..177273)
FT                   /gene="aidB"
FT                   /locus_tag="RALTA_A0178"
FT   CDS_pept        complement(175603..177273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aidB"
FT                   /locus_tag="RALTA_A0178"
FT                   /product="isovaleryl CoA dehydrogenase"
FT                   /function="1.1.3.12 : Leucine degradation"
FT                   /function="1.1.3.14 : Valine degradation"
FT                   /EC_number="1.3.99.10"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7961409; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62851"
FT                   /db_xref="GOA:B2AGF2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62851.1"
FT                   /translation="MTDAATHRVFNQVPDLAHYNLFDSDPMVRAALERLGGGWHADALR
FT                   QFGARLGEPEVQQWAADANRHTPELHTHSRTGERIDMVEFHPGWHALLGLLRSQQLQAL
FT                   PFAQPRAGAWAARTAGYFLQAQVESGSLCPPTMTFASIPVLRKEAALFAELEPRLYATG
FT                   HDARDLPWRDKSAIMIGMGMTEKQGGSDVRANTTVARPVRGEGRGAEYALTGHKWFFSA
FT                   PMCDAHLVVARMGAEDGPLSCFFVPRFRDDGSRNAVQIQRLKDKLGNRSNASSEVEFRD
FT                   AAGILIGEEGRGIPTIIEMATSTRLDCVIGSAAILRAAFVQALHHTRHRSAFGRLLCDQ
FT                   PLMRNVLADLALESEAATLLMMELGHAFAHAEGDNPDPLAAAWKRVVTPAAKFWVCKRT
FT                   LEATGEAMEVWGGNGYVEEGPMARLYREAPVNSIWEGSGNIMCLDVLRALQRNPDDGAR
FT                   LLQDLSRRAGGHPSVRAELASLQAMLREPAEQQEANARRFAQGLVLTAQAALMLAHADP
FT                   ENAELFVASRLGRQHGRVFGTLDAEAGALGRVASRGFEG"
FT   gene            177475..177576
FT                   /locus_tag="RALTA_Amisc_RNA_8"
FT   misc_RNA        177475..177576
FT                   /locus_tag="RALTA_Amisc_RNA_8"
FT                   /product="TPP"
FT                   /inference="profile:Rfam:8.0"
FT   gene            177677..179557
FT                   /gene="thiC"
FT                   /locus_tag="RALTA_A0179"
FT   CDS_pept        177677..179557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="RALTA_A0179"
FT                   /product="thiamin (pyrimidine moiety) biosynthesis protein"
FT                   /function="1.5.3.8 : Thiamine (Vitamin B1)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9371431; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62852"
FT                   /db_xref="GOA:B2AGF3"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62852.1"
FT                   /translation="MARTAPAASFESLESDLDQKFAYPASSKTYLTGSRPDIRVPLRTI
FT                   LQTSTRTEKGEMPNPPIPVYDTSGPYSDPDVHIDLKAGLPPVRAKWIEERGDTEVLPGL
FT                   SSEYGRDRANDPATAHLRFAQLTNPRRAKAGANVSQMHYARKGIITPEMEYVALRESLN
FT                   LQALYDKPEYKALLRQHPGNALGAGLPLRPEDITPEFVRQEIASGRAIIPANINHTELE
FT                   PMAIGRNFRVKINGNLGNSAVTSSLAEEVEKMVWSIRWGADTIMDLSTGKHIHETREWI
FT                   LRNSPVPIGTVPIYQALDKTGGIAEDLTWEMFRDTLIEQAEQGVDYFTIHAGVLLRYVP
FT                   LTADRVTGIVSRGGSIMAKWCLAHHKENFLYTHFDEICEIMKAYDVSFSLGDGLRPGCI
FT                   ADSNDDAQFGELRTLGELTAKAWKHDVQVMIEGPGHVPLQRIQANMDEELKHCYEAPFY
FT                   TLGPLVTDIAPGYDHITSGIGAANIGWMGTAMLCYVTPKEHLGLPDKEDVREGIITYKI
FT                   AAHAADLAKGWPGAQLRDNALSKARFEFRWEDQFNLGLDPERARSYHDATLPAEGAKIA
FT                   HFCSMCGPKFCSMKITQEVRDYAASLPKEAQQGMEEKSIEFLKKGSKIYS"
FT   gene            179714..180904
FT                   /gene="thiO"
FT                   /locus_tag="RALTA_A0180"
FT   CDS_pept        179714..180904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="RALTA_A0180"
FT                   /product="D-AMINO ACID OXIDASE FLAVOPROTEIN OXIDOREDUCTASE;
FT                   thiamine biosynthesis"
FT                   /function="1.5.3.8 : Thiamine (Vitamin B1)"
FT                   /EC_number="1.4.3.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9371431; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62853"
FT                   /db_xref="GOA:B2AGF4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62853.1"
FT                   /translation="MTAVQSFDVAILGAGLAGRLAAWLLVRGGARVALVERAGPDGAGS
FT                   AAYVAAAMLAPLAESAIAERRIVDLGIASVDLWRAWLVELPEPVFFQEDGTLVVWHARD
FT                   RAEMSLFTSRVRAVAPPELVAQRLRALDGKGVGEVEPALAGRFPQGLLLAGEGQLDNRG
FT                   ALRALLSCAVSEGVHCVWEAGEVDAGSLPQLGIHADVVLDCRGLGARSAWPAQPGGSQP
FT                   GLRGLRGEVVRVHAPDVRLHRPVRLLHPRYPIYIAPKPNDLYVIGATELESEDDSPMSV
FT                   RSALELLSAAHSLHPAFGEARVLELNVQRRPTRPDHLPAIRVDQRARVVRVNGLYRHGF
FT                   LIAPAVTEAACAVVGALLNGDPAAHAVPAALRWPGMIEAVTEAPAPTVGARSGTLH"
FT   gene            180917..181114
FT                   /gene="thiS"
FT                   /locus_tag="RALTA_A0181"
FT   CDS_pept        180917..181114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="RALTA_A0181"
FT                   /product="sulfur transfer protein"
FT                   /function="1.5.3.8 : Thiamine (Vitamin B1)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8432721; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62854"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62854.1"
FT                   /translation="MDILLNGRPLALAESATLADAVSAAQIAPPFAAAVNGQFVPRAAH
FT                   ANTPLAAGDRIDLVQPVTGG"
FT   gene            181118..181954
FT                   /gene="thiG"
FT                   /locus_tag="RALTA_A0182"
FT   CDS_pept        181118..181954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="RALTA_A0182"
FT                   /product="thiamin biosynthesis ThiGH complex subunit"
FT                   /function="1.5.3.8 : Thiamine (Vitamin B1)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8432721; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62855"
FT                   /db_xref="GOA:B2AGF6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62855.1"
FT                   /translation="MTFEPSATLRDPFVLYGESFGSRLLLGTARYPSPATLEAAVQASA
FT                   PAMITVALRRQGAVGDGEGGQAFWQMLKALNVPVLPNTAGCFTAQEVITTAMMAREVFE
FT                   TPWIKLELIGDDYTLQPDTLNLPAVAETLLKEGFKVLPYCTEDLVLCRRLLDVGCQALM
FT                   PWAAPIGTGRGAVNPHAMRVLRERLPDTPLIVDAGLGLPSHAAQVLEWGYDGVLLNTAV
FT                   AQAAYPVDMARAFAQAVAAGRTAYLAGPMPEREVAQASTPVVGMPFWHADNTEQRA"
FT   gene            181951..183084
FT                   /gene="thiE"
FT                   /locus_tag="RALTA_A0183"
FT   CDS_pept        181951..183084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="RALTA_A0183"
FT                   /product="THIAMINE-PHOSPHATE PYROPHOSPHORYLASE"
FT                   /function="1.5.3.8 : Thiamine (Vitamin B1)"
FT                   /EC_number="2.5.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8432721; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62856"
FT                   /db_xref="GOA:B2AGF7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62856.1"
FT                   /translation="MTRRPVHVPSDGPLRQAVLEHYGDTFGVDDKPWQAWRLEDAPAQP
FT                   GAHDVLLSDGEADADTIARVAAAGATLIETEREGGQWVDTVRSPMGTWVFSVAADTDQP
FT                   HSPAFVAVLLACLSLHFPAHDALCLARAWAPGSADWPSDFARFPHVRHAALVAPEHTVA
FT                   PFAPCPALGLYVVVPSAEWIERLAPLNVPTLQLRFKSGDAAAVRAEIARAARAMQGSSS
FT                   RLFINDHWQAAIEHHAAHGAHSGIYGIHLGQEDLDDADLDAIRASGLRLGVSTHGYAEM
FT                   LRVAAIRPSYLALGAIFPTTTKTMPTQPQGMGRFRAYVKLMQPVIPSLVGIGGVNATNM
FT                   REVLAVGVGSAAVVRAVTEADDVPAAVARLVSLFPAG"
FT   gene            183092..183598
FT                   /locus_tag="RALTA_A0184"
FT   CDS_pept        183092..183598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0184"
FT                   /product="putative acetyltransferase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62857"
FT                   /db_xref="GOA:B2AGF8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62857.1"
FT                   /translation="MAAPRIRLAAVDDLPRLPDIELAAAALFPEGDLPALLRLVSTPDS
FT                   ALVAAQREGRLWVAEHGGAVAGFALASRNRECGYLDEMDVHPDHGRRGLGRALVGAVQD
FT                   WARASGLRSLNLTTFAHLPWNAPFYASMGFRRLEDRELCPLLSEALAAQRAAGLRQRIA
FT                   MRQTF"
FT   gene            183774..184223
FT                   /locus_tag="RALTA_A0185"
FT   CDS_pept        183774..184223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0185"
FT                   /product="putative thioesterase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62858"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62858.1"
FT                   /translation="MSTQLPEIIPAAPGTPEKPYFGIDVPLMRYFGLQPELIEEGYCRT
FT                   RLPAHPQLVNSRGDVHGGTLMATLDFTLSGAARSHAPTETGVITIDMSTHFLAAARGEL
FT                   TLEARCLRRGARIAFCEGEVKDAAGTVVCVARAAFKLVPLSSGGN"
FT   gene            complement(184249..184683)
FT                   /locus_tag="RALTA_A0186"
FT   CDS_pept        complement(184249..184683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62859"
FT                   /db_xref="InterPro:IPR025688"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62859.1"
FT                   /translation="MPMLTHIDLRSDPDAAFYLKHEVVEVAFATEAGELISREGPNRYQ
FT                   PGDALITSRSGDRWCVSRDRFDPKYEAIPPLAHGQDGAYRNKPIPVLAREMHEAFSIER
FT                   SAGGDVLHGKPGDWLMQYAPGDYGITERARFEQVYRPLQD"
FT   gene            complement(184692..185573)
FT                   /gene="thiD"
FT                   /locus_tag="RALTA_A0187"
FT   CDS_pept        complement(184692..185573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="RALTA_A0187"
FT                   /product="bifunctional hydroxy-methylpyrimidine kinase and
FT                   hydroxy-phosphomethylpyrimidine kinase"
FT                   /function="1.5.3.8 : Thiamine (Vitamin B1)"
FT                   /EC_number="2.7.4.7"
FT                   /EC_number="2.7.1.49"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10075431; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62860"
FT                   /db_xref="GOA:B2AGG1"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62860.1"
FT                   /translation="MPGRLAHRPSLISSQMIPTPPRTLTIAGSDSGGGAGIQADLKTFS
FT                   ALGCFGMSAITAITAQNTLGVTGVHAIPADMVAAQIDAVAGDIGVDAAKTGMLGTAAIV
FT                   EAVAAAADRHGIRKLVVDPVMISTSGATLSDDATTQAMVRLLFPRALLVTPNLPEASYL
FT                   LGRRIARRADMEQAAADLIAMGCRAVLLKGGHLEDDGAAGIAGGLDDLLMLKDGTVRVF
FT                   THPRVDTRNLHGTGCTLAAAIASQLARGDALEDAAGKALDYVAQAIAAGAGLRLGSGNG
FT                   PLNHAFAPRALG"
FT   gene            185799..187217
FT                   /gene="ahcY"
FT                   /locus_tag="RALTA_A0188"
FT   CDS_pept        185799..187217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="RALTA_A0188"
FT                   /product="ADENOSYLHOMOCYSTEINASE (S-ADENOSYL-L-HOMOCYSTEINE
FT                   HYDROLASE)"
FT                   /function="1.5.1.9 : Methionine"
FT                   /EC_number="3.3.1.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62861"
FT                   /db_xref="GOA:B2AGG2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62861.1"
FT                   /translation="MNAVTDLKQDYLVADINLAGWGRKEIAIAETEMPGLMAIRDEFAA
FT                   AQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAAGGTPVF
FT                   AFKGESLKEYWDFTHRIFDWADGGTPNMILDDGGDATLLLHLGARAEKDQSVIANPGSE
FT                   EETFLFAAIKEKLAKDPSWYSRNLAAIRGVTEETTTGVHRLYQMAQKGELRFPAINVND
FT                   SVTKSKFDNLYGCRESLVDGIKRATDVMIAGKIAVVAGYGDVGKGSAQALRALSAQVWV
FT                   TEIDPICALQAAMEGYRVVTMDYAAEHGDIFVTCTGNYHVITHEHMAKMKDQAIVCNIG
FT                   HFDNEIDIASIEKYEWDEIKPQVDHVKFPDGKKLIILAKGRLVNLGCATGHPSYVMSSS
FT                   FANQTIAQIELWQERDSGKYPVGVYTLPKHLDEKVARLQLRKLNAQLTELTDQQAAYIG
FT                   VKKEGPYKADHYRY"
FT   gene            187292..187642
FT                   /locus_tag="RALTA_A0189"
FT   CDS_pept        187292..187642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0189"
FT                   /product="conserved hypothetical protein; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62862"
FT                   /db_xref="GOA:B2AGG3"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62862.1"
FT                   /translation="MRLLVVWIINAVALFVLPYIIPSIHIKSFGSAMLAALVLGLVNTL
FT                   IRPILVILTLPVTLLTLGLFIFVINALLFLFVGNLLSGFTVGGFWAALLGSILYSVISW
FT                   LLASLLLGNRDD"
FT   gene            187683..188513
FT                   /gene="metF"
FT                   /locus_tag="RALTA_A0190"
FT   CDS_pept        187683..188513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="RALTA_A0190"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /function="1.7.17 : Formyl-tetrahydrofolate biosynthesis"
FT                   /EC_number="1.5.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10201405; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62863"
FT                   /db_xref="GOA:B2AGG4"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62863.1"
FT                   /translation="MQDRYFSFEFFPPKTAEGTEKLRNTRAQLAPLKPKYISVTFGAGG
FT                   TTQQGTLDAVLEIQRDGIEAAPHLSCVGSSRESIRAILQQYRDGGIRHIVALRGDMPSG
FT                   MGEIGEFRYANELVEFIRAETGDWFNIEVAAYPEYHPQAKSPRHDLDNFVRKVKAGADS
FT                   AITQYFYNADAYFRFVDDVRALGVEVPIVPGIMPITNYSQLMRFSEMCGAEVPRWVAKR
FT                   LESFGDDRESIRAFGLDVVTALCERLLAAGVPGLHFYTLNAAGATKAIWQRLKL"
FT   gene            188521..188880
FT                   /locus_tag="RALTA_A0191"
FT   CDS_pept        188521..188880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0191"
FT                   /product="conserved hypothetical protein; TfoX N-terminal
FT                   domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62864"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62864.1"
FT                   /translation="MATRRPDPFIEHLLELMGPLAARIGPVTAKRMFGGHGLFYDGLMF
FT                   ALVSGGTCYLKADDATRGKFEAEGSEPFRYQSAKREVTMRHYLSLPPAALESPAAMTPW
FT                   AKLAVEAALRLGNAG"
FT   gene            189087..189845
FT                   /locus_tag="RALTA_A0192"
FT   CDS_pept        189087..189845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0192"
FT                   /product="conserved hypothetical protein, DUF82"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62865"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62865.1"
FT                   /translation="MVTATFRFYEELNDFLAPDQRRRDLSCVCARAATVKHMIEALGVP
FT                   HTEVELILVNGESSGFDRQLCEGDRVSVYPKFERIDVSPLLRVRGQPLRVMRFVADAHL
FT                   GGLAHLLRMTGFDTLYDNHFEDSEIERIAVDEGRIVLTRDRELLKRRGITHGCYVRALK
FT                   SRQQVREIFARLDLAGSARPFSLCLDCNAPLRALDPAGAAGRVPDGVLARHRSFVTCDR
FT                   CRRVFWEGSHWRCMRALVEELVQGAGTDPG"
FT   gene            complement(189842..190429)
FT                   /locus_tag="RALTA_A0193"
FT   CDS_pept        complement(189842..190429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0193"
FT                   /product="Putative 5-formyltetrahydrofolate cyclo-ligase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62866"
FT                   /db_xref="GOA:B2AGG7"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62866.1"
FT                   /translation="MSSIPAQTAPSPAADDDRRALRARLLAQRAALPARAEADTRIAAA
FT                   LSELLAGLAVRCLGFYWPIQQEFDARAAVAQWLAAVPGRHAALPSVSRPGAPLDFHLWT
FT                   PDAPMATGHYGIPVPDGTEAATPDALLIPCVGFSPDKFRLGYGGGFYDRTLAAMAQRPV
FT                   AIGIGYDACRIALQAQPHDIAMDWIVTESGAF"
FT   gene            190534..192486
FT                   /locus_tag="RALTA_A0194"
FT   CDS_pept        190534..192486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0194"
FT                   /product="putative SOLUBLE LYTIC MUREIN TRANSGLYCOSYLASE
FT                   PRECURSOR TRANSMEMBRANE PROTEIN"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /function="6.2 : Peptidoglycan (murein)"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10452894; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62867"
FT                   /db_xref="GOA:B2AGG8"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62867.1"
FT                   /translation="MLKGVYLQRAGRAAWIALACALLVTPVHAQKRPQAVTRAAPTVIP
FT                   SDPDEAFAALREAARKNDVERAYAISATLVDYPVPSYVEYFRIKPQLFDASGLARVDAP
FT                   DDQVRVFLQRYKGDAIADRMRNDWLLVLGKKRDWANFDAEYPQFVLKDDTQVECYALLS
FT                   RALKGQNVAAEARNVLSDPRYYGEGCVDLIGYLVQSQQIQRSDVAFQARLALEQNYVTL
FT                   AGKIAALLPDARVDGDTLATIVKMARNDPSQAAAYLATAQGTLSRDEQGAAWGVIGQFA
FT                   AKKLLPEAAGYYRRQMDLGGNQWLSDDTQEWRVRAALRQGDWKQVRQAVELMRPELRAK
FT                   DPAWIYWYGRALKVDGRDTEAQQNFQQIAGQFNFYGQLASEELGNRITLPPRTAVSDAE
FT                   AMAMRARPGFQRAQKFYAMNLRFEGNREWNWELRNMSDRELLAAAEYARRLELLDRTVN
FT                   SADRTRNEHDFALRFLMPYRDIMQRATDEVGLDMAWVYGLIRQESRFIMNARSSAGAHG
FT                   LMQVMPATAKYVARKIGMSDFSPSMMGDPTINIQLGTNYLNMVLTDLDSSWTLASAAYN
FT                   AGPGRPKAWRSTLARPVEGAIFAETIPFNETRGYVKNVLSNATYYAALMSGRPQSLKSR
FT                   LGTVTPSAVTTTSLP"
FT   gene            192612..193634
FT                   /locus_tag="RALTA_A0195"
FT   CDS_pept        192612..193634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0195"
FT                   /product="putative NADH dehydrogenase"
FT                   /function="1.4 : Energy production/transport"
FT                   /EC_number="1.6.99.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62868"
FT                   /db_xref="GOA:B2AGG9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62868.1"
FT                   /translation="MQTSNVLVIGGAGFIGSHLVSRLAGAASASGAPLEAGANPDSPIA
FT                   PDRIVVGTRNVEHAQHLLLLPRVEVVELGLADNAALDDAIGSLGVDGIVVNLVGVLHGE
FT                   RADPYGEAFASAHVELVRQIVASCLSTGVRRLLHMSALGADSNGPSMYLRSKGDGERIV
FT                   RASGLDWTIFRPSVVFGPDDHFLNLFAHMQQLAPVVPLACAHARFQPVFVQDVVQAFLN
FT                   AMVNPATIGHGYELGGPQVYTLEELVRFAGRASGHPRPVIALPDALARVQAAVMEHMPG
FT                   APLLSRDNLDSMQLDNVLARPMAPELNLHPVHLESVMTDALSGRNRDAALTHMRASVHR
FT                   "
FT   gene            193833..194531
FT                   /locus_tag="RALTA_A0196"
FT   CDS_pept        193833..194531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0196"
FT                   /product="putative Glutathione S-transferase"
FT                   /function="1.5.3.10 : Glutathione"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62869"
FT                   /db_xref="GOA:B2AGH0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62869.1"
FT                   /translation="MKLVIGNKNYSSWSLRPWLLLRQAGIDFEEVQVRLFTGSFAAEIA
FT                   RYSPAGKVPVLVDGDVTVWDSLAISEYVAERFPDKQLWPADPAERAVARAICAEMHSGF
FT                   ANVRNQLPMNVTAVLPGRGWNVAVQREVERIAAIWDGLRKQHGARGPFLFGTFTVADAF
FT                   YAPVVSRFATYGIHLPDDREDAKAYADFMLGLPAMQQWIAGAREERDFLADDEPYRLAP
FT                   DRADAIIVTH"
FT   gene            194594..195841
FT                   /gene="cca"
FT                   /locus_tag="RALTA_A0197"
FT   CDS_pept        194594..195841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="RALTA_A0197"
FT                   /product="tRNA nucleotidyl transferase"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.7.7.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62870"
FT                   /db_xref="GOA:B2AGH1"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62870.1"
FT                   /translation="MQVYAVGGAIRDELLGKPSQDRDYVVVGATPAEMEAAGYRPVGKD
FT                   FPVFLHPRTQEEYALARTERKTAMGYKGFAFYCEPDVTLEDDLVRRDLTINAMARAVDA
FT                   DGNLTGPVIDPHGGQRDLAARLFRHVSDAFAEDPVRILRLARFAARFHDFNVAAETMRL
FT                   MREMVAAGEVDALVPERVWQELARGLMEARPSRMFEVLRECGALARLLPELERLWGVPQ
FT                   RADFHPEVDTGVHVMMVIDCAAALGAPLPVRFAALVHDLGKGTTPEDVLPRHIGHELRS
FT                   VRLLEEVCARLRVPNECRDLAVVVAREHGHIHRSLELGAAAVVRLLERCDALRKPARFA
FT                   QALQACEADKRGRKGFEHSDYPQAARLLAAREAAASVDAGAIARACADNVAQIKDRVHA
FT                   ARVEAVAQRLGAQPGE"
FT   gene            complement(195888..196082)
FT                   /locus_tag="RALTA_A0198"
FT   CDS_pept        complement(195888..196082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0198"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62871"
FT                   /db_xref="GOA:B2AGH2"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62871.1"
FT                   /translation="MLRWTLTIFLSVIILSAALPWLQKVGLGRLPGDVRFRVFGREFVL
FT                   PFASTILISLIALVIGKLL"
FT   gene            complement(196099..197310)
FT                   /locus_tag="RALTA_A0199"
FT   CDS_pept        complement(196099..197310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0199"
FT                   /product="conserved hypothetical protein, DUF185; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62872"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62872.1"
FT                   /translation="MQKAASLPLPPADAQAASDTLTARIGESIDAAGGWIGFDRYMALA
FT                   LYAPGLGYYSGGSAKFGRDARDGSDFITAPELSPFFARTLARQFAPLLAQGLPRLLEFG
FT                   AGTGRLAADLLLGLEQEGQLPDTYAIVELSGELRARQQDTLARRAPHLAERVTWLDTLP
FT                   AAFEGVIVGNEVLDAMPVQLYARRGGSWHERGVARAAVPPEGGAPAFRFEDRALAAADV
FT                   PEALRAIPGEHDLVTETHAEAEGFTRAVGAMLARGAAFFIDYGFPGGEYYHPQRAGGTL
FT                   MCHYRHHAHPDPFLYPGLQDITAHVNFSGIAHAAVESGLTVAGFASQARFLMNAGITDL
FT                   LMALDPSDARTFLPQANAVQKLLSEAEMGELFKVIALTRGFDRGLEDSEPLAGFARGDR
FT                   SHAL"
FT   gene            197326..198183
FT                   /locus_tag="RALTA_A0200"
FT   CDS_pept        197326..198183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0200"
FT                   /product="putative deshydrogenase"
FT                   /function="1 : Metabolism"
FT                   /function="1.4 : Energy production/transport"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62873"
FT                   /db_xref="GOA:B2AGH4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62873.1"
FT                   /translation="MPASDTSASQAGDKAGQPAARGVALVTGGARRLGRAIALELAAQG
FT                   WDVAVHCHRSVDEAEALATQIRALGRRAAVLRADLADEAATSRLVADCTAALGVPTCLV
FT                   NNASLFQYDVATSFSYASLDTHMRTNVAAPLLLARELHKALAAAAGPDGAGKAAEKAAE
FT                   PRGVVINLLDQKLDNLNPDFLSYTLSKAALQTATVQLAQALAPRLRVVGVAPGITLVSG
FT                   EQSEQSFRRAHRVTPLGQSSTPEDIAQAVAYLAQARAVTGTTLYVDGGQHLMPLARDVM
FT                   FLTE"
FT   gene            198255..198656
FT                   /locus_tag="RALTA_A0201"
FT   CDS_pept        198255..198656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0201"
FT                   /product="putative Dihydroneopterin aldolase"
FT                   /function="1.5.3.2 : Folic acid"
FT                   /EC_number="4.1.2.25"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62874"
FT                   /db_xref="GOA:B2AGH5"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62874.1"
FT                   /translation="MTMLAALSHPSLQDCRRMFLRNYEVQINIGVHEFEKKGEQRVLIN
FT                   IDLFVPLEECTPQADKLDEVVDYDFMRNTVAARMAQGHVHLQETLCDDVARAMLKHPKV
FT                   RAVRVSTEKPDVYPDCDSVGVEVFHIKQG"
FT   gene            198765..199691
FT                   /locus_tag="RALTA_A0202"
FT   CDS_pept        198765..199691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0202"
FT                   /product="putative ATP pyrophosphatase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62875"
FT                   /db_xref="GOA:B2AGH6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62875.1"
FT                   /translation="MSHSNNFYRLETRLQSQTGKAIGDFGMIEDGDTVLVCMSGGKDSY
FT                   TMLSVLMALQKRAPIKFKLIAMNLDQKQPGFPEHILPEYLKSVGVEYVIVEADTYSIVK
FT                   EKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVNTFFLNMFFGGKMKAM
FT                   PPKLATDDGAHIVIRPLAYCSEKDIASYARAMEFPIIPCNLCGSQENLQRKKVSEMLQE
FT                   WERQNPGRIDNIFSALRNVVPSHLADTELFPFTGLATGLAKVDEASLFGETTFQQQPLT
FT                   FAGSLDENRMEFVRFERAPAAEPAGTP"
FT   gene            complement(199761..200876)
FT                   /locus_tag="RALTA_A0203"
FT   CDS_pept        complement(199761..200876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62876"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62876.1"
FT                   /translation="MSVSENILENAGRILGPVFGTGRRRGWQKLAARPAQLPANPCQDS
FT                   AGGQRASPVPMRGDFNMALSAQPTEVSEFHNCWARRILVILGAAVLCACSAMKLGYQQG
FT                   DRLAYWWIDNYVDVTSAQEPLTREAIARFFAWHRKAQLPEIASLLEEAKADVRQPVTPA
FT                   MVAHFQDASQQLARRSFEQAMPDMADFLLTLTPDQIARMEKKFAEGNAKYRKKFLNANP
FT                   AEREEARFDKVMEYARLVYGGFSPEQEKAIRVKVGPVVQNAEARYAERVARQQEWIKMV
FT                   RFVQATQPPKAQVIDLLRRFREYWQNPPARHAASHEASNNAGIALTVAIANLTTPQQKT
FT                   HAQERFQKWIDDTHALMREKANPPVQSAQAN"
FT   gene            200891..202255
FT                   /gene="glmU"
FT                   /locus_tag="RALTA_A0204"
FT   CDS_pept        200891..202255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="RALTA_A0204"
FT                   /product="bifunctional: N-acetyl glucosamine-1-phosphate
FT                   uridyltransferase (N-terminal); glucosamine-1-phosphate
FT                   acetyl transferase (C-terminal)"
FT                   /function="1.1.4 : Amines"
FT                   /function="1.6.3.1 : O antigen"
FT                   /function="1.6.4 : Enterobacterial common antigen (surface
FT                   glycolipid)"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /function="1.7.10 : Sugar nucleotide biosynthesis,
FT                   conversions"
FT                   /function="1.7.12 : Amino sugar conversions"
FT                   /function="6.1 : Membrane"
FT                   /function="6.2 : Peptidoglycan (murein)"
FT                   /function="6.3 : Surface antigens (ECA, O antigen of LPS)"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.57"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11084021; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62877"
FT                   /db_xref="GOA:B2AGH8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62877.1"
FT                   /translation="MNIVILAAGMGKRMYSDLPKVLHPVAGRPMLAHVLDTARALSPSR
FT                   LVVVVGHGAARVREAVAADDVAFAEQAQQLGTGHAVMQALPLLDDNQPTLVLYGDVPLT
FT                   SAATLQALVAEAGAQRFGVLTVEMPDPTGYGRIVRDAAGSIVRIVEQKDATEAEKAIRE
FT                   INTGIIVCPTGHLRKWLSTLRNDNAQGEYYLTDTVERAVADGVETVSAQPAAVWETLGV
FT                   NSKLQLAEVERIHQGNQARRLLEAGVTLLDPARIDVRGELTCGRDVTIDVGCVFEGRVH
FT                   LEDGVRIGAHCVIRNSTVGAGAQVHPFCHIDEAKVGPAGRIGPYARLRPGTELGEDVHI
FT                   GNFVEVKNAQVAAHSKANHLAYVGDATVGSRVNIGAGTITCNYDGVNKHRTVIEDDVFI
FT                   GSDTQLVAPVTVRRGATLGAGTTLTKEAPADKLTLSRAKQLTIDAWQRPVKQPKQ"
FT   gene            202346..204184
FT                   /gene="glmS"
FT                   /locus_tag="RALTA_A0205"
FT   CDS_pept        202346..204184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="RALTA_A0205"
FT                   /product="L-glutamine:D-fructose-6-phosphate
FT                   aminotransferase"
FT                   /function="1.6.3.1 : O antigen"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /function="1.7.10 : Sugar nucleotide biosynthesis,
FT                   conversions"
FT                   /function="1.7.12 : Amino sugar conversions"
FT                   /function="6.1 : Membrane"
FT                   /function="6.2 : Peptidoglycan (murein)"
FT                   /function="6.3 : Surface antigens (ECA, O antigen of LPS)"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.6.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62878"
FT                   /db_xref="GOA:B2AGH9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62878.1"
FT                   /translation="MCGIVGAVSTRNIVPVLIEGLRRLEYRGYDSCGVAVVRDDAVERA
FT                   RTVSRVADLDAQTQASGLSGFTGVAHTRWATHGKPDTVNAHPHLSGETIALVHNGIIEN
FT                   YEPLREELRAVGYGFESQTDTEVVAHLIHQAYSYPSSATRGDLFASVRAVTKRLHGAYA
FT                   IAVFAKDQPGRVVGARAGSPLVVALGENESFLASDALAVAGTANRIIYLEEGDVVEITL
FT                   DGVTIHDASDHPVEREARVVEAHAASVDLGPYRHFMQKEIFEQPRALGDTLEGVEGLSP
FT                   DLFGDNAAEVFAGIDSVLILACGTSYYSGCTAKYWLESIAKIPTQVEVASEYRYRDTVP
FT                   NPRALVVVISQSGETADTMAALRHARALGHVHTLAVCNVATSAMVRETELRFLTRAGTE
FT                   IGVASTKAFTTQLAALYMLTLSLAKTRGLLTEEAEAKALTNLRHLPAALHGVLALEPQI
FT                   IAWSEDFARRENALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVTEA
FT                   MPVVTVAPNDALLEKLKSNIQEVRARGGRLYVFADSDTQIQSSDGIQVIRMPEHYGDLS
FT                   PILHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE"
FT   gene            complement(204237..205184)
FT                   /locus_tag="RALTA_A0206"
FT   CDS_pept        complement(204237..205184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0206"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62879"
FT                   /db_xref="GOA:B2AGI0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62879.1"
FT                   /translation="MGLRQLHHFVTLVEQGSFARAAAALHLSQPALTRSIQALESELGT
FT                   LIDRSYGKVRPTAAGMLALARARRMLREQRELRRDLQLLEDVEIGTIRAGFGPFAASFL
FT                   LDPVLEALVRRYPRLRIDLETADTSAMRRSLEAEQLDIFVGESRSLAELAHLQIDRLPA
FT                   LETAFFVRSGHPLTRQREVTLADLRGYPVAGTRLPPHIMRFFRQALHEASGGSGPVPEE
FT                   EPGLMTVTCNDMHALRALLLAVDAVALVPVAMMADACAQRQAVALPMHPPTALKAQYGI
FT                   VTLAGRTPSPAMRVFAALVHEAVAQTGAGSEPAP"
FT   gene            205290..206282
FT                   /locus_tag="RALTA_A0207"
FT   CDS_pept        205290..206282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0207"
FT                   /product="conserved hypothetical protein, UPF0065"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12562821"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62880"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62880.1"
FT                   /translation="MNRRAWLTLATGGLVAGLTLGAAVPAAAQAYPAKPIRIVVPYVAG
FT                   GGTDTIARAMGEKLSKRLGQPVVVDNKAGASGIIGTDAVAKAAPDGYTLLMTLTQSVLT
FT                   NQFLFQKLPYDPRKDLTMISVLADAQLVLVTHPSVPARTVRELGEYARSRPGKLSYASW
FT                   GVGSLSHLSGAYYSKLVHGQATHVPYKGEAPMLQDLLGGQVQFGFASILTAKPYIQSGK
FT                   LKALAVTGTQRSSALPDMPTFAESGMQDSAFKTVGWIGLVAPVGVPAPILARLESEVRA
FT                   ILQTPDMQERMVALGLRTVGSSPAEAQALYARDWPVLKTLVADSGAKLD"
FT   gene            206591..207070
FT                   /gene="bfr2"
FT                   /locus_tag="RALTA_A0208"
FT   CDS_pept        206591..207070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr2"
FT                   /locus_tag="RALTA_A0208"
FT                   /product="bacterioferritin, iron storage homoprotein"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2661540, 9867433; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62881"
FT                   /db_xref="GOA:B2AGI2"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62881.1"
FT                   /translation="MKTDKKVIQLLNAQLRHELTAINQYFLHARMYRHWGLRALGKHEY
FT                   DESIEEMKHADKLIERILLLDGLPNLQDLDKLLVGENTEEMLGCDLKLELVSQASCKDA
FT                   IKYFESVGDYVSRQLVVDILEDTEEHIDWLEAQLELVRKVGLQNYIQSAMGGVED"
FT   gene            207167..207241
FT                   /locus_tag="RALTA_AtRNA1"
FT   tRNA            207167..207241
FT                   /locus_tag="RALTA_AtRNA1"
FT                   /product="tRNA-Cys"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            207557..208000
FT                   /locus_tag="RALTA_A0209"
FT   CDS_pept        207557..208000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0209"
FT                   /product="putative GCN5-related N-acetyltransferase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62882"
FT                   /db_xref="GOA:B2AGI3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62882.1"
FT                   /translation="MMKDLRIRVAVPTDAPAVGEVLERCGLSVDGVPRLLEHFHVAILG
FT                   AQIIGCAAGERCGETVVIRSVAVLPEHRDQGVATHVVRAALMRARANGARRAVLLASSC
FT                   PSYFARYGFTLVPAAKLPPEVMSSSEFHRAADTPPLCMWCELS"
FT   gene            complement(208061..209038)
FT                   /locus_tag="RALTA_A0210"
FT   CDS_pept        complement(208061..209038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0210"
FT                   /product="putative cation efflux protein"
FT                   /function="4.2.A.4 : The Cation Diffusion Facilitator (CDF)
FT                   Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62883"
FT                   /db_xref="GOA:B2AGI4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62883.1"
FT                   /translation="MHTQDLSAWTHSHAFDAGNRAAERGTRLVMVITAVTMVAEIAAGL
FT                   WFNSMALLADGWHMSSHALAIGLSAFAYAAARRYAGDWRFAFGTWKIEVLAGFASAVFL
FT                   LCIAALMAAGSLERLFTPQAIHYREAMGVTALGLLVNLGCALILGGHAHGHAHGHDHGH
FT                   DHGHHHGHDHGHHHHDLNLRAAYVHVLADAATSVLAIVALAGGWWLGWAWLDPVMGLVG
FT                   AVLVGRWAIGLMRQSGTVLLDREMDHPVVDEVREVLAGLDHGDESTRVSDLHVWRVGRQ
FT                   HFACIVCLVTHDAALTPQRVREALSVHEELVHVTVEISRCASDH"
FT   gene            complement(209470..210930)
FT                   /locus_tag="RALTA_A0211"
FT   CDS_pept        complement(209470..210930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0211"
FT                   /product="putative transcriptional regulator, GntR family;
FT                   C-term aminotransferase motif"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62884"
FT                   /db_xref="GOA:B2AGI5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62884.1"
FT                   /translation="MLTLNLTRSRRDGDTLTEQIVAGIAALVEQRALRPGTALPSVRRF
FT                   AQHHHVSTFTVAEAYGRLTALGYLASRPGSGYTVAHRHAPAGHARAPHWEAPGLNAAWL
FT                   LSDVFADHSVPIKAGAGWLPGDWLNEEGLHQAMRASARVPAAQLSGYGHPYGFAPLREH
FT                   IAAGLGQYGIPLQARQVVLTQGATQALDLVVRTLLRAGDTVLVESPCYCNLLQILRLAG
FT                   LRVVGVPRTAAGLDTDALEDALRAHAPRALFINTVLQNPTGASLTSMNAFRVLQLAEQH
FT                   RLLVVEDDIYRELAPAGSPMLAAMDGLSQVVYINGFSKTITPSLRVGYLAASPDLAKAF
FT                   ARTKMAVGLTSSEVTERLVYSVLTSGHYGRHVAALSERLRAQQDRVTEKMEAHGLEVLL
FT                   RPEGGMFAWARLSEAVQARWLASRRGGPLLGNRLATLALEHGIWLAPGSYFEPDETDSP
FT                   WIRFNVATGDAPQLWQFFDSLAQARQAA"
FT   gene            211254..212585
FT                   /locus_tag="RALTA_A0212"
FT   CDS_pept        211254..212585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0212"
FT                   /product="Omega-amino acid--pyruvate aminotransferase
FT                   (Omega-APT) (Beta-alanine--pyruvate aminotransferase)"
FT                   /function="1.1.3.1 : L-alanine degradation"
FT                   /function="1.5.1 : Amino acids"
FT                   /function="1.1.2.3 : Propionate degradation"
FT                   /EC_number="2.6.1.18"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6822556; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62885"
FT                   /db_xref="GOA:B2AGI6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62885.1"
FT                   /translation="MDAAKTVIPDLDALWMPFTANRQYKAAPRLLASASGMYYTTHDGR
FT                   RILDGCAGLWCVAAGHCRKEIVEAVARQAATLDYAPPFQMGHPLSFEAATKLAAIMPQG
FT                   LDRIFFTNSGSESVDTALKIALAYHRARGEGQRTRFIGRERGYHGVGFGGMAVGGIGPN
FT                   RKAFSANLMPGTDHLPATFNLAEAAFSKGQPQWGAHLADELERILALHDPANVAAVIVE
FT                   PLAGSAGVLVPPVGYLEKLREITSRHGILLIFDEVITAFGRLGAATAAERFNVTPDLIT
FT                   MAKAINNAAVPMGAVAVRREVHDAVVNSAAPGAIELLHGYTYSGHPLAAAAAIATLDLY
FT                   QRENLFGRAAELAPVFEAAAHGVRGAPHVKDIRNYGLVAGIELESRPGQPGARAYEAFL
FT                   KCLELGVLVRYTGDILAFSPPLIISEAQIGEMFDTVKQALRDIK"
FT   gene            212707..214224
FT                   /locus_tag="RALTA_A0213"
FT   CDS_pept        212707..214224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0213"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /function="1.1.3 : Amino acids"
FT                   /function="1.1.2.3 : Propionate degradation"
FT                   /EC_number="1.2.1.27"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62886"
FT                   /db_xref="GOA:B2AGI7"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62886.1"
FT                   /translation="MSIAENRQLAEVHHFIGGTVRRAGGQRQADVFNPATGEVAARVAL
FT                   GTAQDVADAVAAARAAFPAWADTPPLRRARILFKFKELLDQHHDDLAALITREHGKVFS
FT                   DAKGEVTRGIEVVEFACGIPNLLKTDFTDNIGGGIDNWNLRQPLGVVAGITPFNFPVMV
FT                   PMWMFPVALACGNTFVLKPSERDPSPSLLIADLLRQAGLPDGVFNVVQGDKEAVDALLA
FT                   HPDVQALSFVGSTPIAEYIYTEGMKHGKRVQALGGAKNHLVVMPDADLDQAVDALIGAA
FT                   YGSAGERCMAISVAVAVGDVADKLVPRLAERARALKIRNGMEADAEMGPLVTGAHKAKV
FT                   EGYIAQGVAEGATLVTDGRGHKVDGHENGFYVGGTLFDHVTPEMTIYKEEIFGPVLSVV
FT                   RVHDFAEAVALINAHEYGNGVSCYTSDGGIARAFARQIQVGMVGINVPIPVPMAWHSFG
FT                   GWKRSLFGDHHAYGEEGVRFYTRYKSVMQRWPDAIAKGAEFTMPVAK"
FT   gene            214248..214598
FT                   /locus_tag="RALTA_A0214"
FT   CDS_pept        214248..214598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0214"
FT                   /product="putative Glyoxalase/dioxygenase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62887"
FT                   /db_xref="GOA:B2AGI8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62887.1"
FT                   /translation="MKVNRIVANIGTADPAQARVFYQDVLGLELLMDHGWIRTYGSDAA
FT                   ARTQVSFAVEGGNGTPVPALSIEVDDVDEAHRRMLAAGFAVEYGPADEPWGVRRFFVRD
FT                   PFGQLVNILAHA"
FT   gene            214775..216172
FT                   /locus_tag="RALTA_A0215"
FT   CDS_pept        214775..216172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0215"
FT                   /product="Cationic amino acid transporter"
FT                   /function="4.2.A.3 : The Amino Acid-Polyamine-Choline (APC)
FT                   Family"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62888"
FT                   /db_xref="GOA:B2AGI9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62888.1"
FT                   /translation="MSLFRTKDIDAMLAVARDDGLKKVLGPVDLVLMGIGAIIGTGIFV
FT                   LTGTGALTAGPALTVSFVIAALACGFAALCYAEFASAIPVSGSIYTYSYATLGEIVAWM
FT                   IGWDLLLEYGLATSAVSVGWSGYFQSLMAGFGMKLPAALTAAPGLVPGVQTVLNLPACL
FT                   IMLAITWVVSYGVRESARVNNLMVAVKIGVVLLFIAVGVWHVQPANWQPFAPFGFTGIF
FT                   NAAALVFFAFIGFDAVTSAAEEVRNPRRDLPIGIIGSLAVCTVLYVVVAAIMTGIVPFA
FT                   KFAGVDHPVSLALQFAGQNWVAGFVDLGAILGMTTVILVMTYGQTRVIFAMSRDGLLPE
FT                   RLSSVHPVHATPYFATWTVGLVFAAIAAFVPLNVLAELINIGTLAAFTLISVAVLVLRK
FT                   TRPELPRAFRCPGVPVVPLLSIGFCLFLMAHLQALTWAAFLVWLALGLVIYFAYARRNA
FT                   VLHNHGG"
FT   gene            complement(216176..217585)
FT                   /locus_tag="RALTA_A0216"
FT   CDS_pept        complement(216176..217585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0216"
FT                   /product="putative transcriptional regulator, GntR family;
FT                   C-term aminotransferase motif"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62889"
FT                   /db_xref="GOA:B2AGJ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62889.1"
FT                   /translation="MKLILDASTGIPLTEQIVEGVKAWIGNREARPGARLPSIRQLAAE
FT                   NGISRFPVIEAYDRLVSQGLLDSRQGSGFYVADSPLAGRSARGWSDPSLAEDLSDHILE
FT                   QFNHPSGTLKLAGGFVPETWRDVEGLTQAIRAISRNEIDSVIHYATPMGHPELRRQVLL
FT                   RVRQLGIAAELPQVLITTGASQALDLVVRHLLKPGDTVFVEDPGYYNLFGLLRLHGVQL
FT                   VGVPHTPDGPDPDATEALLRQHKPKLFFTNSVLQNPTGSTLAPPVAFRLLELARRHGFR
FT                   FVEDDIFSDFQTHFTDRLATLDQLEHVIYIGGFSKTVSASLRIGYLVADKALVKDLVDV
FT                   KVLTSVAGSHFAEAVTAALLERGGYRKYVERLRLRVREAVANAVRQLHGNGWEVFCQPS
FT                   GGNFLWARPPGIEDSRELVTLGEQFGVTLAPGNYFRPGGETSAWIRINAAYANEPRAVA
FT                   FMKAAAERGAR"
FT   gene            217788..218135
FT                   /locus_tag="RALTA_A0217"
FT   CDS_pept        217788..218135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62890"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62890.1"
FT                   /translation="MRELRTFELDQPGLPVSWRAGYGQTVCAVAGKLWVTIEGNPNDIW
FT                   LEPGQELALPEGYRVWLSGDGAGARFTLAQTPAPWSMQRLAAWLRALRHRVDEHSTDAF
FT                   GECPRIGALCR"
FT   gene            218400..221690
FT                   /locus_tag="RALTA_A0218"
FT   CDS_pept        218400..221690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0218"
FT                   /product="METHYLMALONYL-COA MUTASE"
FT                   /function="1.1.2.3 : Propionate degradation"
FT                   /function="1.7.1 : Unassigned reversible reactions"
FT                   /EC_number="5.4.99.2"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62891"
FT                   /db_xref="GOA:B2AGJ2"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62891.1"
FT                   /translation="MTDLSDVHDVRRGAPQPKPVQPGTGPANKVRFVTAASLFDGHDAS
FT                   INIMRRILQSHGCEVVHLGHNRSVEEIVTAALQEDAQGIAISSYQGGHVEYFKYMVDLL
FT                   RDKGGEHVQVFGGGGGVIVPDEIRELQAYGVARIYSPEDGQRMGLAGMIADMVQRCDLD
FT                   LSRYAPTSLDPVAAGDRRALAQLITALENGKADAALMAAMHAQAQQASVPVLGITGTGG
FT                   AGKSSLTDELIRRFRLDQQDALSIAVISIDPSRRKSGGALLGDRIRMNAINHPNIFMRS
FT                   MATREAGSEISQALPDAIAACKVAGFDLVIVETSGIGQGDAAIVPHVDLSLYVMTPEFG
FT                   AASQLEKIDMLDFADFVAINKFDRKGAQDAWRDVAKQVQRNREQWHGKPEDMPVYGTQA
FT                   SRFNDDGVTMLYQGLREALAGHGLKVGAGTLPVLSGRISTGQNVIVPPARSRYLAELAD
FT                   TVRAYHRRVAEQSRIARERQQLRESSRILQAAQGDGTALDALAAERDTALGQVERKLLA
FT                   MWPQMREAYSGDEYVVKIRDKEIRTGLVTTTLSGTKVRKVVLPRFEDDGEVLKWLMREN
FT                   VPGSFPYTAGVFAFKRENEDPTRMFAGEGDAFRTNRRFKLVSQGMEAKRLSTAFDSVTL
FT                   YGEDPHVRPDIYGKVGNSGVSIATLDDMKVLYDGFDLTSPSTSVSMTINGPAPTILAMF
FT                   MNTAIDQQLDKFRADNGRDPTADEEAKIRAWVLQNVRGTVQADILKEDQGQNTCIFSTE
FT                   FSLKVMGDIQEYFVHHQVRNFYSVSISGYHIAEAGANPISQLAFTLSNGFTYVEAYLAR
FT                   GMHIDDFAPNLSFFFSNGMDPEYSVLGRVARRIWAVTMRDKYGANERSQKLKYHIQTSG
FT                   RSLHAQEIDFNDIRTTLQALIAIYDNCNSLHTNAYDEAITTPTGESVRRALAIQLIINR
FT                   EWGVAKCENPNQGSFLIEELTDLVEEAVLQEFERIAERGGVLGAMETGYQRGKIQEESL
FT                   YYEQLKHDGTLPLIGVNTFRNPDGDPVPQKLELARSSEAEKQSQLERLQAFQQAHADEA
FT                   PAMLQRLRQAVIDNQNVFAVLMDAVRVCSLGQITHALFEVGGQYRRNM"
FT   gene            221835..222272
FT                   /locus_tag="RALTA_A0219"
FT   CDS_pept        221835..222272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0219"
FT                   /product="putative ribonucleoside phosphate hydrolase,
FT                   Histidine triad (HIT) protein"
FT                   /function="1.5.2.1 : Purine biosynthesis"
FT                   /function="1.7 : Central intermediary metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62892"
FT                   /db_xref="GOA:B2AGJ3"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62892.1"
FT                   /translation="MDTQYSPNNIFAKILRGEMPCIKVYEDDDTIAFMDIMPQADGHTL
FT                   VVPKEAAVNLFDLSERGAQAAIVATQRVARAVRAAFNPDGISIGQFNGAAAGQTVPHVH
FT                   FHIVPRYNDQSLRGHARDMQEPEVLKGHAERIIAALREQAP"
FT   gene            222317..223171
FT                   /locus_tag="RALTA_A0220"
FT   CDS_pept        222317..223171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0220"
FT                   /product="3-HYDROXYBUTYRYL-COA DEHYDROGENASE"
FT                   /function="1.1.5.1 : Phenylacetic acid degradation"
FT                   /function="1.1.2 : Fatty acids (fatty acid oxidation)"
FT                   /EC_number="1.1.1.157"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8655474; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62893"
FT                   /db_xref="GOA:B2AGJ4"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62893.1"
FT                   /translation="MAIKTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVAT
FT                   VSGSLDRLIKKEKLTEAQKADALARIKGSTSYDDLKAADIVIEAATENYDLKVKILKQI
FT                   DGIVGDNVIIASNTSSISITKLAAVTARADRFIGMHFFNPVPVMALVELIRGLQTSDAT
FT                   HAAVEALSKQLGKYPITVRNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGC
FT                   NHPIGPLALADMIGLDTMLAVMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYV
FT                   YSK"
FT   gene            223464..223844
FT                   /locus_tag="RALTA_A0221"
FT   CDS_pept        223464..223844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0221"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62894"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62894.1"
FT                   /translation="MRGTVHPFRLQQHRIMAHPVLFAALLAGLMSLLAARSAMAHVDVG
FT                   VHIGPPVYAAPAPVYVAPPPPVVYAPRYHGWHGDRYWDGRRWYGRHEWRGRHHHHYRHH
FT                   HHRHHHDRHHGHGHHGHRGHGH"
FT   gene            complement(223884..224330)
FT                   /locus_tag="RALTA_A0223"
FT   CDS_pept        complement(223884..224330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62895"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62895.1"
FT                   /translation="MGNKVGNKVASAIDADTLRAYRETQYRVLGDTPMTLRIDQRSAAL
FT                   AALHRALGVDCSAFITAANPFSQRCDDAANARRQQALAEDLNALGRRAIEAAGEHPDNG
FT                   WPAEPSFLVPGLSLAEARALGETYQQNAVVWSGADAVPRLVLLR"
FT   gene            complement(224332..225000)
FT                   /locus_tag="RALTA_A0224"
FT   CDS_pept        complement(224332..225000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0224"
FT                   /product="putative transcriptional regulator, crp family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62896"
FT                   /db_xref="GOA:B2AGJ7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62896.1"
FT                   /translation="MLNDFVDRCVWAADLSPEQRERVRRAMFVHEYSQGDYVCHKGDKA
FT                   EHWLGVLEGIVKITTVSPSGKSVTFTGVPTGGWFGEGAVLKSEIRKYDVMALRRSTIAF
FT                   LPRDTFQWLLDTSLPFTRFLLTQFNERLGQFIAAVEYERLLDIDSRVARAVSSLFNEHL
FT                   YPGIGKTLEISQEEIGLLAGISRQRANQALKVLEQQGLVRVDYGVIEVLDLDGLRQYGE
FT                   "
FT   gene            225281..227239
FT                   /locus_tag="RALTA_A0225"
FT   CDS_pept        225281..227239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0225"
FT                   /product="putative AMP-dependent synthetase and ligase"
FT                   /function="1 : Metabolism"
FT                   /EC_number="6.2.1.26"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62897"
FT                   /db_xref="GOA:B2AGJ8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62897.1"
FT                   /translation="MQESSATTFPRWLLAHAQQRPEHPAYREKDLGIWQTYSWAQAAQQ
FT                   VRALACGLAALGFKRGMNLAVVGDNRPRLYWAMTAAQALGGVPVPLYQDAIANEMVYVL
FT                   NDAEIEFAIVEDQEQVDKLLEVEAQLAESGRAVRHVIFEDPRGLLDYDHPSLMSYERLQ
FT                   ELGREFDQAHPGFYDEAIAAGQPDDTAIILYTSGTTGKPKGVCHSHHGLIGSARNGCAF
FT                   DKLNADDDVLSYLPMAWVGDNLFSYAQAMVAGFTVNCPESRETVMTDLREIGPTYYFAP
FT                   PRIYEGLLTQVMIRMEDAGWIKRKLFHWAMDVARRCGTAILDGQPVPVAERARYALGEA
FT                   LVYGPLRNVLGMSRIRVAYTAGEAIGPDLFRFYRSIGVNLKQFYGQTETCAYVCLQPDG
FT                   KVKFDSVGPAAPGMEIRIADNGEVLVRGVGLLKSYYKRDDATREAINDEGYFMTGDAGV
FT                   IDADGHLKIIDRAKDVGKLADGSMFAPKYIENKLKFFPYIKEAVAFGNGRDQVCAFINI
FT                   DFEAVGNWAERRHLPYAGYVDLAAQPDVLEMIGECVNQVNADLANDPMLAGSQIARFLV
FT                   LHKELDPDDDELTRTRKVRRGFIAEKYGVLVDALYAGKSEQFIETRVKFEDGREGSVSA
FT                   TLKLVDARRLPVAARAA"
FT   gene            227269..228231
FT                   /locus_tag="RALTA_A0226"
FT   CDS_pept        227269..228231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0226"
FT                   /product="putative transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62898"
FT                   /db_xref="GOA:B2AGJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62898.1"
FT                   /translation="MTQVAWQGAGKREWSAAARTDASGAGGGGAMAPAGTLPPAGLADD
FT                   SGVHPGTRHAQRTGAQARTGGEVILDLQHISLSFGGVKALTDISFDVCEHEVRAIIGPN
FT                   GAGKSSMLNVINGVYHPQQGRIVFRGEERKQMHPTAAARQGIARTFQNIALFKGMTVLD
FT                   NIMTGRNTQFRTSWFAHALWWGPARNEEMRHRQKVEEVIDFLEIQSIRKTPVGRLPYGL
FT                   QKRVELARALAAEPSMLLLDEPMAGMNVEEKQDMCRFILDVNRQFGTTIVLIEHDMGVV
FT                   MDISDRVVVLDYGKKIGDGTPEEVKGNPDVIKAYLGTSH"
FT   gene            228243..229157
FT                   /locus_tag="RALTA_A0227"
FT   CDS_pept        228243..229157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0227"
FT                   /product="putative branched-chain amino acid transport
FT                   system permease, membrane component"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62899"
FT                   /db_xref="GOA:B2AGK0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62899.1"
FT                   /translation="MTFFVEILLGGLLSGLMYSLVALGFVLIYKASGVFNFAQGAMVYF
FT                   AALAVVGLMDKGMPMWAAVIGAFVVMILVGMSTERFVLRKLVNQPPITLFMATIGLSFF
FT                   LEGLGPLLFGNEVRPINLGIVDEPIESILTTFNIVISKFDLAAAAIAGVLVGSLALFFQ
FT                   YTKVGRALRAVADDHQAALSLGIPLQNIWAIVWGVAGFVALVAGMLWGSRNGVQFALTL
FT                   TALKALPVLILGGFTSVPGAIVGGLIIGASEKLAEIYIPPVFQSMFGGNFGGIEGWFPY
FT                   VFALLFLLVRPEGLFGEKHIDRV"
FT   gene            229184..230260
FT                   /locus_tag="RALTA_A0228"
FT   CDS_pept        229184..230260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0228"
FT                   /product="putative branched-chain amino acid transport
FT                   system permease, membrane component"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62900"
FT                   /db_xref="GOA:B2AGK1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62900.1"
FT                   /translation="MFYREAGQFKTSYVADSQIFPIRQDRIGFAVLMAVAFVAIPFVGS
FT                   EYWFSAILIPFLIFSLAALGLNILTGYAGQLSLGTAAFMAVGAYAAYNFQLRIEGMPVL
FT                   LTFILAGLSAALVGVAFGLPSLRIKGFYLAVATLAAQFFVVWALTKFPWFSNNSSSGVI
FT                   TAQRLDLFGYAIDTPVKKYLFVLAIVTVLALAAKNLVRSATGRAWMSVRDMDVAAEVIG
FT                   IPLMRTKLLAFAVSSFYCGVAGALYAFCYLGSVEPDGFSLDLSFRVLFMIIIGGVGSIL
FT                   GSFLGAAFILLLPIFLDNVLPPLASLLHLPFTNATVSHIQLMVFGGLIIFFLIVEPHGL
FT                   ARLWQIAKEKLRLWPFPH"
FT   gene            230331..231689
FT                   /locus_tag="RALTA_A0229"
FT   CDS_pept        230331..231689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0229"
FT                   /product="putative branched amino acid transport system
FT                   permease, periplasmic binding component"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62901"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62901.1"
FT                   /translation="MRAKETVMTNLIRNVQRAALVVSAAAALLAPAVPALAQSNEQFIA
FT                   LPSYRVGPYGANGQSWYGGFIDYLNYVNLKDGGVNGVKLSWEECETEYNNAKGVECYER
FT                   LKSKNATTKGTAYHAMSTGISYALVDKTAADKVPLVMMGYGRTDAVDGSVFPYAFPLVT
FT                   TYQMQVSAIVKYLASKSGGSLAGKKIVYLYHDSAYGKEPIVALQAEARLNKFNLVEIPV
FT                   AHPGNEQGAQWLKIRQENPDYVIFWGWGVMNQTALKAAQKVGFSREKMIGSWWAGSEED
FT                   TVPAGDASKGYMSATWNVAGKSVPLIADIEKVVYGAGKGNMQDKNKIGSVLYNRGVSAA
FT                   VVTVEAVRVAQAKFGKGKPMTGEQMRWAFENLNLTNARLQQLGATGLLPEIKTSCENHE
FT                   GSGKVKIQQWDGSKWVVVSDWIEGNKGLIHPLFKATAAQYAKEKGITPGCSKS"
FT   gene            231707..232612
FT                   /locus_tag="RALTA_A0230"
FT   CDS_pept        231707..232612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0230"
FT                   /product="putative branched-chain amino acid transport
FT                   system permease, ATP_binding component"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62902"
FT                   /db_xref="GOA:B2AGK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62902.1"
FT                   /translation="MVSPLSLWERGANRRDCEVASYRHTTTSRTMSLLSVNNIEVIYDH
FT                   VILVLKGVSLEVPEGKIVALLGANGAGKTTTLKAISNLLQAERGDVTKGSIEYRGDRVD
FT                   QLTPNDLVRRGVIQVMEGRHCFAHLTIEENLLTGAYTRGLSRGQTRDELEKIYEYFPRL
FT                   KTRRKSQAGYTSGGEQQMCAIGRAMMAKPAMILLDEPSMGLAPQIVEEIFEIVRGLNSR
FT                   ESVSFLLAEQNTMVALRYADYGYILENGRVVMDGDAESLRTNEDVKEFYLGVAANDADG
FT                   AGRKSFRDVKSYRRRKRWLA"
FT   gene            232786..234036
FT                   /locus_tag="RALTA_A0231"
FT   CDS_pept        232786..234036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0231"
FT                   /product="putative phenylacetate-CoA ligase"
FT                   /function="1 : Metabolism"
FT                   /EC_number="6.2.1.30"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62903"
FT                   /db_xref="GOA:B2AGK4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62903.1"
FT                   /translation="MPEHFDPLETRAPEVREQALLAALARQVAHAREHAPYFAELLGGV
FT                   DPRLLSSRAALAELPVTRKSDLSARQRALPPLGGLNATPLGKLRHVFQSPGPIHEPDGH
FT                   DADWWRTARAMHAAGFRAGDLVYNTFSYHFTPAGMMMESGAHRLGCCVFPAGVGQTDSQ
FT                   VQALASLQPAAYAGTPSFLKLLLERGDELGTPCTSLAKALVSGEALPPSLRNWFRDRGV
FT                   RVQQMYGTADVGLIAYETEGGDGWVVDEGVLVEIVEPGGSRPMPEGETGEVVVTVLGNG
FT                   DYPLIRFGTGDLSAVVPASSQRPSPCGRTNIRLKGWLGRADQATKVKGMFVHPGQVADV
FT                   LRRHPEIRAARLVVTGDPGADVMTLHCEATRQDAELQRAVAESLREVMRLRGEVAFVAA
FT                   GSLPQDGRLIEDARKYD"
FT   gene            complement(234257..234721)
FT                   /locus_tag="RALTA_A0232"
FT   CDS_pept        complement(234257..234721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0232"
FT                   /product="conserved hypothetical protein, DUF454; putative
FT                   membrane component"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62904"
FT                   /db_xref="GOA:B2AGK5"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62904.1"
FT                   /translation="MRPFVRPLPPSNSDLSPDPDAAPSHRQRVLRAAWVALGGLCLLLG
FT                   VIGIFLPVLPTTPFVLLAAACFARGSRRFHEWLLGHPRFGPLVGDWQRHRSIPFKAKCL
FT                   ALSMMWLSMGTTAWLLRGRPLVSAALLACAVGVSVWMVRLPTRPTEGGKT"
FT   gene            complement(234743..235720)
FT                   /locus_tag="RALTA_A0233"
FT   CDS_pept        complement(234743..235720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0233"
FT                   /product="conserved hypothetical protein, Putative
FT                   2-nitropropane dioxygenase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62905"
FT                   /db_xref="GOA:B2AGK6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62905.1"
FT                   /translation="MPAAKQLPQALQNLALPVIASPMFIVSYPELVLAQCKAGIVGSFP
FT                   ALNARPAELLDEWLTQIEQELAAFRAAHPGAPVGPVAVNQIVHSSNARLEHDIKVCVEH
FT                   KVPIFITSLRAPPRELIDAVHSYGGIVLHDVISLRHAEKAIESGVDGLILVAAGAGGHA
FT                   GMLSPFALVGEVRKIFDGPIALSGSIATGEAVLAAQAMGADFAYVGTRFIASQEAHAAE
FT                   SYKQSITSSAAADIVYTNLFTGVHGNYIRESISNAGLDPDNLPVADKSKMDFSSGSSKA
FT                   KAWKDIWGAGQGVGQIHDIPSAGEIVARMKSEYDAAKARLGIAR"
FT   gene            complement(235846..237288)
FT                   /gene="creC"
FT                   /locus_tag="RALTA_A0234"
FT   CDS_pept        complement(235846..237288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creC"
FT                   /locus_tag="RALTA_A0234"
FT                   /product="sensory histidine kinase"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62906"
FT                   /db_xref="GOA:B2AGK7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62906.1"
FT                   /translation="MHIGLRIFFGFFLIVGLATVLTLRVFVQEVKPGVRQAMEDTLIDT
FT                   AHVLAALAADDLKAGRIADGAFARHMAALREVPVNAEVSGLHKDSIGYRVYVTDASGIV
FT                   RFDSTGTDVGRDYSRWNDVYLTLRGKYGARSTRADPADEDSTVMHVAAPVRDVDSNGER
FT                   IIGVLTVAKPNAAMAPFIARSQRKILLYGGLLIGTACVIGLACTLWLMHGLSRLRGYAR
FT                   AVAAGERAEMPLRGAGELAELGRAVQGMRERLEDKQYVEHYIHTLTHEMKSPLAAIGGA
FT                   AELLQEEMPAADRQRFVANIRTQSGRLETMIRKLLALAEVEQRQRLEVREPVALAPLLA
FT                   QLCAELEPRARQRGVALQCAGGDGPGHVAGDPFLLRQAIANLLDNAIDFAPPGTAVTVL
FT                   LERRGDALAIAVADQGPGIPDYALPRVFERFYSLPRPHGADKSTGLGLCFAREVATLHH
FT                   GDVTVANRPGGGALAELVLPAA"
FT   gene            complement(237298..237993)
FT                   /gene="creB"
FT                   /locus_tag="RALTA_A0235"
FT   CDS_pept        complement(237298..237993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creB"
FT                   /locus_tag="RALTA_A0235"
FT                   /product="response regulator, CheY family"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2.2 : Activator"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62907"
FT                   /db_xref="GOA:B2AGK8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62907.1"
FT                   /translation="MPGMEQPRILVVEDEQAIADTILYALRTDGMLAEHCTLGGDALAC
FT                   LRAAQADLLILDVGLPDLSGFEVCRTLRTFSDAPVIFLTARHEEIDRIVGLEIGADDYV
FT                   VKPFSPRELAARVRAILRRARGGGATAKPGEAAGFTHDKDGARLAYHGHWLALTRYEYL
FT                   LLAWLVAHPGRIYSRAQLMDAVWAGALDTSDRTVDTHIKTLRAKLREVSAEGAERIRTH
FT                   RGMGYSLAP"
FT   gene            complement(238003..239136)
FT                   /locus_tag="RALTA_A0236"
FT   CDS_pept        complement(238003..239136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0236"
FT                   /product="putative Flavoprotein monooxygenase"
FT                   /function="1.4 : Energy production/transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62908"
FT                   /db_xref="GOA:B2AGK9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62908.1"
FT                   /translation="MPSFDYDLVIAGASFAGAACALAAARAGLRVLVLERKTDPGDKLH
FT                   TTGILVREAIEQTWLGQAPADCVHRVEQVKLYSPRLRSLNLSAPGYYFHTTDTPRLMRW
FT                   LAAELVRHRVELRLGQAFVGAVPRHGGWHVTGVGHTRYLVGADGAQSRVAQCAGLGRVH
FT                   SVLYGVEYEFPGLALPEPDALHCFITRRFAPGYIGWIAQNPTGVQAGLALRYRPRRGRA
FT                   PDLDGLLAHVRERAGLPQLAQPAATRAGLIPCGGPVLPLARDGVILTGDAAGIVSPLTA
FT                   GGIHYAFAHGESVGDAVAAHLLRGGPAPEAVASASAPRFRAKRALRWMFERFQCDWPFD
FT                   LMLYSPPLRRAAEQIYFHQRGAQSAQSAPPARAAASA"
FT   gene            complement(239387..240724)
FT                   /gene="dctD1"
FT                   /locus_tag="RALTA_A0238"
FT   CDS_pept        complement(239387..240724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctD1"
FT                   /locus_tag="RALTA_A0238"
FT                   /product="transcriptional response regulator,
FT                   C4-DICARBOXYLATE TRANSPORT RESPONSE REGULATOR"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3671068; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62909"
FT                   /db_xref="GOA:B2AGL0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62909.1"
FT                   /translation="MSTAMQDGLRVLFVEDEPLVRQATAQSLELAGFRVLALPSAEAAI
FT                   PHLHGAFAGVVVTDVRLPGASGLDLLQHCRNAAPGVPVILVTGHGDITMAVQAMREGAY
FT                   DFIEKPFGADRLTDTVRRALERRALELENQALRRELAGPAAGTRIIGRSPAIEQVRALV
FT                   ANVAPTDVPVMINGETGTGKELVARSLHALSGRAEGPFIALNCGAVPEAIFESEMFGHE
FT                   AGAFTGAGKRRIGKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGSLERLGSNASVKI
FT                   DVRIVAAAKGDMDALVAQGSFREDLYYRLNVVTIALPPLRERREDIVPLFEHFSLVSAV
FT                   RYQRPAPILSEAQRQALAQRPWPGNVRELRNAADRMVLGVPEGGQAGAQAAGPDESAPL
FT                   RERMEHFERAVIADALARTGGAVSQAADLLQVGKATLYDKIKRYGL"
FT   gene            complement(240721..242718)
FT                   /gene="dctB1"
FT                   /locus_tag="RALTA_A0239"
FT   CDS_pept        complement(240721..242718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctB1"
FT                   /locus_tag="RALTA_A0239"
FT                   /product="sensor histiidne kinase, transcriptional
FT                   regulator of C4-DICARBOXYLATE TRANSPORT"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3671068; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62910"
FT                   /db_xref="GOA:B2AGL1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62910.1"
FT                   /translation="MPHSDDFLAVHDPAATRPVHAPAAGSGRWWGFAVALAAGLLLLCA
FT                   LTWLVSVQRGLASLQQGTATRADRYAATLESTLDRYEFLPALVSLHPFVRGLLAAPDDA
FT                   QRVAAANQYLAEVNRRAHASATYVIAANGIALAASNHGQPGSFVGTDYRFRPYFQTAAS
FT                   GKMGRFYAIGITSDEPGYYIAQPIESGGRVIGVTVVKLNLEWFQRAGSGAEPLMVSDDH
FT                   GVIFLSSVPAWQYRTLRPLPPALRAEMEQTRQYHGRAVTPLPLEPLASPVTRWLADTTL
FT                   PRGARLVRVRDEAAAGRTTFAPDGAERADRYLELNRTVGPAGWTMQVMAPLDPVLANAR
FT                   NATVAAALAYACICLLLVNWRQRRQRARDMQYSRRLLEAAYDQLERRVEARTADLMAIN
FT                   EKLEDEVAERTRAESELRAAQDELVQASKLAALGQMAAGITHELNQPLAALRTFSDNTR
FT                   VLLARGQLDAAEGNLSAIAGLTERMGKITGQLKLFAGKARPVRRPVALRAAVDHVLALL
FT                   APRLGAVTVSVAGLDDAPALAVRADELKLEQVLLNLLGNALDAIAAAAPAQGRIDVDVQ
FT                   AGEQAVTIVVRDNGTGIAPEALPRLFEPFFTTKETGQGLGLGLAISSSIVREFGGQLSV
FT                   ANVPGGGAQFTLVLARAPAIDTAPSVSASP"
FT   gene            complement(242822..244123)
FT                   /gene="dctA1"
FT                   /locus_tag="RALTA_A0240"
FT   CDS_pept        complement(242822..244123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctA1"
FT                   /locus_tag="RALTA_A0240"
FT                   /product="citrate and C4-dicarboxylic acids transport
FT                   protein (DAACS family)"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /function="4.2.A.23 : The Dicarboxylate/Amino Acid:Cation
FT                   (Na+ or H+) Symporter (DAACS) Family"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10482502; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62911"
FT                   /db_xref="GOA:B2AGL2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62911.1"
FT                   /translation="MRKPFYKILYVQVLFAICIGILLGHFWPDTGVAMKPLGDGFIKLI
FT                   KMIIGPIIFCTVVTGIAGMSDMKKVGRVGGKALLYFEVVSTFALLIGLGAAHLLKPGVG
FT                   FNIDPATLDTKAIAQYVSKAHGQSTVEFLMHIIPDTVFSAFANGDILQILLVSLFFGAA
FT                   LAVLGERARIVVQLIEQVSKVFFHIVHVITKVAPIGAFGAMAFTIGKYGLGSLVPLLKL
FT                   IGTFYFTAIVFVLVVLGTIARMTGFSIVRFIAYIKEELLIVLGTSSSEAALPHMMEKLE
FT                   KLGCSKSVVGLVVPTGYSFNLDGTNIYMTMAVIFIAQATGIELTLMQQLTILAVAMITS
FT                   KGASGVTGSGFITLAATLAVVPTIPVAGMVLILGIDRFMSECRALTNIIGNGVATVVVS
FT                   AWERELDRKRLARVLQHGAGDDADTLGEAGQRAA"
FT   gene            244514..244834
FT                   /locus_tag="RALTA_A0242"
FT   CDS_pept        244514..244834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0242"
FT                   /product="conserved hypothetical protein; putative
FT                   FERREDOXIN 2FE-2S"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62912"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62912.1"
FT                   /translation="MRSYYQHHVFFCLNQREAGENCCANYNAKAMQEYAKKRCKELGIA
FT                   GGEGRVRINKAGCLNRCELGPVLVVYPEAIWYTYVDEHDIDEIIDSHLLKGKPVERLMV
FT                   DR"
FT   gene            245002..245643
FT                   /locus_tag="RALTA_A0243"
FT   CDS_pept        245002..245643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0243"
FT                   /product="putative hydrolase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62913"
FT                   /db_xref="GOA:B2AGL4"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62913.1"
FT                   /translation="MNAHTQVLSIAGPVGAIDVSVDLPQGEPRGLALVAHPHPLFGGTK
FT                   DNKVAQTLARAFVQLGYATVRPNFRGVGATAGEHDNGIGEQDDLLAVAAWMRQQTAWSA
FT                   QAATLPLALGGFSFGSFVSTHVARRLAEAGTPVQRLVLVGTAASRWEVAQVPADTIVIH
FT                   GEQDDTVPLASVFDWARPQELPVIVIPGADHFFHRKLHLIKQLVVNAWDR"
FT   gene            245706..246905
FT                   /gene="dacC"
FT                   /locus_tag="RALTA_A0244"
FT   CDS_pept        245706..246905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacC"
FT                   /locus_tag="RALTA_A0244"
FT                   /product="D-alanyl-D-alanine carboxypeptidase;
FT                   penicillin-binding protein 6a"
FT                   /function="5.1 : Cell division"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /function="7.2 : Periplasmic space"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /EC_number="3.4.16.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62914"
FT                   /db_xref="GOA:B2AGL5"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62914.1"
FT                   /translation="MLNRATTRLSSAFAPAAIAAAVVLAAAPAAVLAQGVPMPQVAAKS
FT                   WMLYDVTSGQALASQNADARIEPASLTKLMTAYLAFEALKEKRLTLDQAVVPTNLVLKV
FT                   KSDESRMFIEPNKPVTVQDLLLGLIVQSGNDAALALAEAVGGSEEGFVAMMNREAQRMG
FT                   MKNTHFTNTDGIPDPNHYTTAVDLATLTTRLIKDFPEYYSMYSQKEFTYNKIRQPNRNR
FT                   LLYIDSTVDGVKTGHTKSAGYCLISSAKRPLANVPDGSRRLISIVIGTTTEQVRTQESL
FT                   KILNYGFQFFDTLRLYDKGQVLATPDIYKGKSGTVKIGVQNETFVTVPKGTGGRLKPVL
FT                   ERQELLIAPISAGQQVGMVKLMDGTNKVAEFPVVALEEVPEAGFFGRLWDTIRLWFKRK
FT                   "
FT   gene            246966..247274
FT                   /locus_tag="RALTA_A0245"
FT   CDS_pept        246966..247274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0245"
FT                   /product="conserved hypothetical protein, DUF493"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62915"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62915.1"
FT                   /translation="MTTDNQGSGNKPGDIPPEQSLIEYPSHFPIKVMGAMQDGFAEAIV
FT                   ALVQEFDPDFHAGKMEMRPSSKGNYLGLTVTVWVTSREQLDDLYRALTSHPMVKVVL"
FT   gene            247444..248682
FT                   /locus_tag="RALTA_A0246"
FT   CDS_pept        247444..248682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0246"
FT                   /product="putative S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62916"
FT                   /db_xref="GOA:B2AGL7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62916.1"
FT                   /translation="MATCPLRHANSHTNMNTITLKPGKEKSLLRRHPWIYATGIATTEG
FT                   RCEPGATVIVRAADGRFLAKAAYSPESQIRARVWTFDENEPVDHALFKRRVAAAIAYRR
FT                   QWVRDSDAVRLIFGESDRLPGLIVDYYGNGASGQLVCQFNSAGVEHWKTAIVQALIKET
FT                   GCPNVYERSDAAVRQREGLELVTGVLAGAEPDPALSVTEHGVRYYVDVRNGHKTGFYVD
FT                   QRDNRKLVGDLAEGREVLNCFCYTGGFSLAALRGGAKAVTSIDSSGEALKIAAGNVTLN
FT                   GFDPGRAAWLDADVFKTLREFRAEGRQFDLIVLDPPKFAPSAQHIDRAARAYKEINLVG
FT                   TQLLRPGGLLFTYSCSGAISMELFQKIVAGAVTDARADARILRRLSAGTDHPMLAAFPE
FT                   GEYLKGLLLEKVA"
FT   gene            complement(248698..250806)
FT                   /locus_tag="RALTA_A0247"
FT   CDS_pept        complement(248698..250806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0247"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /function="2.1 : DNA related"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62917"
FT                   /db_xref="GOA:B2AGL8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62917.1"
FT                   /translation="MTLDLASPAESAEAATPDADAVPAYLSRLNPEQRAAVEHGSEAPL
FT                   LIIAGAGSGKTNTLAHRVAHLVLGGADPRRILLLTFSRRAAAEMGRRVERIVDQALGTS
FT                   TGAGRAALQWSGTFHAIGARLLREYAETLGLSPAFTISDRGDSADLMHVVRHDLGLSET
FT                   ASRFPKKETCLSIYSRVVNTQAPLEDVLRQQFPRYAMWADALRTLFAGYVEAKQKQHVL
FT                   DYDDLLLYWAQAMAEPAIAQDMGARFDHILVDEYQDTNALQASILLALRPDGRGLTVVG
FT                   DDAQSIYAFRGATVRNILDFPAQFTPAAQQVTLSQNYRSTQPILQAANAVIGLAAERYT
FT                   KDLWSERQSAEKPGVIVVNDEADQARFVVEQVLARREAGLALMAQAVLFRAADHSAQLE
FT                   IELARRNIPFVKFGGLKFLESTHVKDVLAVVRWLENPRDRMAGFRTLQLLPGIGPKTAA
FT                   RVLDAMALATEPLFSLQEFEPPPAAAPAWADLLTLARALMAPTSPWPSEFEQVLAWYTP
FT                   HLERLHDDAPARQADLQQLERIAATYGARERFLTELTLDPPSASSDESGVPSRDEDYLI
FT                   LSTIHSAKGQEWKAVYVLNAVDGCMPSDLATGTTEEIEEERRLLYVAMTRAKDHLDVIV
FT                   PQRFYVHQQVGFGDRHVYASRTRFLPNKVMPNFYSRSWPPPPMPGEGAVKPALAPVDLA
FT                   GRMRNMWR"
FT   gene            complement(250960..251493)
FT                   /locus_tag="RALTA_A0248"
FT   CDS_pept        complement(250960..251493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0248"
FT                   /product="conserved hypothetical protein; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62918"
FT                   /db_xref="GOA:B2AGL9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62918.1"
FT                   /translation="MTTSPASKTSRKPWPIVAAVVVLALLGWFGYRALSPSGTAPAATF
FT                   TLLSGEKVSTADLKGKVYLVNFWATSCATCIKEMPDMVKTYEQFKGKGLEFVAVAMNYD
FT                   PPMYVMNFAKTRGLPFKVAMDSDGSAAKAFGNVGLTPTTFVIDKEGRILKRYVGEPEWD
FT                   ALHKLLDGALAKSA"
FT   gene            complement(251628..252059)
FT                   /locus_tag="RALTA_A0249"
FT   CDS_pept        complement(251628..252059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62919"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62919.1"
FT                   /translation="MAGVAGVCAASPAHLPPATDLAAHGADAARRGEPLVVLVSMPGCS
FT                   YCDAVRRNYLGPQAAAGEIAVREVDMTADTPLRDADGSLTTARAWAGARQVRVAPTVLF
FT                   LDRQGRAAAGPLRGMQPDFYGAYLEQALAQARAAVAARK"
FT   gene            252436..253038
FT                   /locus_tag="RALTA_A0250"
FT   CDS_pept        252436..253038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0250"
FT                   /product="putative lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62920"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62920.1"
FT                   /translation="MRPVPLPLSLPAAPRWSLTCCAALLALALCACSPRYDWRTIQSGE
FT                   GGYAALYPGKPTSAARDVTIAGRKLPMTMEAARVDDTLFAVGVVTLPADDEALRREALA
FT                   AMQAGLLANLGTLSAEPRSRPVTIMSADRPGRPLAGLELQASGVSPQDQSPRRLSARLV
FT                   AVGTRAFQAVVLESGEAARDARQAEQVEQFLGGFHPL"
FT   gene            253121..253762
FT                   /locus_tag="RALTA_A0251"
FT   CDS_pept        253121..253762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0251"
FT                   /product="putative neutral amino-acid efflux system, rhtB
FT                   family (lysine, threonine, homoserine)"
FT                   /function="4.2.A.76 : The Resistance to
FT                   Homoserine/Threonine (RhtB) Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62921"
FT                   /db_xref="GOA:B2AGM2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62921.1"
FT                   /translation="MRWEVWLAYFAACWVIAVSPGSGAVLSMSHGLSYGLRRTTTTIFG
FT                   LQAGLVIVLLVAGGGLGALLLASEQAFMVVKTIGALYLIYLGIQQWRARVEPDAAQDGK
FT                   PARVAVMSRRRRFATGLLTNVTNPKGIIFMVAVLPQFIDPNRPLALQLAILAATMCAVD
FT                   LVVMHGYALLASRMQGLFRNARAVLWQNRFFGSVLMAVGAALFFVRRQHA"
FT   gene            253852..254031
FT                   /locus_tag="RALTA_A0252"
FT   CDS_pept        253852..254031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0252"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62922"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62922.1"
FT                   /translation="MNPIAGARLQPRHTVPPVEEPAPPGVPPDLPLSPEDDPPPPPVEP
FT                   PVAGHVAGRYCFSS"
FT   gene            complement(254013..254735)
FT                   /locus_tag="RALTA_A0253"
FT   CDS_pept        complement(254013..254735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0253"
FT                   /product="putative transcriptional regulator, GntR family,
FT                   small molecule-binding UbiC domain"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12757941; Product type pr : putative
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62923"
FT                   /db_xref="GOA:B2AGM4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62923.1"
FT                   /translation="MDQRLKALKPDEADATPIYLQVARKLTAAIQAGQWRVGDALPSER
FT                   TLVDSLGISRVTARHALQVLAEEGTITRNRGAGTFIAPRAEPRPARLDNFSELARRRGM
FT                   TPASELVAFERRRATAQESAELALPDGDEIVRLTRLRKADGQIYWMDVTTLALAVLPDA
FT                   SAIGESLYAYLERIGKPVLRVTETLRAVVASAEVAARLGIEPGEPLLHIRRIGYTHGDK
FT                   PVELTDAYCLNDFYELKQ"
FT   gene            254803..255159
FT                   /locus_tag="RALTA_A0254"
FT   CDS_pept        254803..255159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0254"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62924"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62924.1"
FT                   /translation="MEIARRDDARAMDYASVMEKFHQGCTAGCYLSQTCIRDIKPREIL
FT                   GIWSVRDATSVAPWIHGIPAPPDPVGLKWPCCGHEPVLPVITTLSHCGSHRGEGKEPGT
FT                   AADASRRVSLYLAQ"
FT   gene            255413..256900
FT                   /gene="zwf1"
FT                   /locus_tag="RALTA_A0255"
FT   CDS_pept        255413..256900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf1"
FT                   /locus_tag="RALTA_A0255"
FT                   /product="glucose-6-phosphate dehydrogenase"
FT                   /function="1.3.2 : Pentose phosphate shunt, oxidative
FT                   branch"
FT                   /function="7.1 : Cytoplasm"
FT                   /function="1.3.9 : Entner-Doudoroff pathway"
FT                   /function="1.5.3.10 : Glutathione"
FT                   /EC_number="1.1.1.49"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10400573; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62925"
FT                   /db_xref="GOA:B2AGM6"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62925.1"
FT                   /translation="MPTSRTVSAFGTADARPLDLVIFGGAGDLSARKLLPSLYMCHRDG
FT                   NLPEGTRIIGVGRHRWDREAFVNFADESAQPFVDARYIEPAKWQGFLQRLDFVHLDAAQ
FT                   AADYPALAAQLRSDALRIYYMAMPPGLFAATCDNLASHGLIADDTRLVLEKPLGVDLAS
FT                   AIGIGEVVSRYFSEDRTYRIDHYLGKETVQNLMALRFGNSIFEPLWRTPFVRSVQITVA
FT                   ETVGVGTRGGFYDEAGAMRDMVQNHLLQLVSILAMEPPASLNSDAVRDEKLKVLRSLRP
FT                   MSPEDVRRNTVRGQYTAGAIAGELVRGYLQEDGIPPDSRTETFVAMRAELGTWRWNKVP
FT                   FYLRTGKRMQERVTEVVIHFAEVPHSIFDPGSTLQPNRMVIRLQPEESVRLTLMVKQPG
FT                   EGMKLKPLSLALNLDSAFTTRRAEAYERLLLDVIRGRLALFVRRDELQAAWTWVDPILE
FT                   AWRAQDEGPRPYTAGTWGPAASSAFMAREGVQWSEEA"
FT   gene            complement(256914..258455)
FT                   /locus_tag="RALTA_A0256"
FT   CDS_pept        complement(256914..258455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0256"
FT                   /product="putative ATPase, Mg chelatase-related protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62926"
FT                   /db_xref="GOA:B2AGM7"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62926.1"
FT                   /translation="MSLAVLRSRALTGIAAPPVRVETHLANGLPAFTIVGLADTGVRES
FT                   RERVRAAILNSGYEFPNRRITVNLAPADLPKESGRFDLAIALGILAASGQIPADALDTH
FT                   EFAAELSLSGELRPVRGALAMAMGLARDNAARASSGEAPRAFLVAAGNGAEAALIEDLA
FT                   VHAATTLRQACDHLGPLDDARLPRAMPPLLPPAAGRGADMRDVRGQAQARRAMEVAAAG
FT                   QHSVLLVGPPGTGKSMLAQRLPGLLPPMSLQQALEAAAVMSLTPGGFRPEAWGLRPCRA
FT                   PHHTASGPAMVGGGGNPRPGEISLAHHGVLFLDELPEFDRRVLEVLREPLESGRITIAR
FT                   ANGHADFPACFQFVAAMNPCPCGYLGHPDRPCRCTPDQVRRYQSRISGPMLDRIDLQIE
FT                   VPAQDQGEMLDGPPGEASAVVRARVLAARERQLARQGKPNNELGGREIEQHCAMDAQAQ
FT                   ALLRGAMTRLAWSARSYFRVLKVARTIADLAGADVLNAAHVGEAIQYRRALRMAG"
FT   gene            complement(258544..258822)
FT                   /locus_tag="RALTA_A0257"
FT   CDS_pept        complement(258544..258822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0257"
FT                   /product="conserved hypothetical protein, DUF526"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62927"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62927.1"
FT                   /translation="MKPTDLFNDLQNKVSEALRNSPARDIEKNVRSMMTQGFARLDLVT
FT                   REEFDVQSQVLARTRARLEELESRVAELERRAGIPPGAGSVDSTGGA"
FT   gene            259211..259993
FT                   /locus_tag="RALTA_A0258"
FT   CDS_pept        259211..259993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0258"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62928"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62928.1"
FT                   /translation="MKKLALAVSALVLASAAGGALAQSTDAAAPAAEPASPHTFTANVS
FT                   LVTDYRYRGISQTNLRPAIQGGFDYAHESGFYLGNWNSSVSWLEDANPAVSAPVEMDFY
FT                   GGFKNTFKVAGTEFAYDLGVLEYYYPGGYNNPRPYTTELYAGIGWGPVMLKYSHSVTNL
FT                   FGWADSKNSYYVDLSANVPLNFWDLTLNAHVGYQGVKHNSDASYTDWKIGLTKDLGKGF
FT                   ALAVAYVDTNAKEVAYTSANRGRYLGKAAAWASITKTF"
FT   gene            260046..260384
FT                   /gene="glnB/K"
FT                   /locus_tag="RALTA_A0259"
FT   CDS_pept        260046..260384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB/K"
FT                   /locus_tag="RALTA_A0259"
FT                   /product="regulatory protein (P-II) for nitrogen
FT                   assimilation by glutamine synthetase (ATase); signal
FT                   transduction protein, associated to amtB, ammonium
FT                   transporter"
FT                   /function="1.5.1.2 : Glutamine"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.3.3 : Inhibition / activation of enzymes"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14668330; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62929"
FT                   /db_xref="GOA:B2AGN0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62929.1"
FT                   /translation="MKLIIAVIKPFKLDEVREALSDVGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYIVDFLPKVKIEVAVPDDVVERAIEAVEKSARTGKIGDGKIFVAPIEQVIRIRT
FT                   GETGGDAL"
FT   gene            260456..261964
FT                   /gene="amtB"
FT                   /locus_tag="RALTA_A0260"
FT   CDS_pept        260456..261964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="RALTA_A0260"
FT                   /product="ammonium transport protein (Amt family)"
FT                   /function="4.2.A.49 : The Ammonium Transporter (Amt)
FT                   Family"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10637624, 15563598, 15361618; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62930"
FT                   /db_xref="GOA:B2AGN1"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62930.1"
FT                   /translation="MALAVGTAGVGVSTPAAAQDKPAAEASAAATSAPAAAPAAAATAA
FT                   APAAAAAAAAPAEAAAAPAAPVPNKGDTAWLLVSTAFVILMTLPGLALFYGGLVRSKNM
FT                   LSVLMQCLVIFSLVALLWAIYGYSFAFTEGNAFFGGTDRLFMKGLTVDAVAATFSKGVV
FT                   LPELGYFAFQCAFACITCGLIIGAFAERARFSAVLVFVVLWFTFAYLPIAHMVWFWPGP
FT                   DAYTDAAAGTAATAKAGWLFQKGALDFAGGTVVHINAAVAGLVGAFMFGKRIGFGREAI
FT                   RPHSLTFTMVGASLLWFGWFGFNAGSALEANGSAALAFVNTLLATCAAVLSWTFGEWIG
FT                   KGKPSMLGGASGAVAGLVAITPAAGFVGPMGSIVMGLVAGLLCLWGVTGLKRMLGMDDS
FT                   LDVFGVHGVGGIVGALLTGVFAAPSLGGTGIYDYVANKVAEDYSIAGQLWIQFEGVLTT
FT                   VVWSGVVAFVAYKLVDMLIGLRVPEDEEREGLDITSHGETAYEG"
FT   gene            262523..263818
FT                   /locus_tag="RALTA_A0261"
FT   CDS_pept        262523..263818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62931"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62931.1"
FT                   /translation="MVPHLITALNGPLLELEKKILDATPSIERWFRLEWQEHTPPFYCS
FT                   VDLRNAGFKLAPVDTNLFPGGFNNLAPEMLPLAVQAAMAAIEKICPDAKNLLLIPERHT
FT                   RNMFYLQNVARLSLIMRQAGLNVRLGSLSEEITEPTPIELPDGQTLVVEPLARLGTRGR
FT                   RLGLKDFDPCSILLNNDLSAGIPPILENINEQYLLPPLHAGWSTRRKSSHFAAYDEVAK
FT                   KFAKLIDIDPWMVNPYFARTTGVNFHERVGEEELADAVEGVLKKIAKKYREYGIKETPY
FT                   VVVKADAGTYGMGIMTVRDPSEIKGLNRKERNKMSVVKEGLEVSDVIIQEGVHTFEKVN
FT                   EAVAEPVVYMIDRYVVGGFYRVHTGRGNDENLNAPGMHFVPLAFAPNGIPDSHAKPGAA
FT                   VPNRFYMYGVVARLALLAASLELEKTDPNPII"
FT   gene            263827..264792
FT                   /gene="gshB"
FT                   /locus_tag="RALTA_A0262"
FT   CDS_pept        263827..264792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="RALTA_A0262"
FT                   /product="glutathione synthetase"
FT                   /function="1.5.3.10 : Glutathione"
FT                   /EC_number="6.3.2.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9010922; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62932"
FT                   /db_xref="GOA:B2AGN3"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62932.1"
FT                   /translation="MRILFITDPLETFKTYKDSTFAMMAEAAARGHELYWCLQPQLALS
FT                   GRTVETVATRLHLTGDDGGEHGAWYREGNSALEPLSAFDAVLMRKDPPFDMEYVTSTWL
FT                   LELAEAQGARVFNKPQAIRDHSEKLAIAQYPEFITPTLVTRDLARIRDFHAEHRDIIVK
FT                   PLDGMGGMGVFRVGADGMNLAAIVETLGQDGARSLMVQRYIPAIKDGDKRVLLIGGVPV
FT                   PYSLARVPMAGEVRGNLAAGGTGRAQELSRRDREIAEALAPGLWEQGLLLVGLDVIGDY
FT                   LTEVNVTSPTCFQEITQQTGFHVAAMFIDALEHAVGAAGS"
FT   gene            264871..265326
FT                   /locus_tag="RALTA_A0263"
FT   CDS_pept        264871..265326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0263"
FT                   /product="PTS system fructose IIA component
FT                   (phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system)"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /function="4.4.A.6 : The PTS Mannose-Fructose-Sorbose (Man)
FT                   Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2117666; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62933"
FT                   /db_xref="GOA:B2AGN4"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62933.1"
FT                   /translation="MAGILIIAHTPLASALRDCAAHVYCGQPQRLEAIDVLPDADPAAV
FT                   LAEARRRLEAICEDNGALVLTDIFGATPANIAARLAEPGRVRVLAGVNLPMLVRAICYR
FT                   AEKLDQLATKALAGGSQGVLQVGTTTVQNQTANHPDKYAAEGHHHHQ"
FT   gene            265295..265564
FT                   /gene="ptsH"
FT                   /locus_tag="RALTA_A0264"
FT   CDS_pept        265295..265564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="RALTA_A0264"
FT                   /product="PTS family Hpr protein,
FT                   phosphohistidinoprotein-hexose phosphotransferase"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /function="4.8.A.8 : The Phosphotransferase System HPr
FT                   (HPr) Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62934"
FT                   /db_xref="GOA:B2AGN5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62934.1"
FT                   /translation="MLQRDTTIINKLGLHARASAKLTQLAGSFVSQVKMSRNGRQVDAK
FT                   SIMGVMMLAAGIGSTVTIETEGPDEQEAMDALLALIANRFGEGE"
FT   gene            265614..267386
FT                   /gene="ptsI"
FT                   /locus_tag="RALTA_A0265"
FT   CDS_pept        265614..267386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="RALTA_A0265"
FT                   /product="PTS family enzyme I and Hpr components,
FT                   PEP-protein phosphotransferase"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /function="4.8.A.7 : The Phosphotransferase System Enzyme I
FT                   (EI) Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62935"
FT                   /db_xref="GOA:B2AGN6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62935.1"
FT                   /translation="MPFALHGIPVSRGVAIGRAHLLAPAALDVSHYLVDEERLDAEVER
FT                   LRAARAAVRAELAALKRDLPRDAPEEMGAFLDVHAMILDDEALAREPEALIRGRRYNAE
FT                   WALTTRLEELMRQFEEIEDEYLRERKADIQQVVERILKALAGAPVLVPAPVPALAADGE
FT                   PAPGVIVVAHDIAPADMLQFRHTVFHGFVTDLGGRTSHTAIVARSLDIPAAVGVQSASE
FT                   LIRQDDWIIIDGDAGLVIVDPTAIILEEYRHRQSERVLEKKRLQRLRHTPAVTLDGIEI
FT                   ELLANIEMAEDAGAALAAGAVGVGLFRSEFLFMNRRDELPGEEEQFQAYRGAVDAMHGL
FT                   PVTIRTIDIGADKPLDARGDGRADDFETALNPALGLRAIRWSLSEPGMFLTQLRALLRA
FT                   SAFGPVRLLVPMLAHASEIDQTLALIAKAKRQLDERGEPYDPGMKVGAMIEIPAAVLLL
FT                   PLFLRKMDFLSIGTNDLIQYTLAIDRADNAVAHLFDPLHPAVLQLVARTIREANRAGVP
FT                   VAVCGEMAGDPSMTRLLLGMGLREFSMHPAQLLRVKQEILHADCQRLEPLVDQLLQAYD
FT                   PEEQAAVLRQMARP"
FT   gene            267567..267905
FT                   /gene="bfd"
FT                   /locus_tag="RALTA_A0266"
FT   CDS_pept        267567..267905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfd"
FT                   /locus_tag="RALTA_A0266"
FT                   /product="BACTERIOFERRITIN-ASSOCIATED FERREDOXIN PROTEIN"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /function="1.4 : Energy production/transport"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62936"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62936.1"
FT                   /translation="MPVSRAPTEGLVYVCICNQITDREIHGAAHLGVETLDELAETLGV
FT                   GTCCGRCRECAQQVLQEGVAAVRNVTVATLASIQIVEISSCSASGPCTIMDTRDPAVAN
FT                   DQRKALVA"
FT   gene            268028..268507
FT                   /gene="bfr1"
FT                   /locus_tag="RALTA_A0267"
FT   CDS_pept        268028..268507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr1"
FT                   /locus_tag="RALTA_A0267"
FT                   /product="bacterioferritin, an iron storage homoprotein"
FT                   /function="5.5.7 : Fe aquisition"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62937"
FT                   /db_xref="GOA:B2AGN8"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62937.1"
FT                   /translation="MKGDKKVIQHLNAQLKNELTAINQYFLHARMYRHWGLKKLGDVEY
FT                   KESIGEMKHADRLIDRILMLDGLPNLQDLHKLLLGEDTPEMLKCDLKLEQTAHTTVKEG
FT                   IAYCESVGDYVSREILVDILTDTEEHIEYLETQLDLIDKVGLQNYLQSQMEPGEQ"
FT   gene            268692..269735
FT                   /gene="selD"
FT                   /locus_tag="RALTA_A0268"
FT   CDS_pept        268692..269735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /locus_tag="RALTA_A0268"
FT                   /product="selenophosphate synthase"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.7.9.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1650339; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62938"
FT                   /db_xref="GOA:B2AGN9"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62938.1"
FT                   /translation="MTSPIRLTQYSHGAGCGCKISPKVLDVILAGSGAQHLDPRLWVGN
FT                   ASRDDAAVYALDGAEGQRGVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGDPLMA
FT                   IAILGWPVNVLPPEVAREVVAGGRRACDDAGIPLAGGHSIDAPEPIFGLAVTGLVERAH
FT                   MKRNDTATPGCRLYLTKPLGIGVLTTAEKKGLLRDDNRHLARDWMCVLNKPGSAFGRLP
FT                   GVRAMTDVTGFGLLGHLVEMADGSGLTARLDYAAVPVLDDVADYIGQGCVPGGTQRNFD
FT                   SYGHRIAPLTEAQRALLCDPQTSGGLLVAVEPAGEAGFLAECQRLGLALAPIGEMVARA
FT                   ALAVEIR"
FT   gene            269735..270841
FT                   /gene="selU"
FT                   /locus_tag="RALTA_A0269"
FT   CDS_pept        269735..270841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selU"
FT                   /locus_tag="RALTA_A0269"
FT                   /product="Selenophosphate-dependent tRNA 2-selenouridine
FT                   synthase"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /EC_number="2.9.1.-"
FT                   /EC_number="2.9.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14594807; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62939"
FT                   /db_xref="GOA:B2AGP0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62939.1"
FT                   /translation="MRPDTSDFRELFLSGVAMLDVRAPLEFARGAFPGAVNLPLMDDAE
FT                   RHEVGLCYAQKGQQAAIELGHELVSGQRKAARIAAWAEFARAHPDGYLYCFRGGLRSQL
FT                   VQQWLRDAGVDYPRVSGGYKAMRGFLIETIDTAAATQPWFVVGGLTGSGKTDVLADVPA
FT                   SIDLEGHARHRGSAFGRRALPQPPQIDFENALAIDVLHHLDAGWRALVVEDEGRFIGSR
FT                   DVPQALSQRMQASPLVWLEAPFNARVERVLRDYVQGLAAEFIDTKGSAEGFAAYATRLR
FT                   EAMAAIAPRLGGARYGKLAALLDQALARQAESGEVALHRGWIEVLLRDYYDPMYDYQRA
FT                   QREARIVFRGDRDAVTDWLLAHTARQGE"
FT   gene            complement(270849..271871)
FT                   /locus_tag="RALTA_A0270"
FT   CDS_pept        complement(270849..271871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0270"
FT                   /product="conserved hypothetical protein; similar to
FT                   p1RATA1884, 1881 and 1879"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62940"
FT                   /db_xref="InterPro:IPR040761"
FT                   /db_xref="InterPro:IPR041290"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62940.1"
FT                   /translation="MVRSRTRSCSLAAAVFTLALSASIAGAQTTATHLIVSTEGWSTHC
FT                   FGRYLIDLPPQANARASYKLWGADIERLTVPNAASLQGKVEQRTIALQSMAHDTAGSML
FT                   VRRIDHGNGSTSLLSWSSPRRTILMYEEAYLATTSPWQAFKYSGDISASRQAMAVAFLN
FT                   TLAANIRSRADNEIPTGPGFCIDKGFIAGNDYRSESVQVGITLPQHPNAFISFDASTGA
FT                   EEDRLLERVDNFLSKAVLGPLAGLKVLRKRERNVGTIPAEEYATAATGNGQRVYVFAWE
FT                   SQGKNKSLSEQNVTAGLHVLEQPVDSPQTPYQPAFQSDDEALQLWDAIIDSIRLRPGAV
FT                   "
FT   gene            complement(271904..272920)
FT                   /locus_tag="RALTA_A0271"
FT   CDS_pept        complement(271904..272920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0271"
FT                   /product="conserved hypothetical protein; similar to
FT                   p1RATA1884, 1881 and 1879"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62941"
FT                   /db_xref="InterPro:IPR040761"
FT                   /db_xref="InterPro:IPR041290"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62941.1"
FT                   /translation="MKTSRSFVTVIAVFLTLAFASISYGQSMTRSPSMDKLGWKTYCFG
FT                   RYLVELPPQAKVSATYKIWGDEIAPMPGQTPGTLRSMIDQREKDLKAAHHETQGSMFVG
FT                   RTMVGTESEVLLSWSLPYSKAMLRDDTYLVAASPWRVFHYGGGVSPGREAIALRLAKTL
FT                   ANNIRSRSETEIPTGPGFCIDQGFIAGNDYRSESVQVGITLPQHPNAFISFDASTGAEE
FT                   DRLLERVDNFLTKAILGPLAGLKVLRKRERNVGAIPAEEYATAATGNGQRVYVFAWESQ
FT                   GKNKSLSEQNVSAGLRVLEQPVDSPQTPYQPAFQSDDEALQLWDAIIDSIRLRPGAA"
FT   gene            complement(272917..274578)
FT                   /locus_tag="RALTA_A0272"
FT   CDS_pept        complement(272917..274578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0272"
FT                   /product="conserved hypothetical protein; putative
FT                   hydrolase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62942"
FT                   /db_xref="GOA:B2AGP3"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62942.1"
FT                   /translation="MQNERNSSDPEVVISRTRDIDGRPVFDTHLTPTEDTRTKVIETKL
FT                   PAVIPIVFLPGIMGTNLKNKKTGNAVWRPPNMSLNLADILGVVAALATWGIRGPKQRQQ
FT                   ILKAEDLTVDDGGSIDVGESGLAKETARKRGWGSVLRTSYNPVMGLLEARTSRIVANRT
FT                   LQGWWSTEGLRPPGDYGEETGQPPLTEPELMKAARYDFDVWCAGYNWLQSNRKSAEDVR
FT                   QYIENTVLRHYREQKPPVPADKVILVTHSMGGLVARALTNLVGYEKVLGVVHGVLPATG
FT                   APAIYHHMRAGYEGPEQLILGSNAGEVTAVVANSAGALELCPTFDHRDGQAWLFLQNEP
FT                   GEVVMDTEGLPCAFPRAGNPYDEIYKNPAWYGLVPEPNTKFLNLSEDLSNYEYAKAASR
FT                   STFEELIDQVARFHRDLAGQYHPETYVHYGADGSRPMHSWQDIVWRGNPNAFPTSAFPA
FT                   SDDGNGSYRASNNAPALTAARGQGDGTVPAFSGEAPRDAGVVASFRHGSDGAGSENADR
FT                   KGYDHQGSYNDPRARWATLYGIAKISQLADWHSSEK"
FT   gene            complement(274586..277639)
FT                   /locus_tag="RALTA_A0273"
FT   CDS_pept        complement(274586..277639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0273"
FT                   /product="conserved hypothetical protein; VGR-RELATED
FT                   PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 11136451, 9696756"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62943"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62943.1"
FT                   /translation="MDAATLYQHLFSAAHRLYALEGDGAIRELAVEAWIGREGVSMLAE
FT                   SRIIALSANAGIPLDSLLGQRVTLVTALAGGGQSRRTGLIRQAEKLGADGSLARYRLTV
FT                   VPWLWLTTQQRHSQVFQKRGLDNIIESVLQDYAPYAHWRYAAGAETRIAAFGERDHIAQ
FT                   FRETDYQFLSRLLAEAGLGYTVVEDEEAPSGHAVVFFADSAQLPEDPESAAGGGIRYHR
FT                   AHSQESADAIQQLICETRAAVGGVAVSAWDPEAKRAIRAHAPARYGVFSGRAVSPDPYF
FT                   SVSLSLAPDAASAQRVAGQVMDAIEVRALVFTGSGSVRTLRSGTRLTVTDCPHLPPQPD
FT                   DTAGYPLLLDAVEHCGINNLAVETRAALADRIGPLEAALCFDTPPPAPDTVAMTAGLMN
FT                   SFFDGAAERLVSADSLPTAAREHGYAALFRAFDARRPWRAAVLEGDCPRLYSRAIPLGA
FT                   HTAIVVGPEGQTQADGNAEHHASPRGQIRVRFPWQRGERADDRSSRWIRVAQRQAGAGM
FT                   GWQWLPRIGQEVLVKFTDNDIDQPFVIGALYNGQGEAGIVPTPGGRSMSGTTFSQPYDA
FT                   SGIYAMGSDSQPSAQGNLAGGNSPAWHGMGADPDGHRNDAALSGFKSQEHGGTGYNQLV
FT                   FDDSDDQLRTQLATTEQASQLNLGHLIHQQDNRRGSFRGQGFELRTDGYAAVRGQAGLL
FT                   LTTYRDAVTGHVLPTGDNAAGIALLRQAGDLVRTLSDGATTHQTQALSTGKDDDAPLAK
FT                   QAKAAAGMVDGHSLEAAKADAAGGNTSTPGKVPHQGEPMVHLSGRAGVAMVAGQDLQIA
FT                   SGESVVLASGQDNNVAVAGQARIHAGQAIGVAAGLSSAGDGNVGLQLTAGKGDIDLQAQ
FT                   HDLLKLAAREDLTIVSANMNVDFAAAKRIRIATAGGASITIEGGNITFECPGPITYKAA
FT                   QRKFEGPTHASREMNTWPQTPFDDAYLLRDEITGEPLRNVQVELRRNDGARIKLVTDSE
FT                   GRLPKQRGISMEHVQLRVLGKYTRDQKD"
FT   gene            complement(277941..278726)
FT                   /gene="moeB"
FT                   /locus_tag="RALTA_A0274"
FT   CDS_pept        complement(277941..278726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeB"
FT                   /locus_tag="RALTA_A0274"
FT                   /product="molybdopterin synthase sulfurylase"
FT                   /function="1.5.3.4 : Molybdenum (molybdopterin)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62944"
FT                   /db_xref="GOA:B2AGP5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62944.1"
FT                   /translation="MSDAIQDDTSDGLDDEQLLRYSRHILLDELGIEGQRRLLAGHAVV
FT                   IGAGGLGAAALPFLASAGVGRITVVDNDEVDLTNLQRQIIHTTANVGRPKVDSAREGML
FT                   RINPGLDIVTVPARVGDAELDQLVASASVVLDCCDNFATRQAVNRACVRHKVPLVSGAA
FT                   LRFDGQISVFDRRQPDAPCYACLFPPAEPAPEVACATMGVFAPLVGMVGTVQAAEALKL
FT                   LANVGDSLAGRLLMVNALSMEWTTMRLARTPDCPVCGGH"
FT   gene            complement(278813..280420)
FT                   /locus_tag="RALTA_A0275"
FT   CDS_pept        complement(278813..280420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0275"
FT                   /product="Carboxy-terminal-processing protease, Peptidase
FT                   S41 family; putative autocatalytic processed precursor"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.21.102"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62945"
FT                   /db_xref="GOA:B2AGP6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62945.1"
FT                   /translation="MRKTLKNISLVSVGLVAGVLATLQISATAQNSSGPLPLDQLRLMA
FT                   DIFGQIKREYVEPVDDKKLLTEAIKGMVASLDPHSSYLDEKDFKELQEGTRGRFAGLGI
FT                   EISQEEGLVKVINPIEDTPAFRAGIQPGDLITRIDDKPVRGLPLEQAVKRMRGEPGTKV
FT                   TLTIYRKSEERTFPVSITRAEIRVQSVKAKMLDNNIGWIRLTSFQERTISDLARKLTEL
FT                   SQKNPNMKGLVLDLRNNGGGVLQGAVGVAAAFLPEDATVVSTNGQVPDAKRVYKATYNN
FT                   YRLSSLEDDPLKDLPALFKKIPMVVLTNAYSASASEIVAGALQDHHRAQIMGKTTFGKG
FT                   SVQTVRPLTNDTGIKLTIAYYYTPSGKSIQAKGIRPDIPVDQNPEGDPDDALITREIDT
FT                   ERHLHNKQESEEPEMTEREQRRVEELRRLEEENAKKTPEEREKERRKKPVEFGSADDFM
FT                   LQQAIAQLNGQPVKRSKSRLETNPPADNGKAAKPSGKSGAKGASVPAAKPAAPAPGKQP
FT                   PASAPIGEPLGTPTGKAP"
FT   gene            complement(280600..281346)
FT                   /gene="gpmA"
FT                   /locus_tag="RALTA_A0276"
FT   CDS_pept        complement(280600..281346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="RALTA_A0276"
FT                   /product="phosphoglyceromutase 1"
FT                   /function="1.1.1.23 : Galactose degradation"
FT                   /function="1.3.1 : Glycolysis"
FT                   /function="1.7.8 : Gluconeogenesis"
FT                   /EC_number="5.4.2.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62946"
FT                   /db_xref="GOA:B2AGP7"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62946.1"
FT                   /translation="MYKLVLIRHGESTWNLENRFTGWVDVDLTETGAAQARQAGKLLKE
FT                   AGMGFDVAYTSVLKRAIRTLWHVQDEMDLMWIPVRNEWRLNERHYGALAGLNKSETAAK
FT                   FGDEQVLVWRRSYDTPPPALEPTDPRASYDDPRYANVPRNEIPLTECLKDTVARVMPLW
FT                   NESIAPDIQSGKRVVIAAHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDADLRP
FT                   LRHYYLGDQEAIAASLAAVASQGKAR"
FT   gene            281548..281961
FT                   /locus_tag="RALTA_A0277"
FT   CDS_pept        281548..281961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0277"
FT                   /product="putative rhodanese-related sulfurtransferase;
FT                   putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62947"
FT                   /db_xref="GOA:B2AGP8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62947.1"
FT                   /translation="MNFFADYNNLALIALAVVSGGLLAWPAISRSAGGKSVNTATATQL
FT                   INKRGAVVVDIREPAEYAKGHLPQAKSAPLADLASRAAGLAKDKAAPIIVVCQTGQRSG
FT                   KAQAALKEAGYSEIYALEGGIAAWQQAGLPLVK"
FT   gene            282040..282297
FT                   /gene="grxC"
FT                   /locus_tag="RALTA_A0278"
FT   CDS_pept        282040..282297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="RALTA_A0278"
FT                   /product="glutaredoxin"
FT                   /function="1.6.15.2 : Thioredoxin, glutaredoxin"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62948"
FT                   /db_xref="GOA:B2AGP9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62948.1"
FT                   /translation="MARVVMYSTVVCPYCVMAERLLKSRGVETIEKILIDREPGKREEM
FT                   MSRTGRRTVPQIYIDDTHVGGFDDLSALDRQGGLVPLLAA"
FT   gene            282494..283012
FT                   /gene="secB"
FT                   /locus_tag="RALTA_A0279"
FT   CDS_pept        282494..283012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="RALTA_A0279"
FT                   /product="molecular chaperone in protein export, enhances
FT                   activity of SecA (General Secretory Pathway)"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="7.1 : Cytoplasm"
FT                   /function="4.3.A.5 : The Type II (General) Secretory
FT                   Pathway (IISP) Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15128935; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62949"
FT                   /db_xref="GOA:B2AGQ0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62949.1"
FT                   /translation="MSDQQNTQQDDQPFFNIQRVYLKDMSLEQPNSPAIFLESEAPSVE
FT                   VQVNVGASQLQEGIFEVVVTGTVTTKVQDKVAFLVEAHQAGIFDIRNVPVEQLDPLLGI
FT                   ACPTILYPYLRGNIADVITRAGFQAIHLSEINFQALYEQRLQAAMEEAQGAEGGNSGIV
FT                   MPDGSQARH"
FT   gene            283127..284143
FT                   /gene="gpsA"
FT                   /locus_tag="RALTA_A0280"
FT   CDS_pept        283127..284143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="RALTA_A0280"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD+)"
FT                   /function="1.1.1.23 : Galactose degradation"
FT                   /function="1.7.6 : Glycerol metabolism"
FT                   /function="1.8.1 : Phosphorous metabolism"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.1.1.94"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62950"
FT                   /db_xref="GOA:B2AGQ1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62950.1"
FT                   /translation="MKLTFLGAGAWGTALASHAAATNDVVLWGRDPAQLGAIAATHENA
FT                   AYLPGVKLSARLAVQADFELAVAHAADDPDGIVVVATPVAGLREMTRRLAARSARPVSM
FT                   LWLCKGFEAGTHLLPHQMVRAELDAAGRTEGFAYGVLSGPSFAREVAQGLPCALTVAGT
FT                   EPSLADRAQAAFHHHAMRIYGSDDLTGVEVGGAVKNVLAIATGASDGLGLGLNARAALV
FT                   TRGLAEMTRLGLALGGRVETFMGLAGVGDLILTATGDLSRNRKVGQQLASGQSLEQVLA
FT                   GLGHVAEGVRCAQAVAELAATHGIEMPIARAVCAVLFDGLSAADAVAQLLQRDARDE"
FT   gene            284182..285159
FT                   /locus_tag="RALTA_A0281"
FT   CDS_pept        284182..285159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0281"
FT                   /product="conserved hypothetical protein, UPF0065"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12562821"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62951"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62951.1"
FT                   /translation="MSTRRQALIALAAACAAGASGSAFAQPWPARPIRMVVPFPPGSSP
FT                   DLIARLLTEKLAAALGQPVVVENRPGAGGNIGTGMVARAAPDGYTLLFTINGPLVTAPT
FT                   LSRNLNYDPFRQLAPVTLVATSPNVLVVDARLPAHNLREFVALARSRAGELNYGSPGNG
FT                   SASHLAMEQLKAMAGVDLQHVPYPGFPQVTTAMVGGQVQAAFMVPAIAMPQVNAGKLRV
FT                   LAVTTTGRTAVLPSVPTVAESGYPGFEAISWQAVLAPAGTPQAVIDRLYRELVAIIGSA
FT                   DVRDKMRAQYFVPAGTAPASLRQTMASEKTRWDKVIRAAGVQPE"
FT   gene            complement(285184..285654)
FT                   /locus_tag="RALTA_A0282"
FT   CDS_pept        complement(285184..285654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0282"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /function="2.2.3 : RNA modification"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62952"
FT                   /db_xref="GOA:B2AGQ3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62952.1"
FT                   /translation="MFNVVLVEPEIPPNTGNVIRLCANTGAQLHLVKPLGFPLDDARMR
FT                   RAGLDYHEYATMRVHDSWDALMASEQPDPTRMFALTTRGSTPFGQVAFRPGDWFVFGSE
FT                   TRGLSPERREWFPPAQRIRLPMRPDNRSLNLSNTVAVVVFEAWRQNGFAGGS"
FT   gene            complement(285740..286597)
FT                   /locus_tag="RALTA_A0283"
FT   CDS_pept        complement(285740..286597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0283"
FT                   /product="putative amidophosphoribosyltransferase,
FT                   comF/gntX family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62953"
FT                   /db_xref="GOA:B2AGQ4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62953.1"
FT                   /translation="MQGHGQTRQQENQEPARGQALPLAPDEPGRHARWAAAGRQVYARA
FT                   ARAAGAAGRALSRAREQLLPSACVLCGTVQRHVVCTPCAADLLRPVRRCTVCALALGRH
FT                   RHCPACAASPRAFDHAHTLGDYAAPQDQLVLALKFGHALPLAAWLAARLAEGLPGAWAV
FT                   ARHAAPDLIAPVPLSPQRLAARGFNQAWEIARPLARRLGLHTDPVLLQRQRDTGSQRAL
FT                   DLAARQVNLQGAFALTRAMRLDGLHVALVDDVMTSGATLHEAAAVLKARGASRVSVIVA
FT                   LRTP"
FT   gene            286586..287539
FT                   /locus_tag="RALTA_A0284"
FT   CDS_pept        286586..287539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0284"
FT                   /product="putative BIOTIN SYNTHESIS METHYLTRANSFERASE,
FT                   bioC"
FT                   /function="1.5.3.1 : Biotin"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62954"
FT                   /db_xref="GOA:B2AGQ5"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62954.1"
FT                   /translation="MSLHAADSPDAFLPPARLTRLAFDRRSRGFGQLDFLLGEIGRRMQ
FT                   ERMEVIRLAPQRALDIGCGHGQGLAGLRARFPDAQIAGLDISGAMLAEAGQRDPQRRPG
FT                   WIGRMLGKRPLFDLVQGDLATLPFAPASFDLLWSNLALHWHPEPHRVFPEWHRVTRDEG
FT                   LVLFSLFGPDTLKELRAAFAEVDEAPHTLRFVDMHDIGDMLVHSGWSTPVMDMETLTVT
FT                   YESPATLLREVQAFGGLRAHAGVPPQGLRGRGWYQALTQALERRRNADGVIPLSFEIVY
FT                   GHAWKLAPRGAQARDGEGRAVVPLDQIGRAKPRRAG"
FT   gene            complement(287547..287909)
FT                   /locus_tag="RALTA_A0285"
FT   CDS_pept        complement(287547..287909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0285"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62955"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62955.1"
FT                   /translation="MRFISQSWGEEEGPSRFPPESPPAVWNAIPKSCIANHSASDAHPG
FT                   RWRPDRTVRANQDVLVPGDHCDKLAHYRALPIHGQGRDLTARLARRLILCMGQDAAIAL
FT                   PAAPALCLRQSATGAS"
FT   gene            287809..288318
FT                   /locus_tag="RALTA_A0286"
FT   CDS_pept        287809..288318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0286"
FT                   /product="conserved hypothetical protein, putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62956"
FT                   /db_xref="GOA:B2AGQ7"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62956.1"
FT                   /translation="MQDLGIAFQTAGGDSGGNLDGPSSSPHDWLMKRNCSLSPRQVGWF
FT                   YLSILTVSLAIALFFAWQGSWLVLPFASIELIGLGIALLVYARHATDYERVSITDGTLV
FT                   VETASAGRVTRQEFNPCWVRIELGESFRALVTLRSGARAVQVGCYVDPYRRRKFAQELA
FT                   AALRRL"
FT   gene            288377..289639
FT                   /gene="coxB"
FT                   /locus_tag="RALTA_A0287"
FT   CDS_pept        288377..289639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="RALTA_A0287"
FT                   /product="CYTOCHROME C OXIDASE POLYPEPTIDE II PRECURSOR
FT                   (CYTOCHROME AA3 SUBUNIT 2) TRANSMEMBRANE PROTEIN"
FT                   /function="1.4 : Energy production/transport"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /EC_number="1.9.3.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62957"
FT                   /db_xref="GOA:B2AGQ8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62957.1"
FT                   /translation="MKMWKKASAVCLAGASLLASQAASAVSDMPGGPAVRQLNLTEPVT
FT                   KIAEQIHWLNWMMLIICTVIFIAVFSVMFYSIFTHRKAKGAKPASFHESITVEVVWTIV
FT                   PFLIVIAMALPATKTVVAMKDTTNSDVTIKATGYQWKWGYDYLKGEGEGISFVSTLTTP
FT                   REQINNEQAKSNTYLMEVDNELVVPVNKKIRIVTTANDVIHAWMIPAFGVKQDAIPGFV
FT                   RDTWFKAEKIGVYRGQCAELCGKEHAFMPIVVRVVSDADYTKWVDGKKKELAAKADDPN
FT                   KTWTLDEAKVRGEKIYAANCAVCHQPNGKGAGAFPALDGSKIVNGPKAGQMHILLEGKG
FT                   GMPSWKQLSDTELATVMTYTRNAWGNKTGEVIQPGEFVGARAGKFPEGGGAAGGEAPKA
FT                   EAKPAAQADKQASLAGNRVAG"
FT   gene            289678..291285
FT                   /gene="coxA"
FT                   /locus_tag="RALTA_A0288"
FT   CDS_pept        289678..291285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="RALTA_A0288"
FT                   /product="CYTOCHROME C OXIDASE POLYPEPTIDE I (CYTOCHROME
FT                   AA3 SUBUNIT 1) TRANSMEMBRANE PROTEIN"
FT                   /function="1.4 : Energy production/transport"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /EC_number="1.9.3.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62958"
FT                   /db_xref="GOA:B2AGQ9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62958.1"
FT                   /translation="MSTATPDALAHPHDHAHDDHAHDHPHGWRRWLFATNHKDIGTLYL
FT                   LFSFIMLLSGGVLALLIRLELFEPGLQFFRPELFNQFTTMHGLVMVFGAIMPAFVGFAN
FT                   WMIPLQIGASDMAFARMNNFSFWLMPPAALLLAGSFFAPGGATAAGWTLYAPLSVQMGP
FT                   GMDMAIFAMHIMGASSIMGSINIIVTILNMRAPGMTLMKMPMFCWTWLITAYLLIAVMP
FT                   VLAGAITMVLTDRHFGTSFFSAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIISHVVP
FT                   AFARKRLFGYSSMVYATASIAILSFIVWAHHMFTTGMPVTGQLFFMYATMLIAVPTAVK
FT                   IFNWIATMWRGSMTFETPMLFAIGFIFVFTIGGFTGLMPAVAPIDIQLQDTYFIVAHFH
FT                   YVLVAGSLFALFAGFYYWGPKWSGFMYNEARGQIHFWGSLIFFNVTFFPMHFLGLAGMP
FT                   RRYADYPTQFADFNAIASIGALGFGLMQVYFFFFVVLPSYRGGQQAADKPWDGAEGLEW
FT                   TVPSPAPFHTFEVPPQVR"
FT   gene            291309..291494
FT                   /locus_tag="RALTA_A0289"
FT   CDS_pept        291309..291494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62959"
FT                   /db_xref="GOA:B2AGR0"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62959.1"
FT                   /translation="MKGAAASAPFAPAGIKTVMQSPDKSPSPPDHKAANRRLGLILLSI
FT                   VVVFFLGFFAKMKFLG"
FT   gene            291512..292147
FT                   /gene="ctaG"
FT                   /locus_tag="RALTA_A0290"
FT   CDS_pept        291512..292147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaG"
FT                   /locus_tag="RALTA_A0290"
FT                   /product="Cytochrome c oxidase assembly protein CtaG/Cox11;
FT                   transmembrane protein"
FT                   /function="1.4 : Energy production/transport"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62960"
FT                   /db_xref="GOA:B2AGR1"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62960.1"
FT                   /translation="MSIEQQSRREAHKEAGREADKRFNRGMMLRLVVIVAVMFGFGYAL
FT                   VPLYKKICEITGINVITTRELHGAVKNTQIDKSRTITVEFDSNARGPFAFRPVKNSMEV
FT                   HPGEMATIVYEVANGQPRDISAQAIPSYAPKQATQYFMKLECFCFKQQTLKANEAREMP
FT                   VVFVIDPALPKDVKSITLSYTFFEVGTPVAQAPEGQLAPQPAPAGKGI"
FT   gene            292190..292414
FT                   /locus_tag="RALTA_A0291"
FT   CDS_pept        292190..292414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0291"
FT                   /product="conserved hypothetical protein; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62961"
FT                   /db_xref="GOA:B2AGR2"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62961.1"
FT                   /translation="MDEMKDAVKRKLSFAQTMRAVLWSFIGLRKGAEHERDMARLNPVH
FT                   VVIAGLIAAAVFIAILVVIVRLVVSQAAA"
FT   gene            292559..293419
FT                   /gene="coxC"
FT                   /locus_tag="RALTA_A0292"
FT   CDS_pept        292559..293419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxC"
FT                   /locus_tag="RALTA_A0292"
FT                   /product="CYTOCHROME C OXIDASE SUBUNIT III TRANSMEMBRANE
FT                   PROTEIN"
FT                   /function="1.4 : Energy production/transport"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /EC_number="1.9.3.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62962"
FT                   /db_xref="GOA:B2AGR3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62962.1"
FT                   /translation="MSANRANAPYYFVPGPSRHPITASFGLLMTGAGAAGWVNGQPWAP
FT                   YLCGFGLLWFLFVLKSWFGDAISESEGGMYGKNIDLSFRWSMGWFIFSEVMFFAAFFGA
FT                   LFYARSIAMPWLGDLNNKILWPDFAAVWPNTGPAGVVENFQTMGPWPIPTINTALLLMS
FT                   GLTLTWAHHALLAGKRSQLIQGLVLTILLGAIFMCFQVYEYMHAYSELNLKLSSGIYGS
FT                   TFFLLTGFHGFHVTMGAIMLTVVLIRVLKGHFTPEHHFAFEGAAWYWHFVDVVWLFLYV
FT                   VVYWL"
FT   gene            complement(293564..293773)
FT                   /locus_tag="RALTA_A0293"
FT   CDS_pept        complement(293564..293773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0293"
FT                   /product="conserved hypothetical protein; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62963"
FT                   /db_xref="GOA:B2AGR4"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62963.1"
FT                   /translation="MRFVIIIAFILIIASLASALFFMMRDRGKTPNMMRSLMLRVGFSV
FT                   ALFLFILFSSWMGWIHSTGIRMAP"
FT   gene            293864..294619
FT                   /locus_tag="RALTA_A0294"
FT   CDS_pept        293864..294619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0294"
FT                   /product="putative TRANSMEMBRANE CYTOCHROME OXIDASE COMPLEX
FT                   BIOGENESIS FACTOR"
FT                   /function="1.4 : Energy production/transport"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62964"
FT                   /db_xref="GOA:B2AGR5"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62964.1"
FT                   /translation="MSWRRFASPLPLAAALVVIAVTCALGNWQLDRAHEKEARAARLQA
FT                   LAAQPPVVLGTAPLSQVVTDRAVRVTGRFDASRTVLLDNRPHGIGGRSGDSRAGFLVLT
FT                   PLVIGASPDEAAARRAVLVLRGWLPRDAQDRTRIAPFPTPEGEVTITGTALAGVPRVYS
FT                   LGQEAAGSRIRQNLEIAPYAAETGLALHPLVVEQRNDTGDGLARDWPPADAGADRHYGY
FT                   AFQWFGLAALTVVLVVVPGWRRARRLAAP"
FT   gene            294652..295341
FT                   /locus_tag="RALTA_A0295"
FT   CDS_pept        294652..295341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0295"
FT                   /product="conserved hypothetical protein; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62965"
FT                   /db_xref="GOA:B2AGR6"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62965.1"
FT                   /translation="MQGLAEDKGLTYSMAQQDSAPAAAASPRDPRIDARTRRGRLQMLM
FT                   LLLVCASPVIASYFTYYVIKPRGGATNYGALVDPQRPMPPVRVTDEQGQAVPLEQFRGK
FT                   WLLVSADPSACDEACAKKLFTIRQIRAGQGQDRLRIVPVWLVTDAGKIDERLVAAYNEP
FT                   YAGVRFLRIDRQAAQQWLPAEPGKRAEDTLFLVDPLGNLMMRFPQDPDPKKVSGDLKKL
FT                   LKVSRIG"
FT   gene            295351..296454
FT                   /gene="ctaA"
FT                   /locus_tag="RALTA_A0296"
FT   CDS_pept        295351..296454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="RALTA_A0296"
FT                   /product="CYTOCHROME C oxidase assembly protein, AA3
FT                   subunit-CONTROLLING TRANSMEMBRANE PROTEIN"
FT                   /function="1.4 : Energy production/transport"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62966"
FT                   /db_xref="GOA:B2AGR7"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62966.1"
FT                   /translation="MLLQLAIIGVLIALFPLSYVMVKGDRNKYRKLAWITAFLTLDLIM
FT                   FGSFTRLTDSGLGCPDWPGCYGHSNPHAAMEPIRAAETAMPSGPVTLAKAWIEMIHRYF
FT                   AMAVGVLIITLMVLAWVKRRELKQSPWFATGVLLLVCVQGAFGAFTVTLKLQPVIVVTH
FT                   LMLGMALLAVLIQLGSRNDPPHPVAPQAARLRWPVRIGLLLLVIQIFLGGWVSTNYAVL
FT                   ACTDFPLCNGQLVPEMDFRHGFTLWRQLGMTADGDYIPHAALVAIHWVHRCFAVVVLGY
FT                   LAWFGLRARRLEGLSRAAGWLLATLVLQLATGLSNIVFDWPLVAAVAHNGGAALLLLLL
FT                   VRLHYNIGLTTRAAGAPAAVPTAARAT"
FT   gene            296451..297395
FT                   /gene="ctaB"
FT                   /locus_tag="RALTA_A0297"
FT   CDS_pept        296451..297395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="RALTA_A0297"
FT                   /product="PROTOHEME IX FARNESYLTRANSFERASE (HEME O
FT                   SYNTHASE) TRANSMEMBRANE PROTEIN"
FT                   /function="1.4 : Energy production/transport"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /EC_number="2.5.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62967"
FT                   /db_xref="GOA:B2AGR8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62967.1"
FT                   /translation="MKDKTPSVVTATHPHSLGRLSRMRHLARQYAALTKPRVTQLAVFC
FT                   AIIGMFLATPGMVPWPVLIGGAAGIWLLAGAAFAINCLVEQKIDALMRRTAWRPSATGE
FT                   ITTRQTLVFSAILGGAGMWLLHVYANDLTMWLTFATFLGYAVVYTILLKPATPQNIVIG
FT                   GLSGAMPPALGWAAVAGEVPAEAWFLVLIIFTWTPPHFWALALYRRADYAKSGLPMLPV
FT                   THGERYTLLHILLYTLIMIAATLLPFVYGMSGYIYLAAALALGAGFLAYAWKLYRNYSD
FT                   ELAQRTFRFSILYLSLLFAALLVDHYFKFVPQV"
FT   gene            297507..298127
FT                   /locus_tag="RALTA_A0298"
FT   CDS_pept        297507..298127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0298"
FT                   /product="putative cytochrome c oxidase assembly factor,
FT                   scoC"
FT                   /function="1.4 : Energy production/transport"
FT                   /function="1.6.15.1 : Cytochromes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62968"
FT                   /db_xref="GOA:B2AGR9"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62968.1"
FT                   /translation="MPRLSSASGLFAAFRRFSLLAALALAVAACGQQKASFRNVDITGA
FT                   ADFGKDFSLTDHTGKVRTLADYKGKAVVMFFGYTHCPDVCPTTMAELKAVMEKLGPDAD
FT                   RVQVLFVTVDPERDTQALLAQYVPAFDPRFVGLRPADEASLQKLAKDFKVFYAKVPGSS
FT                   PNNYTVDHSAGSYVFDPNGKLRLFIRHGQGPEPIAHDLKQLLS"
FT   gene            complement(298232..299161)
FT                   /gene="rpoH"
FT                   /locus_tag="RALTA_A0299"
FT   CDS_pept        complement(298232..299161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="RALTA_A0299"
FT                   /product="RNA polymerase sigma H (sigma 32) factor;
FT                   transcription of heat shock and stress proteins"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2.1 : Sigma factors, anti-sigmafactors"
FT                   /function="3.3.3 : Stimulon (ie. environmental stimulus)"
FT                   /function="5.5.2 : Temperature extremes"
FT                   /function="5.5 : Adaptation to stress"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62969"
FT                   /db_xref="GOA:B2AGS0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62969.1"
FT                   /translation="MNAVLSADQTLTNNRLPTVPRNTGSFALTFPATVGNLDSYIQAVH
FT                   RIPLLTAEEEQRLARELRDHDSVEAARRLVMSHLRLVVSIARQYLGYGLPHADLIQEGN
FT                   IGLMKAVKRFDPDQGVRLVSYAMHWIKAEIHEYVLKNWRMVKVATTKAQRKLFFNLRSH
FT                   KQGGHTFTPEQVEAVARELNVKPEEVMEMETRLSGGDLALEGQVDDGEEEFAPIAYLAD
FT                   NHNEPTRVMEAKRQDRMQVEGLEEALAKLDERSRRIIEARWLNVEDDGSGGATLHELAD
FT                   EFGVSAERIRQIEAAAMKKMKGALQAFA"
FT   gene            299506..300381
FT                   /locus_tag="RALTA_A0300"
FT   CDS_pept        299506..300381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0300"
FT                   /product="conserved hypothetical protein, PIRIN-LIKE
FT                   PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 16980458"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62970"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62970.1"
FT                   /translation="MSAIEHLLKPHVRDLGDFTVRRLLPAAATQTVGPFIFFDHMGPVQ
FT                   LPPGQGADVRPHPHIGLATVTYLFEGEIIHRDSLGSDQAIRPGDVNWMTAGHGIVHSER
FT                   SPEHVRPEGARLHGIQTWVALPQEHEGAEPSFFHHPAATLPRIERPGVRMVVIAGDAFG
FT                   QTSPVQVFSRTLYVAIELDAGASVEIPADHAERGIYPVDGAVALDGEPLPAEHMVVLTP
FT                   GQPATLTATAPSRVMLLGGDPTDGHRFIYWNFVASSKVAIEAAAQRWEDDQFPHVPGET
FT                   ERIPLPPRKP"
FT   gene            complement(300400..301452)
FT                   /locus_tag="RALTA_A0301"
FT   CDS_pept        complement(300400..301452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0301"
FT                   /product="putative phosphoribosyl transferase"
FT                   /function="1 : Metabolism"
FT                   /EC_number="2.4.2.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62971"
FT                   /db_xref="GOA:B2AGS2"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62971.1"
FT                   /translation="MGEAAALRYHEPRTHYPHAAMTTTAAPFPAARYIKEIGRGVNGAR
FT                   ALPREDAQALFDAMLAGRVSDLELGAILMAYRIKGEAPHELAGMLEAAHAHCQPLPAPP
FT                   DRQVVVIPSYNGARKQPNLVPLLALLLAREGIPVVVHGTRVFEGRVTSMALFEALGVPL
FT                   CASTDEAAARLRDGDRDGPLAVLPVDVLSPGLSRLLERRTVIGLRNSSHTVAKMLQPVG
FT                   EHTPAEGLRLYSYTHPEYRETLTDYFSHEPANVLLARGTEGEVVADARRSGRIDWLHEG
FT                   HQQTLVGQAGGSIGDVPELPPGSDAGLTVAWIRRVLDGAVPVPAPIAIQIEAIRECLRQ
FT                   GTRVTWASPV"
FT   gene            complement(301479..302282)
FT                   /gene="nasD"
FT                   /locus_tag="RALTA_A0302"
FT   CDS_pept        complement(301479..302282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /locus_tag="RALTA_A0302"
FT                   /product="nitrate ABC transporter, ATP_binding component"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8169203, 9495773; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62972"
FT                   /db_xref="GOA:B2AGS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62972.1"
FT                   /translation="MDKFVSIENVGQTFKTRKGPFVALRDIDLQIAEGEFITLIGHSGC
FT                   GKSTLLNLLAGLATPTTGALICAGREIAGPGPERAVVFQNHSLLPWLTCFENVYLGVER
FT                   VFAGSEDKARLRARTHDTLALVGLSHAEGKYPHEISGGMKQRVGIARALAMAPKVLLMD
FT                   EPFGALDALTRAHLQDELIKIVAATRSTVVMVTHDVDEAVLLADRIVMMTNGPAATIGE
FT                   ILKVDLPRPRDRVALADDPAYHRCRTAVLDFLYRKQRNPALQQAA"
FT   gene            complement(302302..303192)
FT                   /gene="nasE"
FT                   /locus_tag="RALTA_A0303"
FT   CDS_pept        complement(302302..303192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /locus_tag="RALTA_A0303"
FT                   /product="NITRATE ABC TRANSPORTER, TRANSMEMBRANE component"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8169203, 9495773; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62973"
FT                   /db_xref="GOA:B2AGS4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62973.1"
FT                   /translation="MNAIASTTPDAAADPDTKERTRRREQEISAQALRAARREAAAALV
FT                   LKAVPPLLGFALFVLAWHGIASLIPAIPTPGATWNAAVPLFADPFYRNGPNDQGIGWNV
FT                   LASLARVAAGFGLAALVGIPAGFVIGRFAFLNAMTAPVISLLRPVSPLAWLPIGLLLFK
FT                   AANPAAIWAIFICSIWPMVINTAVGVTRVPQDYLNVARVLDLSEWKVFTRVLFPAVLPY
FT                   MLTGVRLSIGTAWLVIVAAEMLTGGTGIGFWLWDEWNNLKVEHIVIAIFVIGLIGLLLE
FT                   HALLALARRFSYGTH"
FT   gene            complement(303224..304558)
FT                   /gene="nasF"
FT                   /locus_tag="RALTA_A0304"
FT   CDS_pept        complement(303224..304558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasF"
FT                   /locus_tag="RALTA_A0304"
FT                   /product="NITRATE ABC TRANSPORTER, periplasmic component"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8169203, 9495773; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62974"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62974.1"
FT                   /translation="MPTRLSHARPLHAAVQNSDAAASADAVPASSGRRRALATIASASV
FT                   MTLVDPLVRAGAWAAGSDAPEKTEVRIGFIPLTDCASVVMAATLGLDKKYGIKITPTKE
FT                   ASWAGVRDKLVNGELDAAHVLYGLVYGVQLGIGGPKKDMAVLMSLNHNGQAITLSSKLA
FT                   EKGVRDGASLKALMAKEKRDYTFAQTFPTGTHAMWLYYWLAANGINPMQDAKAITVPPP
FT                   QMVANMRVGNMDGFCVGEPWGARAIADKIGFTAETTQAIWKNHPEKTLGTTAEFVQKYP
FT                   NTARAMVAAVLEASKFIDASASNRRKTAETIAAKSYVNTDMDIILDRMLGRYTNGLGKT
FT                   WDDPDAMKFYQDGNANFPFLSDGMWFLTQHKRWGLLKAHPDYLAVARQVNRIDIYKQAA
FT                   TAAQVPLPKSDMRSSKLIDGVVWDGKDPKAYADGFKIKAAGTPSA"
FT   gene            complement(304935..305579)
FT                   /gene="nasR"
FT                   /locus_tag="RALTA_A0305"
FT   CDS_pept        complement(304935..305579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasR"
FT                   /locus_tag="RALTA_A0305"
FT                   /product="response regulator antiterminator transcriptional
FT                   regulator, RNA-binding ANTAR domain"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /function="3.3.1 : Operon (regulation of one operon)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8169203, 9495773; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62975"
FT                   /db_xref="GOA:B2AGS6"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62975.1"
FT                   /translation="MTRRHPPPTPAPANPATPATGRVLRILLVRDPLDADPLNVETIRS
FT                   GLVNAGFTEIQVVDADLRLPDVITASQPDMLIIASESAARDTIEHVCVSTQHAPRPIVL
FT                   FTDNDDSQRIKAALSAGITAYIVDGLRAERVKTVLDVAYARFELDQQLRAELDATRLKL
FT                   AERKVVERAKGLLMQARGLSEEEAYKRLRSMAMERGLKLVDAAQRVIDVMG"
FT   gene            305788..306489
FT                   /locus_tag="RALTA_A0306"
FT   CDS_pept        305788..306489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0306"
FT                   /product="putative isomerase/hydrolase; putative
FT                   Fumarylacetoacetate (FAA) hydrolase"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /EC_number="3.7.1.2"
FT                   /EC_number="5.3.3.-"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62976"
FT                   /db_xref="GOA:B2AGS7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62976.1"
FT                   /translation="MTEFVFAPPAPVGVPVRGSDASFPVRRVYCVGRNYAAHAREMGSD
FT                   PDREPPFFFCKPSDAVSYVADGTEGSFPYPPGTSNCHYEVELVVAIGKGGRDIPVEQAA
FT                   GHVFGYAVGLDMTRRDLQNESKKTGRPWETGKAFDHSAPIGPIVPVAAIGHPQKGEVTL
FT                   SVNGVEKQRGDLSDLIWSVPEMVSYLSKLFELQPGDLIFSGTPEGVGPVVKGDVMQCRV
FT                   GGVGDLTIKVV"
FT   gene            306494..307141
FT                   /locus_tag="RALTA_A0307"
FT   CDS_pept        306494..307141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0307"
FT                   /product="putative MALEYLACETOACETATE ISOMERASE"
FT                   /function="1 : Metabolism"
FT                   /EC_number="5.2.1.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62977"
FT                   /db_xref="GOA:B2AGS8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62977.1"
FT                   /translation="MLKLYSYFRSSASFRVRIALELKGLSYDYVPVHLLKEGGQQLKPE
FT                   FRAVNPDGLVPALVDGEHVLQQSLAIVEYLDEVHPEPKLLPGTALDRAYVRGLAQEIAC
FT                   EIHPLNNLRVLKYLKHTVGVTDEVKDAWYRHWIELGFASLQANLERSGKAGRFCFGDTP
FT                   TLADLCLVPQVFNAQRFNIDVARYPAIAKIYETCMALPAFQKAEPKSQPDAE"
FT   gene            complement(307211..308368)
FT                   /gene="ftsY"
FT                   /locus_tag="RALTA_A0308"
FT   CDS_pept        complement(307211..308368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="RALTA_A0308"
FT                   /product="Signal recognition particle GTPase"
FT                   /function="4.3.A.5 : The Type II (General) Secretory
FT                   Pathway (IISP) Family"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62978"
FT                   /db_xref="GOA:B2AGS9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62978.1"
FT                   /translation="MFSFWKKRKAEPAPVEATVEAPAPAPAPAPAVPAPAPAPAPSPTP
FT                   SPAPAPVPVPVPVPAQVPPPAPAPVAAETLELVPPPAPSAEARQGWMQRLRTGLSKTSR
FT                   NLGTLFVGVKVDEDLFEELETALLMADAGVEATEYLLGELRKRVKAERIETAEGVKTAL
FT                   RELLTRLLRPLEKTMELGREQPLVMMIAGVNGAGKTTSIGKLCKHFQRYDQKVLLAAGD
FT                   TFRAAAREQLAIWGERNNVTVVAQESGDPAAVIFDAVNAAKARGIDIVMADTAGRLPTQ
FT                   LHLMEELKKVKRVISKAMPSAPHEVLLVIDANTGQNALQQTRAFDDALGLTGLIVTKLD
FT                   GTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFKAEEFADALLG"
FT   gene            308531..310144
FT                   /locus_tag="RALTA_A0309"
FT   CDS_pept        308531..310144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0309"
FT                   /product="putative ZINC PROTEASE, peptidase M16 family"
FT                   /EC_number="3.4.24.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62979"
FT                   /db_xref="GOA:B2AGT0"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62979.1"
FT                   /translation="MADSRAASRTRIDRQNSSRRGRMNHCAVMTAAGAPGTKAAAQTRI
FT                   QRHAPPFQAPAARAARLARRVIPALLLALLPWSPPAAAQGVVASPMPAAQTAPAGATAQ
FT                   GTTEYRLSNGLRLIVKEDHRAPTVAHQVWYRVGGIDEVSGTTGVAHMLEHMMFKGTPKV
FT                   GVGEFSKQVAALGGRENAMTNRDFTMYYQQIGKQYLPKMMELEADRMANLVITKDEFER
FT                   EMKVVMEERRLRTDDSARGTVYEQLLATVYTAAAYRHPVIGWMDDLVNMRVEDVKDWYR
FT                   HWYVPNNATVIVTGDVKADEVRALAERYYGKLKPRALPVRKDQEEPAQKGIKRIWVKAP
FT                   AENQYMVMAYKVPRLRDVEKDVDPYALEVLAAVLNGYDNARLTRELVRERRLADDVNVG
FT                   YDSINRGESLFVLDGTPASGHNTDEIERALRAEIQRIASEGVSPEELKRVKAQVVAGQI
FT                   YKRDSVFGQGMEIGVSEISDISWRQIDRMLDKIKAVTPAQVQAVAAKYFNDDNLTVATL
FT                   VPQPIDPNKPKSQAPSGLRH"
FT   gene            310155..311537
FT                   /locus_tag="RALTA_A0310"
FT   CDS_pept        310155..311537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0310"
FT                   /product="putative ZINC PROTEASE, peptidase M16 family"
FT                   /EC_number="3.4.24.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62980"
FT                   /db_xref="GOA:B2AGT1"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62980.1"
FT                   /translation="MTQSVTSAQRPLRKLAGAALGAVVLLAAQLAQAAIPIEHWTASTG
FT                   ARVFFVHSPSIPMLDINIDFDAGSRYDPPGKAGLATLTAALLDKGAAAQDGQPARDEAR
FT                   IADAFADTGAAFGGAAGGDRGGIGLRTLTAQPELDQSVALAAQLIKAPTYPDAVVGREK
FT                   QRLITAIREADTKPGVIADKALARAMYPDHPYGIAATPDSVASITRDDIVAFWRDNYGA
FT                   QRAVVTLIGAVDRKQAEAIAEQLTRGLPAGRAAPALPQVKLKIAPSEQRLPHPAQQSSV
FT                   ALGQPAIARGDPDYFALLVGNYVLGGGGFSSRLTDEVREKRGLTYGVDSYFAPSKQPGP
FT                   FGISLQTKKAQTDEALALVRQVLARFVAEGPSEKELRAAKDNLINGFPLRIDNNRKLLT
FT                   NVANIGWYGLPLDYLDTWTAQIGKVTREQVRAAFQRHVHPDNMATVIVGGPVQAPATAS
FT                   RQ"
FT   gene            311599..312246
FT                   /locus_tag="RALTA_A0311"
FT   CDS_pept        311599..312246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0311"
FT                   /product="conserved hypothetical protein, putative
FT                   methyltransferase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62981"
FT                   /db_xref="GOA:B2AGT2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62981.1"
FT                   /translation="MNSRSRLPSPAPRGRSPVSPVPRQAPAQVRIIGGRWKRTLLPVPD
FT                   AQGLRPTPDRVRETLFNWLGQDLSGLECLDLFAGSGALGFEAASRGAAVVTLVESNARV
FT                   ARQLRDNVTRLDARQIRVMQGDAFAIAAQLPDASFDVVFLDPPFAEDWIGPSLAHAARL
FT                   SRPGGAVYVETDRPLTGADAPVPASLEIVRHARAGAVHFHLLQHRTPGNGAA"
FT   gene            312487..312972
FT                   /gene="coaD"
FT                   /locus_tag="RALTA_A0312"
FT   CDS_pept        312487..312972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="RALTA_A0312"
FT                   /product="CMP-deoxy-D-manno-octulosonate-lipid A
FT                   transferase (phosphopantetheine adenylyltransferase)"
FT                   /function="1.5.3.5 : Coenzyme A"
FT                   /function="6.3 : Surface antigens (ECA, O antigen of LPS)"
FT                   /EC_number="2.7.7.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62982"
FT                   /db_xref="GOA:B2AGT3"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62982.1"
FT                   /translation="MVSAVYPGTFDPMTRGHEDLVRRASNIFDELVVGVAHSPNKRPFF
FT                   SLEERISIAREVLGHYPNVRVEGFSGLLKDFVRKNNARVIVRGLRAVSDFEYEFQMAGM
FT                   NRYLLPDVETMFLTPSDQYQFISGTFVREIAVLGGDVSKFVFPSVERWLQEKIAKPE"
FT   gene            313040..313300
FT                   /locus_tag="RALTA_A0313"
FT   CDS_pept        313040..313300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0313"
FT                   /product="putative 4Fe-4S ferredoxin-type protein"
FT                   /function="1.4.3 : Electron carrier"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62983"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62983.1"
FT                   /translation="MALMITDDCINCDVCEPECPNEAISMGPEIYEIDPNKCTECVGHF
FT                   DEPQCQQVCPVACIPKDPNRVETHEVLMQRYRLLTAARHAA"
FT   gene            complement(313444..315303)
FT                   /locus_tag="RALTA_A0314"
FT   CDS_pept        complement(313444..315303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0314"
FT                   /product="conserved hypothetical protein, DUF839"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62984"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62984.1"
FT                   /translation="MSYLTDEARAASRAAKPDVDVPGQMLEDIVAANPARRRVLRGGLG
FT                   LSLVSAFGSGLLAACGGDDDPAPAPAPAPAPAPAPAPAPATPSYEVTFEPIAKSTADTV
FT                   VVPSGYSVDVLFSAGDPVEAGATGYAGAFQSSAETERQAGGNHDGMHYFALPGVDPQKG
FT                   GLLAINHELPDYNILFPTAYNAATASPEQKRIALSAVGISVIEVELAASGKWQVKRDSI
FT                   YNKRYTGNTLYRVGGPAASVVGATVVGMLNNCSSGYTPWGTYLTCEESTDNYIDPDPAK
FT                   ADNGYGWVVEIDPYGTLSAPAKRTAMGRFDHENVAFITDASNNVAFYMGDDGTPGCIYK
FT                   FVPSKAFDPNNRAANANLLDTGTLYVAKFNADGSGQWIELTQGKNGLTVGASDPGNWTQ
FT                   SAVSPAPTTVDFATQADVLINTKSAARVAGGTLMDRPEWITAAPDNTLYCTLTNNSGRQ
FT                   QTDAANPRKNNLHGHIIKWNEAGNSPLATTFTWSILLQAGDPSLATDNLKGNINGDTFS
FT                   SPDGLRVDPKGRLWVQTDSSTSATYTGTFGNNSMYYISPTGQSKRFLAGPTGCEITGIA
FT                   YTPDLTTCFINIQHPTGKWPDAAKPPRSSTIVVRRADGKPIGA"
FT   gene            complement(315511..316107)
FT                   /gene="pth"
FT                   /locus_tag="RALTA_A0315"
FT   CDS_pept        complement(315511..316107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="RALTA_A0315"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.1.1.29"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62985"
FT                   /db_xref="GOA:B2AGT6"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62985.1"
FT                   /translation="MIKLIVGLGNPGAEYEATRHNAGFWLVDQLARMGGATLRVEGRFH
FT                   GLAARARLWDQEVWLLKPSTFMNRSGLAVVSLARFYKILPDEIVVVHDEMDLPAGSAKL
FT                   KRGGGAGGHNGLKDISAHLGTQDYWRLRLGVGHPRNAPGGAGAGREDVVNFVLKPPRRE
FT                   EQEAIDAALDRCIEPLGLLARGDAERAMAQLHTAR"
FT   gene            complement(316282..316899)
FT                   /gene="rplY"
FT                   /locus_tag="RALTA_A0316"
FT   CDS_pept        complement(316282..316899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="RALTA_A0316"
FT                   /product="5S rRNA binding 50S RIBOSOMAL SUBUNIT PROTEIN
FT                   L25"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="6.6 : Ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2034228; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62986"
FT                   /db_xref="GOA:B2AGT7"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62986.1"
FT                   /translation="MKVVAFERSVQGTGASRRLRNSGKTPGIIYGGAAEPKMIELDHNA
FT                   LWHALKKEAFHSSILDLEVAGKSEKALLRAFQMHPFKPLVLHVDFQRVSANDKIHVKVP
FT                   LHFMNQETAPGVKLGHGLVNHIVNDLEVSCLPADLPEFIEVDVGAMELGQTLHLSDLKL
FT                   PKGVTVITHGDDNPAIASISQPAGAVSEAAEGGEAAGETPAA"
FT   gene            complement(317033..317986)
FT                   /gene="prs"
FT                   /locus_tag="RALTA_A0317"
FT   CDS_pept        complement(317033..317986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="RALTA_A0317"
FT                   /product="phosphoribosylpyrophosphate synthetase"
FT                   /function="1.5.2.3 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="2.7.6.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62987"
FT                   /db_xref="GOA:B2AGT8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62987.1"
FT                   /translation="MSSEGLMVFTGNANPKLAEAVVQHLGIPLGKAQVGRFSDGEVQVE
FT                   IQENVRGKHVIVLQSTCAPTNDNLMELMVMVDALKRASARSITAAMPYFGYARQDRRPR
FT                   SARVAISAKVVANMLEVAGVERVLTMDLHADQIQGFFDIPVDNIYASPVLLGDLREKNY
FT                   GDLLVVSPDVGGVVRARALAKELNCDLAIIDKRRPKANVAEVMNIIGEVEGRNCVIMDD
FT                   MIDTGGTLCKAAQVLKERGALKVFAYCTHPVLSGGAAARIADSALDEVVVCDTIPLSEE
FT                   AAKCGKIRQLSTAPLLAETFTRIVKGDSIMSLFAGS"
FT   gene            complement(318084..318160)
FT                   /locus_tag="RALTA_AtRNA57"
FT   tRNA            complement(318084..318160)
FT                   /locus_tag="RALTA_AtRNA57"
FT                   /product="tRNA-Gln"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(318220..319098)
FT                   /gene="ispE"
FT                   /locus_tag="RALTA_A0318"
FT   CDS_pept        complement(318220..319098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="RALTA_A0318"
FT                   /product="4-diphosphocytidyl-2-C-methylerythritol kinase"
FT                   /function="1.5.3.19 : Isoprenoid biosynthesis"
FT                   /EC_number="2.7.1.148"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12878729; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62988"
FT                   /db_xref="GOA:B2AGT9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62988.1"
FT                   /translation="MPSSHPLPPPELRDCPAPAKLNLFLHVTGRRADGYHTLQTVFQLV
FT                   DWCDMLHFRRRDDGVVARVTEVPGVPAESDLVVRAARALQAATGTTFGAEIAIDKVLPM
FT                   GGGIGGGSSDAATTLLALNHLWGLGLTRPELMRIGLTLGADVPVFVLGQNAFAQGIGEE
FT                   LTPVELPDSWFVIIHPKQHVPTAEIFSDECLTRDTPVSIIAVFAARTNKFDFGRNDLEP
FT                   IATAKFGEVARALAWLKQHNQHARMTGSGACVFARFPDAKTAQQVLERLPPEWDGRCVR
FT                   SLAHHPLAAFA"
FT   gene            complement(319130..319741)
FT                   /gene="lolB"
FT                   /locus_tag="RALTA_A0319"
FT   CDS_pept        complement(319130..319741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolB"
FT                   /locus_tag="RALTA_A0319"
FT                   /product="Outer-membrane lipoprotein lolB precursor"
FT                   /function="1.6.10 : Lipoprotein"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 17350955; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62989"
FT                   /db_xref="GOA:B2AGU0"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62989.1"
FT                   /translation="MNRSRRLALLCLGVPLLLQACASVAPSRSFDVDQDAASRQYTGRF
FT                   SANYVRYGRDEGVQGSFRWEEQGRNVRLDLVSPLGQTLAVVTATPSGATLDLPNQPPRN
FT                   APEVDTLMEEALGFALPVAGMRDWLHGRATQGSPARATRDEQGRLATLAQNGWTVRYVA
FT                   WQDTPAPGAAATQVPRRIDLARDAGSNPLSVRLVIDPQTP"
FT   gene            complement(319831..321774)
FT                   /locus_tag="RALTA_A0320"
FT   CDS_pept        complement(319831..321774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0320"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62990"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62990.1"
FT                   /translation="MSDLMPDLMPDSTLQATAGGGLTTSPRAGSRAARRASLLARWWRA
FT                   PRRHARALAAGALLAAAAGAAHAAPPVGAGSLPMLQLAAADTPAAKPARPALPSLELTD
FT                   DIVYMVLAAEISIQRGLVGPAYRTYLELARQTRDPRFAQRATEIAFNARIPQQALDAAR
FT                   LWKEITPTSPAAGQVLSTLLVLNGRWDDARPLLQQQLATVPASQRGDAILQLQQQLSRT
FT                   SDPAGAARLLQDLTRNEAKLPETQLALARARELAGDEPGALAALDQALRLRPAYEAAAL
FT                   MAAELRAEKQPDEAVAVLKRFLEKSPESVNGHITLARLYLLKNDMPAARQEFETLRKVA
FT                   PADPRVPLALGLTSLQAKNFGEAEQYLQEYLQLVEKQPSANPDIAYQYLAQIAEERKDY
FT                   AGAIRWLDRIEDVRLAPAATAKRAQLLARMGKLDDAQALFGEMLTDAEDIPDPGQRSQR
FT                   VTAIRQAEVATLMENKAYDRARKVLNERVAAEPDNADWIYELAMLDERQKRYASMETGL
FT                   RRVIALQPQQKQGYNALGYSLADRNERLPEALKLLERASELGPDDPYIMDSLAWVKFRM
FT                   GDLQPAAVLLRNAYAKAPEAEIGAHLGEVLWQLGEHDEARKTWTEAVRIDPENETLIDT
FT                   LRRYQFNAQPSR"
FT   gene            321930..322802
FT                   /gene="mutM"
FT                   /locus_tag="RALTA_A0321"
FT   CDS_pept        321930..322802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="RALTA_A0321"
FT                   /product="formamidopyrimidine/5-formyluracil/
FT                   5-hydroxymethyluracil DNA glycosylase/ DNA lyase"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62991"
FT                   /db_xref="GOA:B2AGU2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62991.1"
FT                   /translation="MPELPEVEVTRRGLLPHVVGRRIAAVTVRHRGLRWPVDPGLEACL
FT                   AHRLVRRIERRGKYLLLECISADAAQPPGWLLVHLGMTGTLRVLPEAPPPGMHDHFDLL
FT                   LDAGPAPGMLADTIVLRFRDPRRFGAILWTTLPEAELASHPLLSTLGIEPFDPAFDGAW
FT                   LHRHTRGRSAAIKTVLLSGAIVVGVGNIYASESLFRAGIRPTTAAGRLSRARCDRLAQA
FT                   VRDTLAQAIERGGSTLRDFVGSDGASGYFQLDCFVYDRAGLPCRVCATPVRQIVQGQRS
FT                   TFYCPKCQH"
FT   gene            323066..325018
FT                   /locus_tag="RALTA_A0322"
FT   CDS_pept        323066..325018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0322"
FT                   /product="conserved hypothetical protein; putative
FT                   nucleoside triphosphate hydrolase domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62992"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62992.1"
FT                   /translation="MTTLAHQFEQYGAWRTGVLQSLAEFQSWLQQHDLYDAQADDRVQR
FT                   IQNVLRSDRLKVAFIAEFSRGKSELINAIFFADYGRRILPSSAGRTTMCPTELRYDEAE
FT                   PPSIRLLPIETRLQDASTADFIEAGTSASHWHSVPLDPSSPEGMLEAFQHVVQTMRVPP
FT                   EQAEALGLYHENDPDAAYAVDAEGMVEISRWRHAVINFPHPLLRQGLVILDTPGLNAIG
FT                   TEPELTLRLIPDAHVVVFVLAADAGVTKSDLELWRSHVGAGHRRGCLAVLNKIDGLWDP
FT                   LRQPGEIAQEIARQVSTTAQVLGIEQSRVYPVSAQKGLVAKVTHDDALLARSGLPEFEH
FT                   VLSDQLIPRRREIVSDQVYRLVQDMARAAQQLLQSRRRDIVEQLFELRGLRGKNHAMVK
FT                   HMLMRVQGEKDEFEQSISKFQALRLVFGRHSADIIKSLQLRDVRRTMRSAREQMKERFF
FT                   SRGLREDMDALFAQLSGLVSDADNKIGQLHQLIDSMYRRFNAEHGFTLPAPMQFTAERY
FT                   LAELQETLRLVQAHFGTISMLTRSRPQLVQSAFNTMASRVLENFRGLNRDIEVWLKSVM
FT                   TPLEAQVREHQKQLRRRVDSIERIHEATDTLESRIAQLEEVLNGLDERSGRIEGFAQRL
FT                   MRPAADAGSASLAVA"
FT   gene            325144..326319
FT                   /gene="mutY"
FT                   /locus_tag="RALTA_A0323"
FT   CDS_pept        325144..326319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="RALTA_A0323"
FT                   /product="adenine DNA glycosylase"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.2.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2197596; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62993"
FT                   /db_xref="GOA:B2AGU4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62993.1"
FT                   /translation="MSRKPAPRTAPALPDDLCVPPDFGARVVDWQRRYGRHDLPWQNTR
FT                   DPYRIWLSEIMLQQTQVSAVIDYFQRFVAQLPTVQALAAAPADQVMALWAGLGYYSRAR
FT                   NLHRCAMQVVSEHGGRFPTDPAVLVTLPGIGRSTAAAIAAFSAGVRVPILDGNVKRVFA
FT                   RCFGIHGHPGERAVETRMWQLAELALPAPGPRESEDMVAYTQGLMDLGATVCSRGKPAC
FT                   LADAAACPLSADCVARRDGLTGVLPAPRPRAAIPERSTVMLLVRREREVLLRLRPDSGI
FT                   WGGLWSLPEMPVETVPFDAEDAEAWALDYARAFGTPARAVLAGELTHVFTHFRLLIRAI
FT                   RVDLAAQANVLQQDGAAPAGQRWLSLDDLDALGTPAPVRRLLEDQARVGLF"
FT   gene            complement(326362..327021)
FT                   /locus_tag="RALTA_A0324"
FT   CDS_pept        complement(326362..327021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0324"
FT                   /product="putative peptidase, S16 family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62994"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62994.1"
FT                   /translation="MSSTDLYRPTGSADPPRTLDNLPLFPLHTVLFPGGRLPLRVFEAR
FT                   YVDMVRNCLRDSAPFGVCLIASGDEVARPNQPTVPELVGCLAEIVDCNMEQLGVLLIRA
FT                   RGRDRFHILGHETRDDGLLVARAEVLPPDIIDCKLELLGECLDALRRIVTRLHAEQPDR
FT                   LPFDEPYLWDDPSWVANRLCELLPVPLKAKQMLMALPDAGMRIEIVHRYMRQNHML"
FT   gene            complement(327114..327989)
FT                   /locus_tag="RALTA_A0325"
FT   CDS_pept        complement(327114..327989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0325"
FT                   /product="conserved hypothetical protein; putative P-loop
FT                   ATPase"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62995"
FT                   /db_xref="GOA:B2AGU6"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62995.1"
FT                   /translation="MRIILITGISGSGKSVALNVLEDAGYYCVDNLPAQFIPELTRYLD
FT                   AQGYTHLGVATDIRSRESLDQLPDTVRALAAEHQVEVIFLTASTDALVQRYSETRRRHP
FT                   LSARTDGAAGGGAFNDTALMEAIEMERSLLSPLAEAAHRIDTSNVRTNTLRSWIKELIR
FT                   DDSQRLTLLFESFGFKHGVPSDADMVFDVRSLPNPYYDLALRPLTGRDTPVIDFLQGQP
FT                   MVLAMAEDIRAYVEKWLPSFIADNRSYLTVAIGCTGGQHRSVYIAERLANYFRAHGNVL
FT                   VRHRELAPAG"
FT   gene            complement(328101..328493)
FT                   /gene="psiF"
FT                   /locus_tag="RALTA_A0326"
FT   CDS_pept        complement(328101..328493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="RALTA_A0326"
FT                   /product="phosphate starvation inducible psiF; putative
FT                   exported protein"
FT                   /function="5.5.3 : Starvation response"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2160940; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62996"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62996.1"
FT                   /translation="MKSLIAVCALVTPLFAASAFAQTATPATPATPAKPSAAAPATPAV
FT                   PATPATPASPDKPAANTQQDKMKACNAQASGKKGDERKAFMKECLSKSGVSKTQQEKMA
FT                   SCSKSGKGKKGDEYKAHMKECLSKAA"
FT   gene            complement(328665..329636)
FT                   /gene="ptsK"
FT                   /locus_tag="RALTA_A0328"
FT   CDS_pept        complement(328665..329636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsK"
FT                   /locus_tag="RALTA_A0328"
FT                   /product="HPr serine kinase/phosphorylase"
FT                   /function="1.1.1 : Carbohydrates/Carbon compounds"
FT                   /function="3.1.3.2 : Covalent modification, demodification,
FT                   maturation"
FT                   /function="4.9.B : Putative uncharacterized transport
FT                   protein"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="3.1.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62997"
FT                   /db_xref="GOA:B2AGU8"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62997.1"
FT                   /translation="MELTGVTSQSIFDDNAADLKLSWVAGLEGADRAFDVEFAREATSA
FT                   ADLVGHLNLIHPNRIQVLGKPEITYYQRLDDETRKRQMGELILLEPPFLVIADGMEPPP
FT                   DLELRCTRSSTPLFTTPVSSAAVIDHLRLYLSRISAPRVTMHGVFLDILGMGVLIMGES
FT                   GLGKSELGLELISRGHGLVADDAVDFVRLGPDFIEGRCPPLLQNLLEVRGLGLLDIKTI
FT                   FGETAVRRKMKIKLVVQLVRRNDGEFERLPLDSQYLDVLGLPIHMVKIQVAAGRNLAVL
FT                   VEAAVRNTILRLRGIDTLRDFMDRQRAAMQADAVSRGQGRLL"
FT   gene            complement(329718..330173)
FT                   /gene="ptsN"
FT                   /locus_tag="RALTA_A0329"
FT   CDS_pept        complement(329718..330173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="RALTA_A0329"
FT                   /product="Phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system (PTS), EIIA 2 component"
FT                   /function="4.9.B : Putative uncharacterized transport
FT                   protein"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62998"
FT                   /db_xref="GOA:B2AGU9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62998.1"
FT                   /translation="MNRLAKLLPPGNITLDVSVTSKKRVFEQAGLLFENNHGVARAIVT
FT                   DNLFARESLGSTGLGAGVAIPHGRIKGLKQPLAAFMRLAEPIPFESPDGKPVSLLIFLL
FT                   VPEQATQQHLEILSEIAQLLSDRDMREGLATLPTPDAVHQLLIAWHP"
FT   gene            complement(330525..330875)
FT                   /gene="yhbH"
FT                   /locus_tag="RALTA_A0330"
FT   CDS_pept        complement(330525..330875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbH"
FT                   /locus_tag="RALTA_A0330"
FT                   /product="sigma(54) modulation protein"
FT                   /function="2.2.2 : Transcription related"
FT                   /function="3.1.2.1 : Sigma factors, anti-sigmafactors"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAP62999"
FT                   /db_xref="GOA:B2AGV0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP62999.1"
FT                   /translation="MNFKISGHHLDITPPLREYVETKLERIVRHFDQVIGVSVLLSVDN
FT                   HKEKDRRQYAEINLHLKGKDIFVEAHHEDLYAAIDALVDKLDRQVIRYKDRVQGHDREA
FT                   VKYQMAAAQMQQ"
FT   gene            complement(330924..332402)
FT                   /gene="rpoN"
FT                   /locus_tag="RALTA_A0331"
FT   CDS_pept        complement(330924..332402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="RALTA_A0331"
FT                   /product="sigma N (sigma 54) factor of RNA polymerase"
FT                   /function="3.1.2.1 : Sigma factors, anti-sigmafactors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63000"
FT                   /db_xref="GOA:B2AGV1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63000.1"
FT                   /translation="MKPSLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVEQALTENP
FT                   LLERENDWIESPLRVAADGSVNVQSAPAPAPAEPQGNGDAHADGAAEDSYGDNSSGDDY
FT                   SNGDWSLDDFARRPQGDEDEKTPMQLRDAEPTLREYLMEQLTPLKISARDKGLAIFLIE
FT                   SLDDDGYLSASLEEICAELPEELEFDPDEVHAILTLLQSFDPPGVGARNAAECLALQLR
FT                   RLTHPQRELALTIVTHHLELLAVRDYTRLKKALQVDEVALKAAHDLIRSLAPYPGHAYS
FT                   RPEADFVVPDVFVRKSGGGWIAQLNPDVMPRLRINDMYAQILRGAKGETGTAGLQQKLQ
FT                   EARWLIKNIQQRFDTILRVSQAIVERQKNFFTHGEIAMRPLVLREIADTLGLHESTISR
FT                   VTTNKYMATPMGTFELKYFFGSHVSTETGGAASSTAIRALIKQLIGAEDPRNPLSDSRI
FT                   AELLGEQGFVVARRTVAKYREALKIPAVNLRKSL"
FT   gene            complement(332528..333328)
FT                   /locus_tag="RALTA_A0332"
FT   CDS_pept        complement(332528..333328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0332"
FT                   /product="putative ABC transport protein, atp_binding
FT                   component"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63001"
FT                   /db_xref="GOA:B2AGV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63001.1"
FT                   /translation="MTDTATIADKPVVEANAVLPGGSTLVVRHLKKRYGSRTVVKDVSL
FT                   DVKSGEVVGLLGPNGAGKTTSFYMIVGLVALDEGDIVLDGDHISGLPIHERARMGLSYL
FT                   PQEASVFRKLNVEENIRAVLELQLDKGKPLARAEIERRLDALLDDLQIAHLRNNPALSL
FT                   SGGERRRVEIARALASSPRFILLDEPFAGVDPIAVGEIQRIVSFLKARNIGVLITDHNV
FT                   RETLGICDHAYIISEGTVLAAGQPEDIIANDAVRRVYLGENFRM"
FT   gene            complement(333337..333981)
FT                   /locus_tag="RALTA_A0333"
FT   CDS_pept        complement(333337..333981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0333"
FT                   /product="conserved hypothetical protein, OstA domain;
FT                   putative exported PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63002"
FT                   /db_xref="GOA:B2AGV3"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63002.1"
FT                   /translation="MTASLTTSSRRRTAPALLALAMAFGLLGQPALAERADRDKPMVLE
FT                   ADNASYDDVKQIYTLTGNVVLTKGTMILKSDAAELRTDPEGYQFAVATSKPGRQAYIRQ
FT                   KREGVDEYIDGWGDRIEYDGKQEFSKLIGNARMARLQGAKLLDEIRGAVLTYDSRKELY
FT                   TAAGGGSGDAAAANPSGRVRAVLSPRQDQKSGTAGGSPLDLKPAPAPANKP"
FT   gene            complement(334101..334730)
FT                   /locus_tag="RALTA_A0334"
FT   CDS_pept        complement(334101..334730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0334"
FT                   /product="conserved hypothetical protein, DUF1239; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63003"
FT                   /db_xref="GOA:B2AGV4"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63003.1"
FT                   /translation="MQALLASLSGIVMRLLPLLLMAIVAGSTFWLVQINSPREDQAAQT
FT                   AKKHEPDYFMDRFSATELAPDGSTKIRFTGERMIHFEDDQTYEVTRPAMRAYEPDRPPV
FT                   TARADIGRMNAEGTVIDLYGNGYVLRQQGADPSKDPQLTAASSYFQLLVNDDIVKTDKP
FT                   VKLTRGPSVMTANGLIFNNVTREVQLLGNVRGTIITGPSPGRAPGS"
FT   gene            complement(334795..335811)
FT                   /gene="kdsD"
FT                   /locus_tag="RALTA_A0335"
FT   CDS_pept        complement(334795..335811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsD"
FT                   /locus_tag="RALTA_A0335"
FT                   /product="Arabinose-5-phosphate isomerase"
FT                   /function="3.1.4 : Regulation level unknown"
FT                   /function="6.7 : Capsule (M and K antigens)"
FT                   /EC_number="5.3.1.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12805358; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63004"
FT                   /db_xref="GOA:B2AGV5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63004.1"
FT                   /translation="MRSHSLVYFVAMIANFDADRALRLARDTLQTEADAVSALSGRLNG
FT                   DFAHAVQLILQCTGRVVVSGIGKSGHIGRKVAATLASTGTPAFFVHPAEASHGDLGMVT
FT                   RDDVLIAFSNSGETGELLSIIPIVKRIGARLISVTGNPDSNLAKLADVHLDAAVEKEAC
FT                   PLNLAPTASTTAALALGDALAVAVLDARGFGEEDFARSHPGGALGRKLLTHVRDVMRTG
FT                   NAVPEVRESTPLAQALMEITRKGMAMTAVVDPDGRAIGVFTDGDLRRLLETPRDWKTVP
FT                   IGEVMHRNPHVVNQDQLAVEAVQVMEANRINQLLVVDDDGRLAGALHIHDLTRAKVI"
FT   gene            335922..337901
FT                   /locus_tag="RALTA_A0336"
FT   CDS_pept        335922..337901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0336"
FT                   /product="GLUTATHIONE-REGULATED POTASSIUM-EFFLUX SYSTEM
FT                   K+/H+ ANTIPORTER TRANSMEMBRANE PROTEIN"
FT                   /function="4.2.A.37 : The Monovalent Cation:Proton
FT                   Antiporter-2 (CPA2) Family"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63005"
FT                   /db_xref="GOA:B2AGV6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63005.1"
FT                   /translation="MHSPLELTLVLLAAAVFGVVGFRMLQLPPMLGYLAVGILIGPHAL
FT                   GLASDTAQTKYLAEFGVVFLMFSIGLEFSLAKLRAMKRLVFGLGGSQVVLSMLAVVPAS
FT                   WAFNWLFPLSWQASVALGGALAMSSTAIVSKMLSERMELESEHGRNIISILLFQDLAVV
FT                   PLLIVIPALSRDPGDLMMALGLATLKIVVALGVIFFLGQRLMSRWFHVVAARRSQELFM
FT                   LNLLLVTLGMAALTERLGLSMALGAFMAGMLISETPYRHQVEEDIKPFRDVLLGLFFVT
FT                   IGMLLNIRVVLDHLWLVLALLVVPVLFKLVLIAALARVFGSRQGVAIRTGLGLAQAGEF
FT                   GFVLLNQIDGLNLVDPVLIQVILASMLLSMLAAPFLIQYSDAIVLRFAANEWLMQSLNM
FT                   TRIAAQSLQTEKHAIICGFGRSGQNLAHMLEREGINYVALDLDPDRVREAAAAGDTVVY
FT                   GDAGRREALIAAGIHRAAALIVTYANTPSALKVLHHVQELAPALPVIVRTVDDSELDTL
FT                   QKAGATEVVPEIIEGSLMLASHALVLLGVPMRRVVRGVQQARDARYSLLRGYFHGRDDE
FT                   EDMVERDSVRLHSVSLGPQSTAVGRRLGVLGLERIGVEVTAVRRRGIRAFDPQPETVLE
FT                   PGDIVVLRGPPEALEAAETRILNG"
FT   gene            complement(337949..338323)
FT                   /locus_tag="RALTA_A0337"
FT   CDS_pept        complement(337949..338323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63006"
FT                   /db_xref="InterPro:IPR027373"
FT                   /db_xref="InterPro:IPR038268"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63006.1"
FT                   /translation="MCEIFIRANPASYQSQSRSLRLHGAATSIRLESLFWEVLEELAQR
FT                   DGMTVNQLITRLHDELTEHRGSEAVAGNFSSFLRVCCLRYLMLQGEGRIPADRDVPIRS
FT                   LDARAVLDNLPESWVEPRPH"
FT   gene            complement(338423..339001)
FT                   /locus_tag="RALTA_A0338"
FT   CDS_pept        complement(338423..339001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0338"
FT                   /product="conserved hypothetical protein; putative
FT                   peptidase, type 1 glutamine amidotransferase (GATase1)-like
FT                   domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63007"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63007.1"
FT                   /translation="MAKKILMLVGDYAEDYETMVPFQALQMVGHAVHAVCPDKRAGDAC
FT                   ATAIHDFEGDQTYSEKRGHNFTLNATFAEIDPASYDALVIPGGRAPEYLRLNARVLEIV
FT                   RHFAQAGKPIAAVCHGAQLLAAAGVLEGKTCSAYPACAPEVKLAGGTYAEIPVDQAHTD
FT                   GNLVTAPAWPAHPAWLAQFLAVLGTRVVH"
FT   gene            339196..339768
FT                   /gene="apt"
FT                   /locus_tag="RALTA_A0339"
FT   CDS_pept        339196..339768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="RALTA_A0339"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /function="1.7.33 : Nucleotide and nucleoside conversions"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.4.2.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63008"
FT                   /db_xref="GOA:B2AGV9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63008.1"
FT                   /translation="MADSIIQSPDLGDVTGYLRERIRTVPDWPQPGVMFRDITPLLQDP
FT                   KTLRVLIDVFVHRYMDAQLDLVAGIDARGFILGAIVAYELNLGFVPIRKKGKLPFQTVA
FT                   EEYELEYGSATVEIHADACKTGDRVLLVDDLIATGGTMMAGRKLLERLGATVVEGAAIV
FT                   DLPELGGSKLLHGAGLPLFTVCKFEGH"
FT   gene            339809..340420
FT                   /locus_tag="RALTA_A0340"
FT   CDS_pept        339809..340420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0340"
FT                   /product="putative lysis exporter"
FT                   /function="4.2.A.75 : The L-lysine exporter (LysE) family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63009"
FT                   /db_xref="GOA:B2AGW0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63009.1"
FT                   /translation="MPDLLLFLLTSVAVTVAPGPDNLQVLARGMAQGRRAGLVAALGFS
FT                   VGCLFHTVIAAVGLAAVLRSSPLAFQLIKYAGAAYLIWIGIQALRAKGGLAQGGAVEAV
FT                   PLARVFRQSVLGNMLNPKVTLFFLVFLPQFVRADAAHPGLQFLLLGVVFMLQTAVVFSL
FT                   FGLCAGWLGAWLRRRPATGRWLDRAAGAIFVGLGIKVALP"
FT   gene            340603..342282
FT                   /locus_tag="RALTA_A0341"
FT   CDS_pept        340603..342282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0341"
FT                   /product="putative transport protein (PNaS
FT                   family)/regulator/enzyme"
FT                   /function="4.2.A.58 : The Phosphate:Na+ Symporter (PNaS)
FT                   Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63010"
FT                   /db_xref="GOA:B2AGW1"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63010.1"
FT                   /translation="MGVLLHLLSGVALLVWGTNIVKVGILRVYGANLRHVLSTSVSNRF
FT                   TAFLAGLGVTGLVQSSNATAVIVSSFVGQGLIAVAPALAIMLGANVGTALMVQVFSLDL
FT                   SWLSPLLIFVGVICHLTWKGSKPGHVGRVLIGLGLITLALELISIATRPVVQAAGVKVL
FT                   FASLTGDAGLDMLVGAFLTILCYSSLAVVLFCGALASAGVVSIHVALALVLGANLGSGV
FT                   SALLTTSGNNQPGKRVTLGNLLSRLLGCLIALPLLGQAEELLALVDHEPQRLIVNFHLL
FT                   FNVALAVLLLGATAPLARLCEKVLPGRNTGDSQVTPRHLDPAALSTPTLALSNAAREVL
FT                   RIGDRVEQMLDNMLRVMRTNDAKLATATCRIDNEVDDLYTAIKLYLTRISLEALDERDG
FT                   QRWTEIISLTINLEHAGDIIERILLDTKDKKIAHNLMFSEAGMQEIAEMHARLVANLRL
FT                   GLSVFLNGDLKSAQALMAEKANFRELERKYARTHLQRVAVQTAESVETSSLHLDVISEL
FT                   KRLNSLFCATAYPVLEQAGVLNRSRMKEDDVAPVTSVQAAQH"
FT   gene            complement(342292..342777)
FT                   /locus_tag="RALTA_A0342"
FT   CDS_pept        complement(342292..342777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0342"
FT                   /product="conserved hypothetical protein, DUF355"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63011"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63011.1"
FT                   /translation="MELTVVPVTKPEATNFIFGQSHFIKTVEDLHEALVGTVPGIRFGL
FT                   AFCEASGKRLVRWSGTDEPLIDMACENARAIGAGHSFLIFLGDGFFPVNVLGAVRAVPE
FT                   VCRIYCATANPTQVIVAQTDAGRGVVGVIDGASPLGIETEADVAERKALLRKFGYKL"
FT   gene            342893..343486
FT                   /locus_tag="RALTA_A0343"
FT   CDS_pept        342893..343486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0343"
FT                   /product="putative Phosphoglycerate
FT                   mutase/bisphosphoglycerate mutase"
FT                   /function="1 : Metabolism"
FT                   /EC_number="5.4.2.1"
FT                   /EC_number="5.4.2.4"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63012"
FT                   /db_xref="GOA:B2AGW3"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63012.1"
FT                   /translation="MPAFFRWLAVLAIAPTLAAAQVAPASQHEVALTELRHPNVVVVLR
FT                   HASAPGVGDPPGFRLADCATQRNLDARGREQAARLGASWKAAGFRPTQVWSSAWCRCQD
FT                   TARLIGLGPVQVQPLLNSFFGGDAQRRDAQVAQLSRLIDGLDPRGGPYLMVTHQVVITA
FT                   LTGHGADSGGGVVIELPHGGAARRTRVLPAAGLD"
FT   gene            complement(343514..346378)
FT                   /gene="uvrA1"
FT                   /locus_tag="RALTA_A0344"
FT   CDS_pept        complement(343514..346378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA1"
FT                   /locus_tag="RALTA_A0344"
FT                   /product="ATPase and DNA damage recognition protein of
FT                   nucleotide excision repair excinuclease UvrABC"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="5.6.1 : Radiation"
FT                   /function="5.8 : SOS response"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11421287, 16829526; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63013"
FT                   /db_xref="GOA:B2AGW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63013.1"
FT                   /translation="MEEIKIRGARTHNLKNINLDLPRNRLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLYARAGTPYCPDHNLPLQAQSVSQMVDAALALPEDTRLMILAPVVVDRKGEHS
FT                   DLFDSMQAQGFVRFRIRSGGGTAHEAEAKVYEVDQLPKLKKTEKHSIDVVVDRVKVRAD
FT                   IKQRLAESFETALRLADGRALALEMDSGKEHTFSSRFACPICSYSLQELEPRLFSFNNP
FT                   MGACPSCDGLGQITFFDPKRVVAFPNLSLASGAIKGWDRRNQFYFQMLQSLAAYYDFDT
FT                   DTAFEDLPETVQQVVLHGSGEQEIPFTYINERGRATVREHVFEGIIPNLERRYRETDSV
FT                   AVREELAKYQNNQPCPACHGTRLRTEARHVKLGEGEQARAIFEINGWPLRDALTYFLTL
FT                   DMHGAKREIADKIVKEITARLNFLNNVGLDYLSLERSADTLSGGEAQRIRLASQIGSGL
FT                   TGVMYVLDEPSIGLHQRDNDRLIGTLKHLRDIGNSVLVVEHDEDMIRACDYVVDIGPGA
FT                   GVHGGMIVAEGTPRQIEASPASLTGQYLSGQRRIEVPKQRTAPDDERLLRIVNASGNNL
FT                   RNVTAEVPVGLLTCITGVSGSGKSTLINDTLYHAVARHLYGSTPEPAQHDRIEGLEHFD
FT                   KVINVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPSAKERGYDPGRFSFNVKGGRCES
FT                   CQGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLEVLYKGKNISEVLDLTVEQAHEFFS
FT                   AVPVVRRKLQTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELSKRDTGRTLYILDEPT
FT                   TGLHFHDIELLLKVIHKLRDQGNTVVIIEHNLDVIKTADWLIDMGPEGGAGGGQVIARG
FT                   TPEAVAKSKASFTGKYLAPLLKRA"
FT   gene            346607..347857
FT                   /locus_tag="RALTA_A0345"
FT   CDS_pept        346607..347857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0345"
FT                   /product="putative transporter, MFS family"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63014"
FT                   /db_xref="GOA:B2AGW5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63014.1"
FT                   /translation="MPSIPSSSPETGAADASQAPARERMTRAELRAAVSLASIFALRML
FT                   GLFLILPVFAEYARTLADGQDAQRVGLAMGIYGLMQAFLHIPLGWLSDRVGRKPVMVGG
FT                   LLLFIAGGLVAAFSDTLSGIIAGRALQGMGAISAAITACIADLTRERHRTKAMAMVGGS
FT                   IGLTFALSLVIASPLLHSIGMSGIFGLMSVLGLVAIGVTVFLVPTPPPPHPVRLPFRKV
FT                   LLNGDLARLNVGVLALHASQVAMFMVVPAMLADAGMPLDQHWKVYLPVVLVSFVLMLGP
FT                   MMAAERYGRVRPVLLGAVALMTAVQLLFAAVHGLWAIVGVLLLFFVAFNVLEAMQPSLV
FT                   SRYAAAARGAALGVYNTTQALGLFLGGAAGGWLLEHEGRSAVFVGCAAVLLLWLIIAWS
FT                   MKAPPARGQEAVPATAA"
FT   gene            348060..348596
FT                   /gene="ssb1"
FT                   /locus_tag="RALTA_A0346"
FT   CDS_pept        348060..348596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb1"
FT                   /locus_tag="RALTA_A0346"
FT                   /product="ssDNA-binding protein, controls activity of
FT                   RecBCD nuclease"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="5.8 : SOS response"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9735287; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63015"
FT                   /db_xref="GOA:B2AGW6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63015.1"
FT                   /translation="MASVNKVILVGNLGADPETRYMPSGDAVTNLRLATTDRYKDKQSG
FT                   EMKEATEWHRVAMFGKLAEIAAQYLRKGSSVYIEGRIRTRKWQDQSGQDKYSTEIVADQ
FT                   MQMLGSRQGGGGGGGDEGGYGGGGGGGYSRESSGGGYGGGRGAQGGGGQQGGAARRPQQ
FT                   PASNGFEDMDDDIPF"
FT   gene            348860..349906
FT                   /locus_tag="RALTA_A0347"
FT   CDS_pept        348860..349906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0347"
FT                   /product="putative OUTER MEMBRANE PORIN"
FT                   /function="4.1.B : Beta barrel porins (The Outer Membrane
FT                   Porin (OMP) Functional Superfamily)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63016"
FT                   /db_xref="GOA:B2AGW7"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63016.1"
FT                   /translation="MPVAMAGMVAGMACGVTGPVRAQPAASVSVYGLIDTMVRYSDNNR
FT                   GDERLAELSEGYFSGSRWGMRGTEALGGGWAALFTLESGFDLASGNSLQGTAISNYGQV
FT                   GTQGAGRLFGRQSYLGVEHQAWGKLTFGRQFTTAYDATFRFQPYGHPNLDAVAILNGYT
FT                   GPRQDNMVKYAGRLGALSAAAHYTFGEAPGDARAGSSRGLALAWTTARIDVGALLQRTD
FT                   ALPTAEARTIWGIGGSSQLGRVKLALGYLDHRYRLAPTRNHVLTGGATLQATPALALSL
FT                   AAGYDRQTAASGHRLMLTGVAEYALSRRTSVYAEADFNRISGAYALPAFMGVRGNKFGG
FT                   GVGLRHRL"
FT   gene            349943..350914
FT                   /locus_tag="RALTA_A0348"
FT   CDS_pept        349943..350914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0348"
FT                   /product="conserved hypothetical protein, UPF0065"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12562821"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63017"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63017.1"
FT                   /translation="MARLLALPALPALAAMPAQAERGAAWPRHPVRLVVTFPPGGSSDI
FT                   VARLLAPLLQERLGQPFVTDNRPGAGSTIGAAAVAAAPNDGYTLLMSNSAALSISPFLL
FT                   RRPSYDPVHSFTHVHYIGAVPMVFAVHPSVPARSLAELAAWIRAQRDPVPFGSGGAASV
FT                   AHIVGELFAQQAGLKLTHVPYKGAGPMRTDLLGGQIPFAVDALPQNLPFLQSGDLRLLA
FT                   VTSARRVPQAPRLPTVGQAGYPGLVAENFVGVSAPANLPEDIVQRLHQSLQGILQQPAV
FT                   RGHLEAQGFVLAERRPEAFAAYVRQQVQAWGPVVAATGATLS"
FT   gene            350911..351861
FT                   /locus_tag="RALTA_A0349"
FT   CDS_pept        350911..351861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0349"
FT                   /product="conserved hypothetical protein, Basic membrane
FT                   lipoprotein motif"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63018"
FT                   /db_xref="GOA:B2AGW9"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63018.1"
FT                   /translation="MSARIQVVLFGPEGRGSFNEAGHAGAVRARDAGHDVAVAWIADPD
FT                   PQARAAALLALCESEPDLVVAHGGQGDYPVAVAAARHPLRRFVVTQGSVLCANTASYAV
FT                   LQEQSAFLAGVLAATDSRTGVVAHLSGEKVRPGLKGRAAFLHGVRSTMPGATALTTFCG
FT                   NQHDPELASRAVTAQARAGADIVFAMIDGGRDGAIAACRASGIRQIGNVLDWTRRHPEV
FT                   FLASAVADSGLCVEHAIADFARDRIAWGAAREFGLETPAAVRLALGRDVSQAARVALDH
FT                   WSQRLLDGSVAVEEDYAGPEFETGTPASAQASQYR"
FT   gene            complement(351879..353051)
FT                   /locus_tag="RALTA_A0350"
FT   CDS_pept        complement(351879..353051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0350"
FT                   /product="putative diguanylate cyclase (GGDEF domain)"
FT                   /function="1.7.33 : Nucleotide and nucleoside conversions"
FT                   /function="3 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63019"
FT                   /db_xref="GOA:B2AGX0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63019.1"
FT                   /translation="MLHDAGRFLALVNPAIALLLALCFLFAWHHERTRPHLLQLGACYL
FT                   LAAAAIGLQVLWPPRAGGGPATIAGALYLGSAALLLHGMLARIGARPDRCAGVALPLAL
FT                   FGMVAWFDLVHPSLVARIYVLNVGVALILLPGVASLAPLRTGRTVDRVLLWVFVVFALQ
FT                   FLPRTLLALAPGTAHDAAALLPTPCWLWLQATLALLLLALGLALLAATAQDVIDDLRHE
FT                   RDTDPLTQLHTRRSLEALAARQIPPRPGEKLSVLLCDLDYFKFINDNYGHSAGDAVLTQ
FT                   VGRIIAAGIRRRDIAARLGGEEFVVLLPDTPHEAALQLAERLRQTLEQTSMDVLPGMGN
FT                   VTASFGVATLRPGEDLEALLMRADNVLYAAKNNGRNCVEWEREAGVPALV"
FT   gene            353448..353786
FT                   /locus_tag="RALTA_A0351"
FT   CDS_pept        353448..353786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0351"
FT                   /product="conserved hypothetical protein; putative
FT                   transmembrane protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63020"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63020.1"
FT                   /translation="MKTKKAMPVLLLAASVLAAPFAMAQGGARSKPMTDPMAASAPAAQ
FT                   NSPYMQVQQWKKGDRLPTEFRDRQYVIDDYKQYNLPAPRKGTRWVGIGAEYYLVAPNGV
FT                   IQQVGSGS"
FT   gene            complement(353870..354118)
FT                   /locus_tag="RALTA_A0352"
FT   CDS_pept        complement(353870..354118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63021"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63021.1"
FT                   /translation="MRKFLPMVTAIVLCGATGMAFAHNCPNEMKAIDAKLSTKPALSPE
FT                   DAAKVSKLRADGEAYHKAGKHDESMKSLLEAKKILGI"
FT   gene            354546..355043
FT                   /locus_tag="RALTA_A0353"
FT   CDS_pept        354546..355043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0353"
FT                   /product="putative K+ transport system component"
FT                   /function="4.1.A.1. : The Voltage-gated Ion Channel (VIC)
FT                   Superfamily"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63022"
FT                   /db_xref="GOA:B2AGX3"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63022.1"
FT                   /translation="METSAEHYSLALLCTAVLTVTVVGIHYEALRLLSAMHPRRWSGRM
FT                   NIGVLIVCIILVHCLEALVFAVGFWFADRVLGLGGLASVAVPGVEAARAQPGALRYAYF
FT                   ALETFTTQSLGDIVPVGATRLIASIEPLVGLILIGWSTSFTYVMMRRDWELDDEGGRHR
FT                   RG"
FT   gene            355150..356622
FT                   /locus_tag="RALTA_A0354"
FT   CDS_pept        355150..356622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0354"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63023"
FT                   /db_xref="GOA:B2AGX4"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63023.1"
FT                   /translation="MARLVMILLGVDYLRARWRGLLWLGCASVLLGLVVFVDALDNAIY
FT                   FPMTPFAVVLLLEGLATLVVARSGIGGQRTLRQVKGVSFCLAALLILAGHHHGHFVLSM
FT                   IFGTLFLADGLLQIVSARVVRFRTWRLAVAVGVFEILVAIFFYQPYPTHYVGTVPYCLG
FT                   LGLIFGGWNLLLLASRLRRLDHNPGMDPADASPAPAPAYTAHALHAAGGAPELTLWDGP
FT                   PGPGEHALTVHVWTPVGSARGEARRQPLVDRYIAAVDRDGVISTGHAALESPEGIYISL
FT                   YPAEEIDRSPHEFTRILRATRENDVAGKFQPDYETEARAWCPSTVQVRIRNYDPERLRR
FT                   FWEAYRQDTTYNLTYRNCSSTVSHALEAALEGASARVWRQARGWRPLWRLLATPELWVA
FT                   AQIRKRAKTMAWTPGLTLDYARALSMLADPRPSGWASMTRMALGQMRRQRQDWREAAHT
FT                   AQGADAGAGEGAAAGTVAGAANAGSARPRGND"
FT   gene            356671..357030
FT                   /locus_tag="RALTA_A0355"
FT   CDS_pept        356671..357030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0355"
FT                   /product="putative lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63024"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63024.1"
FT                   /translation="MPRRQRILNRIAALVALGALAVACGAHAQRQDQGGAAAAINEAVQ
FT                   EGSSPYRPDPSATPASVRSDECRALAEQIAQAPKRTYRATEPTIETAQGRKVPELERDR
FT                   PRKSLQQAYQEKCTQ"
FT   gene            complement(357074..357925)
FT                   /locus_tag="RALTA_A0356"
FT   CDS_pept        complement(357074..357925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0356"
FT                   /product="putative transcriptional regulator, RpiR and
FT                   Sugar isomerase (SIS) domains"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63025"
FT                   /db_xref="GOA:B2AGX6"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63025.1"
FT                   /translation="MLEMLRRGFPSLSTQFQGGARYLLDHPQDVPVLSMRKIAASAGVQ
FT                   PATLVRLSQHLGFDGWQAMRELFVDALRGGTQPYARRARKVVRESSASRMLDEMLETQH
FT                   RNLDRIAASNEKTLPQAAELLSHAACVHVAGFRSCFPIAFTFHYVYRLFRSTVHLIRAD
FT                   AGTLEMELRGLAPKDAVVVVSFAPYSQESIRVAEAARECGCKVIALTDSTVAPIALAAD
FT                   CTLLFSVESPSFFPSITAGVAVVEALVEQLLARKGKGAIRALEQAEGELHRTGAYVTPG
FT                   HS"
FT   gene            358428..358844
FT                   /locus_tag="RALTA_A0357"
FT   CDS_pept        358428..358844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0357"
FT                   /product="putative TYPE 4 FIMBRIAL BIOGENESIS TRANSMEMBRANE
FT                   PROTEIN, pilE family"
FT                   /function="4.3.A.7 : The Type IV (Conjugal DNA-Protein
FT                   Transfer) Secretory Pathway (IVSP) Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63026"
FT                   /db_xref="GOA:B2AGX7"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63026.1"
FT                   /translation="MPCRGRPPHGFTLIEVMITVAVIAILAAVAIPNYSRYVVRSNRAA
FT                   IESFMLEVAGAQERFLVDNRAYAATLGALGMSVPAGLATRYDVTVTPNAALPPGYRIVA
FT                   TPRGSQLSDTDCGTLTLTSAGAKSASGAGTDCWN"
FT   gene            358847..359341
FT                   /locus_tag="RALTA_A0358"
FT   CDS_pept        358847..359341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0358"
FT                   /product="putative TYPE 4 FIMBRIAL PILIN RELATED
FT                   TRANSMEMBRANE PROTEIN, pilE family"
FT                   /function="4.3.A.7 : The Type IV (Conjugal DNA-Protein
FT                   Transfer) Secretory Pathway (IVSP) Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63027"
FT                   /db_xref="GOA:B2AGX8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63027.1"
FT                   /translation="MRPTPAHAHDRRLSAWRGFTLIELLCALSVLAILAVAAAPSFAAL
FT                   LAGQRVRSASLDLASALVLARSEAVKRNATVSLAPTGAAWTAGWTVSAGAETVRSFGPY
FT                   GGLTITPSAAGGLALGNDGRLTGAAMTFELAPSGDTGATARVCVQVSETGRIASTNGAC
FT                   T"
FT   gene            359338..359970
FT                   /locus_tag="RALTA_A0359"
FT   CDS_pept        359338..359970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0359"
FT                   /product="putative TYPE 4 FIMBRIAL BIOGENESIS RELATED
FT                   TRANSMEMBRANE PROTEIN, pilE family"
FT                   /function="4.3.A.7 : The Type IV (Conjugal DNA-Protein
FT                   Transfer) Secretory Pathway (IVSP) Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63028"
FT                   /db_xref="GOA:B2AGX9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63028.1"
FT                   /translation="MTRIASRIPSPRRRLPVRRAQGGFLLIEVLVAVVILLVALLGTAG
FT                   LVARSGQTEMESYQRVQALALLQDMAARLNANRQVAACYANGAAGMQLGSAAAPPAACT
FT                   QGSAAQNATADADLQAWNAALLGSAEKRPGASAADPAQAVGAMIGARGCIETVDAVNQV
FT                   YRITVAWQGLATTGAPALGCGKDQYGNDAYRRAVSTQIRIGTLGTVS"
FT   gene            359967..361031
FT                   /locus_tag="RALTA_A0360"
FT   CDS_pept        359967..361031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0360"
FT                   /product="putative TYPE 4 FIMBRIAL BIOGENESIS PROTEIN
FT                   TRANSMEMBRANE"
FT                   /function="4.3.A.7 : The Type IV (Conjugal DNA-Protein
FT                   Transfer) Secretory Pathway (IVSP) Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63029"
FT                   /db_xref="GOA:B2AGY0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63029.1"
FT                   /translation="MTAPRIAVPAFRRGATRLRRQRGISLIELMIGITIGLVLLTALAG
FT                   LYYANSLSRTEFAKAAEQVENGRYALEQIRREVELAGFFGVGNIARGNKAAEPALCATD
FT                   PAALGFSPTAETVPLALTGYAPGVAAPCLPDLAATSEVLVVRRVSTTPVAAPAPGSAYL
FT                   QVSACSQDAQNFVFDASGAAAFGLRTKACDAAQPAELRRAMVRIFYLAGCDRCSNGGDG
FT                   IPTLKMAELVNGAFQSRSVAQGVQDMHVQYGVDQDGNGSADCYVTDPRANNSGVCTAVP
FT                   GYDWGVAINNLANVTTVRVHLLARTLKPSGGHTDNRTYEIGRAVAAGPFNDGYKRHVYA
FT                   QVARLVNVAGLREQ"
FT   gene            361028..361618
FT                   /locus_tag="RALTA_A0361"
FT   CDS_pept        361028..361618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0361"
FT                   /product="putative pilin biogenesis TRANSMEMBRANE PROTEIN
FT                   (pilin operon)"
FT                   /function="4.3.A.7 : The Type IV (Conjugal DNA-Protein
FT                   Transfer) Secretory Pathway (IVSP) Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63030"
FT                   /db_xref="GOA:B2AGY1"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63030.1"
FT                   /translation="MTPYRHHTAMRTTIKSTGGALRRSQSGVTLVVTLVFMVMFLMIAV
FT                   AMVNSGLINVKVASNQQHSAEARDVAQQAIEQVISDDFTKAPVAVDVPVDVTGDGTADY
FT                   VAQVAVPACVTSKPVAKVIDPEKHPEDAECTLGSSTGNGNLVVGPGGANVVSSLCNDTQ
FT                   WDVAATVNDANTGTVATVHQGVAVRTLYGSTCP"
FT   gene            361661..364930
FT                   /locus_tag="RALTA_A0362"
FT   CDS_pept        361661..364930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0362"
FT                   /product="TYPE 4 FIMBRIAL BIOGENESIS PILY1-RELATED PROTEIN;
FT                   SIGNAL PEPTIDE"
FT                   /function="6.5 : Pilus"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63031"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63031.1"
FT                   /translation="MSMSARRLRAYAACATALFGLAAAPAAQAEDIDLFTGLQANAGAR
FT                   PNVLLILDNASAWNANAQVDCETPGVVGPNNLNNNVGAEQCALYKAVSDLIRDPNTTGK
FT                   INLGVMMFGGSNNTGAQFRFPSVTPPTAPSGLVLLDQAGGEQMLAFIKSIDRTKDSSNN
FT                   SQVGGAMQEAWAFFSGKTGLSGTTYKSPISNPCQKNFIIYIANALNNGKPQDTGQDAYN
FT                   KLREAGATAAQLTPIPLSRGNNIDNWGDEWARFLNGMDLNAANNAGSVTATRQNIITYT
FT                   IGVTDGSKQSLDYLEFVNSMATKGGGGNFTVRAGDDDALAKALKDIFNEMQAVNNVFAS
FT                   VSLPVSVNGQGSYLNQVYIGMFRPDGKARPRWVGNLKQYKLGYDTNGNLVMLDAGVPGG
FT                   TDQTSKSAISNAGTGFISPNARSYWTEDPPKQVASSSIVTDWPADGFWKNASAQLRNAK
FT                   DAPDGEIVEKGGAGEMLRADYLTSQGARRLLTCADAKCTKGTPLAAFSAANKALTEGNG
FT                   PSLLKTTAADVANMIDWVRGKDVFAALTGTDPKKEAEPGPGGNVTVRGSIHGDVLHSRP
FT                   VVVDYGGSTGVVVFYGANDGVFHAVNGNRTGAISTGAGQVRAGGELWGFVAPEFYGKLA
FT                   RLYNNAPEVRLTGSPQDTAEVQFTPRDYFFDGTTTVYQNLSNPAAPQVTIYLTARRGGR
FT                   LVYALDVSDPAQPKYLWSKTSADIPELGQTWSQPRVMRVRGYSTPVLIMGAGYDPDGED
FT                   SDPALGGEPTAANKQGRGVLVLDAATGNVVWAALGSCAGITTGTCVTIDSRAIPSDVAV
FT                   VDRNGDGYADKAYVGDVGGNVWRIDFGALETDVPSTWTVGKLAQLGGAVNTNDARKFLY
FT                   PPDVVATGKYDAVMIASGDREKPLYSLSQTPGAAQNVRNRFFMVKDTNVDGRLPSTWTA
FT                   VKAADLVDATSVAYRDSAVASGFYLSLEFGEKAVNAPLTVAGYTYFGTNTPSKVQPGAC
FT                   YPDLGVARGYAVSFLTGLGMNNGPRYVTFDNGGLPPSPVFGMVSVTQADGSTRLVPVLI
FT                   GGGKAGGTGGDDKSSLGGQEVKPASAGKRKRTYWYTQSDKT"
FT   gene            complement(364961..366445)
FT                   /locus_tag="RALTA_A0363"
FT   CDS_pept        complement(364961..366445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0363"
FT                   /product="putative Outer membrane efflux protein"
FT                   /function="4.2.A.6 : The Resistance-Nodulation-Cell
FT                   Division (RND) Superfamily"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63032"
FT                   /db_xref="GOA:B2AGY3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63032.1"
FT                   /translation="MQRLTSLFAAALLCGCAVGPDFRVPAPPDDAGYVPGPQPVATVAA
FT                   DGADAPGQAHAQTLAAGADVPAQWWTLFRSPALDATIRSALAASPTLAQARARLLEAQE
FT                   NLAARTGATRWPAIDAKLDTSRQQVDFQSLGITAIPSPGPFTLYGATVQVSYALDLFGG
FT                   QRRELEGLQAVVDYQRYELEAARLALAANVATAAIREAGLRAQLSDTAAMVAAQQRQLG
FT                   ITEARLREGGVARVELQRRRAELAQTRALVPALQRQLDATRHQLAVYTGQTPASAALPE
FT                   FHLDALHLPDTLPVSLPATLARRRPDIRAAEALLHQASANIGVATANLYPQVTLSASGG
FT                   TQATAARDLFSSLNVWSLAAGLVQPVFRGGELQARKRAAEAAYEQSLAAYRQAVLQGLQ
FT                   DVADALRALEADAAALRERADGARQARDTLAVVSEQYRLGGVSQLALLDAERQSRQAAL
FT                   ELAQARADRLADSAALLQALGGGWWEEDAAMASAPR"
FT   gene            complement(366457..367614)
FT                   /locus_tag="RALTA_A0364"
FT   CDS_pept        complement(366457..367614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0364"
FT                   /product="putative ABC-2 transporter, membrane + ATP
FT                   binding component"
FT                   /function="4.3.A.1.am : ATP binding and membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63033"
FT                   /db_xref="GOA:B2AGY4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63033.1"
FT                   /translation="MTPATASASARFSLQRWWSIVLKEFLQLRRDRVTFGMIVGLPIMQ
FT                   LLLFGFAINTDPRQLPTAVIAADQSEFTRSFIASMEQSTYFKLVGTLPDERAGREALMK
FT                   GEVQFVLTIPPDFTRRLLRGERPALLVEADATDPSATGQAIAALPQLPYRVATHDLKGA
FT                   LAPLAGGRPPFDVQVQRLYNPEGITQYNIVPGLMGVILTMTMVMMTGLAMTRERERGTM
FT                   ENLLATPVRPLEVMTGKIVPYIFIGLIQSTIVLLAARWIFSVPFVGSVLAVYLAALLFI
FT                   AANLTVGITLSSLAQNQLQAMQLTFFYFLPNILLSGFMFPFAGMPGWAQAIGNILPMTY
FT                   FHRMVRGILLKGNGWFELWPNLWPMALFIVVVMAIAVRFYRRTLD"
FT   gene            complement(367611..368576)
FT                   /locus_tag="RALTA_A0365"
FT   CDS_pept        complement(367611..368576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0365"
FT                   /product="putative ABC TRANSPORTER, ATP-BINDING component"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63034"
FT                   /db_xref="GOA:B2AGY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63034.1"
FT                   /translation="MNATANGTSLGLAIDVRGLNKHFGDKHVVNDLSMQVARGEIFGFL
FT                   GPNGSGKTTSIRMMCGLLTPDSGAGTCLGFDILTESDEIKRRVGYMTQKFSYWDDLSIR
FT                   ENLDFVARVYGMPNRREAVDRALEDLGLATRSAQLAGALSGGWKQRLALAACLLHEPEL
FT                   LLLDEPTAGVDPKARRDFWEQLHQLAARGISVLVSTHYMDEAERCHKLAYIAYGRLLAQ
FT                   GTADEVVASQRLSTWSVEGADLAALSAQLQGAPGVEQTVAFGTALHVTGRDAQALAETL
FT                   ARLAGPGRRIEQARTSLEDVFIHMMSGAEDNMARKTREAP"
FT   gene            complement(368573..369562)
FT                   /locus_tag="RALTA_A0366"
FT   CDS_pept        complement(368573..369562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0366"
FT                   /product="putative biotinyl/lipoyl-carrier protein"
FT                   /function="1.6.15.4 : Acyl carrier protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63035"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63035.1"
FT                   /translation="MNHAVFPACPRPRAVLRGTALLGAALLAAACGNARIDTWQGYVEG
FT                   EFVSVASPFAGRLDTLSVQRGQQVAQGAALFALEADDERAARQQAADQLRAAEATLQDL
FT                   KTGKRPLEVEVSRAQLAQAQAQAQRSAAAWRRDQRQYEIGGIAQAQLDESRAQAGSDAA
FT                   RVRELQRDIDVARLPGRDAQQAAQAAQVAAARAALAQAEWKLSRKTVAATQAGLVYDVP
FT                   YRLGEWVPAGSPVVRMLPPGNVKVRFYVPETVVGALRNGQAVQVRCDGCAAPVAATISY
FT                   VANEAEYTPPVIYSNETRRKLVFLVEARPSAADAPRLRPGQPVEVVRQ"
FT   gene            complement(369559..370290)
FT                   /locus_tag="RALTA_A0367"
FT   CDS_pept        complement(369559..370290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0367"
FT                   /product="putative transcriptional regulator, tetR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63036"
FT                   /db_xref="GOA:B2AGY7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63036.1"
FT                   /translation="MPRKPAPTKPPRRSPGRPAAGQPGQRERILDAATELFSRQGVAGT
FT                   PVKAIATSAGVTPALVHYYFGDRDLLLDAVIEEKVQPLVARFFAGSPSDDEPLAMLVGI
FT                   ATRLIHAVTGAPWFPGLWIREVASDDGALRERVLRRFALERAGALMAPLAAAIGRGQLN
FT                   PGLEPALVVPSLVGLALLPLATTHIWRRLPGAEAVDTDALVRHVTALLTHGLSPAPASP
FT                   KTPAGAARPKGRTARHSPESA"
FT   gene            complement(370545..371378)
FT                   /gene="queF"
FT                   /locus_tag="RALTA_A0368"
FT   CDS_pept        complement(370545..371378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queF"
FT                   /locus_tag="RALTA_A0368"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /function="1.5.2 : Nucleotide"
FT                   /function="2.2.5 : tRNA"
FT                   /EC_number="1.7.1.13"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63037"
FT                   /db_xref="GOA:B2AGY8"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AGY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63037.1"
FT                   /translation="MSLPEHSPLGKPSAYKTEYDASLLFPIPRQPKRTEIGLPEGKPVP
FT                   FFGVDIWNAYELSWLNLKGKPQVALATFIIPSDTPNIVESKSFKLYLNSFNQTRIASPE
FT                   ALQQLLHHDLSEATGGTVQVRLVTEADLGKQQMGELDGLLLDRLDIEVDRYEPAPELLF
FT                   ADQDETPVEETLVSHLLKSNCLVTGQPDWGSVQIRYVGAPINQEALLKYLISFRNHNEF
FT                   HEQCVERIFMDVMRQCKPVKLAVYARYTRRGGLDINPFRTNFNTAWPDNKRNARQ"
FT   gene            complement(371408..372946)
FT                   /gene="ilvA"
FT                   /locus_tag="RALTA_A0369"
FT   CDS_pept        complement(371408..372946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="RALTA_A0369"
FT                   /product="threonine deaminase"
FT                   /function="1.5.1.18 : Isoleucine/valine"
FT                   /EC_number="4.3.1.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63038"
FT                   /db_xref="GOA:B2AGY9"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63038.1"
FT                   /translation="MTRQSAARPDYLKKILTAKVYDVAQETELTYAHQLSARTGNSVWF
FT                   KREDTQPVFSFKLRGAYNKMASLSAEEIKRGVIAASAGNHAQGVALAAARLQCKAIIAM
FT                   PVTTPQVKIDAVRERGGQWVEIVLHGESYSDAYNHAAVLEKKHKLTFIHPFDDPEVIAG
FT                   QGTIAMEILRQHPGPIHAVFVAIGGGGLISGIAAYIKAVRPEIKVIGVQTVDSDAMKRS
FT                   VDAGKRIELKEVGLFSDGTAVRLVGKETFRITRELVDDIILCDTDAICAGVKDVFQDTR
FT                   SILEPAGALAVAGLKAYAEREKLKGQHLVAIACGANMNFDRLRFVAERAEVGEAREGVF
FT                   AVTIPEERGSFKRFCELVGTRSVTEFNYRIADTSMAHIFVGVQIASRAENDKIAASFRK
FT                   HGFDTLDLSNDELAKQHIRYMVGGRSALAHDELLYRFEFPERPGALMKFLSSMSPNWNI
FT                   SLFHYRNQGADTSNILVGIQVPKNEKRAFRAFLSTLGYVHWDETDNPVYKLFLS"
FT   gene            373252..374058
FT                   /gene="otsB"
FT                   /locus_tag="RALTA_A0370"
FT   CDS_pept        373252..374058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="RALTA_A0370"
FT                   /product="trehalose-6-phosphate phosphatase"
FT                   /function="1.7.9 : Misc. glucose metabolism"
FT                   /EC_number="3.1.3.12"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63039"
FT                   /db_xref="GOA:B2AGZ0"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63039.1"
FT                   /translation="MPQLPLIEPNTALFLDFDGTLADLAPRPELVQVEPELVGTLRTLY
FT                   QRLDGALAVISGRPIIELDHFLQPLQLPAAGIHGAEFRTDGGMVSKTPAPGLEPLIPHL
FT                   EALVRAYPALRLERKSVAVAIHYRQAPELAGIVDAAVTDVLRHAVGLEALPGKMVVEIK
FT                   PAGVDKGDAIAAFMKSAPFAERVPLFAGDDMTDEPGFAAVRKLGGLGVLVGQRESVAAV
FT                   SVPGPAALRSWLHRSAHALASSASGGAPRAVPHEAGPGPGRRSTTS"
FT   gene            374072..375937
FT                   /locus_tag="RALTA_A0371"
FT   CDS_pept        374072..375937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0371"
FT                   /product="putative Glycoside hydrolase, family 15"
FT                   /function="1.6.9 : Polysaccharides, cytoplasmic"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63040"
FT                   /db_xref="GOA:B2AGZ1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63040.1"
FT                   /translation="MTNPSSPAELGKPPTEGVNRTVDGGTRFANPSLSLGMIGNCAISA
FT                   LVDCRGRIVWSCLPRFDGDPVFNALLDPSENAGHFSIEIEDFHSSRQWYEPNTAVLRTR
FT                   LTDIHGNCLEITDFAPRFFRLGRYFRPTTLIRRMRPVRGAPRVRVVVAPRFEWGRKAPQ
FT                   ITRGSSHVRYIGDDMTLRMTTDAPLAYVLSHTPFLVTRGHNFILGPDETLAHGVEETAR
FT                   DFEQETTAYWRLWSRRLAVPREWQDAVIRAAITLKMSLYEETGAIVAAMTTSIPEAPGS
FT                   GRNWDYRFCWLRDAFFVVRALNSLSEVGTMEDYLRWLSNVVMQSQDGHIQPLYGIGLER
FT                   ELPESMLDHLPGYRGMGPVRVGNQAQEHFQHDVYGNVVLGAAQAFHDHRLLHRGGPAEF
FT                   GRLEAVGEQAVRVFGTPDAGMWELRTRARVHTSSALMSWAACDRLAKVAEKLVLPERAA
FT                   YWHGHAHRMKERILAESWSESRQAFAESFGGRELDASVLLMAEVNFIDPRDPRFIATVK
FT                   ALETTLCDGPYMRRYEAPDDFGKPETAFNICTFWRIDALARIGRRDEAREIFEAMLAAR
FT                   NPLGLLSEDTHPVTGEMWGNFPQTYSMVGLINGAMRLSAPWDTVI"
FT   gene            376013..377404
FT                   /gene="otsA"
FT                   /locus_tag="RALTA_A0372"
FT   CDS_pept        376013..377404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="RALTA_A0372"
FT                   /product="trehalose-6-phosphate synthase"
FT                   /function="1.7.9 : Misc. glucose metabolism"
FT                   /EC_number="2.4.1.15"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63041"
FT                   /db_xref="GOA:B2AGZ2"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63041.1"
FT                   /translation="MPRLVAVSNRVADPRNVAAGGLAVALSEALRQTGGLWFGWSGKAL
FT                   QTAQGGTPGEGDLHLQQAGNVTLATVDLSREDHDAYYLGYSNGVLWPVFHYRLDLADFD
FT                   SNFLNGYRRVNQLFARKLAPLLQPDDIIWIHDYHLIPLASELRAIGCGQKIGFFLHVPL
FT                   PPPLILAAIPQHEWLMRALFAYDLLGFQSHADVEHFSRYVQAEAQAEPMGEHRYRAFHR
FT                   TVRAQAFPIGIDVDEFMELGRGEEAQETYEMMCAQYARRRLLLGIDRLDYSKGLPQRLK
FT                   AFYRLLAEYPENRSSATLVQIAAPSRESVDAYADLRREMEQLSGSINGEFGELDWMPVR
FT                   YIHRTTARKRLPGLCRASRVALVTPLRDGMNLVAKEFIAAQDPEDPGVLVLSRFAGAAE
FT                   QLREALLVNPYDTRATAQAIQQALHMPLAERHQRHQKLLERIRAQDVHWWSREYLRALS
FT                   ETEGA"
FT   gene            377437..377796
FT                   /locus_tag="RALTA_A0373"
FT   CDS_pept        377437..377796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0373"
FT                   /product="putative Pterin-4-alpha-carbinolamine
FT                   dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63042"
FT                   /db_xref="GOA:B2AGZ3"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63042.1"
FT                   /translation="MDMSEDLAAQSCTPCRGGVPPLTPEEAEALLQQAPGWELADGATR
FT                   LERRFSFGNFAQALAFVTGVGQLAEAQGHHPEISFGWGHATVSWRTKKIKGLHRNDFIM
FT                   AVKTTELAAAQQGGG"
FT   gene            complement(378014..378619)
FT                   /locus_tag="RALTA_A0374"
FT   CDS_pept        complement(378014..378619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63043"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63043.1"
FT                   /translation="MTAAPNAPLLRTDLPTGILLAAGFGRRFDAAGQRNKLLEVLPGGR
FT                   SVAWRSARTLAAALPESIAVIRPGNPALAAELRRGGCRVLEAPEAEAGMGAALRAAVAA
FT                   TPEARGWVVALADMPWLPMELIRAVALTITTPDTIAAPWRNGQRGHPVGFGAAWRDALL
FT                   ALDGDEGARALLNDKPVTRILTEDEGAFRDIDTPADLR"
FT   gene            complement(378639..379676)
FT                   /gene="coxI"
FT                   /locus_tag="RALTA_A0375"
FT   CDS_pept        complement(378639..379676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxI"
FT                   /locus_tag="RALTA_A0375"
FT                   /product="carbon monoxide dehydrogenase accessory protein;
FT                   may be involved in the anchoring of CO dehydrogenase to the
FT                   cytoplasmic membrane"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14644498; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63044"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63044.1"
FT                   /translation="MDSVDLEVLKNSVQWQQQGHRVLLVTVVRTWGSSPRPEGAMLAVR
FT                   DDGLVVGSVSGGCIEDDIIDRVRRQGITSDRPEAIKYGISAEEAHRFGLPCGGTIELVA
FT                   EPLKPASGIAELLDAVENGRLVARTLDMATGAATLGPANATDGLAFDGKTLLTIHGPRY
FT                   RMLVIGAGQLSKYLCQIAVGLGFQVTVCDPREEYTETWDIPGVTMVRTMPDDTVTDMKL
FT                   DERCAVIALTHDPKLDDLALMEALRTRAFYVGALGSRRNNQARRERLKEFDLTELQLAR
FT                   LHGPVGIYIGSRTPPEIAISILAEVIAAKNHVSLPDILQVEGAKAAREMAASTGSSCDV
FT                   APDPA"
FT   gene            complement(379649..380206)
FT                   /gene="coxG"
FT                   /locus_tag="RALTA_A0376"
FT   CDS_pept        complement(379649..380206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxG"
FT                   /locus_tag="RALTA_A0376"
FT                   /product="carbon monoxide dehydrogenase accessory protein;
FT                   may be involved in the anchoring of CO dehydrogenase to the
FT                   cytoplasmic membrane"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14644498; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63045"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63045.1"
FT                   /translation="MEMNQSQRLPVPQQVAWEALNDTGLLKQCIPGCESIEPDGDHAYL
FT                   LAMTAAVGPVKARFKGRMALEDIQAPDSYTIRFDGQGGAAGFGKGTARVKLEPDGDETV
FT                   LTYTVDAHVGGKIAQIGSRLVDAAARKLADTFFARFTEAVSPDTTQETPAAEGAPAAAA
FT                   GENEQTEEPKRKRSWTAWISKS"
FT   gene            complement(380197..381447)
FT                   /gene="coxE"
FT                   /locus_tag="RALTA_A0377"
FT   CDS_pept        complement(380197..381447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxE"
FT                   /locus_tag="RALTA_A0377"
FT                   /product="carbon monoxide dehydrogenase accessory protein;
FT                   may be involved in the addition of the Cu-ion to CoxL"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /function="2.3.3 : Posttranslational modification"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63046"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63046.1"
FT                   /translation="MLHAGAHGGGPRTALPVLARNVTHFMRLLRDGGFALSPAHAADAL
FT                   TALRLVDIGQRDEVRAALAALVLSGPDQRPLFDAAFDLFWRDPDWEGKLRALLLPRVDA
FT                   GTPPPKRSNRLADALAARQPEMPSRPAQAEAERIHVPLTFSDQERLAQRDFETLSAQEW
FT                   RALQHLVRTRRAHLALQRTRRLRAATCGTHADLRASARLAVRQHGEWLRWKFRKHAERK
FT                   PPVVLLLDISGSMSQYSRAVLYFCHALMQSRERMSVFLFGTRLTNITRSLRERDPDEAV
FT                   AVITGQVRDWAGGTRIGAALASFNRHWARRTLSGRATVLLVTDGLDHEQIDLLGDEMAR
FT                   LRRFAHRIVWLNPLLRYPGFTPQARGVQAILPHVDALRPAHNLDSLLALESLLSGQGGP
FT                   ARAGAPNPPRKEAPPWK"
FT   gene            complement(381457..382353)
FT                   /gene="coxD"
FT                   /locus_tag="RALTA_A0378"
FT   CDS_pept        complement(381457..382353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxD"
FT                   /locus_tag="RALTA_A0378"
FT                   /product="carbon monoxide dehydrogenase accessory protein,
FT                   putative ATPase; may be involved in the attachment of the
FT                   sulfido group to the Mo-ion to CoxL"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /function="2.3.3 : Posttranslational modification"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14644498; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63047"
FT                   /db_xref="GOA:B2AGZ8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63047.1"
FT                   /translation="MLPTSIDHTLAQLAHQQYFADRETATVLYLALRMQRPLFLEGEPG
FT                   VGKTALAQAMAGVLGTRLLRLQCYEGLDAASALYEWDYPRQIMALRLAEARGERPEAQS
FT                   LYHDDYLLKRPLLESLLPDPAAPGVPRVLLIDEIDRADEPFEAFLLEVLSEFQVSIPEI
FT                   GVIRAERPPLIVITSNRTREVHDALKRRCLYQWVGYPERDRELQIVAARAPEAAAALQA
FT                   QAIDFVHRLRGIDLFKAPGIAEAIDWCRALAALGTTELDPQSVRDTLGVLLKYQDDLAR
FT                   VDGPTVAELLAGATPGA"
FT   gene            complement(382544..383344)
FT                   /gene="cooxM"
FT                   /locus_tag="RALTA_A0379"
FT   CDS_pept        complement(382544..383344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cooxM"
FT                   /locus_tag="RALTA_A0379"
FT                   /product="Carbon monoxide dehydrogenase medium chain (CO
FT                   dehydrogenase subunit M) (CO-DH M)"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /EC_number="1.2.99.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2818128, 10430865; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63048"
FT                   /db_xref="GOA:B2AGZ9"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B2AGZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63048.1"
FT                   /translation="MYAFNFERAADAKAAVAKLKADPDAKFLGGGQSLLAAMKLRLASP
FT                   STLVDVARIPGMAEIRVDGNEIAIGAAARHADVAENATVRERIPALAALAGGIGDRQVR
FT                   AMGTIGGALANDDPAACYPAAVLGLGATVVTDRRSIAADDFFKGLYETALEPDELITAV
FT                   RFPIPDQAAYVKFRNPASRFALVGVMVARSGNTVRVAVTGAADSVFRCQPLEQALSADF
FT                   SAQAARGVKVDAGTLNTDLHASAEYRAHLIPVLAARAVEAAVKG"
FT   gene            complement(383450..385828)
FT                   /gene="coxL"
FT                   /locus_tag="RALTA_A0380"
FT   CDS_pept        complement(383450..385828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxL"
FT                   /locus_tag="RALTA_A0380"
FT                   /product="Carbon monoxide dehydrogenase large chain (CO
FT                   dehydrogenase subunit L) (CO-DH L)"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /EC_number="1.2.99.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2818128, 10430865; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63049"
FT                   /db_xref="GOA:B2AH00"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63049.1"
FT                   /translation="MNAPDNQRLVGASVKRKEDYRYLTGNGQYTDDIVLPQQSYAYFLR
FT                   SPYAHARIRAIDKSAALAAPGVIAVLTGADLAADKVGGLPCGWLIHSIDGSPMKEPPHP
FT                   VIAHDKVRHVGDQVALVIAETLQQARDAAEQIDVDYEELPAVVSAADAASASTLVHDDV
FT                   PANTCYTWGHGDKAATDAAFARAAHVTTLEIVNNRLIPNAIEPRAVNASYTRQDDSYTV
FT                   YVANQNPHVERLLMGAFVLGLPESRLRIIAPDVGGGFGSKIFLYPEDVALTWASKKVGR
FT                   PVKWTADRSESFLTDAHGRDHVTRAELALDADGKFLAMRVHTVANMGAYLSTFASSVPT
FT                   ILYATLLAGQYATPAIYAEVQAVFTNTAPVDAYRGAGRPEATFVVERLVETAAHELNID
FT                   PAELRRKNFIRQFPYATPVGLTYDTGDYEPCLARAQELADVKGFPARRDEAKQRGKLRG
FT                   LGYSCYIEACGLAPSNIAGALGARAGLFEVGEIRVHPTGTVTVFTGSHSHGQGHETTFA
FT                   QVVADRLGLQLDQVEIVHGDTGRVPFGMGTYGSRSLAVGGSAIVKALDKIEAKAKKIAA
FT                   HLLEASDSDIEFSNGVFRVAGTDRTKTFGEVALSAYVPHNYPLDKLEPGLNENAFYDPT
FT                   NFTYPSGAYVCEVEVDPDTGESQVVKFTAVDDFGNIINPMIVEGQVHGGIGQGLGQAMM
FT                   EQCVYDKDSGQLLTGSYMDYAMPRAGDLPDFTVETASGTPCTHNPLGVKGCGEAGAIGS
FT                   PPAFINALVDALSPLGVKDVQMPATPHRVWQAIQAARTP"
FT   gene            complement(385841..386344)
FT                   /gene="coxS"
FT                   /locus_tag="RALTA_A0381"
FT   CDS_pept        complement(385841..386344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxS"
FT                   /locus_tag="RALTA_A0381"
FT                   /product="Carbon monoxide dehydrogenase small chain (CO
FT                   dehydrogenase subunit S) (CO-DH S)"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /EC_number="1.2.99.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2818128, 10430865; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63050"
FT                   /db_xref="GOA:B2AH01"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63050.1"
FT                   /translation="MAIPIRLTVNGKPVDAQVEPNTLLVQFLREQLRLTGTHVGCDTAQ
FT                   CGACTVHLDGRAVKSCNILALQADGATVTTIEGLAGDRAGNALHPMQEAFRECHGLQCG
FT                   FCTPGMVMSATALVQQHPDADAATIRAHLEGNLCRCTGYHNIVRAVQQGQAAMQGTASA
FT                   ASAE"
FT   gene            386664..387242
FT                   /locus_tag="RALTA_A0382"
FT   CDS_pept        386664..387242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0382"
FT                   /product="conserved hypothetical protein; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63051"
FT                   /db_xref="GOA:B2AH02"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63051.1"
FT                   /translation="MEAFFDWLFETIALPKVGLPAIFVVSLVSATLLPLGSEPAVFGYV
FT                   KLNPQMFWPAIVVATAGNTVGGAIDWWLGYAAKLALVRYHKRRRAREHEAEHLEHRAHA
FT                   RKPPKPKLDVRYFRWMRRLGPPTLLLSWLPGVGDPLCTLAGWLRLSFWPSLAWMAVGKF
FT                   LRYLVMTAGLMWIPDTFWQNIAHTVKAWF"
FT   gene            387426..391400
FT                   /locus_tag="RALTA_A0383"
FT   CDS_pept        387426..391400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0383"
FT                   /product="putative FAD/FMN binding Fe-S oxidoreductase"
FT                   /function="1.4 : Energy production/transport"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63052"
FT                   /db_xref="GOA:B2AH03"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63052.1"
FT                   /translation="MNAPLVLDAKLAAQDAPPRLREIPYNYTSFSDREIVIRLLGEEAW
FT                   RILDELRSERRTGRSARMLYEVLGDIWVVRRNPYLQDDLLENPKRRQMLVSALHHRLNE
FT                   IEKRRAADRAEHAEPAAEDRSHRVEQLVAFAKQAIEDFKNEFAAAYDLRKRAQRVLGRV
FT                   TQKDNIKFDGLSRVSHVTDATDWRVEYPFVVLTPDTEEEIAGLVKGCFELGLTIIPRGG
FT                   GTGYTGGAVPLTPMSAVINTEKLEQLGPVEQTDLPGVPHKVATIFSGAGVVTRRVADAA
FT                   DKAGLVFAVDPTSIDASCIGGNVAMNAGGKKAVLWGTALDNLAWWRMVDPEGNWLEITR
FT                   LDHNLGKIHDVPVATFELKWSDGNRAPGEKVLRTETLAIEGRKFRKEGLGKDVTDKFLA
FT                   GLPGVQKEGCDGIITSARWILHRMPKHIRTVCLEFFGQARDAIPSIVEIKDFLDAETKK
FT                   PGGAILAGLEHLDERYLRAVGYATKSKRNAFPKMVLIGDIVGDDEDAVARATSEVIRMA
FT                   NGKSGEGFIAVSPEARKKFWLDRSRTAAIAKHTNAFKINEDVVIPLNRMGEYTDGIERI
FT                   NIELSIKSKLQLVDALEAFFARGNLPLGRSDDANEIPSAELLEDRVQHALTLLREIRAR
FT                   WRYLQDHLDTPLAQAKASLIGHGLGLLGQEFEARLHQQPDASVFHLLQDRTIRVSWKNE
FT                   IRAELRKIFNGGEFKPILDEAQKIHKQVLRGRVFVALHMHAGDGNVHTNIPVNSDDYDM
FT                   LQDAHRAVARIMDLARSLDGVISGEHGIGITKLEFLTEAEIGDFRAYKQKVDPQGRFNK
FT                   GKLLPGADLRNAYTPSFGLMGHESLIMQQSDIGAIAESVKDCLRCGKCKPVCATHVPRA
FT                   NLLYSPRNKILATSLLVEAFLYEEQTRRGISVKHWDEFSDVADHCTVCHKCVTPCPVKI
FT                   DFGDVSMNMRNLLRKMGQKKFNPGTAASMFFLNATNPETINLTRKVMIDWGYKAQRLGN
FT                   DVLKKIAKKQTAHPPATVGKPPVREQVIHFINKKMPGNLPKKTARALLDIEDNEIVPII
FT                   RDPKATTPETEAVFYFPGCGSERLFSQVGLATQAMLWHVGVQTVLPPGYLCCGYPQRGN
FT                   GQYDKAEKIVTDNRVLFHRVANTLNYLDIKTVVVSCGTCYDQLAGYEFDKIFPGCRIID
FT                   IHEYLLEKGVKLEGVTGTRYMYHDPCHTPIKTVDPTKLVNDLMGGNAGLGKIEKNERCC
FT                   GESGTLAVTRPDISTQVRFRKEEEMTRGADKLRADGFTGDVKILTSCPSCLQGLSRYKE
FT                   DASVQADYIVIEMAKHLLGENWMPEYVAKANAGGIERVLV"
FT   gene            391590..392027
FT                   /locus_tag="RALTA_A0384"
FT   CDS_pept        391590..392027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0384"
FT                   /product="conserved hypothetical protein; putative
FT                   nucleotide-binding protein, histidine triad motif"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63053"
FT                   /db_xref="GOA:B2AH04"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63053.1"
FT                   /translation="MIKSPNCPLCETDGGELVWMGDRARLILVEHDRFPGFCRIVWNDH
FT                   VAELSDLDEGDQAWLMRLVARVERVVREVMTPDKVNLAAFGNMVPHLHWHIIPRYRWDT
FT                   HFPEAIWAAPQRAADAVRVRELASRLPALRTALALVEAGDA"
FT   gene            392157..394022
FT                   /locus_tag="RALTA_A0385"
FT   CDS_pept        392157..394022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0385"
FT                   /product="putative ABC TRANSPORTER, ATP-binding membrane
FT                   component"
FT                   /function="4.3.A.1.am : ATP binding and membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63054"
FT                   /db_xref="GOA:B2AH05"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63054.1"
FT                   /translation="MSSTPTSVTVPGPAVPARALKIQSRLRMAATWALIKPYWKSEDRV
FT                   AGLGLLALVVVLNLGIVYINVLLNEWNRVFYNALEQRDYASFKVLLLRFSWIAGFYIVA
FT                   FLSRQYYTMMLQMRWRTWMTGRFMDRWLAHQAYYRIEQTHTTDNPDQRIADDLRLFTDG
FT                   GLSLSLGLLNSVVTLISFVGILWALSGPISLALGGSEIVIPGYMVWFAGAYAVVGSLVA
FT                   HFVGRPLIGLNFQQEQYEADFRFTLVRLRENSEPVALYRGEPTEKAGLRARFDRIRANW
FT                   NQLMLYTRRLNFVSSGYAQFAIIFPILVAAPRYFAGKMTLGGLMQISSAFGQVQGALSW
FT                   FVDNYATLVGWKAAANRLIDFQEAIRVAERQEASPDGSRDIEVAYHGEPQDGIAIDSLA
FT                   LALPVRAGRGAAVGQRPLVAPFSLTVAPGERWLVSGPSGCGKSVLFRALAGIWPYGSGT
FT                   VTMPEGARRLFLPQRSYLPIGTLADALAYPDAGTEHSKEVLQAALRQTRLAALADQLDV
FT                   FDNWSLRLSPGEQQRLAFARALLQKPDYLFLDEATSALDEDTERAMYQLMVEQLPQTAI
FT                   VSIAHRSTVAAFHQRRLRYVPQDAEAARAAQAGEPGVSYRVVCEA"
FT   gene            394111..394527
FT                   /locus_tag="RALTA_A0386"
FT   CDS_pept        394111..394527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0386"
FT                   /product="conserved hypothetical protein, DUF971"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63055"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63055.1"
FT                   /translation="MAGLEKDTPHPTALTVHTQSRVLEIGFDNGRSFRLPFELLRVYSP
FT                   SAEVQGHGPGQEVLQTGKREVGVDAVEPVGNYAIQIRFSDGHDTGIYSWDLLYRLGDNQ
FT                   DALWQDYLQRLEAAGADRDTPMPAAGGGHACGHH"
FT   gene            394559..395290
FT                   /gene="ubiE"
FT                   /locus_tag="RALTA_A0387"
FT   CDS_pept        394559..395290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="RALTA_A0387"
FT                   /product="bifunctional: 2-octaprenyl-6-methoxy-1,
FT                   4-benzoquinone methylase; S-adenosylmethionine:2-DMK
FT                   methyltransferase"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.3.7 : Anaerobic respiration"
FT                   /function="1.5.3.11 : Menaquinone (MK), ubiquinone (Q)"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9045837; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63056"
FT                   /db_xref="GOA:B2AH07"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63056.1"
FT                   /translation="MSETHFGFEKVDETEKAGKVAGVFHSVASKYDVMNDLMSGGMHRL
FT                   WKMFTIAQAGVRPGHKVLDIAGGTGDLAKAFAKQAGPTGQVWLTDINESMLRVGRDRLL
FT                   NKGIVTPVALCDAEKIPFPDNYFDLVTVAFGLRNMTHKEAALAEMRRVVKPGGKVMVLE
FT                   FSKVWKPLEKAYDVYSFKVLPWLGQRVAGDAPSYRYLAESIRMHPDQVSLVRLMEHAGL
FT                   ENVEYFNLTAGVVALHVGRKY"
FT   gene            395353..396336
FT                   /locus_tag="RALTA_A0388"
FT   CDS_pept        395353..396336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0388"
FT                   /product="conserved hypothetical protein, COG4395"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63057"
FT                   /db_xref="GOA:B2AH08"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63057.1"
FT                   /translation="MSSFRGKFLVGSLITAIAFGMVFDANAKRMGGSRSIGKQSSTVTQ
FT                   QRQQAPQPTSPTQQPAQQPTQAAPATAGAAGAAGAAAAAPKRNWGGILGGIAAGLGIGW
FT                   LLSHFGLGGAALSFLSNLILIALVAFAAIWLIRKFRGSKRAAQPAYAGAGGAPNLGRNA
FT                   EPMFRGEPTPVSSGSQSASPVLPASAAPVAAGAVAQQPWGVPADFDTESFLRNAKVHFV
FT                   RLQAAWDAGNLDDIREFTTPEMFAEIKMDLAERGAEVNKTDVVTLEAQLLGIESSPAQH
FT                   LASVRFSGMIREKAGEAAQPFGEVWNLAKPVSGNGGWLLAGIQQES"
FT   gene            396463..397155
FT                   /locus_tag="RALTA_A0389"
FT   CDS_pept        396463..397155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0389"
FT                   /product="conserved hypothetical protein, DUF1243"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63058"
FT                   /db_xref="GOA:B2AH09"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63058.1"
FT                   /translation="MNTLPSALATPAISALNHLLEQEPWARNQLAPFAGRVIRFDAAAF
FT                   ELSLKVTEHGCTELAPAAEAPAVTLRVPVQQWPLVAADVAEGGQAAAMRHVRIEGDAEL
FT                   ANTVSTLARNLRWDAAEDLSRALRGILGGPVSDSVAQRVVDGVRQVHEQATRVGRALVD
FT                   NVTDYLLDEQPTLVRHAALDEFGADVGHLRDRLARLEKRLERLERGGTAPAPGASSGPS
FT                   GKLPSPHR"
FT   gene            397221..398798
FT                   /gene="ubiB"
FT                   /locus_tag="RALTA_A0390"
FT   CDS_pept        397221..398798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="RALTA_A0390"
FT                   /product="2-octaprenylphenol hydroxylase of ubiquinone
FT                   biosynthetic pathway"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.5.3.11 : Menaquinone (MK), ubiquinone (Q)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10960098; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63059"
FT                   /db_xref="GOA:B2AH10"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63059.1"
FT                   /translation="MTRLLRLGKILFVILYYGLDELVLSGFSSRRIRFLVRVITIGRKL
FT                   DMPRGVRLRLALTRLGPIFVKFGQVLSTRRDLMPPDIADELAKLQDQVPPFDSAVAVRI
FT                   IERSLGRPLDQLFETFEHQPVASASIAQVHFATLKGGPCHGREVAVKVLRPGMLPVIDS
FT                   DLALMRDMATWLERFWADGKRLKPREVVAEFDKYLHDELDLMIEAANASQLRRNFADTN
FT                   LLLVPEVFWDWCSSTVFVMERMHGIPISRTDSLKAAGVDMHQLAEEGVEIFFTQVFRDG
FT                   FFHADMHPGNILVSVQPETFGRYIALDFGIVGALSEFDKNYLAQNFIAFFRRDYHRVAL
FT                   LHVESGWVPPETRVEELESAVRACCEPYFDKPLKEISLGMVLMRLFQTSRRFNVEIQPQ
FT                   LVLLQKTLLNIEGLGRQLDPDLDLWKTAKPFLERWMHEQVGWQGAWERIKVEAPLWAKM
FT                   LPDFPRLAHQFLERRALTTNGEQDKLLAMLVLEQRRTNRLLGTAVLLAGGFVAGIVLTH
FT                   VLGWAGYW"
FT   gene            398836..399456
FT                   /locus_tag="RALTA_A0391"
FT   CDS_pept        398836..399456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0391"
FT                   /product="putative Thiopurine S-methyltransferase"
FT                   /function="1.8.2 : Sulfur metabolism"
FT                   /EC_number="2.1.1.67"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63060"
FT                   /db_xref="GOA:B2AH11"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63060.1"
FT                   /translation="MGDTTRPVPSFTTRNAGDPAFWDERFKEGFTPWDLGGVPEEFRRF
FT                   VEGRQPCPTLVPGCGNGWEAAWLFERGWPVTAIDFSAQAVASARRALGPAGAVVQQGDF
FT                   FAFTPQPACELIYERAFLCALPPALRAAYGARVAELLPPGGLLAGYFYLGENRGGPPFA
FT                   MPEAELDALLGPGFERIEDRPSAAPLPVFQGQERWQVWRRRGG"
FT   gene            399748..401184
FT                   /locus_tag="RALTA_A0392"
FT   CDS_pept        399748..401184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0392"
FT                   /product="putative SODIUM/SOLUTE SYMPORTER"
FT                   /function="4.2.A.21 : The Solute:Sodium Symporter (SSS)
FT                   Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63061"
FT                   /db_xref="GOA:B2AH12"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63061.1"
FT                   /translation="MLIWFVIIYWVISVGIGLWAALRVRNTTDFAVAGRSLPFHIVTAT
FT                   VFATWFGSETVLGIPAVFLKEGLSGVVSDPFGSSLCLILVGLFFARPLYRMNLLTIGDY
FT                   YHNRYGRLAEVLTTLCIVVSYLGWVAAQIKALGLVFYTVSDGALSQEAGMMIGAASVLV
FT                   YTLFGGMWSVAITDFIQMIIIVIGMMYIGYEVSGQAGGVTAVVSHAAAAGKFEFLPSLD
FT                   FVQIIGFAAALFTMMLGSIPQQDVFQRVTSSRTELIAGRASVLGGVLYFCFAFIPMFLA
FT                   YSATLIDPGMVARYIDTDSQLILPQLILQHAPMFAQVMFFGALLSAIKSCASATLLAPS
FT                   VTFAENILRPYFRHLDDKQFLRVMQSVVLVFTTLVTLFALNSHLSIFHMVENAYKVTLV
FT                   SSFVPLAFGMFWKHATRQGGLAAILLGLSSWLTCEIAFADAVVPPQMVGLLFSVSGMVV
FT                   GSLLPQWIADHAPVKEVHIA"
FT   gene            401350..401685
FT                   /locus_tag="RALTA_A0393"
FT   CDS_pept        401350..401685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63062"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63062.1"
FT                   /translation="MPIYAYRCDACGHGRDVLQKMSDAPLTDCPSCGAAGAFKKQLTAA
FT                   GFQLKGSGWYVTDFRGGSGGTSAPAAGGAAAGAAAASAPAAAESPAASTTAAAPAAGGC
FT                   GSACACH"
FT   gene            401699..402409
FT                   /locus_tag="RALTA_A0394"
FT   CDS_pept        401699..402409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0394"
FT                   /product="conserved hypothetical protein, DUF502; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63063"
FT                   /db_xref="GOA:B2AH14"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63063.1"
FT                   /translation="MVAKKTSALKTWFLTGLLVLVPLGITLWVLSLIIGTMDQSLALLP
FT                   EAWRPDRLMFGKRVTGLGAILTLLFILLVGLLAHNFIGQRLVRWWEALLGHIPVVGPIY
FT                   TSVKQVSDTLLSSSGNAFRKALLVQYPREGSWTIAFLTGRPGGDVQNHLQGEYVSVYVP
FT                   TTPNPTSGFFLMMPKADTIELDMTVDAALKYIVSMGVVAPAELPRKNGSAPRPVATSPA
FT                   GRSSNEEPVQTTDP"
FT   gene            402475..404283
FT                   /gene="aspS"
FT                   /locus_tag="RALTA_A0395"
FT   CDS_pept        402475..404283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="RALTA_A0395"
FT                   /product="aspartate tRNA synthetase"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="6.1.1.12"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63064"
FT                   /db_xref="GOA:B2AH15"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63064.1"
FT                   /translation="MSSMRTHYCGLVTEQFSGQEVALTGWVQRRRDHGGVIFIDLRDRE
FT                   GLVQVVCDPDRPEMFKAAEEIRNEFCIRVTGKVRPRPAGTENANLTSGKIEVLCHELTV
FT                   LNPSVTPPFQLDDDNLSETTRLTHRVLDLRRPQMQYNLRLRYKVAMEVRKFLDAQGFID
FT                   IETPMLGKSTPEGARDYLVPSRVNPGHFFALPQSPQIFKQMLMVSGFDRYYQITKCFRD
FT                   EDLRADRQPEFTQIDCETSFLTEQEIRDLFEDMMRTVFKNAIDVDLDAKFPVMEFREAM
FT                   ARFGSDKPDLRVKLEFTELTEVMKDVDFKVFSGPANSDNGRVVGLRVPGGGAISRGEID
FT                   AYTQFVGIYGAKGLAWIKVNEVAKGRDGLQSPIVKNLHDAAIAEILKRTGAQDGDIIFF
FT                   GADKAKVVNDSIGALRLKIGHSDFGKANGLFEDAWKPLWVVDFPMFEYDEEDARWVAMH
FT                   HPFTSPKDEHLEYLETDPGKCLAKAYDMVLNGWEMGGGSVRIFRSDIQSKVFRALKIND
FT                   EEARAKFGYLLDALQYGAPPHGGLAFGLDRIVTMMAGADSIRDVIAFPKTQRAQDLLTQ
FT                   APSSVDEKQLRELHIRLRTAEPKPNA"
FT   gene            404487..405404
FT                   /locus_tag="RALTA_A0396"
FT   CDS_pept        404487..405404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0396"
FT                   /product="conserved hypothetical protein; putative
FT                   TRANSMEMBRANE PROTEIN"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63065"
FT                   /db_xref="GOA:B2AH16"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63065.1"
FT                   /translation="MNLNLDTELIRQFLLAHQETILTWLAAGLIMMLLARFELRRAQRR
FT                   AAQAMSESVATTVAACVPDIAHAVQAASPQAVAEPVEMQRAEALRRLALDTVGVVMTRG
FT                   RWLDELGNLRLADDALLAGQRADGADPLLVVAPQPVVQAYLDAQRIFEDEAAQVQALRR
FT                   DAQRVQEALQALDAEAAHIEQETGSIVLRFEQVNAQAAQGMDGGDYQRFLIQKYNTLGQ
FT                   REKEIAQERARLQGEARQRAEALATHAHAASRRYRHALAPLMEQLRAAWGHGESPQVFD
FT                   TWQRHGNTEPYLAPHSMAGARSAA"
FT   gene            405508..406017
FT                   /gene="nudB"
FT                   /locus_tag="RALTA_A0398"
FT   CDS_pept        405508..406017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudB"
FT                   /locus_tag="RALTA_A0398"
FT                   /product="dATP pyrophosphohydrolase"
FT                   /function="1.7.33 : Nucleotide and nucleoside conversions"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63066"
FT                   /db_xref="GOA:B2AH17"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63066.1"
FT                   /translation="MSYKIPESVLVVIYTPDLQVLLLERADRPGFWQSVTGSLDTLDEP
FT                   LALTAAREVAEETGIIAGEHQLTDWGHAIQYDIYPQWRHRYAEGVTRNTEHWFGLRVAA
FT                   ALPVTLAPREHLQYKWLPWQQAAQQCFSSSNAEAIRQLAWRAGKAGAPAAADADAGHEA
FT                   TVGGRP"
FT   gene            406014..406796
FT                   /locus_tag="RALTA_A0399"
FT   CDS_pept        406014..406796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0399"
FT                   /product="putative metal dependent
FT                   endonuclease/phosphatase"
FT                   /function="2 : Information transfer"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63067"
FT                   /db_xref="GOA:B2AH18"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63067.1"
FT                   /translation="MKLRVVTYNIHKGVTGIARRPRIQNVRAGLHAMDADIVFLQEVQD
FT                   RNDRLVAAALFDPEHTQLNYLATDAYPHSVYGRNAVYDYGHHGNAILSRHPILMSENLD
FT                   ISDHRFEQRGLLHAVADVHGVETHLICVHFGLFARSRARQAEALVERVKNVVPADVPLV
FT                   IAGDFNDWNHRLDAQICNTLGAVEASHARGARLHTFPSHMPWWQLDRIYVRGYEIERAH
FT                   ALTGRDWAQRSDHVPLVAELGHPLGGMVERDVPADQAA"
FT   gene            complement(406863..407384)
FT                   /gene="mobB"
FT                   /locus_tag="RALTA_A0400"
FT   CDS_pept        complement(406863..407384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="RALTA_A0400"
FT                   /product="MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
FT                   PROTEIN B"
FT                   /function="1.5.3.4 : Molybdenum (molybdopterin)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63068"
FT                   /db_xref="GOA:B2AH19"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63068.1"
FT                   /translation="MVKVFGITGSSGSGKTTLLDQLIPCFVSAGLRVAGVKHTHHGFDP
FT                   DTPGKDSWRMRAAGCANVVLVGARHLTLMRHYPEAVPSPELDDALAVLPPDTDLVLVEG
FT                   YKRSDFPKLEVFRPALGRAPLWDEVPGVVAVASDDPAAVAAMTALPVLDLNDAQAVFAF
FT                   IRDYSVPGRD"
FT   gene            407478..408824
FT                   /locus_tag="RALTA_A0401"
FT   CDS_pept        407478..408824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0401"
FT                   /product="putative cardiolipin synthase; putative exported
FT                   protein"
FT                   /function="1 : Metabolism"
FT                   /function="6.1 : Membrane"
FT                   /function="1.6.1 : Phospholipid"
FT                   /EC_number="2.7.8.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63069"
FT                   /db_xref="GOA:B2AH20"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63069.1"
FT                   /translation="MCRRRLARRNLSDNHGMSRISHSAQAEDAPVRDTATTGEPLYRHH
FT                   MLRWAWRRGKPTTGNTVRLLHGGQDFFPALIAAIDQAAFQVMLETYIYADDEVGRAVAD
FT                   ALIRAAARGVAVRVTVDGFGAGDMPAELAERLRAGGVRLRVYRALRGFRLARRHLRRLH
FT                   RKIAVIDRHIAFVGGINIIDDHNHGPFEGANLGPRYDFAVQVSGPLVDRIALSAERLWW
FT                   RLSLREARGSERAAAVADYPLVTDLPPRPEATGGIRAALLLRDNLRNRRTIEREYLRAL
FT                   GAARHDVILANAYFLPGHKMRRALLACRQRGVRVRLLLQGMVEYRLQHYATHALYASLL
FT                   EAGVEIYEYAESFLHAKVGVVDEAWATVGSSNMDPFSLLLAREANVAVYDAAFAAELRE
FT                   ALERAIAHRSVRVLPDVHARRSPLHRLGNWTAYMLLRLGVIIAGVTGRY"
FT   gene            409118..409759
FT                   /locus_tag="RALTA_A0402"
FT   CDS_pept        409118..409759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0402"
FT                   /product="putative transcriptional regulator, tetR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63070"
FT                   /db_xref="GOA:B2AH21"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63070.1"
FT                   /translation="MRHQSARLESAASSPSPMRKGEMTRVAILDAALELSSRDGLEGLT
FT                   IGLLAERMQMSKSGVFAHFGSREDLQVEVVREYHRRFEQEVFYPSLQEPRGLPRLWSMV
FT                   RRWMEKRIQEVTTGCIYISGAVEYDDRAGSLVRDELVKSVTIWRAALTRAINQAKEEGH
FT                   LRADCDPRLMLFEMYSLELGLHHDARFLRLPDSAELAMVALNKLIQSYRT"
FT   gene            409835..411622
FT                   /locus_tag="RALTA_A0403"
FT   CDS_pept        409835..411622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0403"
FT                   /product="putative ACYL-COA DEHYDROGENASE OXIDOREDUCTASE"
FT                   /function="1.4 : Energy production/transport"
FT                   /EC_number="1.3.99.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63071"
FT                   /db_xref="GOA:B2AH22"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63071.1"
FT                   /translation="MGQYTAPLRDMQFVLHELLGAEAELKAMPPHADIDADTINQVIEE
FT                   AGKFCSDVVFPLNQVGDREGCTYVGDGVVKAPTGFKEAYQQYVEAGWPALACDPAFGGQ
FT                   GLPIVVNNVVYEMLNSANQAWTMYPGLSHGAYEALHAHGTPELQQTYLPKLVSGVWTGT
FT                   MCLTEPHCGTDLGILRSKAEPQADGSYRITGTKIFISAGEHDLAENIIHLVLARLPDAP
FT                   AGTKGISLFVVPKFIPDASGNPGERNGIQCGSIEHKMGIHGNATCVMNLDGARGWMVGE
FT                   PNKGLNAMFVMMNAARLGVGAQGLGLTEVAYQNSVAYAKDRLQMRSLTGPKAPEKAADP
FT                   IIVHPDVRRMLLTQRAYAEGGRAFSYWTALQIDRELSHPDEAVRKQAGDLVALLTPVIK
FT                   AFLTDNAFTSTNEGMQVFGGHGYISEWGMEQYVRDARINMIYEGTNTIQALDLLGRKIL
FT                   GDMGAKMKAFGKIVQEFVEAEGTNEAMQEFINPLADLGDKVQKLTMEIGMKAMGNADEV
FT                   GAAAVPYLRVVGHLVFAYFWARMAKIALEKQGSGDKFYTAKLATARFYFAKLLPETAAE
FT                   IRKARAGSASLMALDADLF"
FT   gene            411752..414175
FT                   /locus_tag="RALTA_A0404"
FT   CDS_pept        411752..414175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0404"
FT                   /product="putative 3-HYDROXYACYL-COA DEHYDROGENASE
FT                   OXIDOREDUCTASE"
FT                   /function="1.4 : Energy production/transport"
FT                   /EC_number="1.1.1.35"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63072"
FT                   /db_xref="GOA:B2AH23"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63072.1"
FT                   /translation="MSNFIVKKVAVLGAGVMGAQIAAHLINARVPVVLFDLPAKEGPKN
FT                   GIALRAIENLKKLSPAPLGIKDEAGLIQAANYEDDIALLKECDLVIEAIAERMDWKHDL
FT                   YKKVAPHLASHAIFATNTSGLSITALSDGFDDSLKSRFCGVHFFNPPRYMHLVELIPTA
FT                   TTQPEILDQLEAFLTTTLGKGVVRAKDTPNFIANRVGIFSILAVFAEAEKFGIPFDVVD
FT                   DLTGSKLGRAKSATFRTADVVGLDTMAHVIKTMQDNLHDDPFAPVYKTPAVLKGLVDAG
FT                   ALGQKTGAGFYKKEGKAIKVLDAKTGQYVDAGKKADEIVVRMLKKEPAERIKLLRESTN
FT                   PQAQFLWAVFRDVFHYIAVYLEQIAGSAADIDLAIRWGFGWNSGPFEDWQSAGWKQVAE
FT                   WVKEDVESGKALSAAPLPAWVFDGPVAERQGVHAAEGSWSPATQSFVARSTLPVYRRQV
FT                   FRAALKGTEAVDPRKAGRTVEENDAVRIWVSEGQDDVLVVSFKSKMNTIGPDVIDGLTR
FT                   AIDLAEAQYKGLVVWQPTSLQLGAPGGPFSAGANLEAAMPAFMMGGAKGIEPFVKKFQD
FT                   GMMRVKYASVPVVSAASGIALGGGCELMLHSAARVAALETYVGLVEVGVGLVPAGGGLK
FT                   EAALAAARAAQAAGSTNYLQFLTGRFQSAAMAKVSASALEARQMGYLQPSDRIVFNVHE
FT                   LLHVAQNEVRALADAGYRAPLPALIPVAGRSGIATIKASLVNMRDGGFISAHDFLIATR
FT                   IAEVVCGGDVEAGSLVSEDWLLALERKAFVDLLGTAKTQERIMGMLQTGKPVRN"
FT   gene            414200..415396
FT                   /locus_tag="RALTA_A0405"
FT   CDS_pept        414200..415396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0405"
FT                   /product="putative 3-ketoacyl-CoA thiolase"
FT                   /function="1 : Metabolism"
FT                   /EC_number="2.3.1.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63073"
FT                   /db_xref="GOA:B2AH24"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63073.1"
FT                   /translation="MKQLQDAYIVAATRSPIGKAPKGAFKNTRPDDLLATILKAAVAQV
FT                   PNLDPKLIEDAIVGCAIPEAQQGLNVARIGALLSGLPNTVGGITVNRFCASGVSAVAMA
FT                   ADRIRVGESDVMIAAGVESMSMVPMMGNSPSMSPEIFTRDENVGIAYGMGLTAEKVAQQ
FT                   WKVSREDQDAFSLASHQKAIAAQQAGEFKDEITPIEIVERFPDLASGQVSVKTRTISLD
FT                   EGPRPETSLEGLGKLRPVFANKGSVTAGNSSQTSDGAGALILVSEKILKQFNLVPLARF
FT                   VSFAVRGVPPEIMGIGPKEAIPAALKAAGLTQDQIDWIELNEAFAAQSLAVMRDLDLDP
FT                   ARVNRMGGAIALGHPLGATGAIRSATVVHALRRHNLKYGMVTMCVGTGMGAAGIFERV"
FT   gene            415509..416465
FT                   /locus_tag="RALTA_A0406"
FT   CDS_pept        415509..416465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0406"
FT                   /product="conserved hypothetical protein, DegV family"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63074"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63074.1"
FT                   /translation="MQETAILADAACDLPRDVMAQLKVHTIPFRIRAGEHFVADTRDED
FT                   ALPTLYQQYLVGRQDHYAESIPLLERELEEHLLRNVVAHCDRAILFTIASSRSKLYAHA
FT                   SGAVIGTVARSVRLRKEAGRSGLFDLTVVDTGAIGPGQALIVREAARMAAAGASPQAVR
FT                   EAVETRLRDAAHMFLVPDELLYLYTRARQKGEGSITWGRYAMGSAFNIRPVVRMHRGHT
FT                   EAIAKARGSEEGARRVLQHAEQCIRGGDLMVPTISVCHAGPLDAVRAMPAFQSLARTAR
FT                   DQGVELMLAPMSLTVALNVGARAFGLSYLAESPPPFE"
FT   gene            416486..417262
FT                   /locus_tag="RALTA_A0407"
FT   CDS_pept        416486..417262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0407"
FT                   /product="putative ENOYL-COA HYDRATASE"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63075"
FT                   /db_xref="GOA:B2AH26"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63075.1"
FT                   /translation="MSIRTSIEQGILTLEFDRIDKKNAITAAMYQSLADALRAAQTDPA
FT                   VRAILLRGKPKVFTAGNDLEDFMQRPPSGGEGAEAAPVFQFLYQISHASKPVVAAVSGA
FT                   AVGVGTTMLLHCDLVYASDTAKLSLPFVQLGLCPEAASSLLLPRLVGYQRAAEKLMLGE
FT                   AFSAQEALEIGLVTRVLPVAELHDFALAQARKLAALPASSLRETKLLMKAGAMAEVEKQ
FT                   MADEGAVFRRMLVAPEAKEAFSAFFEKRKPDFMKFV"
FT   gene            complement(417355..417759)
FT                   /locus_tag="RALTA_A0408"
FT   CDS_pept        complement(417355..417759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0408"
FT                   /product="putative Acyl-CoA thioester hydrolase"
FT                   /EC_number="3.1.2.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63076"
FT                   /db_xref="GOA:B2AH27"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63076.1"
FT                   /translation="MNAPHTVPALPAGKNPALRVVPMPADANVHGDVFGGWIMSQVDIA
FT                   GSIPAVERAQGRVATVAVNSFLFKHPVFVGDLVSFYADIVKTGRTSITVAVEVYAQRMR
FT                   HSNEIVKVTEATLTYVATDESRQPRVLPTA"
FT   gene            417870..419768
FT                   /locus_tag="RALTA_A0409"
FT   CDS_pept        417870..419768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0409"
FT                   /product="putative ABC transport system, ATPase membrane
FT                   component"
FT                   /function="4.3.A.1.am : ATP binding and membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63077"
FT                   /db_xref="GOA:B2AH28"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63077.1"
FT                   /translation="MRRYSTTAEQAPDPASVKLFPGQRAPRSDWQTVRNLLPYVWHYKW
FT                   RVMLALACLVAAKVANLGVPVLMKRLIDSMNITAGDPRALLAVPVGLIVAYGMLRLSAT
FT                   LFTELREILFSKVTQSAVREIALQVFRHLHALSLRFHLDRQTGGMSRDIERGTRGIQSL
FT                   ISYSLYSILPTLVEMALVIGFFILHYDIWFAAITGCALVGYIVFTIVVTEWRTHFRRRM
FT                   NELDSRANQKAIDSLLNFETVKYFGNEAYEAQRYDENLRKYRTAAIRSQNSLSFLNFGQ
FT                   QAIIAIGLILILWRATVGVVDGKLTLGDLVLVNTLMIQLYIPLNFLGVIYREIKQATTD
FT                   MDRMFVLLGTHQEVADAPGAPPLRVSGAQVRFRDVRFGYEPDRTILDGVDFTIAAGTTT
FT                   AVVGHSGSGKSTLARLLFRFYDVGGGAIEIDGQDIRAITQDSLRRAIGIVPQDTVLFND
FT                   SIYYNIAYGRPDATRDEVIAAAQAAQIDAFIRELPQGYDTPVGERGLKLSGGEKQRVAI
FT                   ARTLLKNPPVLVFDEATSALDSRTEQAIQAELMRLAQNRTTLLIAHRLSTVVHADQILV
FT                   MDHGRIVERGTHAQLMRAGGRYAGMWDIQARAAARGGDAIGADALALDVGDATQDA"
FT   gene            419969..421111
FT                   /locus_tag="RALTA_A0410"
FT   CDS_pept        419969..421111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0410"
FT                   /product="putative precursor ABC-type
FT                   nitrate/sulfonate/bicarbonate transport system, periplasmic
FT                   component"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63078"
FT                   /db_xref="GOA:B2AH29"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63078.1"
FT                   /translation="MPKSRAAQVLPGVFTAATEGAGHAGARPAPAAARRRLLKLGAMLG
FT                   TSLVLSTSFAGAAHAQAASTRVRFQLDWRFEGPAALFLLGEQKGYYKAEKLEVAIDAGN
FT                   GSGNVVNRVASGTYDMGFADMSSVMEFYGNNPDAKNKPVAVMMVYNNTPAAILALKKSG
FT                   IRAPKDLAGKRMGAPVFDAGRRAFPIFAKANGLQASSFNWQAMDPTLRETMLVRGDLDA
FT                   ITGFSFTSILNLNARGVKDEDIVVLPYPQFGVKLYGNAVIASEAFIRQNPEAVKAFLRA
FT                   FSKSARDVIARPEEGIRALKARDGIIDEKLETRRLKLALDSVVRSPDAKAEGFGRVSKP
FT                   RLSLMASQVADAFGTKGRINADALWTDAYLPSAAELDVLR"
FT   gene            421108..421950
FT                   /locus_tag="RALTA_A0411"
FT   CDS_pept        421108..421950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0411"
FT                   /product="putative ABC TRANSPORTER, ATP-BINDING component"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63079"
FT                   /db_xref="GOA:B2AH30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63079.1"
FT                   /translation="MMAHLAESMPAAATAPVEPFVDFNRVWLAYDDALARQGEFAVEDL
FT                   SLQAAPGEFIAIVGPSGCGKSTFMKLATGLRPATHGTVKVAGQKVSGPLKQVGMAFQAP
FT                   TLLPWRTTLDNVMLPLEIVEPYRSTLRARRDEYVDRARRLLHTVGLGGYEDKYPWQLSG
FT                   GMQQRASICRALIHQPRMLLLDEPFGALDAFTREELWCVLRDLWQAQRFNVILVTHDLR
FT                   EAVFLADTVYVMSQRPGRILLRKEIHLPRPRDLELTYTEPFAGLVHALREKIGHVRQH"
FT   gene            421963..422739
FT                   /locus_tag="RALTA_A0412"
FT   CDS_pept        421963..422739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0412"
FT                   /product="putative ABC transport system, inner membrane
FT                   component"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63080"
FT                   /db_xref="GOA:B2AH31"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63080.1"
FT                   /translation="MMMTLTSAQERRVQRVAPWLLLAAVLLLWQGACMAFDVSDFILPT
FT                   PSAIVAALADYADVIAGHAWRTFWTTMVGFGVAIGVGVLLGLAMGSSRLLYAASYPLMT
FT                   AFNALPKAAFVPILVVWFGLGAGPAILTAFLISFFPIMVNIATGLATLEPELEDVLRVL
FT                   GAKRRDVLFKVGLPRALPYFFASLKVAITLAFVGTTVSEMNAANEGIGYLLVSAGSAMK
FT                   MPLAFAGLVVIAVMAMAMYELFAVVEKRMTGWAHRG"
FT   gene            complement(422758..423528)
FT                   /locus_tag="RALTA_A0413"
FT   CDS_pept        complement(422758..423528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0413"
FT                   /product="putative transcriptional regulator, gntR ubiC
FT                   families"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63081"
FT                   /db_xref="GOA:B2AH32"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63081.1"
FT                   /translation="MQRDIDPVSAALGATSPRHLDLARTLMQEIVNGNPPVGALLPTEA
FT                   ELCETWNLSRYAVRQAVQKLTNLGMVSRQAGVGTRVISDRPQSRFTQLMDSPADLVSYA
FT                   KGTTLRTSAFGTVEADDTLAALLRCAPGASWLHIGGTRFDSAPGHEPIALVDIYVDRAY
FT                   GDLPPPGETLDVPVYTMVEKQYGIKITRVEQEVQGWLVEGAQAAALQVPDKSAGLRIIR
FT                   TYFLRDQAIIVTTGVHPASRFSYCSTYQLQQAGG"
FT   gene            423757..425256
FT                   /locus_tag="RALTA_A0414"
FT   CDS_pept        423757..425256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0414"
FT                   /product="putative AMP-dependent synthetase/ligase"
FT                   /function="1 : Metabolism"
FT                   /EC_number="6.2.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63082"
FT                   /db_xref="GOA:B2AH33"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63082.1"
FT                   /translation="MYPIDFLWRAAHRHPERTAIFSPDGQLSYRVLADTVLRRAAALVA
FT                   LDPVPRSRVCVGAANTVDHLVAILAILAAGKVWVPLNPRNGDPELRRIVDFVEPSLVLA
FT                   DAGMAGRLAGIAPPLRLLSDLGADGGDPAAVVMGPRGRGGVPLEAAQAVKFTGGSTGFP
FT                   KGVIQPLRAWNANIATQIHELGLTPADRYLVAAPITHGTSTYMLPLLGAGGALVFPESA
FT                   KPAGLLDAAQAHGATLFFAPPTLILALVEEQRRAPRALPALRYLVYGGAPMRPEQIRDA
FT                   QAVFGPVLCTSFGQTEAPQIITFLPPGEMHGERLASVGRPSLLTRVAIVDKSGNVLGAG
FT                   EEGEIAVRGDLVMSGYLKAETETRKTLVDGWLRTGDAGVLDEHGFLFLRDRIRDVIITG
FT                   GFNVYPGDVEVVLSAHPAVADCSVVGIPDAKWGEAVHAAVQLRPGMQVAADELIALVKR
FT                   ELGSVKTPKHIHVFQALPRSAVGKVLKPAVRESILSTWSAT"
FT   gene            425253..426077
FT                   /locus_tag="RALTA_A0415"
FT   CDS_pept        425253..426077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0415"
FT                   /product="putative citrate synthase"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /EC_number="2.3.3.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63083"
FT                   /db_xref="GOA:B2AH34"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63083.1"
FT                   /translation="MNSPDISPDMAPDISPNPSATPRTRLCRYTEQAVYYGEDDLVADL
FT                   LGQASFIDVFMKQTFGSVPGPAQRRIAEAVLVTLMEHGMTPSAIATRMIYSSSPENLQA
FT                   GVAAGLLAVASQFIGTMEPAAGLLDQIAAAGADGAAEARRIAREYRARREPVPGFGHHL
FT                   HRPDDPRALALLALARELGTHGARCAALEQLAAEVDAAAGRHITINATGAVAAVLGDIG
FT                   IPARLMRGFAVLSRAAGLIAHIAEEQREPSGRFVWRLVDEAMTPARSAGGPD"
FT   gene            426120..427079
FT                   /locus_tag="RALTA_A0416"
FT   CDS_pept        426120..427079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0416"
FT                   /product="Chlorohydroquinone/hydroquinone 1,2-dioxygenase
FT                   (Hydroquinone meta-cleavage dioxygenase)"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /EC_number="1.13.11.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15060023; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63084"
FT                   /db_xref="GOA:B2AH35"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63084.1"
FT                   /translation="MTTADRAIQRHHHITLSVGTAQQDYDFHTRVLSLKSVKKTLIYDG
FT                   GTPFYHLYYGNDLGEESTLITCFPVAHFGRKGTRGTGQIGSLALSVPVSAIPFWHKRLT
FT                   DHGFEVRRTERFGEVVLAFAHPCGVEYELIGIADDARTPYSNGEVPAEFAIRGLHTIAV
FT                   NVREMESSQQFMQEGWSGREVGRDGKYLRYAFGDGASGKLVDFALEPGLPQASWTYGEG
FT                   TVHHCAFQVEDRVVQDMVKARLEGLGLTDTSERKDRGYFESIYVRTPSGAMFEATVSKP
FT                   QAFLVDEPYESLGSTLQIAPQFESQRATILQSLESLHY"
FT   gene            427131..427790
FT                   /locus_tag="RALTA_A0417"
FT   CDS_pept        427131..427790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0417"
FT                   /product="putative Phospholipase/Carboxylesterase"
FT                   /function="1 : Metabolism"
FT                   /function="6.1 : Membrane"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63085"
FT                   /db_xref="GOA:B2AH36"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63085.1"
FT                   /translation="MPVLNPHLHTPLSVFDAPAGNARLAAILVHGRGQSPALMRELLVD
FT                   RLDCPQVAWFAPLAAENTWYPARFIAPLEANEPRLSQALARIEVLSEALLAMGFPYTSQ
FT                   VLVGFSQGACLCSEYLWRQRRRYAGLIAFTGGLIGPPGAPRECARPWLAGMPVLLSTWD
FT                   EDPHVPADSVRESAHWFRAAGADVSIRVEPGTEHGIRDREIAYANSFLAACVPDAS"
FT   gene            427811..428869
FT                   /locus_tag="RALTA_A0418"
FT   CDS_pept        427811..428869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0418"
FT                   /product="Maleylacetate reductase"
FT                   /function="1.1 : Carbon compound utilization"
FT                   /EC_number="1.3.1.32"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14766925; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63086"
FT                   /db_xref="GOA:B2AH37"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63086.1"
FT                   /translation="MQPFIHETRQSRIVFGTGAREHLLREVEQLGLRRVLVLTSPEQFA
FT                   LGRQMAELIGERSVGVYGHAVMHVPADVVRNAVDAVRRAGADGCVAAGGGSAMGLAKAI
FT                   ALEAGLPFIAVPTTYAGSEMTPLYAITEGGLKHTGRDWRVAPRTVIYDPELTLSLPPGL
FT                   AMTSGMNAIAHAAEGLYASDGNPVYALMAEEGIRALAGALRCLKRDACHAEARGDALYG
FT                   AWLCGMVLGNLQMGIHHKLCHTLGGSFNLPHAEVHTVVLPYAMAYNAAAAPQAMVRIAR
FT                   ALGSATAPEGLRELGAALGVPRSLREIGMPAHGLDHAADLVVAAPYPNPRPLERAAVRD
FT                   LLQRAYDGAAPA"
FT   gene            428916..429257
FT                   /locus_tag="RALTA_A0419"
FT   CDS_pept        428916..429257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63087"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63087.1"
FT                   /translation="MPTVIRAYFRTGIAAARLQHRPDHIRHIAAHLPEIVCAGALCDEA
FT                   QAPRGLFLAVQGDSAQARALIESDPYHRAGLFERVETEPFLQFVPHANPRLLDEELERA
FT                   LQSAAAAAT"
FT   gene            429372..430337
FT                   /locus_tag="RALTA_A0420"
FT   CDS_pept        429372..430337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0420"
FT                   /product="putative Glycosyl hydrolase, BNR repeat"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63088"
FT                   /db_xref="GOA:B2AH39"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63088.1"
FT                   /translation="MQRIKRYLLSGSAVAVIGGLLYAGLFIKPKPAGKALPQPLVERGD
FT                   AFYGMAVLPDGRMWAVGTNGKILHSDDAGQAWRLQRAAQRATLQDIAAWDARRAVAVGN
FT                   DGVILATADGGVNWQAARAPRSSISNKLMRVQAGQDGRAWAVGSGGVLLRSLDYGNSWE
FT                   SAAPVEDTAWNGVAFDGARGCVVGEFGRIRVTRDAGEHWTTVTSPARQSLMSVRMRDDG
FT                   HAVAVGLRGTVLVSSDAGTSWRAVASATQEDLFDVAWDGSQWVAVGDKGVVLLGGSDGA
FT                   AWRATRFDAMDRGWYTRVLAHGGKYYAAGSRLAAGAAKAL"
FT   gene            430386..431804
FT                   /pseudo
FT                   /locus_tag="RALTA_A0421"
FT   CDS_pept        430386..431804
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0421"
FT                   /product="putative exporter of the RND superfamily (part
FT                   1)"
FT                   /function="4.2.A.6 : The Resistance-Nodulation-Cell
FT                   Division (RND) Superfamily"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="PSEUDO:CAP63089.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            431585..432763
FT                   /pseudo
FT                   /locus_tag="RALTA_A0422"
FT   CDS_pept        431585..432763
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0422"
FT                   /product="putative exporter of the RND superfamily (part
FT                   2)"
FT                   /function="4.2.A.6 : The Resistance-Nodulation-Cell
FT                   Division (RND) Superfamily"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="PSEUDO:CAP63090.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            432820..434400
FT                   /locus_tag="RALTA_A0423"
FT   CDS_pept        432820..434400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0423"
FT                   /product="conserved hypothetical protein, DUF 1302"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63091"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63091.1"
FT                   /translation="MHWRGRRRRTSAAGLALALLAATPQLLAAEAAEAENAAAPAAQDA
FT                   GGDAKGEDYSFRVGGYARTWASFNLQNPPETGRDDRFAPSMLRGSLLLNADAKTGPVTW
FT                   KVVGRADGEYKTRYLKDLEQLNRTNSPGGPGSRLMDQYDNADLREYYMDFSPVERVNLR
FT                   IGKQQVVWGETDFFRALDLVHGFDYRWRSFLEREGDELRKPLFLVKAKVNVPEADGSLQ
FT                   LLYRPGLDRNRDIGNSYDLYGGRWAGQPYKGVDFLAPGALNYNYRQPGANVSDQTGGVR
FT                   WEGIAGPVNYSLAYLKTFSNDPVVNSAFAPSGQAPTGTLGDFIFPKLDLFGATASGYVP
FT                   AIDAVLSTELVYTRNAPYNIGTNFFGGALPGFGGIIKKDVVTTMFRMDKNLNLSRLLGT
FT                   SRPSFFSVQVFDKWIQNFRRSDDIVNLVGYGAAAKEHSTIATVILGLNYRNDKINPQLA
FT                   AGVDLQGRGGFLIPSVEFVYGDHWRLVLEADLFFAKNKRSAGQVEGSTRLFGTFANNSQ
FT                   FLARLTRQF"
FT   gene            434426..435682
FT                   /locus_tag="RALTA_A0424"
FT   CDS_pept        434426..435682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0424"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63092"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63092.1"
FT                   /translation="MIRIRKTIALCLLAVLGSASAASLAAELPAGTVIDKDNLDKIKSD
FT                   TFDGHTIASLLTEKLEWQIRNTGLKIPLGHAKPVQLDPKYLEATRKNAGKAQFDEKTRE
FT                   VTGWEAGIPFPQVSQNDPFAGDKLIWNFYYASPEGDVINNKVTFLMISGDKGLESTQDW
FT                   VFQRYYMKGRLSGDKPVLGDGSVLSKTLFAATAPEDIRGLGTFTIRYDSPKLEDSWAYI
FT                   KSARRTRRLSGGAWMDPVGGLDVLNDDIYVWNARPSWYPKIRLVGKRWILAISDAKLGY
FT                   TPSKKGTPDEWKTVDLKNAPYWNPVQTWQPREVWVIEGTPPGEHPYGKKVVYMDVNYPR
FT                   VYMGEAYDKKGEFWKFINFHMTPSTGEDGTKYSSSIQGDIIDFKARHASIYLFRGYKLN
FT                   EAKIKEADMNYSALESIAK"
FT   gene            435761..436219
FT                   /locus_tag="RALTA_A0425"
FT   CDS_pept        435761..436219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63093"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63093.1"
FT                   /translation="MEIKTMTDEQRKAVALEYFRRMDRGESVLDLFDEHAEFCFPKWGV
FT                   ARGRAQIEQLFGDLMGIVASVRHDIAHANYIQQGDLLVVEGTSAGSLVSGETWRADISH
FT                   AGRWCDVFEIRNFRIQRCYVYLDPDYGGQDVGRYPWLRQRHGGKAGFA"
FT   gene            436280..437224
FT                   /locus_tag="RALTA_A0426"
FT   CDS_pept        436280..437224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0426"
FT                   /product="putative TRANSCRIPTIONal REGULATOR, lysR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63094"
FT                   /db_xref="GOA:B2AH45"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63094.1"
FT                   /translation="MEIKWLEDFVSLAETHSFSRSAELRHVTQPAFSRRIQSLEAWVGT
FT                   ELIDRSSYPTSLTPAGKVFYEQALAMLAQVSETRALMRGQRSANAQVLEFAVPHTLSLT
FT                   FFPEWLKALERKLGTLPCRLRALNVHDAVLMLVEGGCDLVMVYHHARQAIQLDPARYDM
FT                   LVLGTERLSPYSVPDAAGKPLFRLPGTDKKPVPFLSYTPNAFLGRMVDLLLAETAEALK
FT                   LDKCYETDMAEALKVMALSGHGMAFLPESAVRDEVAAGRLVRAESARSLPLSIDMEIRL
FT                   YREKPGENGGERRAGARRKRQLVDQVWGTLTSA"
FT   gene            437342..438649
FT                   /gene="gdhA2"
FT                   /locus_tag="RALTA_A0427"
FT   CDS_pept        437342..438649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA2"
FT                   /locus_tag="RALTA_A0427"
FT                   /product="GLUTAMATE DEHYDROGENASE (NAD(P)+) OXIDOREDUCTASE"
FT                   /function="1.5.1.1 : Glutamate"
FT                   /EC_number="1.4.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63095"
FT                   /db_xref="GOA:B2AH46"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63095.1"
FT                   /translation="MSSAAPTNTAGQKHALPSYLNADNLGPWGIYLQQVDRVTPYLGSL
FT                   ARWVETLKRPKRALVVDVPIELDNGTIAHFEGYRVQHNLSRGPGKGGVRFHQDVTLSEV
FT                   MALSAWMSVKNAAVNVPYGGAKGGIRVDPRTLSQAELERLTRRYTSEINIIIGPSKDIP
FT                   APDVNTNAQVMAWMMDTYSMNSGSTSTGVVTGKPISLGGSLGRHEATGRGVFVVGSEAA
FT                   RNIGLEVKGARVAVQGFGNVGAVAAKLFHEAGAKVVAVQDHRTTLFDPAGLDVPAMMEH
FT                   ASHSGTIDGFRGEVLRSEQFWEVDCDILIPAALEGQITAENAPKITAKLVIEGANGPTT
FT                   PQADDILRERNILVCPDVIANAGGVTVSYFEWVQDFSSFFWTEEEINQRLVRIMQEAFR
FT                   AIWQVAQENKVTLRTAAFIVACTRILQAREMRGLYP"
FT   gene            438916..439815
FT                   /gene="gltI1"
FT                   /locus_tag="RALTA_A0428"
FT   CDS_pept        438916..439815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltI1"
FT                   /locus_tag="RALTA_A0428"
FT                   /product="glutamate/aspartate transport protein; ABC
FT                   superfamily, periplasmic binding component"
FT                   /function="1.5.1.1 : Glutamate"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /function="7.2 : Periplasmic space"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63096"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63096.1"
FT                   /translation="MNFAKLAALMIAGGVMCGTAQAAEQLTGTLKKIKDTGVITLGVRE
FT                   SSIPFNYNLGGVRQVGYSYDINMKIVEAIKDQLKLPNLQVKEIPITSQNRITLLQNGTI
FT                   DIECGSTTNNLERQKQVAFTNSIFIIGTRIMVKKDAGIKDWADLKGKNVVTTAGTTSER
FT                   LLRKMNDDQKLGMNIISTKDHGQSFLTLESGRAVAFMMDDALLYGERAKAKNPADWIVV
FT                   GKPQSRESYGCMIRKDDPQFKKLSDTVISGMMKDGSINTLYTKWFMQPVPPKGLNLDFP
FT                   LSEDMKALIKAPNDKALD"
FT   gene            439878..440606
FT                   /gene="gltJ"
FT                   /locus_tag="RALTA_A0429"
FT   CDS_pept        439878..440606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltJ"
FT                   /locus_tag="RALTA_A0429"
FT                   /product="glutamate/aspartate transport protein; ABC
FT                   superfamily, membrane component"
FT                   /function="1.5.1.1 : Glutamate"
FT                   /function="1.5.1.5 : Aspartate"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63097"
FT                   /db_xref="GOA:B2AH48"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63097.1"
FT                   /translation="MNYNWHWGVFLEQAAQNETYLDWMISGLKVTLALGLSSWVIALVI
FT                   GSVLGVLRTVPNKWLAGIAATYVEIFRNIPLLVQLFIWYFVMPELLPGGEAIKQMNPFA
FT                   QQFLAAMLCLGTFTAARVCEQVRSGINSLARGQKNAGLAMGFTLPQTYRHVLLPMAFRV
FT                   IVPPLTSEFLNIFKNSAVASTIGLLELAAQGRQLVDYTARPYESFIAVTLMYALINVTV
FT                   MLLMRWVEARTRVPGFIGGK"
FT   gene            440616..441299
FT                   /gene="gltK"
FT                   /locus_tag="RALTA_A0430"
FT   CDS_pept        440616..441299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltK"
FT                   /locus_tag="RALTA_A0430"
FT                   /product="glutamate/aspartate transport protein; ABC
FT                   superfamily, membrane component"
FT                   /function="1.5.1.1 : Glutamate"
FT                   /function="1.5.1.5 : Aspartate"
FT                   /function="4.3.A.1.m : membrane component"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63098"
FT                   /db_xref="GOA:B2AH49"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63098.1"
FT                   /translation="MAYSFDFTSINPATLHVLGEGMMVSLKITVTAVVVGIIWGTILAM
FT                   MRLSSFRLLNWFAQGYVTIFRSIPLVMVLLWFFLIIPQVLQSIFNLSPATDLRMTSALV
FT                   AFALFEAAYYSEIIRAGIQSVSRGQMFAAQALGMTYGQSMRLVILPQAFRNMVPLLLTQ
FT                   GIILFQDTSLVYVSALADFFGQAYGIGERDGRIVEMLLFAGLVYFIICFSASLLVKRYQ
FT                   KKVAV"
FT   gene            441296..442030
FT                   /gene="gltL"
FT                   /locus_tag="RALTA_A0431"
FT   CDS_pept        441296..442030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="RALTA_A0431"
FT                   /product="glutamate/aspartate transport protein; ABC
FT                   superfamily, atp_binding component"
FT                   /function="1.5.1.1 : Glutamate"
FT                   /function="1.5.1.5 : Aspartate"
FT                   /function="4.3.A.1.a : ATP binding component"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63099"
FT                   /db_xref="GOA:B2AH50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63099.1"
FT                   /translation="MIEINNVSKWYGSFQVLTDCTTKVAKGEVVVVCGPSGSGKSTLIK
FT                   TVNALEPFQKGDILVDGTSVGNPKTNLPKLRSRVGMVFQNFELFPHLSITENLTIAQMK
FT                   VLGRSKDEAMAKGLKYLERVGLKSQADKYPGQLSGGQQQRVAIARALSMDPICMLFDEP
FT                   TSALDPEMVNEVLDVMVQLAQEGMTMMCVTHEMGFARKVANRVIFMDQGKIVEDADKEE
FT                   FFGNIDARSERARQFLSKILHH"
FT   gene            complement(442112..442942)
FT                   /locus_tag="RALTA_A0432"
FT   CDS_pept        complement(442112..442942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0432"
FT                   /product="putative glutamine amidotransferase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63100"
FT                   /db_xref="GOA:B2AH51"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63100.1"
FT                   /translation="MCQLLGMNCATPTDVTFSFTGFAARGGVTDHHADGFGVAFFEDKA
FT                   CRLFIDNQSAGTSPVADLIKRYPIKSKNVISHIRKATQGTVLLENCHPFMRELWGRHWI
FT                   FAHNGDLHGFTPFLSGVYQPVGDTDSELAFCTLMQGLRKRFPGSQPPLNELGHALADIT
FT                   REITLHGVFNYLLCNGQALFAHCSTRLYYIVRQWPFSTAHLIDADLSIDFAQVTTPDDR
FT                   VAVIATAPLTDNETWTQFAPGELIMFEDGRPTMTLSVPIPPEVQAKNAANTACT"
FT   gene            443154..444173
FT                   /gene="ttuC3"
FT                   /locus_tag="RALTA_A0433"
FT   CDS_pept        443154..444173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttuC3"
FT                   /locus_tag="RALTA_A0433"
FT                   /product="tartrate dehydrogenase"
FT                   /function="1.7.21 : Glyoxylate degradation"
FT                   /EC_number="1.1.1.93"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7592429; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63101"
FT                   /db_xref="GOA:B2AH52"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63101.1"
FT                   /translation="MPEGIRVMDAAARRFGIDFQWDHFDFSSCDYYARHGKMLPDDWFD
FT                   TLVKYDAIYFGAVGWPDAVPDHVSLWGSLLQFRRSFDQYVNLRPVRLMPGIRSPLAGRQ
FT                   PGDIDFYVVRENTEGEYSSIGGRMFPGTEREIVVQETVMSRTGVDRILKFAFELAQKRP
FT                   KKHLTSATKSNGISITMPYWDERVEAMAANYPGIKVDKYHIDILTAHFVQHPDWFDVVV
FT                   ASNLFGDILSDLGPACTGTIGIAPSGNINPDRTFPSLFEPVHGSAPDIAGRGVANPIGQ
FT                   IWCGAMMLEHLGHDEAGAAVLGAIENVLAAGPEHAPLTRDIGGKAGTADLGRAIAEAL"
FT   gene            444170..445477
FT                   /gene="ttuD3"
FT                   /locus_tag="RALTA_A0434"
FT   CDS_pept        444170..445477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttuD3"
FT                   /locus_tag="RALTA_A0434"
FT                   /product="HYDROXYPYRUVATE REDUCTASE OXIDOREDUCTASE PROTEIN"
FT                   /function="1.7.21 : Glyoxylate degradation"
FT                   /EC_number="1.1.1.81"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7592429; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63102"
FT                   /db_xref="GOA:B2AH53"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63102.1"
FT                   /translation="MSAAFAGDARALLLETFQAAVAAADPLQIVAQHLPAPHAGGRTLV
FT                   VGAGKAAASMAAAVERAYAGKATLEGLVVTRYAHGMPTDHIRVIEAGHPVPDESGEQAA
FT                   AEILAAVQSLTPQDRLLVLVSGGGSSLLSLPAEGIPMADLKATTRELLRCGAPITDMNI
FT                   VRKHISRIQGGRLAQASQAPVTTLIVSDVAGDDPSAIASGPTVADPSTFDDALQILRRY
FT                   GAEVPASVQSHLERGARGEVPETPKPGDALFDRVDNIMIATAHGSLEAAAALFRQRGIT
FT                   PVVLGDTVTGEAREVARVYAALVREIRAYNAPFATPVALISGGECTVTLPAGGGASKAR
FT                   GGRCSEFLLSLAVELAGMPDVYAIAADTDGIDGSEDNAGALADPTTLARAEAAGMPGQR
FT                   QLDAHDAWALFDAIGDLVVTGPKRTNVNDYRAILIL"
FT   gene            445523..446557
FT                   /gene="pyrC"
FT                   /locus_tag="RALTA_A0435"
FT   CDS_pept        445523..446557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="RALTA_A0435"
FT                   /product="dihydro-orotase"
FT                   /function="1.5.2.2 : Pyrimidine biosynthesis"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.5.2.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11401542; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63103"
FT                   /db_xref="GOA:B2AH54"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63103.1"
FT                   /translation="MTQKLTITRPDDWHLHLRDGAALAAVLPDTARQFARAIVMPNLKP
FT                   PVTTVAQAQAYRARILAALPAGMQFEPLMTLYLTDNTGPEEIAAARASGFVHGVKLYPA
FT                   GATTNSDAGVTDIRRCYPALEAMQRAGLPLLVHGEVTDPAIDIFDREAVFIERVMTPLR
FT                   RDMPELKVVFEHITTKDAAQYVRDASGPVGATITAHHLLYNRNAIFTGGIRPHYYCLPV
FT                   LKRETHREALVAAATSGSERFFLGTDSAPHARGLKEHACGCAGCYTALHAMELYAEAFD
FT                   AAGALDKLEAFASFNGPAFYGLPRNTGTLTLEREDWELPAELPYGDTTLVPLRGGETLR
FT                   WKAR"
FT   gene            446562..447401
FT                   /locus_tag="RALTA_A0436"
FT   CDS_pept        446562..447401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63104"
FT                   /db_xref="InterPro:IPR021390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63104.1"
FT                   /translation="MRTQQTAAGEPFAAALAGIDWSRPWFQPFAPRGAALAEAVQGGAD
FT                   LRALLDAQSVASGLHNARGLPLRFVPQQALPEGRAYEAHIDATGEVPTRDNLHDFFNAL
FT                   VWLHFPRAKRVLNQIQAAVIAREGVRTARGGVRDAATLFDENAVLFLSEGDEHAEALRG
FT                   FAWQQLFVAQRHAWGTACRVVPFGHALLEKLVQPYKAVTAHAWTLPLVAGGALDKAVAL
FT                   SLQEAAADGTLRGGRCFAPLPVMGIPGWCDDNASPDFYADITVFRPGRMRDLQRQPD"
FT   gene            447469..447749
FT                   /locus_tag="RALTA_Amisc_RNA_2"
FT   misc_RNA        447469..447749
FT                   /locus_tag="RALTA_Amisc_RNA_2"
FT                   /product="RNaseP_bact_a"
FT                   /inference="profile:Rfam:8.0"
FT   gene            complement(447821..448243)
FT                   /locus_tag="RALTA_A0437"
FT   CDS_pept        complement(447821..448243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0437"
FT                   /product="conserved hypothetical protein; Predicted redox
FT                   protein, regulator of disulfide bond formation; osmC-like
FT                   motif"
FT                   /function="5.5 : Adaptation to stress"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63105"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63105.1"
FT                   /translation="MECKVTWMGADGMSFVAQTGSGHIVAMDGAPEGGGHNLAPRPMEM
FT                   VLLGTGGCTAYDVVLILKRGRQDVTGCSVQLQAERAGEDPKVFTRIKFHFVVTGKNLNP
FT                   ATVERAIKLSHEKYCSASIMLAKTAEITHTLEIVEG"
FT   gene            448972..449400
FT                   /gene="rplM"
FT                   /locus_tag="RALTA_A0438"
FT   CDS_pept        448972..449400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="RALTA_A0438"
FT                   /product="50S ribosomal subunit protein L13"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="6.6 : Ribosome"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63106"
FT                   /db_xref="GOA:B2AH57"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63106.1"
FT                   /translation="MKTFSAKPHEVKRDWYVIDATDKVLGRVASEVARRLRGKHKPEFT
FT                   PHVDTGDYIIIVNAAKLRVTGTKETDKKYYRHSGYPGGIYETTFGKMQQRFPGRALEKA
FT                   VKGMLPKGPLGYAMIKKLKVYAEAEHPHEAQQPKALEI"
FT   gene            449413..449805
FT                   /gene="rpsI"
FT                   /locus_tag="RALTA_A0439"
FT   CDS_pept        449413..449805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="RALTA_A0439"
FT                   /product="30S ribosomal subunit protein S9"
FT                   /function="2.3.2 : Translation"
FT                   /function="2.3.8 : Ribosomal proteins"
FT                   /function="6.6 : Ribosome"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63107"
FT                   /db_xref="GOA:B2AH58"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63107.1"
FT                   /translation="MIGNWNYGTGRRKSAVARVFIKSGKGDIVVNGKPIKEYFARETSL
FT                   MIVRQPLELTAHAETFDIKVNVTGGGETGQAGAVRHGITRALIDYDATLKSALSKAGYV
FT                   TRDAREVERKKVGFHKARRRKQFSKR"
FT   gene            450064..450540
FT                   /locus_tag="RALTA_A0440"
FT   CDS_pept        450064..450540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0440"
FT                   /product="conserved hypothetical protein, DUF583"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63108"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63108.1"
FT                   /translation="MLFSKKKGLSIDTLIGEDTAIDGDLVFAGGLRLDGRVRGNVTAAP
FT                   GKASMLVVSEKGMVEGEISVGHLVLNGTVKGPVHAADLLELQPQARVLGDVRYAALEMH
FT                   QGALVEGRLMPLVQGEVKALPNLVEAAPVDEVTEAAAVDGETPAAEAGPTEKAA"
FT   gene            450643..451011
FT                   /locus_tag="RALTA_A0441"
FT   CDS_pept        450643..451011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0441"
FT                   /product="conserved hypothetical protein, HesB family"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63109"
FT                   /db_xref="GOA:B2AH60"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63109.1"
FT                   /translation="MNAVAEAPVTEDVPAPFVFTDSAADKVKQLIEEEGNAELKLRVFV
FT                   QGGGCSGFQYGFTFDEEVNEDDTTMVKNGVTLLIDSMSYQYLVGAEIDYKEDINGAQFV
FT                   IKNPNASTTCGCGSSFSV"
FT   gene            complement(451072..451869)
FT                   /locus_tag="RALTA_A0442"
FT   CDS_pept        complement(451072..451869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0442"
FT                   /product="putative deoxygenase, Phytanoyl-CoA dioxygenase
FT                   family"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63110"
FT                   /db_xref="GOA:B2AH61"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63110.1"
FT                   /translation="MEITREQIDTYQRDGVLVLRGAFTDWVERLREGFAQNLAEPGPFA
FT                   IENVRAGEGGRFFEDYCNWQRIAPFAAFIRESAAAGIAGRIMQSQAVQVFHEHILVKEP
FT                   GTAKPTPWHQDLPYYCVDGTQTASYWIPLDPVTQANTLRVVAGSHRWPRLVRPKRWASN
FT                   ENFYGGDDAFMEMPDVEDGSHTLLAPELEPGDAVVFDFRTVHGAAGNTGSGRRRAFSAR
FT                   FLGDDVRFMQRPGRTSPPFPGIGQQTGERLREDWFPVVWRAAQ"
FT   gene            451961..452875
FT                   /locus_tag="RALTA_A0443"
FT   CDS_pept        451961..452875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0443"
FT                   /product="putative transcriptional regulator, lysR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63111"
FT                   /db_xref="GOA:B2AH62"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63111.1"
FT                   /translation="MIPFSFRQLEYFVAAAEHGSISAAARARHVSQPSVSTAIAQLEAT
FT                   LGEPLFRRQVSRGLSLTPAGQRLLGRARDVLALAAGLAADDGAGRGLSGQLSLTCFQDL
FT                   GPYFVPRLLAGLRERHPGISVTLFEADLAAVHRTLQAGKAELAVTYELGLDARTERRTL
FT                   AELAPYALLPAGHALAGGADVSLADLAAERLILEDIPQTREYFLSLFWAHGLRPALHQY
FT                   TQTFEMQRGLVAHGYGVALSCTRPAGDHSYDGVPIACLPLREPVTPQRVVLARSPAMRA
FT                   SPLAQAFMDWVDTGADRAAGQRG"
FT   gene            complement(452863..453990)
FT                   /locus_tag="RALTA_A0444"
FT   CDS_pept        complement(452863..453990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0444"
FT                   /product="conserved hypothetical protein, UPF0075"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63112"
FT                   /db_xref="GOA:B2AH63"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63112.1"
FT                   /translation="MIPAPGSERYIGIMSGTSMDGADAVLVDFSGARPAVLAASSQPFP
FT                   DTLRAAFGALQQPGEDEIHREALAANALAQVYAACVAALLREARIDAASVAAIGAHGQT
FT                   IRHRPGLYDGIGYTRQSQHPARLAELTGIDVVADFRSRDLAAGGQGAPLVPALHHALFG
FT                   SEAEIRVACNIGGISNISILPAAGGPVSGFDCGPGNALLDYWIGRHRGLAFDSNGDWGA
FT                   SGRVDAALLAQCLAEPYFSAPPPKSTGRDLFHPGWLEARLAAFPALAPADVQATLAALT
FT                   AEAIARDVRACAPAARRLIVCGGGARNAFVMARLAQALPGVAIETSDDYGVPVSQVEAI
FT                   AFAWLARQCLLRLPGNVPTVTGAAGPRVLGAIYPR"
FT   gene            complement(454001..455392)
FT                   /locus_tag="RALTA_A0445"
FT   CDS_pept        complement(454001..455392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0445"
FT                   /product="putative metallopeptidase, M23B family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63113"
FT                   /db_xref="GOA:B2AH64"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63113.1"
FT                   /translation="MWSRLREVFARELVVLVDPTNPQHARRRKQLTASVGAIFTLGMAA
FT                   AMGVAPRSAYDDPRAPRTQQVLRMPDVREQLEQLTDTEAVYVREERMQRGDTIASLLKR
FT                   LGVDDADAQAFIVKNPTARGLFNLNPGQAVQAEIDESNTLVSLQANLGGDAAASRELVI
FT                   ERVRVASGDTAAAYKAKVQRVDNDVHYEMASGAISSGGFFKAMDAANVPDEVVQQMLSI
FT                   FSGVIDFHHDIAAGDRFRIIYEAGFRDGTFVRNGRVVAVELINRNQLHQALWFAPEGSK
FT                   DSGAYYTFDGRSMKRPFLRSPVEFSRVSSGFGGREHPLHHDWAQHKGVDFAAPTGTKVL
FT                   ATGDGVVEFVGQQNGYGNIVILSHPNGYSTYYAHLSGFAGMRQGQAVRQGQLIGYVGAT
FT                   GWATGPHLHYEFRFNDVPQNPLTVTLMESPPLTGKSRQEFLTYTSGLLSRINALRTYNV
FT                   LTAAN"
FT   gene            455643..456884
FT                   /gene="tyrS"
FT                   /locus_tag="RALTA_A0446"
FT   CDS_pept        455643..456884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="RALTA_A0446"
FT                   /product="TYROSYL-TRNA SYNTHETASE"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /EC_number="6.1.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7517395; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63114"
FT                   /db_xref="GOA:B2AH65"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63114.1"
FT                   /translation="MTEVASAAPAKYPLTPSVMQALEVSRRGCDELLIESEWAQKLARS
FT                   EATGVPLRIKLGLDPTAPDIHIGHTVVLNKLRQLQDLGHQVIFLIGDFTSTIGDPSGRN
FT                   STRPPLTREQIEANAQTYYRQASLVLDPARTEIRYNSEWCDPLGARGMIQLAAKYTVAR
FT                   MMERDDFTKRFRSGIPISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLLVGRELQKE
FT                   YGQEPQCILTMPLLVGLDGVEKMSKSKGNYVGVTEAPNEMFGKLMSISDDLMWQYFTLL
FT                   SFRPMSEIDLMKQEIAAGRNPRDCKVLLAQEIVARFHSQADAEKALEDFNHRARGGVPD
FT                   DIPAVSLEGAPLGIAQLLKQANLVPSTSEANRNIEQGGVKIDGATVSDKATRVAAGTYV
FT                   VQVGKRRFARVTLA"
FT   gene            456892..457353
FT                   /gene="dtd"
FT                   /locus_tag="RALTA_A0447"
FT   CDS_pept        456892..457353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="RALTA_A0447"
FT                   /product="D-Tyr-tRNA(Tyr) deacylase"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="5.6.2 : Detoxification (xenobiotic metabolism)"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11568181; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63115"
FT                   /db_xref="GOA:B2AH66"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63115.1"
FT                   /translation="MIALIQRVAQARVTVAGRTTGEIGAGLLALVCAERGDTEAQAERL
FT                   LAKMLSYRVFSDADGKMNLPVQNMDGNGNPGGLLVVSQFTLAADTNSGTRPSFTPAASP
FT                   EDGRRLYEHFVAQARAAHPQVQTGEFGAMMQVSLVNDGPVTFWLRVPPA"
FT   gene            457413..458072
FT                   /locus_tag="RALTA_A0448"
FT   CDS_pept        457413..458072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0448"
FT                   /product="putative Phosphatidylethanolamine-binding
FT                   protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63116"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63116.1"
FT                   /translation="MKLWSKSFQDNAPIPGEFAFCVPDAAAHVALSNNRNPDLHWDDAP
FT                   AETRSFVLICHDRDVPSRGDDVNQEGREVPASLPRVDFFHWVLVDIPPGLTSIAAGSHS
FT                   DGVIARGKPGPEATGGTATAGGLRHGINDYTGWFAGDADMKGDYYGYDGPCPPWNDTLL
FT                   HHYVFTLYALDIDRLPLEGTFTGTQVREAIQGHVLAQASLTGTYTLNPKLATSSAA"
FT   gene            458160..458834
FT                   /locus_tag="RALTA_A0449"
FT   CDS_pept        458160..458834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0449"
FT                   /product="putative PHOSPHOGLYCERATE MUTASE"
FT                   /function="1.7.8 : Gluconeogenesis"
FT                   /function="1.3.1 : Glycolysis"
FT                   /EC_number="5.4.2.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63117"
FT                   /db_xref="GOA:B2AH68"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63117.1"
FT                   /translation="MSQSPGPHSLAFTHLIVIRHGETAWNRERRLQGQLDIPLNETGHA
FT                   QARALAHALAGEPIDAVYSSDLSRAMATAAPLAQALGLQVRPDARLRERSYGSLQGKTY
FT                   AEVAEHLPEDFARWQARVPDYAPPEGESLLGFHERTVDAVLALSRRHPGERIALVAHGG
FT                   VLDCLYREATGMTLEAPRQHELLNASVNRLRSDSTHLTLAQWGDVSHLENLALDEVDRR
FT                   VP"
FT   gene            complement(458843..459568)
FT                   /locus_tag="RALTA_A0450"
FT   CDS_pept        complement(458843..459568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0450"
FT                   /product="putative membrane lipoprotein, DUF165"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63118"
FT                   /db_xref="GOA:B2AH69"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63118.1"
FT                   /translation="MSATTAGPPQAGRVYRYYDFVMVAFVTVLLCSNLIGAAKAAQVTL
FT                   PLIGTVTFGAGVLFFPISYIFGDVLTEVYGYGRDRRVVWAGFAALAFATFMSLVVLNMP
FT                   VAPFMADYQKSLQDVFGNTWRIALGSLVAFCCGSFANSYVLAKMKLWTAGRWLWTRTIG
FT                   STLAGELVDSSLFYVIAFYGIWPIEQVIQVAVAQYVLKTGWEVVMTPVTYKVVGFLKRA
FT                   ENEDYFDRHTNFTPFRVRV"
FT   gene            complement(459759..460343)
FT                   /locus_tag="RALTA_A0451"
FT   CDS_pept        complement(459759..460343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0451"
FT                   /product="putative lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63119"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63119.1"
FT                   /translation="MNRRHFVTRVAGSGLLVATAMAAGCTTTGTGASKDPVAKKQEIDA
FT                   GVDGALNRLFSSANGSRELAQRAQGILVFPRVLAGGFIVGAEYGEGALRSKGATVGYYS
FT                   TTQASVGLTAGGQSKAVIIMFMTPEAYNKFVASKGWTAGADANVAVAKIGADGRLDTLT
FT                   SQQPVIAFVQTNAGLMFDVSVNGSKISKLDI"
FT   gene            complement(460388..460981)
FT                   /locus_tag="RALTA_A0452"
FT   CDS_pept        complement(460388..460981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0452"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63120"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63120.1"
FT                   /translation="MIRQCSRLLAALLALTAFTAGSANAQRPPAPVGVAEEAVISGKIV
FT                   DIDPETKAVLVQGPRGNVVELVGGDEVRNFGQIRKGDILTVARGAALVAALEPVDSKAT
FT                   ALAESVDRTTRAAEGGKPGIMREITTTVTAQITKIDPAKRQITFRGPRETLRTVKVQDP
FT                   AIDLKGIKQGQMAKIVYREVVAITVRAPAAAAAN"
FT   gene            complement(461180..462244)
FT                   /gene="ruvB"
FT                   /locus_tag="RALTA_A0453"
FT   CDS_pept        complement(461180..462244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="RALTA_A0453"
FT                   /product="ATP-dependent DNA helicase, subunit B of RuvABC
FT                   Holliday junction resolvasome"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="5.8 : SOS response"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="3.1.22.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10851230; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63121"
FT                   /db_xref="GOA:B2AH72"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63121.1"
FT                   /translation="MIETDKLAAPARVIAATPASSQEEAFERALRPKLLDEYVGQEKVR
FT                   GQLDIFMHAARKRREALDHVLLFGPPGLGKTTLAHIIAREMGVSLRQTSGPVLERPGDL
FT                   AALLTNLEANDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSVKLDLQPFT
FT                   LVGATTRAGMLTNPLRDRFGIVARLEFYTAEELARIVTRSAQLLQARIDPQGALEIARR
FT                   ARGTPRIANRLLRRVRDYAEVKGDGTITREMADAALAMLDVDRVGFDLMDRKLLEAVLH
FT                   KFGGGPVGVDNLAAAIGEERDTIEDVLEPYLIQQGYLQRTPRGRVATAAAYRHFGLASP
FT                   QGMAGDAGELFGDA"
FT   gene            complement(462304..462885)
FT                   /gene="ruvA"
FT                   /locus_tag="RALTA_A0454"
FT   CDS_pept        complement(462304..462885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="RALTA_A0454"
FT                   /product="subunit A of RuvABC Holliday junction
FT                   resolvasome, regulatory subunit"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="5.8 : SOS response"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10851230; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63122"
FT                   /db_xref="GOA:B2AH73"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63122.1"
FT                   /translation="MIGRIAGTLIEKNPPHLLVDCHGVGYEIDVPMSTFYNLPAVGQPV
FT                   TLLTQLIVREDAHLLYGFGSAAERNTFRELIKITGIGARMALAVLSGMSVPELAQAITL
FT                   QEAGRLTRIPGIGKKTAERLLLELKGKLGAELGHAPGTPAVPDSAVDVLNALLALGYSE
FT                   KEAAAAIKQVPAGTGVSEGIKLALKALSKA"
FT   gene            complement(462958..464226)
FT                   /locus_tag="RALTA_A0455"
FT   CDS_pept        complement(462958..464226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0455"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /function="1.6.1 : Phospholipid"
FT                   /EC_number="3.1.4.46"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63123"
FT                   /db_xref="GOA:B2AH74"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63123.1"
FT                   /translation="MAPPQERCMPSPSRPCAPRPRASFARVVAACRRWLLPAAAAAACA
FT                   ALAAGCATAPRPKRAAPAAPPAPAPAASAPASAPAAQPKPLVIAHRGASALRPEHTLAA
FT                   YAKAIEDGADAIEPDLVMTRDGVLVARHENDITGTTNVAELPQFAERKRTKVIDGERLT
FT                   GWFTEDFTLAELKTLRARERIPRLRPANARLNDQFEVPTFDEIVRLAEQAALRTGKPVG
FT                   IYAELKHPSYFRGIGLPLEDKLAAAVRAQPYLRNAPVFIQCFESGSLRALRRTLGNGLP
FT                   NVKLVQLIGNPRKGPADWKLAGDGRTFGDMLSTTGLREVAAYADGIGPEKSSVVPRDAQ
FT                   GALGAPTAVVQQAHAAGLFVHPYTFRPENSFLPKALQSGGDEATRSPAGMEREVQAFVA
FT                   AGIDGFFTDDPALGRRAVDTPAR"
FT   gene            complement(464289..464834)
FT                   /gene="ruvC"
FT                   /locus_tag="RALTA_A0456"
FT   CDS_pept        complement(464289..464834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="RALTA_A0456"
FT                   /product="endodeoxyribonuclease, subunit C of RuvABC
FT                   Holliday junction resolvasome"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="7.1 : Cytoplasm"
FT                   /function="5.8 : SOS response"
FT                   /EC_number="3.1.22.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10851230; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63124"
FT                   /db_xref="GOA:B2AH75"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63124.1"
FT                   /translation="MRILGIDPGLRTTGFGVIEKQGNKLAYIASGTIKSDGNANLPERL
FT                   KTLYDGISEVSRTYAPDCAAIEKVFVNVNPQSTLLLGQARGAAICGLVGYGLPVFEYTA
FT                   LQLKVAVVGYGRANKAQVQEMVTRLLMLPGQPGSDAADALGVAICHANGGDTLGTLAGL
FT                   APDLVRKGMRVRRGRLVG"
FT   gene            complement(464989..466563)
FT                   /gene="purH"
FT                   /locus_tag="RALTA_A0457"
FT   CDS_pept        complement(464989..466563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="RALTA_A0457"
FT                   /product="bifunctional: IMP cyclohydrolase (N-terminal);
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase
FT                   (C-terminal)"
FT                   /function="1.5.2.1 : Purine biosynthesis"
FT                   /function="1.7.33 : Nucleotide and nucleoside conversions"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63125"
FT                   /db_xref="GOA:B2AH76"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63125.1"
FT                   /translation="MIKQALLSVSDKTGIVEFARELNALGVTLLSTGGTAKLLADSGLP
FT                   VTEVADYTGFPEMLDGRVKTLHPKVHGGILARRDLPEHMAALAEHDIPTIDLLVVNLYP
FT                   FQQTVAKDDCTLPDAIENIDIGGPTMLRSAAKNHRDVTVIVDPADYAVVLGEMRANGNS
FT                   VGYDTNFRLATKVFAHTAQYDGAITNYLTSLGADKSHQARSAYPQTLNLAFDKVQEMRY
FT                   GENPHQSAAFYRDLKAVDGALANYVQLQGKELSYNNIADADAAWECVKSFDAAAAAACV
FT                   IIKHANPCGVALGANALEAYDKAFKTDSTSAFGGIIAFNVELDEAAAQAVAKQFVEVLI
FT                   APSFSAAARAVFAAKQNVRLLEIPLGKGINQYDFKRVGGGLLVQSPDAKNVQPSELRVV
FT                   TRRHPTPKEMDDLMFAWRVAKFVKSNAIVFCGGGMTLGVGAGQMSRVDSARIASIKAQN
FT                   AGLTLAGSAVASDAFFPFRDGLDVVVDAGATCVIQPGGSVRDDEVIAAADEHGIAMVLT
FT                   GTRHFRH"
FT   gene            complement(466586..466819)
FT                   /locus_tag="RALTA_A0458"
FT   CDS_pept        complement(466586..466819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0458"
FT                   /product="putative transcriptional regulator, FIS family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63126"
FT                   /db_xref="GOA:B2AH77"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63126.1"
FT                   /translation="MSRNAIDQCIRESLDTYFRDLDGEEPSNMYNMVLEAVERPLLEAV
FT                   MVRAERNQSLAAAYLGINRNTLRKKLQQHGLL"
FT   gene            complement(466816..467877)
FT                   /gene="dusB"
FT                   /locus_tag="RALTA_A0459"
FT   CDS_pept        complement(466816..467877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="RALTA_A0459"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /function="2.3.2 : Translation"
FT                   /function="6.6 : Ribosome"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11983710; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63127"
FT                   /db_xref="GOA:B2AH78"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63127.1"
FT                   /translation="MQIGPHQLRNNLFVAPMAGVTDRPFRQLCKQLGAGYAVSEMVASN
FT                   AQLWKSEKTMRRANHAGEVEPIAVQIAGAEPSMMAEAARYNVDRGAQIIDINMGCPAKK
FT                   VCNVAAGSALLQNEPLVVRIVEAVVAAVGDRVPVTLKIRTGWNRENRNALRVAQMVQDA
FT                   GISMLTIHGRTRADLYHGDAEYETIAAVKAAVSIPVVANGDITTPQKAKQVLALTGADA
FT                   IMIGRAAQGRPWLFREIEHFLKTGEMLPSPEVAEIRAIMNAHLEDHYAFYGEFTGVRTA
FT                   RKHIAWYTRGLRGANLFRHRMNTLESTAEQLAAVNAFFDEQAQISDRLVYVDDAGPDKD
FT                   EANNNKNGELLAA"
FT   gene            complement(468200..469438)
FT                   /gene="ubiH"
FT                   /locus_tag="RALTA_A0460"
FT   CDS_pept        complement(468200..469438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="RALTA_A0460"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase,
FT                   FAD/NAD(P)-binding"
FT                   /function="1.3.6 : Aerobic respiration"
FT                   /function="1.5.3.11 : Menaquinone (MK), ubiquinone (Q)"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63128"
FT                   /db_xref="GOA:B2AH79"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63128.1"
FT                   /translation="MPAPQPDFGGPADIAIVGGGPVGLALACQLLRTTGWRMVLVDAAT
FT                   PARAARDPRAIALSHGSRQLLEQIGAWPVPGSPIEHIHVSQRGRFGHVRLHHDDYGVPA
FT                   LGYVVRYGELCNVLERALAQAAQAAGEGRLRRAFETRIERIEQDPVPRGADVADAGMVQ
FT                   LQGTGPDGQAARFAARLAVQAEGGLFHEQAAHQGRGARTRDYRQTAVIAHVTCSRPQPG
FT                   WAWERFTEEGPLALLPHEEHGTPGYALVWCCPPEQAARRLALPEAQFAAELGRAFGDRM
FT                   GQFALAGKRHAFPLGLNAAPVTVNGRVVAVGNAAQTLHPVAGQGLNLGLRDAFALADSL
FT                   RGACTPQALQAFAGRHRLDRAVTIGVTDLLPRVFGIAYPLAAHARGASLAALACLPPLR
FT                   HALARHMMFGMRR"
FT   gene            complement(469419..469898)
FT                   /locus_tag="RALTA_A0461"
FT   CDS_pept        complement(469419..469898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63129"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63129.1"
FT                   /translation="MIGWLRRILPGQGGVGGHAGSARRHGPSDPFIVNLYDDRVVVHRP
FT                   DGQREEITWNVLERVVVRVSDRAPWAGTAWLILIGAPDSGQGCVVPFDAANHAALLEQL
FT                   RALPGFNQQKLDNALRDAAAGKSRSDAICWKRGAESRPGTDADHAGASDDAGPAA"
FT   gene            complement(469895..471307)
FT                   /gene="pepP"
FT                   /locus_tag="RALTA_A0462"
FT   CDS_pept        complement(469895..471307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="RALTA_A0462"
FT                   /product="proline aminopeptidase P II"
FT                   /function="1.2.3 : Proteins/peptides/glycopeptides"
FT                   /EC_number="3.4.11.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9520390; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63130"
FT                   /db_xref="GOA:B2AH81"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63130.1"
FT                   /translation="MSAPDHAHLAALLAACRDRRARVLQQLRAGGGGVAILPTAPEAMR
FT                   NRDSDYPYRHDSYFYYLSGFTEPEAVLVLVAGAPGEPAEADRSILFCRPKHEEREIWDG
FT                   FRFGPEGARAAFGFDEAHSIEAIDATLPPLLANRAQIAYPLADSIRTDMQMRRWLDAVR
FT                   MQSRAGVAAPSVAIDIRTLLDEMRLFKDAGELGIMRRAAAISAGAHVRAMQATRAGLRE
FT                   YHLEAELLYEFRRHGAQSVAYNSIVAAGPNACVLHYRAGPAELKDGDLCLIDAGCELDG
FT                   YASDITRTFPVSGRFSPAQRELYDLVVAAQQAAIDETRAGVPYNVPHDAAVRVLAQGML
FT                   DTGLLDRNKEGTLDDVLASGSYRRFYMHRTGHWLGMDVHDVGEYRVASHSGEGERPWRP
FT                   LQPGMVLTIEPGIYVRPAEDVPERYWHIGIRIEDDAVVTEGDCELITRGVPVLADEIEA
FT                   LMRDRATAEGQR"
FT   gene            complement(471390..472115)
FT                   /locus_tag="RALTA_A0463"
FT   CDS_pept        complement(471390..472115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0463"
FT                   /product="putative sugar-phosphate nucleotidyl transferase"
FT                   /function="1 : Metabolism"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63131"
FT                   /db_xref="GOA:B2AH82"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63131.1"
FT                   /translation="MKVMIFAAGRGDRMRPLTDACPKPLLAVGGKPLIVWKIEALARAG
FT                   LRDIVINHAWLGAQIEAALGDGSRFGVRIAYSAEGEALETAGGIAKALPLLSHDPVRGE
FT                   IFLAVSGDIFCDYDFRALLPRAQALAGAAAPHMHLVMVPNPPFHPRGDFALDDHGRLSL
FT                   EAEPASGARLTFGNIGLYDTRLFTDIVPGTRLAMTPIYHAGIAAGTATGERFDGRWENV
FT                   GTPAQLAELDAMLSAAPGR"
FT   gene            complement(472112..472438)
FT                   /locus_tag="RALTA_A0464"
FT   CDS_pept        complement(472112..472438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0464"
FT                   /product="conserved hypothetical protein, COG4392; putative
FT                   transmembrane protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63132"
FT                   /db_xref="GOA:B2AH83"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63132.1"
FT                   /translation="MSALTLLWVFLAAGLATFLIRLSFIAVEGRVRLPSWFRTALQFVP
FT                   AAMLSALIAPDLLMQQGELALTPTNARLVAGVVAILIAARTRSVGWTIAGGMATLLALE
FT                   ALFR"
FT   gene            complement(472435..473238)
FT                   /locus_tag="RALTA_A0465"
FT   CDS_pept        complement(472435..473238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0465"
FT                   /product="putative branched-chain amino acid permease; AzlC
FT                   family"
FT                   /function="4 : Transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63133"
FT                   /db_xref="GOA:B2AH84"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63133.1"
FT                   /translation="MRDDASGPDDSAAPAITAAGEWLAGARALAPMLLGVVPFGLIYGV
FT                   LAVGAGMPAWLACAMSAIVFGGASQMILTQLWTAGTPAVVITLTVAMVNLRHALYSATI
FT                   APTLAHLPRRWKALIAYLLTDEAFAAMTHRLGDTGPRARYRHWYYFGGGFALWASWQLS
FT                   TLAGVLVGAQVPRHWPLDFFLPLTFIGIIVPGLRHRSHVAAALAASALAVACYSLPHKL
FT                   GLMVAALGGIAVGMLVLGRGNRPGPRAASHAADSGTGGAAGKEAA"
FT   gene            complement(473243..474277)
FT                   /locus_tag="RALTA_A0466"
FT   CDS_pept        complement(473243..474277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0466"
FT                   /product="putative Aminoglycoside phosphotransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63134"
FT                   /db_xref="GOA:B2AH85"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63134.1"
FT                   /translation="MAALPHDPRLDQLKAWVAGLGPAWSADPDSCVPASADASFRRYFR
FT                   VSTRHPGHPTAIVMDAPPAHEDCRPFIHVCALFGAAGVTVPTVLAQDLDQGFLLLADLG
FT                   SQTYLSKLDDSSAPGLYAGAAAALVRIQAATRPGELPAYDRALLQRELDLFPQWYVARH
FT                   LGATLSEAQQADWHEVTEALLANNLAQPQVYVHRDFHSRNLMVLEGAANPGVLDFQDAV
FT                   TGPITYDAVSLWRDAYIEWDEEQQLDWLIRYWERARKAALPVNADFGEFYRDFEWMGLQ
FT                   RHLKVLGIFARLYHRDGKDGYLANLPLVMKYTRQVAGRYTELRKLIRLLDALEGVSSPA
FT                   GYTF"
FT   gene            474542..476983
FT                   /gene="imp"
FT                   /locus_tag="RALTA_A0467"
FT   CDS_pept        474542..476983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="RALTA_A0467"
FT                   /product="exported protein required for envelope
FT                   biosynthesis and integrity (ORGANIC SOLVENT TOLERANCE
FT                   TRANSMEMBRANE PROTEIN)"
FT                   /function="5.5.6 : Other stresses (mechanical, nutritional,
FT                   oxidative)"
FT                   /function="6.1 : Membrane"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12207697; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63135"
FT                   /db_xref="GOA:B2AH86"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63135.1"
FT                   /translation="MTEPQRSPNNRALPSPASPRAPARARRGGSLHAGALRPLVLAMAG
FT                   LSAGAQAQITGSAIPDLDQVEPVFEAAPPAPPLPVESGELVPRLAEPAAKGESNPDAPT
FT                   FIEADRMTGYSERGVELEGHAELRRDGGVVKGDKLTYDQDTDEAFAQGNVRMSRAGTLA
FT                   VGPEARLKVEANEGYMLSPDYYFQQTGGTGKAERIDFLDQNRSTARQASYTTCSPDNAD
FT                   WYFSANRIDLDSDRQVGVAYGGVLNFFGVPVAAAPAFSFPLNDDRRSGFLPPLMGYSSK
FT                   SGFDLTAPYYVNIAPNRDLTIYPRLMTERGLQLGGEYRYLSESYSGRVRAEFLPDDKKT
FT                   NSNRWAYSLQHTQRLAPGLAAYLNLNRVSDDRYPDDFNRSVSQSTLRQYTQEGGVTYNW
FT                   QDFTLLARVQKFQTLRPSEPSYERVPQLNGKYLRYDLGGFDVQMEADYTRFRIPLTSTG
FT                   FQQPQGERMYFQPSISYPIVRAGWYVTPKVSFSAAQYQMEAATNTPTAQNNLSRAIPTV
FT                   SLDSGMTFERDAPTISRLFGVNYVQTLEPRLFYVYTPFRDQSQFPLFDTVQSDFGYGQI
FT                   FSENPFTGYDRIADNNKLTGGVTTRLIESDTGIERFRGTIAQRYDFTGQRVQLNGTLAD
FT                   PKSGSSDLLAATTIQLFRGYYLDAGVQFNPDSDRINYGNVAFTYRPESRKVINAGYRYR
FT                   RPTSVTDNTAIDQFEVSSQWPITRRAYGIARFAFDLTASQMVDALAGVEYAADCWVGRV
FT                   VYQRFRNTTQGYTGRVFLQVEFRGLSKIGSNPLNILRLNVPGYEPVSAKPVPTTQFDHY
FT                   E"
FT   gene            476993..478462
FT                   /gene="surA"
FT                   /locus_tag="RALTA_A0468"
FT   CDS_pept        476993..478462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="RALTA_A0468"
FT                   /product="peptidyl-prolyl cis-trans isomerase (PPIase),
FT                   involved in maturation of outer membrane proteins"
FT                   /function="2.3.4 : Chaperoning, folding"
FT                   /function="7.4 : Outer membrane"
FT                   /EC_number="5.2.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 21145448; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63136"
FT                   /db_xref="GOA:B2AH87"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63136.1"
FT                   /translation="MKRQEFAVFSFLLTSWHRLLLPAVLAAMAVPAAAQLKAPGARASG
FT                   IFVPQASDVTAPSSQPKLGVPQAGGQKRSQLIDEVVAVVNNSVITRRELLDRADEIESQ
FT                   LRAGGRPVPARADLLGEVLERLVMERVQTQAAQDAGIRVTDQEVDRAIESVAQQNQMNA
FT                   AELRRRVEASGMTWTKYRDELRKQVQVIRLREREVDSKVQVYDGEIDNYLAARGGQGAA
FT                   AGPTEYNMAQILVRVPENASDAQKQALRAKAEGLLKQAQDGADFAQLAQASSEGPEAAQ
FT                   GGAMGFREIGRLPALFANAVVDLQPGGVAPQVIESAAGFHVIKLVAKRAAPASGPAAAG
FT                   KITQTQVRHILIRTGPNMPEAEARRQLGTLRDRITHGGDFADAARRFSQDGSAQNGGDL
FT                   GWVSPGELVPEFEQAMSRLRPNEISEPVVTQFGVHLIQVLNRRETELSPEKQRDFARAE
FT                   VREQKLRAAYDDWVRQLRSQAYVEYRVNRQR"
FT   gene            478512..479600
FT                   /gene="pdxA1"
FT                   /locus_tag="RALTA_A0469"
FT   CDS_pept        478512..479600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA1"
FT                   /locus_tag="RALTA_A0469"
FT                   /product="4-hydroxy-L-threonine phosphate dehydrogenase,
FT                   NAD-dependent (pyridoxine phosphate biosynthetic protein)"
FT                   /function="1.5.3.6 : Pyridoxine (vitamin B6)"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="1.1.1.262"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15026039; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63137"
FT                   /db_xref="GOA:B2AH88"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63137.1"
FT                   /translation="MPDPLALAITTGEPAGIGPDITIGALLQLAGANHGFDGGAYRFHV
FT                   LGDARLLAERAEALGVTHAWERRLADGGVVVEDIALAVACEAGRLDARNGPYVLKLLDA
FT                   AIEGCRSQAGAAPRYAAMVTAPVQKSTINDAGVPFTGHTEYLAESAGVARVVMMLAGPQ
FT                   PAHDDAMLRVALATTHLPLRAVPDALSVPLLVQTLAIIDADLRRCFGIGRPRILVTGLN
FT                   PHAGESGHMGREEIDIIAPALAQAKDAGIDARGPFPADTLFQPRHLRDADCVLAMYHDQ
FT                   GLAPLKYGTFGHGVNITLGLPFIRTSVDHGTALDLAGTGQAEHGSMIEAIRTAVIMSGH
FT                   ANGRRPGGGAAGHTPSGTQPPC"
FT   gene            479618..480451
FT                   /gene="ksgA"
FT                   /locus_tag="RALTA_A0470"
FT   CDS_pept        479618..480451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="RALTA_A0470"
FT                   /product="S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
FT                   dimethyltransferase (kasugamycin resistance)"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63138"
FT                   /db_xref="GOA:B2AH89"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63138.1"
FT                   /translation="MRSNVHQGHVARKRFGQNFLVDDTIIHGIVNAISPQAGDVLVEIG
FT                   PGLGALTDPLLERIPQMQVVELDRDLVERLRRRYGERLQVHAGDALDFDFDKLAVPGRP
FT                   LRIVGNLPYNISSPLLFHLMEFADHVHDQHFMLQKEVVERMVAEPGSKAFGRLSIMLQV
FT                   RYYMEHVLDVPPGAFNPPPKVDSAVVRMIPWPRHGDGRLRSPHADCDITVLGDVVTAAF
FT                   SQRRKVLRNTLSFLRDQVDFDAMGFDLGRRAEEVPVGEYVELARRLGDKASGQAA"
FT   gene            480529..481566
FT                   /locus_tag="RALTA_A0471"
FT   CDS_pept        480529..481566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0471"
FT                   /product="Tryptophanyl-tRNA synthetase(Tryptophan--tRNA
FT                   ligase) (TrpRS)"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /EC_number="6.1.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8294486; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63139"
FT                   /db_xref="GOA:B2AH90"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63139.1"
FT                   /translation="MTAQTSQTNRRPVILTGDRPTGPLHLGHFVGSLKSRVALQDSHEQ
FT                   YLLLADTQAMTDNAHDPDKVRRNVLEVALDYLAVGIDPAKTTITVQSHLPALAELTLMY
FT                   LNFVTVARLERNPTIKEEIQARGFGRDIPAGFLCYPASQAADITGFKAEVVPVGEDQAP
FT                   LIEQTNEIVRRINHQVGRDVLPECKAMIPQFGRLPGVDGKAKMSKSMGNAIALGAAPEQ
FT                   IKAAVHSMYTDPNHLRVSDPGQVEGNVVFTYLDAFDPNTEEVQALKEHYQRGGLGDMVL
FT                   KRRIEGVLQDMLAPIRERREALAKDPDYVFDILRQGTAKARELTQQTLEEVRDALGMFS
FT                   FESRR"
FT   gene            complement(481631..482536)
FT                   /locus_tag="RALTA_A0472"
FT   CDS_pept        complement(481631..482536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0472"
FT                   /product="putative membrane lipoprotein, DUF6"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63140"
FT                   /db_xref="GOA:B2AH91"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63140.1"
FT                   /translation="MSTQGVARQPLDGTAIGLMVVLCAAWGLQQVVIKVTAPLMGAVLQ
FT                   AGVRSAVAALLVFGFAAWRGTPLWRRDGTLNAGLLAGLLFGAEFFCIFVGLGHTTASRM
FT                   AVFLYTAPIFTALGLHMVVPGERLRPGQWLGVALAFAGMALAFADGIAAPSSQGSTLLG
FT                   DALGILAGALWAATTVVVRASPLAGAPASKTLLYQLAVSAVMLLGMALAGGQTATVQID
FT                   GVVLASLFYQSVLIAFASYLAWFWLLQRYLASRLSVFSFLTPLFGVAFGVVLMHDAVGP
FT                   RFAVAAVLVLAGIVLVNRRG"
FT   gene            complement(482548..482955)
FT                   /gene="gloA"
FT                   /locus_tag="RALTA_A0473"
FT   CDS_pept        complement(482548..482955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="RALTA_A0473"
FT                   /product="glyoxalase I, nickel isomerase"
FT                   /function="1.7.23 : Methylglyoxal metabolism"
FT                   /EC_number="4.4.1.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10913283; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63141"
FT                   /db_xref="GOA:B2AH92"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63141.1"
FT                   /translation="MRLLHTMLRVGDMQRSIDFYTRVLGMQLLRESDNPEYKYRLAFVG
FT                   YGPESETAVLELTYNYGVDSYDLGTAYGHIALETDNAAAACERIRAAGGKVTREAGPVK
FT                   GGTTVIAFVEDPDGYKIELIERHSTRDASRP"
FT   gene            complement(483050..483910)
FT                   /locus_tag="RALTA_A0474"
FT   CDS_pept        complement(483050..483910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0474"
FT                   /product="putative metal-dependent hydrolase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63142"
FT                   /db_xref="GOA:B2AH93"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63142.1"
FT                   /translation="MKLLRPAAEADGAQLELPLAEAAHAPQPAAPLAPEPLQAPAWPVP
FT                   QPNARLLQIGERPLHYTLKRSARRTIGFTIDDRGLSITAPRWVTLADIEAAILEKQRWI
FT                   FNKLGEWRHREARRVLPTVQWRDGAALPFLGQPLTLALESPIGALLFDADRRVLHLALP
FT                   AHADEQQIKDRVQGWLQQQARRLLAERLDLYAARLGIRHTGFALTSAATRWGSCTADGK
FT                   IRLNWRLMHFPLSMIDYVAAHELAHLKEMNHGPRFWETVESIFPEFRDARAQLRAHPPE
FT                   LLPTF"
FT   gene            complement(483907..484671)
FT                   /gene="plsC1"
FT                   /locus_tag="RALTA_A0475"
FT   CDS_pept        complement(483907..484671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC1"
FT                   /locus_tag="RALTA_A0475"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /function="1.5.4 : Fatty acid and phosphatidic acid"
FT                   /EC_number="2.3.1.51"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63143"
FT                   /db_xref="GOA:B2AH94"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63143.1"
FT                   /translation="MTFLRSLLFALYLLVLTPPYACACFVVFPFMNADQRFRFVRGWPR
FT                   MVIAAARAICGIQYRIEGHEHMDAMLDKPVVLLSKHQSAWETVAYVALMPRPLCFVFKR
FT                   ELLLVPFFGWALGMLKMVHINRKEGTRAFASAVRQGRERLAEGAWIIMFPEGTRTPSGL
FT                   EKPRYKSGGARLAVETGAWVLPMAVNSGRVWPRNSFMKYPGTVTISVGPPIASANKTAD
FT                   QLNQEVADWIERDMRRIDPESYRVTQRSESAA"
FT   gene            complement(484721..485329)
FT                   /gene="gmhB2"
FT                   /locus_tag="RALTA_A0476"
FT   CDS_pept        complement(484721..485329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB2"
FT                   /locus_tag="RALTA_A0476"
FT                   /product="D-glycero-D-manno-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /function="1.6.3.2 : Core region"
FT                   /EC_number="3.1.3.-"
FT                   /EC_number="3.1.3.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12101286; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63144"
FT                   /db_xref="GOA:B2AH95"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63144.1"
FT                   /translation="MPQTPPKFVILDRDGVVNLDSDQFIKTPDEWVPIDGSLEAIAALN
FT                   QAGYRVVIASNQSGIGRGLFEMSALNAMHEKMHTALARLGGRVEAVFFCPHTAADGCEC
FT                   RKPRPGMLEQISERFGIELRGVPIVGDSLRDLEAGVAVGCAPHLVRSGKGLKTLDKGGL
FT                   PPGTQVHDDLRAFARWLTGNDGGQRQPAPSAQGGHGAAG"
FT   gene            complement(485373..487496)
FT                   /gene="glyS"
FT                   /locus_tag="RALTA_A0477"
FT   CDS_pept        complement(485373..487496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="RALTA_A0477"
FT                   /product="glycine tRNA synthetase, beta subunit"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63145"
FT                   /db_xref="GOA:B2AH96"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63145.1"
FT                   /translation="MSQPMTDSLLIELFTEELPPKALARLGDAFAQGLFAGLGERDLLE
FT                   PGATVTPFATPRRLAALVSGVRRNAPDREQREKVLPLSVALDANGEPTAPLAKKLAALA
FT                   RSVGVAEIDWQALERGSDGKAEAFFYRYTARGAELAAGLQATLEDTVAKLPIPKVMSYQ
FT                   RPDGSTVHFVRPAHSLIALFGSEILPVTLLGLQASNLTQGHRFLSHGAIEIRHANDYAQ
FT                   QLESAGRVVASYAERRERMRSALLQEAGADQVIMPEALLDEVNSLVEWPVVYACHFEEA
FT                   FLAVPQECLILTMQTNQKYFALTDADGHLRNRFLIVSNLATETPQSIISGNERVVRPRL
FT                   ADAKFFFDQDRKKTLASRVPQLASVVYHNKIGTQLDRVQRLQQIAGHVADALNAAGVAT
FT                   DKAAAMRGAELAKADLLTDMVGEFPELQGTMGTYYARHDDEAEDVALACSEHYRPRFAG
FT                   DALPAGAVSTAVALADKLETLVGIWGIGLQPTGEKDPFALRRHALGILRMLIEKPLALS
FT                   LASLLAQTQQAFAGIAAVKPAPEAILDFLYDRVRGYLKDKGYTTNEVEAVVSLRPDQLH
FT                   DILGRMEAVRTFAALPEAEALAAANKRITNILRKNTEPVGAVNPALFREDAEGALHAAI
FT                   ERVRPAVEAAFASGDFTTALRDLAQLRDAVDQFFNDVMVMAEDAQLRANRLALLASLHA
FT                   LANRVADISKLAA"
FT   gene            complement(487535..488173)
FT                   /locus_tag="RALTA_A0478"
FT   CDS_pept        complement(487535..488173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0478"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63146"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63146.1"
FT                   /translation="MRLLARSALGCALALATLAAAGNAAGARAQAAPSAQVLMLPAELS
FT                   NVCEADAQALQLAMARQWRPSLNALDQWTQLVRSFSCDLSGQRDLGWHRVPLRAYESAI
FT                   RYPLTWIETETHNGRTRRKVKTYYSASQLPPKIDFWVGGRIDEIRYDKRLRRIDARFPA
FT                   AGSRGGTNGAASAAAAAAAAQCAYTTLQFRQQNGLWLLSGVEPNLSPRC"
FT   gene            complement(488170..489120)
FT                   /gene="glyQ"
FT                   /locus_tag="RALTA_A0479"
FT   CDS_pept        complement(488170..489120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="RALTA_A0479"
FT                   /product="glycine tRNA synthetase, alpha subunit"
FT                   /function="2.3.1 : Amino acid-activation"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="6.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63147"
FT                   /db_xref="GOA:B2AH98"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AH98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63147.1"
FT                   /translation="MLTFQQMILTLQAYWDRQGCALLQPIDLEVGAGTSHVHTFLRAIG
FT                   PEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILVLYLGSLEALGLDL
FT                   KQNDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGIE
FT                   RLAMYLQKVENVYDLVWTEWVENGETRRLTYGDVYHQNEVEQSTYNFEHSNTEILFRHF
FT                   AEHEGEAKRLMGNGDGADAAAETGTRLALPAYEQVLKAAHTFNLLDARGAISVTERAAY
FT                   IGRIRNLSRQVAQAYYDSREALGFPMCGQRDGARA"
FT   gene            489436..489606
FT                   /locus_tag="RALTA_A0480"
FT   CDS_pept        489436..489606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0480"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63148"
FT                   /db_xref="GOA:B2AH99"
FT                   /db_xref="UniProtKB/TrEMBL:B2AH99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63148.1"
FT                   /translation="MQARRPPGLAAAAVCQELIIDGDIRIMALLSRKPYLVAIAVMIAA
FT                   ATVSVVTGLLN"
FT   gene            complement(489692..491305)
FT                   /gene="cutE"
FT                   /locus_tag="RALTA_A0481"
FT   CDS_pept        complement(489692..491305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutE"
FT                   /locus_tag="RALTA_A0481"
FT                   /product="apolipoprotein N-acyltransferase, copper
FT                   homeostasis protein"
FT                   /function="1.6.10 : Lipoprotein"
FT                   /function="6.1 : Membrane"
FT                   /function="7.3 : Inner membrane"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8344936; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63149"
FT                   /db_xref="GOA:B2AHA0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63149.1"
FT                   /translation="MKLPAPLPDGAAADAGTAGVPGARAQSRAAMLARLLLAGVLGIAH
FT                   TQAFAPHDWWWLQILSLAGLAALIADAPRTRAAGAIGYAFGLGWFLSGIWWLYISMHVY
FT                   GEMPSWMAALAVLLFSGFLSLYPALAGAFWHRLTARLPAGTLLAPLAFGAAWGLSEWLR
FT                   GVVFTGFPWLSGGYAHADGPLAGYAPVLGVYGIGALAAAVAALLAAAVRGLGRGERGRA
FT                   LGALALAGLVPAAGAALAPLAWTTPAGKPLTVRLLQGNVAQDIKFEPVGIQRSIELYRD
FT                   MITAAPADLVVTPETAFPVILQELPVEVAVAVRDYALTSGTTVLFGAAGADSPVDFTNS
FT                   VFGLGPETERLYRYNKHHLVPFGEFIPLGFRWFVDMMKMPLGDFRRGGLDQASLPVRGV
FT                   RVAPNICYEDLFGEEIAQTLRQQPAPANLLANLTNLAWFGDTIALDQHLQISRMRALET
FT                   RRPMLRSTNTGMTAVVRPDGTVQQRLPTFTVGTLTAEVQGMHGLTPYIRWGNAPVLALI
FT                   ALVLGMAAWRARRAGGRRRG"
FT   gene            complement(491302..492189)
FT                   /gene="corC"
FT                   /locus_tag="RALTA_A0482"
FT   CDS_pept        complement(491302..492189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corC"
FT                   /locus_tag="RALTA_A0482"
FT                   /product="Magnesium and cobalt efflux protein"
FT                   /function="4.2.A.47 : The Divalent Anion:Na+ Symporter
FT                   (DASS) Family"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63150"
FT                   /db_xref="GOA:B2AHA1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63150.1"
FT                   /translation="MNDPYPSSKPAYLKQADRPRSLLERLSDLISPEPDTRAELLEVLQ
FT                   EAHERSLIDADSLSMIEGVFQVSELTAADIMVPRAQMDLVNIADAPETFIPFMQQTAHS
FT                   RFPVYEGSRDNIIGILLAKDLLRYYTDPAFDLRETLRPAVFIPESKRLNILLRDFRINR
FT                   NHIAMVVDEYGGVAGLVTIEDVLEQIVGDIEDEFDLDEDQDKILPMPDGSWRVHGLTEI
FT                   SQFNEAFGTAFSDHDVDTVGGLLSNHVGHVPHRGEVITLPPIRFEVLRADARQVHLLQV
FT                   HREANADSASAASA"
FT   gene            complement(492322..493077)
FT                   /locus_tag="RALTA_A0483"
FT   CDS_pept        complement(492322..493077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0483"
FT                   /product="putative metal-dependent hydrolase, COG0319;
FT                   putative diacylglycerol kinase"
FT                   /function="1 : Metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63151"
FT                   /db_xref="GOA:B2AHA2"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63151.1"
FT                   /translation="MKSPKSKSSGVSLTLFDNEGRARKSAAHALRVQLPDGRSLTLDLS
FT                   QAADGVVALLAEHTDPNQQAGLLVRPDNHDALSVAVTAAPLTTTTGTPATPPALELEVQ
FT                   HGDGIGKGNGLPARRKLETWVKSALYADAALTIRFVGEEEGRTLNRTYRGKDYATNVLT
FT                   FAYAEREDDPVTGDIVLCCPVVEAEARAQRKPLEAHYAHLVVHGVLHAQGYEHEDDAEA
FT                   EEMEAIETETLQALGYADPYRAEKADRAA"
FT   gene            complement(493078..494079)
FT                   /locus_tag="RALTA_A0484"
FT   CDS_pept        complement(493078..494079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0484"
FT                   /product="putative phosphate starvation-inducible ATPase,
FT                   PhoH-like protein"
FT                   /function="5.5.6 : Other stresses (mechanical, nutritional,
FT                   oxidative)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63152"
FT                   /db_xref="GOA:B2AHA3"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63152.1"
FT                   /translation="MKIPSAEFVAPRDDNTRLQNLCGPLDENLRQIEQALDVTIQRRGH
FT                   RMTIRGTHAQDAALALERFYNQARTPLSIDDVQLGLVETRQLSAHGSYLPGNGDDDEAE
FT                   REEGDESPVLHTRRTGLQGRTVAQRDYLRNILSHDLTMGIGPAGTGKTYLAVACAVDAL
FT                   ERDAVKRIVLTRPAVEAGERLGFLPGDLAQKVDPYLRPLYDALYDLLGFDRTQKMFERQ
FT                   MIEIAPLAYMRGRTLNHAFIILDEAQNTTPEQMKMFLTRIGFGSKAVITGDTTQIDLPK
FT                   GQKSGLVEAQHVLRDVRGIACTRFTSIDVVRHPLVARIVDAYDEYHAQHKDA"
FT   gene            complement(494129..495481)
FT                   /gene="miaB"
FT                   /locus_tag="RALTA_A0485"
FT   CDS_pept        complement(494129..495481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="RALTA_A0485"
FT                   /product="isopentenyl-adenosine A37 tRNA methylthiolase,
FT                   Fe-S protein"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11882645, 20042346, 15339930; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63153"
FT                   /db_xref="GOA:B2AHA4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AHA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63153.1"
FT                   /translation="MKKVFVKTYGCQMNEYDSDKMVDVLNASQGLEATDNVEDADVILF
FT                   NTCSVREKAQEKVFSELGRMKALKAVKPDLVIGVGGCVASQEGASIVSRAPYVDVVFGP
FT                   QTLHRLPDLIARRQRTGQSQVDISFPEIEKFDHLPPARVEGPSAFVSIMEGCSKYCSYC
FT                   VVPYTRGEEVSRPFEDVLAEVAGLAEQGVREVTLLGQNVNAYRGKMGDTSEIADFALLI
FT                   EYVAEIPGIERIRYTTSHPKEFTSRLVELYGRCDKLVNHLHLPVQHASDRILMAMKRGY
FT                   SVLEYKSIIRRLRALRPDMSMSSDFIVGFPGETDADFDKLMAMIEEIGYDTSFSFIFSP
FT                   RPGTPAANLHDDTPREVKLQRLQRLQATIEENVQRISQGMVGTVQRILVEGPARKDPTE
FT                   LHGRTENNRVVNFALPGVPQAGRDRLVGQLVDVSITQAFPHSLRGEIVVRQ"
FT   gene            complement(495572..495961)
FT                   /locus_tag="RALTA_A0486"
FT   CDS_pept        complement(495572..495961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0486"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63154"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63154.1"
FT                   /translation="MPAGRDTHRPPQESVKPSRSLWPSLACAAALLLGTASAAAQPVRV
FT                   LPDDAAAARLVIAAPSAGAPQTATLDGKRVGVAPGLRLFGTDNQLLASAAVAGQKLPVR
FT                   YKLDLYGQLLTAWVLSEAEQQALKK"
FT   gene            complement(496166..497851)
FT                   /locus_tag="RALTA_A0487"
FT   CDS_pept        complement(496166..497851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0487"
FT                   /product="putative voltage-gated chloride channel,
FT                   clcB-like"
FT                   /function="4.1.A.11 : The Chloride Channel (ClC) Family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63155"
FT                   /db_xref="GOA:B2AHA6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63155.1"
FT                   /translation="MRLRFLEDQEVTLLAAIPVGICAAIATTLFKEALDGAGFVLFSSH
FT                   ADVVTVFATLALTWRVVVPAVGGALAGALLVLANRLASTHPGATDYMEAVANGSGRLPV
FT                   RITLLRALSSFFSIVSGSSVGKEGAMIQLAALCGSLFPSTRIERGGGSNMRRMLTACGA
FT                   AAGLATVYHTPLSAAVFVAEVVFGALAVQRLMPLFLASVAGAMVSQWHGGLQPLYPGLD
FT                   IAPDLRPQILLAAAALGVAAGIAGALFLRAAGFARSRFAALPGGPVARLALGGALVGVL
FT                   AMAVPEVVGNGFSTIQTLLQEQPLSVPVAAVLLAKLAATVISMGSGAVGGVFTPSLFVG
FT                   AALGQLLALGMQGSAAGAAPLLPLVGMSAFLAATSQAPLMSVLMVFEMTLAPALLLPSM
FT                   IGAVAAYYTASRCQTLSLYSVIAERAQASAAAEHARALTLAGLCDPTDTVLDPNATLAD
FT                   AADKFAETGTRYLYLVQADGRLLGALSIHALQRAQREGAPDDVLALAERDFPALTPDSR
FT                   LRDALEVFAGHGINRIPLVRDPAGRELMGTVSKQRVLQEASCLF"
FT   gene            498151..499701
FT                   /gene="rhlE1"
FT                   /locus_tag="RALTA_A0488"
FT   CDS_pept        498151..499701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlE1"
FT                   /locus_tag="RALTA_A0488"
FT                   /product="ATP-dependent RNA helicase hydrolase"
FT                   /function="2.2.3 : RNA modification"
FT                   /function="1.2.1 : RNA"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15554979; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63156"
FT                   /db_xref="GOA:B2AHA7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63156.1"
FT                   /translation="MSFSELGLSEKIVRAVAEQGYTTPTPIQAQAIPAILKGGDLLAGA
FT                   QTGTGKTAGFTLPMLQLLSETAARQAGGAQRGGRVAVRALVLTPTRELAAQVEESVRNY
FT                   GKYLRLRSMVMFGGVGINPQIEQLKRGVEIVVATPGRLLDHVSQRTIDLSQVELLVLDE
FT                   ADRMLDMGFIHDIRKILNVLPAKRQNLLFSATFSDDIRALADRLLNNPASIEVARRNTT
FT                   AETVDQRVYPVDRERKRELLAHLVRQHDWHQVLVFTRTKHGANRLAEQLTKDGLSALAI
FT                   HGNKSQSARTRALSEFKAGTLRLLVATDIAARGIDIDQLPHVVNFDLPNVPEDYVHRIG
FT                   RTGRAGAEGEAISLVCVDELGLLRDIERLIKRKLEQTVLPGFEVDPSIAPEPIQKGRQQ
FT                   RGGGGQGQGRGRAEARPAGAGEGAQRQRPARQGQGAHGGAGTPGGQRGNGAANGNRAAQ
FT                   PAGARNPAPRRDGQDPARQQRAAAQPARQPHDAAPAPARNRRPAPQAALLGGSRKPAR"
FT   gene            499720..500766
FT                   /locus_tag="RALTA_A0489"
FT   CDS_pept        499720..500766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0489"
FT                   /product="putative aminoglycoside phosphotransferase"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /EC_number="2.7.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63157"
FT                   /db_xref="GOA:B2AHA8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63157.1"
FT                   /translation="MHPSDAPADSGVPYAGLTPELMLDALEGAGLRPDGRLLALNSYEN
FT                   RVWQVGIEDAAPVIAKFYRPGRWTDAAILEEHAFVQQLADAEVPAVPAMALAPGEAGTL
FT                   RHHAGFRFAVFPRCGGREPALDRADTLTWLGRFIGRIHALGAAQPYQARPALDLHTFGI
FT                   APRDWLLASGCIPADLLPAWQSVAQLALDGVQRCYERAGDVRLLRVHGDCHRGNVLWID
FT                   EDDARGGAHGEPGPHFVDFDDSRMAPAIQDIWMLLEGDRAAMQGQLADIVAGYEDFAEF
FT                   RTRELWLVEALRTLRLLHYSAWLASRWADPAFPAAFPWFGTARYWQDRILELREQVALM
FT                   DEAPLWGA"
FT   gene            complement(500818..501258)
FT                   /locus_tag="RALTA_A0490"
FT   CDS_pept        complement(500818..501258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0490"
FT                   /product="putative Universal stress protein"
FT                   /function="5.5 : Adaptation to stress"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63158"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63158.1"
FT                   /translation="MTNIVLATDGSAFSDAAARFIAEGKLLQNGFTVHVVHVAPEVSGQ
FT                   VRAFVSKETIDDWHKEASDKAMAAVCDILAAANVPFERHALHGFAPERIVAYANSVDAA
FT                   AIVMGTHGRGSFFDAVIGSVAGRVLAQADCPVVLVKTPEKKG"
FT   gene            501608..502675
FT                   /locus_tag="RALTA_A0491"
FT   CDS_pept        501608..502675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0491"
FT                   /product="Alpha-methylacyl-CoA racemase (2-methylacyl-CoA
FT                   racemase) (2-arylpropionyl-CoA epimerase)"
FT                   /function="1 : Metabolism"
FT                   /EC_number="5.1.99.4"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63159"
FT                   /db_xref="GOA:B2AHB0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63159.1"
FT                   /translation="MSERGNLLPLRGIKVVEFEGIGPGPLCGAMLAGLGAEVTLVTRPV
FT                   APDARRILRGQSVPAEMELEHGKRVVQLNLKAPEDVAAALELVAGADALIEGLRPGAME
FT                   RLGLGPGACHARNPRLVYGRMTGWGQTGPLSQSAGHDLNYIALTGLLSMAAREGSLPMV
FT                   PPTVMGDATGALGLAFGITSAILSARASGEGCVVDAAITDIVAMLGSLVQVSRAAGTLG
FT                   GPQPSPFHDSPFYDVFPCADGRAITLGALEPQFYRELLERLALTDIDPAAQYDRAQWPA
FT                   VKARIAATIASQPSTHWESVLGGTDVCFARVLTLDEAARHPHNQARGTYRLYRQGEREV
FT                   PRSAPAPRFLPAGTE"
FT   gene            502877..503491
FT                   /locus_tag="RALTA_A0492"
FT   CDS_pept        502877..503491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0492"
FT                   /product="putative transcriptional regulator, response
FT                   receiver CheY domain, HTH LuxR domain"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63160"
FT                   /db_xref="GOA:B2AHB1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63160.1"
FT                   /translation="MIVDEPSRFRTLLCADLVAEFDGDAVLETDGVREGYRLAREHRPG
FT                   LVLVDVERFGNAGIDFVRRVVATLPGVPLLVLSGNDTAQAPVRALRAGAHGFVAKQRGV
FT                   EDVMQAVRGVLSGYLVFPLQTLETVRQLGEQQQAGLPRLSNREITILQYLARGHSNKAI
FT                   AAQLLISSKTVSTHKANIMAKLHVGSLVEMVDYARRHQLVW"
FT   gene            503585..505174
FT                   /locus_tag="RALTA_A0493"
FT   CDS_pept        503585..505174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0493"
FT                   /product="conserved hypothetical protein, COG2989; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63161"
FT                   /db_xref="GOA:B2AHB2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63161.1"
FT                   /translation="MPQTLNAAVRRLGAVAIACATWLAVPAFASEPMWFVQGRPVPEAR
FT                   QAVDALAAVTADGLDPRDYDAEALRQAVTQAAQGPALPPDAAARLDAALTAAMERMLSD
FT                   LHGGRINPRAVHANFAPPAERPFDAATWLRDAVAQHRLPDAIRQAAPTFPLYGTLRQAL
FT                   ARYRDIARQPVWQQPLPPLPASKLTPGQPWAGAAALTARLVALGDLPAGTQPPARYEGA
FT                   LVDGVKAFQSRHGLQADGVIGAATLAQLNLPIADRVRQIELTMERLRWTPLDGPRMIVV
FT                   NVPEFMLRAYEIRDGKLDIKLEMKVIVGKALDTRTPLFEEDMRYIEFSPYWNIPPSIAR
FT                   RETVPRLRRDPGYFSRQGLEFVGGDGKAVTTLSEENLDAVLNGSLRIRQRPGPLNALGD
FT                   IKFVFPNNENIYLHHTPSPQLFKRDRRDFSHGCIRVEAPVALAQFVLHDMPDWNEARIR
FT                   EAMARGKSNTVRLQQPLPVVLAYGTVIARADGRVSFQPDIYGHDKLLDKALRQRTGRPQ
FT                   PRAIASASGAIH"
FT   gene            505210..505797
FT                   /locus_tag="RALTA_A0494"
FT   CDS_pept        505210..505797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0494"
FT                   /product="conserved hypothetical protein, DUF882, COG3108;
FT                   putative exported protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63162"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63162.1"
FT                   /translation="MTDATRKARRRFLHTTGTLALAAGLMPFAPRRALASLPAHGALAG
FT                   LPDARTLAFDHTHTGERVSLVYAVGDRFVPEALTTLNGFLRDHYSGKVGTIDPQLFDLL
FT                   FQVRRELGTDQPFQVISGYRSPATNSRLRNSRGGGVAKHSLHMDGKAIDIRLAGVSLAD
FT                   VRDAAKSLQGGGVGYYETDQFVHIDTGRVRYW"
FT   gene            complement(505917..505993)
FT                   /locus_tag="RALTA_AtRNA56"
FT   tRNA            complement(505917..505993)
FT                   /locus_tag="RALTA_AtRNA56"
FT                   /product="tRNA-Met"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(506126..507823)
FT                   /locus_tag="RALTA_A0495"
FT   CDS_pept        complement(506126..507823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0495"
FT                   /product="putative TRANSPORTER, MSF family"
FT                   /function="4.2.A.1 : The Major Facilitator Superfamily
FT                   (MFS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63163"
FT                   /db_xref="GOA:B2AHB4"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63163.1"
FT                   /translation="MANVQNVAVPGGGAQNAPMTAEERKVIFASSLGTVFEWYDFYLYG
FT                   SLAAIIAKQFFAGLDPTSAFIFALLAFAAGFIVRPFGALVFGRLGDMIGRKYTFLVTIL
FT                   IMGVSTFIVGLLPGYATIGWAAPIILIALRMLQGLALGGEYGGAATYVAEHAPHGKRGA
FT                   YTSWIQTTATLGLFLSLIVILLCREATGPNFETWGWRIPFLVSILLLGVSVYIRLSMNE
FT                   SPAFQRMKAEGKTSKAPLTESFGQWRNLKIVILALLGLTAGQAVVWYTGQFYALFFLTQ
FT                   VLKVDAKTANLLIAGALVIGTPFFIFFGALSDKIGRKWIIMAGCALAVLTYFPLFKALT
FT                   HYANPALERAQHSAQIVVTADPKQCSFQGSPIAREIDFRSSCDIVKRTLAQASASYEVV
FT                   EAPAGTVASVKIGDKEIKAFDAKLVNGHSFDDASKQQIAAFKKEVGSSMAAAGYPTKAD
FT                   PAQMNTIMVLVILVILVIYVTMVYGPIAAMLVELFPTRIRYTSMSLPYHIGNGWFGGLL
FT                   PTISFALVAQNGNIYYGLWYPIIIAALTFVIGALFIRETKDVNIYAND"
FT   gene            complement(508071..508403)
FT                   /locus_tag="RALTA_A0496"
FT   CDS_pept        complement(508071..508403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63164"
FT                   /db_xref="GOA:B2AHB5"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63164.1"
FT                   /translation="MNDTPAPGSAEARHRLAWHRNLRWICGLLAVWFTVTFVVAWFARD
FT                   LRFDFFGWPFSFWVGAQGALVVYVLMAALYAWRMNRDNADDRSVEAPPPAMPSQGASRG
FT                   PGADAA"
FT   gene            complement(508400..509947)
FT                   /locus_tag="RALTA_A0497"
FT   CDS_pept        complement(508400..509947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0497"
FT                   /product="putative sensor histidine kinase"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63165"
FT                   /db_xref="GOA:B2AHB6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63165.1"
FT                   /translation="MSLLRLPWRRVPRAAPAPSSTPDVTDQDLTDALPHLEESTAHPAP
FT                   RSLFGEILDWMLAPLLLLWPMSIAVTYLVAKSIANGPFDRALEASAIVLSQQVREVNGR
FT                   VTLQLPLSAREILRADETDNVYYQVVGKRGEYIAGDQDLPLPSEDDQGHAGLVSLRDDR
FT                   VAGNDVRVAYTYIELKQVSGTQPVLVQVAETLDKRARLANEIIKGVILPQFVILPLAVV
FT                   LVWFGLSRGLAPLTAIQQRIRARNPGDTSPIDERAAPQEITPLVGSFNDLLARLDQSVQ
FT                   TQKRFIADAAHQMKTPLAGLRMQAELAQREQSPEELRRSLAQIAGSSERTAHLVTQLLS
FT                   LARMENLAGTGGMAALDLAALAREVVKDWLPQAWARDIDLGLDADDHPVMVQGNRLMLT
FT                   EMLNNLLDNAIRYTPRGGRATVRVSADAFEPFAYLDVEDTGPGIAPSERERVMERFYRV
FT                   LGTNTEGSGLGLAIVREIVQQHGGDVQITDHVYQQSPRLAGAHFRVTLRRPENFPPA"
FT   gene            complement(509996..510685)
FT                   /locus_tag="RALTA_A0498"
FT   CDS_pept        complement(509996..510685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0498"
FT                   /product="putative response regulator, CheY family"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63166"
FT                   /db_xref="GOA:B2AHB7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63166.1"
FT                   /translation="MRILIAEDDDVLADGLTRSLRHSGYAVDHVANGLEADSALSTQTF
FT                   DLLILDLGLPRMSGLEVLKRLRARGAMLPVLILTAADSVDERVKGLDLGADDYMAKPFA
FT                   LSELEARVRALVRRGAGGGATLMRHGPLAYDQVGRIAYLNDQMLDLSAREIGLLEILLT
FT                   RSGRLVSKEQLVDHLCEWGEEVSNNAIEVYVHRLRKKIEVGGIRIATVRGLGYCLEKFQ
FT                   PAVAAPH"
FT   gene            510921..511985
FT                   /gene="recA"
FT                   /locus_tag="RALTA_A0499"
FT   CDS_pept        510921..511985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="RALTA_A0499"
FT                   /product="DNA strand exchange and recombination protein
FT                   with protease and nuclease activity"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="2.1.4 : DNA repair"
FT                   /function="2.3.6 : Turnover, degradation"
FT                   /function="3.1.3.4 : Proteases, cleavage of compounds"
FT                   /function="5.8 : SOS response"
FT                   /function="7.1 : Cytoplasm"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9487711; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63167"
FT                   /db_xref="GOA:B2AHB8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AHB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63167.1"
FT                   /translation="MDDKKAGAGVSAEKQKALAAALSQIEKQFGKGSIMRLGDGEVEKD
FT                   IQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDA
FT                   EHALDVNYASKLGVNVGDLLISQPDTGEQALEITDALVRSGSIDLIIIDSVAALVPKAE
FT                   IEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKIGVMFGSPETTTGGN
FT                   ALKFYASVRLDIRRIGSIKKGDDVIGNETKVKVVKNKVSPPFREAFFDILYGQGISRQG
FT                   EIIDLGVDAKIVEKSGAWYSYNGEKIGQGKDNAREYLRENPDIAAEIENKVRAALGVVA
FT                   MNPTAAAVAATVED"
FT   gene            512097..512564
FT                   /locus_tag="RALTA_A0500"
FT   CDS_pept        512097..512564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0500"
FT                   /product="putative RecA REGULATORY PROTEIN RECX, COG2137"
FT                   /function="3.1.4 : Regulation level unknown"
FT                   /function="5.8 : SOS response"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63168"
FT                   /db_xref="GOA:B2AHB9"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63168.1"
FT                   /translation="MATRPPLSLKARAVGYLSRREHSRAELARKLAPHAESAEQLEQLL
FT                   DALERENWLSNQRFADSLVHRRGARYGTARVMQEAKTHKLDNEQLGELQERLRATEVER
FT                   AREVWRKRFGTPPDTPETRAKQIRFMVARGFSRAVVGKIIRGADEDGGDAD"
FT   gene            512766..513596
FT                   /locus_tag="RALTA_A0501"
FT   CDS_pept        512766..513596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63169"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63169.1"
FT                   /translation="MFPANAAWHVKLPGLFGTPAPRCPSPRILRSLRIFRISSLAMPLS
FT                   QPVNRSLRHRRAIAAEAYRREDGLWDIEVRLTDTKPRDIELAGDRIRPQGQPLHDLWLR
FT                   ITIDEEMTVLDAEACSDWVPYPSHCDTIGPAYRKLIGLNLRKGFRKAVRERLGGMHGCS
FT                   HLTEAAGVLPSTAIQAFAGEVISIRDNGEDDPNPEPPYQLNGCHALRFDGEVVRQFYPR
FT                   WYGHQPTPKARAEAAPAVASAPQAQQPAANGDRGGHAIDGNDAVPADRPTGTSG"
FT   gene            513686..514852
FT                   /gene="sucC"
FT                   /locus_tag="RALTA_A0502"
FT   CDS_pept        513686..514852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="RALTA_A0502"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /EC_number="6.2.1.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9917402; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63170"
FT                   /db_xref="GOA:B2AHC1"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AHC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63170.1"
FT                   /translation="MNIHEYQGKEILRKYNVPVPRGIPAFSVDEALKAAEQLGGPVWVV
FT                   KAQIHAGGRGKGGGVKVAKSMDEVKTYASNILGMQLVTHQTGPEGKKVNRLLIEEGADI
FT                   KKELYVSLVVDRVSQKIALMASSEGGMDIEEVAAHTPEKIHTLIIEPSTGLTDADADDI
FT                   ARKIGVPDASVAQARQALQGLYKAFYETDASLAEINPLILTGDGKVIALDAKFNFDSNA
FT                   LFRHPEIVAYRDLDEEDANEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGG
FT                   EPANFLDVGGGATTEKVTEAFKLMLKNPNVQAILVNIFGGIMRCDVIAEGVISASKAVS
FT                   LNVPLVVRMKGTNEELGRKMLADSGLPIISADTMEEAAQKVVAAAAGK"
FT   gene            514941..515822
FT                   /gene="sucD"
FT                   /locus_tag="RALTA_A0503"
FT   CDS_pept        514941..515822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="RALTA_A0503"
FT                   /product="succinyl-CoA synthetase, alpha subunit,
FT                   NAD(P)-binding"
FT                   /function="1.3.4 : Tricarboxylic acid cycle"
FT                   /EC_number="6.2.1.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9917402; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63171"
FT                   /db_xref="GOA:B2AHC2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63171.1"
FT                   /translation="MSILINKDTKVITQGITGKTGQFHTRGCRDYANGKNAFVAGVNPK
FT                   KAGEDFEGIPIYASVKDAKAQTGATVSVIYVPPAGAAAAIWEAVDADLDLVVCITEGIP
FT                   VRDMMEVKDRMRRENKKTLLLGPNCPGLITPDEIKIGIMPGHIHKKGRIGVVSRSGTLT
FT                   YEAVGQLTALGLGQSSAVGIGGDPINGLKHIDVMKMFNDDPETDAVVMIGEIGGPDEAN
FT                   AAHWIKDNMKKPVVGFIAGVTAPPGKRMGHAGALISGGADTAQAKLEIMEACGIKVTKN
FT                   PSEMGRLLKAML"
FT   gene            516076..516771
FT                   /locus_tag="RALTA_A0504"
FT   CDS_pept        516076..516771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0504"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein, TerC family"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63172"
FT                   /db_xref="GOA:B2AHC3"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63172.1"
FT                   /translation="MELLSSTTFWIALGSIILTNIVLSGDNAVVIALASRNLPPAQQKK
FT                   AIFWGSAAAIIMRVVLTVAAVKLLSLPYLKIIGAVLLVYIGVQLLTGEDDEDGHDAKDN
FT                   IWAAIRTILIADLVMSLDNVVAVAAAAQKGPEGSQLLLLIVGLGLSIPLIVFGSTLLLK
FT                   VMERFPVIIVLGAALLGYLAGEMLVSDPVDAAWFEVHVPHAHLVFGAAGAILVVIIGKL
FT                   LSRRSAQAA"
FT   gene            517088..517582
FT                   /locus_tag="RALTA_A0505"
FT   CDS_pept        517088..517582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0505"
FT                   /product="type IV secretion system prepilin"
FT                   /function="6.5 : Pilus"
FT                   /function="4.3.A.7 : The Type IV (Conjugal DNA-Protein
FT                   Transfer) Secretory Pathway (IVSP) Family"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63173"
FT                   /db_xref="GOA:B2AHC4"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63173.1"
FT                   /translation="MQRVQQLKKLGRRVQKGFTLIELMIVVAIIGILAAIAIPQYQDYV
FT                   TRSRWSSPLTEIAPLKQAIAQCAQVSGGNLTACGTLAQLTAATGYPAVPTPAGVTLLFG
FT                   AGAPTAPTATTTTIELTATANNLGAANGCVVTLTGTSNANSIVWTGATTGATCTRAQTG
FT                   I"
FT   gene            517679..519493
FT                   /locus_tag="RALTA_A0506"
FT   CDS_pept        517679..519493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0506"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /function="6.3 : Surface antigens (ECA, O antigen of LPS)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63174"
FT                   /db_xref="GOA:B2AHC5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63174.1"
FT                   /translation="MPPSRPNFSSAVLIAAIVIPLLVSRHTLPLATLYGEWAAALCSMV
FT                   AVAAVVFQAVRRPVVSTDASSASMPLISLLFLWLVVVSLIFASLGHSDVSGSRLMTVLT
FT                   LLLGAAVASAAWWYRRMQTGSALDTVDALAIAALIAGLLGTVTQWVQLFHLEPRSFGLV
FT                   STYFYDTNRRLWGNLNQPNHQATVHGLALVASVWLASRGRLRFPMWLAAVALLESGIVL
FT                   SGSRTGVLHVGLAAGYAMIAAWLARGERRGADPMRRPVGLVVAAVAMVAMLLVLQSTIK
FT                   AAGQAFDWRLFDTVAQLEAEDQISARGALWAHAIAMFRAHPWFGVGWGEFGWAQFQQLD
FT                   QVGVKVEMSLHAHNAILDLLAKTGIVGTAGVAVILLAWLWRVVRARLWHGDAEERRQTV
FT                   LVLTWLAMLCAHSMLEYPLHYLYFFLPFCFMLGWLEPSGFGRWRVPLPVARGLALAFVA
FT                   VAAVVLGTMWQDYRRAEAREYASNEGREALPMPRFWFRQHATADAAGQAAITPENAAAL
FT                   LPQHVAAVHLLPTPAMIARTAWLLALTGDAAQGRQWMERLRWYYLGDEAAQYATIAQAC
FT                   RGVKADQRPQAFCGWVADRSRRLAPGRD"
FT   gene            complement(519495..520442)
FT                   /locus_tag="RALTA_A0507"
FT   CDS_pept        complement(519495..520442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63175"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63175.1"
FT                   /translation="MPDRPGIRGHGRQRRRPCRAGRSPRCRLAWRRSARRHGQDTHQRR
FT                   RRHLSRAGRILRRLSLRLPRSVLLPARRGRGARGAAAIHRARPERPGARPRPGRRHAAA
FT                   GLVVPLQPAGRLLPLRRILPRRLATRAGAALAQFLTPGDTMHALTRATLAVATLALGAC
FT                   AVLPSGPSVMALPGTGKNFEQFRADDYNCRQFALGRVGGVSSAQAANNAAVGSAVVGTA
FT                   LGAAAGAAFNGGSGAAVGAGVGLLTGAAVGAGNAQYAGYGTQQQYDAAYVQCMYASGNR
FT                   VPVPGRVAAVPAPAPRYYYPPPPPPVYYSPYPYY"
FT   gene            complement(520693..521172)
FT                   /gene="moaC"
FT                   /locus_tag="RALTA_A0509"
FT   CDS_pept        complement(520693..521172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="RALTA_A0509"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /function="1.5.3.4 : Molybdenum (molybdopterin)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10903949; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63176"
FT                   /db_xref="GOA:B2AHC7"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AHC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63176.1"
FT                   /translation="MTQLTHFDTAGQAHMVDVGDKASTHRVAVATGTITMQPATFALVR
FT                   DGSAKKGDVIGIARVAAIMATKRTADLIPLCHPIGLTKVAVEFVLDEATATVACVVRTE
FT                   TRGQTGVEMEALTGVQVALLTIYDMCKAVDRGMVIGNVKLLEKHGGKSGDWMAAG"
FT   gene            521247..523106
FT                   /locus_tag="RALTA_A0510"
FT   CDS_pept        521247..523106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0510"
FT                   /product="putative zinc metallopeptidase, putative
FT                   precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63177"
FT                   /db_xref="GOA:B2AHC8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63177.1"
FT                   /translation="MGTATGGRYHSNMPKHPSLRSSAACGRGAVADAVPAGSASHRGAA
FT                   SHCRAGGAWAPWRRPLAALLALTFAAPAWPQGTPRTATAPAAPVAAPRAPAPATSGEAA
FT                   DQVYDNLNRSVKAGQKSEFGLRTNNAVVEAGGVQLPDLGDPSTAALSPDMEKRLGDRIM
FT                   RDIRRDPLYVPDPLLSDYLNALGYRLVQAARRQSISGSTGGGTFATGFDLFAVRDRSIN
FT                   AFALPGGYIGVHTGLLVQSDTESELASVLGHEIGHVMQRHIARGITQQDQSMWIALASM
FT                   VLAGLAATRSPDAAAALAMGGQGAAIANQLSFSRGAEREADRVGFQILTAAGFDPQGMP
FT                   DFFMRLQRASGTAENSVPSYVRTHPLTSERIADMQDRVSHASQRKVPNTPEYEFARMRA
FT                   RVIQEASPSDLQNLRAALRTQLAGASALRAPAVHYALAFVEQRLRRYPAAEQELAEARR
FT                   LYGTIPGASSGSPMLDVMAVELARAQGRVPEALSQANASMKAFPLSHAVAVAYAETLIG
FT                   AGRHEEAVRFLRERTRQETGRSEWWEMLARAYAGQGKRLQQHQALAEKYAMDGAYQAAI
FT                   EQLQIARKAGDGDFYTLSEVDARLHQLERQYREDKQDNKGMPN"
FT   gene            complement(523126..523716)
FT                   /locus_tag="RALTA_A0511"
FT   CDS_pept        complement(523126..523716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63178"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63178.1"
FT                   /translation="MDDIVRQAMARWPNVPNVYGWLTLDRRGQWRLRNEYAQQHGLSGD
FT                   PIRHEALIGFIERNYQCDERGCWYFQNGPQRVFVALGYAPWIVRLHQGALQTTTGQSFT
FT                   LQACFADEHGNVVLAGSVAGMAADTAPALQAALLHDHDLEQFSGASTWHGEACGADLGV
FT                   FHHDGRDLAIEPIAESEVPKRFGFVREPAAPAG"
FT   gene            complement(523753..524832)
FT                   /locus_tag="RALTA_A0512"
FT   CDS_pept        complement(523753..524832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0512"
FT                   /product="putative enzyme with alpha/beta-hydrolase domain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63179"
FT                   /db_xref="GOA:B2AHD0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63179.1"
FT                   /translation="MTQLPHHRLPQAVQDAAAPAQGYCASLPMPWWLRGGHAQTIIPAR
FT                   FSRRPPRVRFHRERWATPDQDFIDLDWTTHPVQADTPLVVMFHGLEGDSGSHYAQALMH
FT                   ALSLRGWQGVIPHFRGCSGELNLAPRFYHSGDSAEIRWVLERMRQHHCAGGRKLLVVGI
FT                   SLGGNALLRMLGEDGSTAGHVHAAAAISAPLDLAAGGAALSAGFNLVYTRMFLQTLKRK
FT                   SLAKLEQFPGLFDRDTMLASRDLYAFDNVVTAPLHGFADTDDYWRRAASKPVLRDIAVP
FT                   TLVLNARNDPFLPARHLPGPADASPQVWLEQPEHGGHVGFMTPPAGWRRHMPLQADGRF
FT                   GGHIEWLPARILQFFDSMM"
FT   gene            complement(524874..525314)
FT                   /locus_tag="RALTA_A0513"
FT   CDS_pept        complement(524874..525314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63180"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63180.1"
FT                   /translation="MPRFARLFDSAEDIVDAFREALKLRDAEGALRLWLDEDSITCVLP
FT                   DGQRLIGHEQLRQAFSQLLEEQPVLVDAIETSSHASMAVSIFDVTEALRFGSDRVEADL
FT                   YVHTTYVLMQNHEGWRLAHIHCSPANAVQVAAVAATPGQALH"
FT   gene            complement(525346..526368)
FT                   /gene="rfaF"
FT                   /locus_tag="RALTA_A0514"
FT   CDS_pept        complement(525346..526368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /locus_tag="RALTA_A0514"
FT                   /product="ADP-heptose:LPS heptosyltransferase II"
FT                   /function="1.6.3.2 : Core region"
FT                   /function="6.3 : Surface antigens (ECA, O antigen of LPS)"
FT                   /EC_number="2.-.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63181"
FT                   /db_xref="GOA:B2AHD2"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63181.1"
FT                   /translation="MKKALVIAPNWIGDALMAQPLFALLKARHPRLVIDALAPKWVAPV
FT                   LARMPEIGRVFPSDLAHGKLQLSARLMFAQQLKNEGYDLAYVLPNSLKSALIPWLAGIP
FT                   LRIGYRGEARFGMLNVRHANPPRDHRPPMVEHYARLALKPGARLPENLTEPRLRVDPAR
FT                   VAATAERFGLAPHTRVIAFCPGAEFGPAKRWPAAHFARLAQMLRRSYPYAQMITLGSAK
FT                   DAEIAAEIVSEAPFVRNLCGQTSLDDAVDLLALSEAAVCNDSGLMHVTAALGRPQVAVY
FT                   GSSDPRHTPPLSQAASIMWLQLECSPCFKRECPLGHLRCLKEIEPEMVFVELRKLLHRP
FT                   "
FT   gene            complement(526487..526681)
FT                   /locus_tag="RALTA_A0515"
FT   CDS_pept        complement(526487..526681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63182"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63182.1"
FT                   /translation="MTQTATIIEIGAEDIPLHCPTANTPAWNYHPRVFLDVADTGEAKC
FT                   PYCGTVYKLKPGTVLKGHH"
FT   gene            complement(526777..527697)
FT                   /gene="ilvE"
FT                   /locus_tag="RALTA_A0516"
FT   CDS_pept        complement(526777..527697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="RALTA_A0516"
FT                   /product="branched-chain amino-acid aminotransferase"
FT                   /function="1.5.1.17 : Alanine"
FT                   /function="1.5.1.18 : Isoleucine/valine"
FT                   /function="1.5.1.19 : Leucine"
FT                   /EC_number="2.6.1.42"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63183"
FT                   /db_xref="GOA:B2AHD4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63183.1"
FT                   /translation="MSMADRDGKIWMDGKLIEWRDAKIHVLTHTLHYGMGVFEGVRAYK
FT                   TPEGTAIFRLKEHTRRLFNSAKIFQMAMPFDEATLEAATREVVRANNLESCYIRPIVWI
FT                   GSEKLGVSAKGNTIHVAIAAWPWGAYLGEEGMERGIRVKTSSFTRHHVNVSLVRAKASG
FT                   YYINSILANQEATGLGYDEALLLDTDGYVSEGSGENVFIVRNGVIYTPDLASCLDGITR
FT                   DATLTIARDLGIEVREKRITRDEMYCADEAFFTGTAAEVTPIRELDDRIIGEGRRGPVT
FT                   RQIQDAFFAAVGGTDEKYKKWLTSV"
FT   gene            527948..530941
FT                   /locus_tag="RALTA_A0517"
FT   CDS_pept        527948..530941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0517"
FT                   /product="putative DNA/RNA Helicase"
FT                   /function="2.1 : DNA related"
FT                   /function="2.2 : RNA related"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63184"
FT                   /db_xref="GOA:B2AHD5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63184.1"
FT                   /translation="MPLTTHNASKSPPESASNESPPADWQQALEALRALAGTDPAAGAA
FT                   GPARRLLWALTLDADGAPGTIEPLEQVRGAKGWGKPRPVPLARIAEDDRLEPWDARVAR
FT                   AIRRDASHNRRYVLDRAMAVMALAGHPGVVLAHAPTQTLEVVEDAPALEAVRSAGRYVL
FT                   RLFPPVREAPALEALLPAAARQEAEALRQLTLLRDGPHRLRLIRYTPAQFEAARLIGNG
FT                   LAIPEEGHARLDQTLRALAGQFQVQADAAAGSRTVEAEPRLRAEVAPVGRGISLRLVVT
FT                   PLGPLGPRLAPGAGRERLMAAVRGETLSTQRDLDAELASVAEVFAALPQLVALSPPGGE
FT                   YTWSLDDPEDALAVVEALPSLPAVQAVEWPRGKALRVLPADLPQLGVQIESRGAWYRLA
FT                   GELRVAEGLVLELGKLIDWTAGHAGRFVPIGQGVYVALTQVLRGRLRDLAGVGERVPDG
FT                   IRVPQMATPWLDDVLAGAGVDPDAHFRARIARLRAAREAEIALPATLAAELRPYQEAGY
FT                   RWAMTLAASGLGACLADDMGLGKTLQALAVLVARAGGGAALVIAPTSVCGNWAAEARRF
FT                   APTLNVHVYAEGERDALLAQAGAHDLVIVSYTLLQQASQEFCAREWHTVVADEAQAFKN
FT                   AVTRRAQAMFALPSGFRMALTGTPVENRLAELWSVMRFCNPGLLGSLARFNEHFANPIE
FT                   RAGSREARLRLRRMIAPFVLRRTKAQVLDELPPRTELVIRVEPGPVEAAHYEALRRQAQ
FT                   TEAEAALARLDAARKATRDAPAGARVPAQAQHQVRLHVLAQLMRLRRAACDPRLVTPEV
FT                   AAQLSDQGGEGAKVRAFVELASGLAASGHKTLVFSQFVDFLQLLRQGLERAGLALQYLD
FT                   GATPAAERTRRVAAFQAGEGDVFLISLKAGGFGLNLTAADYVIVADPWWNPAAEDQAMG
FT                   RAHRIGQRRPVTVYRLINAGTIEERIVELHRDKRALADGLLEADDDHAAGTGAPLPDVD
FT                   ELVGLLRR"
FT   gene            complement(531064..531264)
FT                   /locus_tag="RALTA_A0518"
FT   CDS_pept        complement(531064..531264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0518"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63185"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63185.1"
FT                   /translation="MGAPSVNVTRKRPGAADFAADLSDGRDLSPGPAQQDSKVPAKTKR
FT                   LSLPEGMPCGHMAGRGVMPFS"
FT   gene            531263..532279
FT                   /locus_tag="RALTA_A0519"
FT   CDS_pept        531263..532279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0519"
FT                   /product="conserved hypothetical protein, UPF0065"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12562821"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63186"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63186.1"
FT                   /translation="MPNSSRLLPRLSFRSVARVAALCAAVAGTASLPAHAQGEWPTQPV
FT                   TILMGFTAGSGVDIVGRTLQESLQKSLKTTIVYDYRPGAGGNVASEVVAHAKPDGYTLL
FT                   LGTAATHGINPALYKALPFDADADFTPIAPLVEVSNVLTVNPAVLDVKSVKEFIEKVKA
FT                   NPGKYNFASTGNGTGTHLAFAEFNARAGLDMVHVPYKGGPDALQAVVKGEVCCIFNQVQ
FT                   SVLPQFRAGKVRLLGVTTRQRVQVIADVPTIAESGLPGFNSTIWFGLFGPRGLDPKIAR
FT                   KVNDAVRVALETPAIRQKLIDAGNTPRVETVEQFKATVKADRQKWAGVVKTVGASID"
FT   gene            complement(532314..533453)
FT                   /locus_tag="RALTA_A0520"
FT   CDS_pept        complement(532314..533453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0520"
FT                   /product="putative transcriptional regulator; DNA-binding
FT                   HTH domain LuxR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63187"
FT                   /db_xref="GOA:B2AHD8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63187.1"
FT                   /translation="MTDTQMHDTIRALYEGIFDADAWQRSLGALCQASGSSHAHLLVLD
FT                   TVHERVLVHQEVNPMPEAVAAYREQFAAIDPALPFARRMAVGSWYIDSRELGPQVMRKS
FT                   PFYGEFLRPIEQSSVMACLIERQPHYDVFLSLQRPHGHDHYSPEDARALDWAIPHMRQA
FT                   MALRERTHQVSALAHASSQLMERLPFGVIVFRDDGKPLLSNSIGENWVRRLLPAVSIET
FT                   SVAAPPGAARDDGGWTLSRPFADALRAVSNPASAQPAQALRAVDSAGRQAQVILMPLPP
FT                   AHHLALDWQRPSVLVAIHEPGAAPMTLPTVLRELYGLTPAEIRLALQLSTGIGLPEACE
FT                   LIGIRRETGRTQLKAIFTKTGTGTQAQLAHLLTRLGVRA"
FT   gene            complement(533553..534656)
FT                   /locus_tag="RALTA_A0521"
FT   CDS_pept        complement(533553..534656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0521"
FT                   /product="putative transcriptional Regulator, LuxR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63188"
FT                   /db_xref="GOA:B2AHD9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63188.1"
FT                   /translation="MNEADMHGAIRGLYEGILDPGAWQDSLRTLTGLAGAAHASMMVWD
FT                   TVRDQITVNEIVNPVVELFTEYETDYQAIDPAKQFAPAMRPGDWYIDARELGEGTMARH
FT                   PFYRDFFHRYGLRSYVACLVERQPHYEVYFSMQRARRQPLFSSADTGGLDWIVPHMRSA
FT                   MAMRDRTLGLTVLARLSTQLVERLNFALLVFSPQRHVLLCNRAGERWARRLDPAGKVSE
FT                   WTLSRPFADMVQAACDPRRAVAAQAARATSGDASAQVIVLPLPPSHAFAAQWQEPAALV
FT                   IVHEQDRAPLLLGPVLRDLYGLTPAETRLSVQLAHGQGLPEASQQLGIRHETARTQLKA
FT                   VFHKTGCNSQAQLTHLLSRLGAALDQG"
FT   gene            535071..536267
FT                   /gene="pgk"
FT                   /locus_tag="RALTA_A0522"
FT   CDS_pept        535071..536267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="RALTA_A0522"
FT                   /product="phosphoglycerate kinase"
FT                   /function="1.1.1.23 : Galactose degradation"
FT                   /function="1.3.1 : Glycolysis"
FT                   /function="1.7.8 : Gluconeogenesis"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="2.7.2.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2545537; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63189"
FT                   /db_xref="GOA:B2AHE0"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63189.1"
FT                   /translation="MTSVLRLSDLISQGKLSGKRVFIRADLNVPQDDAGNITEDTRIRA
FT                   SVPAIEACLAAGAAVMVTSHLGRPTEGEFKPEDSLAPIAARLSELLGKPVKLVQNWVDG
FT                   VEVAPGQVVLLENCRVNKGEKKNSDELAQKMAKLCDVYVNDAFGTAHRAEATTHGIAKY
FT                   APIACAGPLLAAEIDALGKALGQPARPLVAIVAGSKVSTKLTILKSLADKVDNLIVGGG
FT                   IANTFMLAAGLKIGKSLAEADLVGDAKAIIDIMAERGASVPIPVDVVCAKEFSATATAT
FT                   VKDVKDVADDDMILDIGPKTAALLADQLKAAGTIVWNGPVGVFEFDQFGNGTRVLAEAI
FT                   AESKAFSIAGGGDTLAAIAKYGIADRVGYISTGGGAFLEFLEGKTLPAFEVLEQRAAG"
FT   gene            536361..537797
FT                   /gene="pykA"
FT                   /locus_tag="RALTA_A0523"
FT   CDS_pept        536361..537797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="RALTA_A0523"
FT                   /product="pyruvate kinase II, glucose-stimulated"
FT                   /function="1.1.1.23 : Galactose degradation"
FT                   /function="1.3.1 : Glycolysis"
FT                   /function="1.3.5 : Fermentation"
FT                   /function="1.3.7 : Anaerobic respiration"
FT                   /EC_number="2.7.1.40"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8439398; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63190"
FT                   /db_xref="GOA:B2AHE1"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63190.1"
FT                   /translation="MTRSTKIVATIGPASSSLEILTRMIAAGVDVVRLNFSHGTAQDHL
FT                   DRARLVREAAQACGREVAIMADLQGPKIRVGKFEHGKILLKAGEPFILDSNCKLGNEER
FT                   AGLDYQDLPRDVGPGDLLLLNDGLIVLVVDRVLGNEIFTTVRVGGELSNNKGINRQGGG
FT                   LSAPALTAKDMEDIKTAMALGADYLAVSFPKNATDMEMARQLAAVAGQPHGHRARMIAK
FT                   IERAEAIHPGVLEEILQASDGIMVARGDLAVEVGNAAVPALQKRMIKLAREANKLTITA
FT                   TQMMESMIVNPVPTRAEVSDVANAVLDGTDAVMLSAETAAGRYPVETVEAMAAVCIEAE
FT                   KSEVVQLDTDFLNQTFSRIDQSVAMGALFTAYHLQVKAIAALTDSGATALWMSRHRIHV
FT                   PIYAMTPNLASQRKMQLYRNVVPLPLQSSTDRDTALEQAEELLLAQGVVQRGDFIVLTI
FT                   GEPMGQPGGTNTLKIVRVGH"
FT   gene            537848..538912
FT                   /gene="fbaA"
FT                   /locus_tag="RALTA_A0524"
FT   CDS_pept        537848..538912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="RALTA_A0524"
FT                   /product="FRUCTOSE-BISPHOSPHATE ALDOLASE PROTEIN"
FT                   /function="1.3.1 : Glycolysis"
FT                   /EC_number="4.1.2.13"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8550527; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63191"
FT                   /db_xref="GOA:B2AHE2"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63191.1"
FT                   /translation="MPLVSMRQLLDHAAENSYGLPAFNVNNLEQVQAIMQAADEVNAPV
FT                   IMQASAGARKYAGEHFLRHLIEAAVEAYPHIPVVMHQDHGQSPAICQAAIDLGFSSVMM
FT                   DGSLREDGKTPADYEYNVDVTRKVVQLSHAIGVTVEGELGCLGSLETGEAGEEDGIGAE
FT                   GKLDHSMLLTDPEQAADFVKATQLDALAIAIGTSHGAYKFTRKPTGDILAINRIKEIHA
FT                   RIPNTHLVMHGSSSVPQELLEEIRKFGGDMKETYGVPVEEIQEAIKYGVRKINIDTDIR
FT                   LAMTGAIRRFFVENPSKFDPREYLKPAREAAKQVCKARYLAFGCEGQASKIKPVALSEI
FT                   AQQYKSGKLAQVVQ"
FT   gene            539076..539984
FT                   /gene="purC"
FT                   /locus_tag="RALTA_A0525"
FT   CDS_pept        539076..539984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="RALTA_A0525"
FT                   /product="PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE
FT                   SYNTHASE"
FT                   /function="1.5.2.1 : Purine biosynthesis"
FT                   /EC_number="6.3.2.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1534690; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63192"
FT                   /db_xref="GOA:B2AHE3"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2AHE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63192.1"
FT                   /translation="MTNALYQSSINSLPLLGHGKVRDNYAVGNDKLLIVTTDRLSAFDV
FT                   IMGEPIPDKGRVLNQMANFWFRKLAHIVPNHETGIAPETVVAADEVEQVRGRAVVVKRL
FT                   KPILVEAVVRGYLAGSGWKDYQATGKVCGIELPPGLQNAQKLPEPIFTPAAKAEMGEHD
FT                   ENISFAEVEARIGIALARQMREISIRLYKEAAEFAATRGIIIADTKFEFGLDDNGVLTL
FT                   MDEVLTADSSRFWPADSYQVGTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPKLPDDV
FT                   IEKTAAKYREALTRLTGEELK"
FT   gene            540104..540601
FT                   /gene="purE"
FT                   /locus_tag="RALTA_A0526"
FT   CDS_pept        540104..540601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="RALTA_A0526"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide mutase"
FT                   /function="1.5.2.1 : Purine biosynthesis"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="4.1.1.21"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10574791; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63193"
FT                   /db_xref="GOA:B2AHE4"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63193.1"
FT                   /translation="MSKQDKPLVGVVMGSSSDWDVMQHAVAMLKDFGVPFEAQVVSAHR
FT                   MADDMFRYAESARGRGIRAIIAGAGGAAHLPGMIAAKTIVPVFGVPVPSKYLRGEDSLL
FT                   SIVQMPKGVPVATFAIGEAGAANAALHAIATLATTDDALAAALEAFRAKQTEAARAMTL
FT                   PL"
FT   gene            540654..541898
FT                   /gene="purK"
FT                   /locus_tag="RALTA_A0527"
FT   CDS_pept        540654..541898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="RALTA_A0527"
FT                   /product="phosphoribosylaminoimidazole carboxylase (AIR
FT                   carboxylase), ATPase subunit"
FT                   /function="1.5.2.1 : Purine biosynthesis"
FT                   /function="7.1 : Cytoplasm"
FT                   /EC_number="4.1.1.21"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10569930; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63194"
FT                   /db_xref="GOA:B2AHE5"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63194.1"
FT                   /translation="MPTDIHPYLSEAHTPESRAEFGVDRPDAPILPGAWLGMLGGGQLG
FT                   RMFTHAAQAMGYRVCVLDPDQDSPAGVVADKHICAAYTDEAALAEMGKLCQAVSTEFEN
FT                   VPSLSLDRLEQLGAFVAPRGYCVSIAQNRIGEKKFFAACAERTGVPTAPHWVIQHDADV
FT                   DQLPDHVLPGILKTARMGYDGKGQARVKTRDDVRAAWKAMQHVPCVLEQMLPLAYEVSV
FT                   LAARGADGATATWPLAENVHRDGILFSTEMPSTSVSPEIAERARAAAAAIATEMGYVGV
FT                   LCIEFFVLTDGSLVANEMAPRPHNSGHITMDACETSQFEQQVRAMARLPLGSTRQHSAG
FT                   KMLNLLGDVWFEFGLERTPAWDEVVAQPGAKLHLYGKSDARPSRKMGHVNCIGEHAEAA
FT                   DAAFTAAAQALHIPL"
FT   gene            541912..542901
FT                   /locus_tag="RALTA_A0528"
FT   CDS_pept        541912..542901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0528"
FT                   /product="conserved hypothetical protein,
FT                   Sua5/YciO/YrdC/YwlC family; putative double-stranded RNA
FT                   binding domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63195"
FT                   /db_xref="GOA:B2AHE6"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63195.1"
FT                   /translation="MSPRTPTAAELDEAVRLLEAGQLVAFPTETVYGLGADAENPAAVG
FT                   RIFALKGRPSNHPVIVHVVDGADIGYWTDDVPAAAQQLIDAFWPGPLTLILKRAAHIDA
FT                   AVAGGQDSIGLRCPSHPVAQALLSRFKRGRGGIAAPSANKFGQVSPTTAQHVREEFGDA
FT                   VYVLEGDGVEVGIESTIVDLSRLDQGIGPVLLRPGAVTVGMLAQVLGEAPLPPDAAAPR
FT                   ASGTLKAHYAPHTPLLLADAQAAAARLEALPADARVAWVGRAPLADQRCTWVQAPGDAA
FT                   AYAQELYRLLRKLDRQGYTQLVFEVLPEGQDWAGVRDRLERAAAAFGG"
FT   gene            complement(543068..543406)
FT                   /locus_tag="RALTA_A0529"
FT   CDS_pept        complement(543068..543406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0529"
FT                   /product="putative membrane component, COG4392"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63196"
FT                   /db_xref="GOA:B2AHE7"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63196.1"
FT                   /translation="MSHTEVWIALVGMAVVTVITRALFLMAGEHITVPDRIQRALRYAP
FT                   AAALAAIILPDLMTWQGHFTVAFSNYKLMAGVAATVFYLVTRKMVGMIVVGMAVYTALR
FT                   LLGGVMLT"
FT   gene            complement(543403..544251)
FT                   /locus_tag="RALTA_A0530"
FT   CDS_pept        complement(543403..544251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0530"
FT                   /product="conserved hypothetical protein; Putative
FT                   branched-chain amino acid permease transmembrane protein,
FT                   azlC motif"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63197"
FT                   /db_xref="GOA:B2AHE8"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63197.1"
FT                   /translation="MTSRQPPVWLRLWHRFAPAERAGFLDGARRFAPSLPAVFSWGLVT
FT                   GVAMSKSVLTVPEAIGMSLLVYAGSAQLAVLPLFAAGLPLWTIWLTAAMVNLRFVIFSA
FT                   GMQPHFSYLTLARRTVLGFFNGDLHFVYFLQKYSTPGYEPGKEGYFWGMALTNFCMWQV
FT                   SSIIGIVLASLFPDSWGLGLAGTMALIPVMIATINSRSTLMAVVISAVLALLCFDLPYR
FT                   LGLVVAVVGAIAAGMASDELAARAALRGIQRRRQAPLAKPASKPASKPAPEPADVPGDR
FT                   A"
FT   gene            complement(544440..546041)
FT                   /gene="dacB"
FT                   /locus_tag="RALTA_A0531"
FT   CDS_pept        complement(544440..546041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="RALTA_A0531"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /function="1.6.7 : Peptidoglycan (murein)"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /EC_number="3.4.16.4"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63198"
FT                   /db_xref="GOA:B2AHE9"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63198.1"
FT                   /translation="MAAMPKTLAAPTAARPGALLRRLSPLLSPLLAAVLLAGGPALTPA
FT                   YAKPPAKTAKAVKAAKPAKAQKVAADPALLNAGVPAPVAAALRRAGVPAAAASFYVVRL
FT                   GDSSARASWNAQQPMNPASTMKLVTTFAGLQLLGPDYRWQTSLYADAQPGFDGTVNGNV
FT                   YLRGHGDPKLVPEEMAKLVARARAAGATTINGDLVLDRSYFADGLDSNGTIDGEVQRAY
FT                   NVGPDALLYAFKTLSFTLTPDPATQTVAVSVTPELAQLKLDNRLTLTNGRCGDWQSSAS
FT                   PTVLPQADGTVLASFSGDYASDCGEHVLNIATLSHAEFTWGGFVAEWQRAGGRFARLPA
FT                   LRSGKVPRGAVLLARHYGLPLADIVRDINKFSNNVMARQLFLTLGAEMDRGGPASTGRS
FT                   IRVVQRWLARQGLDMPGLVLDNGSGLSRAERISAYDMARLLQQAAASPVGPVLIDSLPV
FT                   LGVDGTLRNRLTRASAAGSGYLKTGTLADVRALAGYVDAAEGGRYVVVSMINHANAAQA
FT                   QEAHDALLQWVYRGAH"
FT   gene            complement(546093..546680)
FT                   /locus_tag="RALTA_A0532"
FT   CDS_pept        complement(546093..546680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0532"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63199"
FT                   /db_xref="GOA:B2AHF0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63199.1"
FT                   /translation="MIPDASGTPPATPARRARTAAAPARRRTRDALAPDPAAGDGADGG
FT                   FDPHVPNIDYGVLDDLVGYAIRRAQIRIYEDFVQSLAQWQITPPRFSALVIISRNPHLK
FT                   LTELAQILGIARSGAVLLVDALEAMKLVARRPAAGDRRAYSLVLTPAGRRTLEAATQAV
FT                   VAHDAHVSSALSEAEQATLKALLARLAPPRAG"
FT   gene            complement(546677..547828)
FT                   /locus_tag="RALTA_A0533"
FT   CDS_pept        complement(546677..547828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0533"
FT                   /product="putative branched amino acid transport system
FT                   permease, periplasmic binding component"
FT                   /function="4.3.A.1.p : periplasmic binding component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63200"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63200.1"
FT                   /translation="MTSQTAARLARLALGIAVAFTATTALADITVGVSLSTTGPSASLG
FT                   IPQKNSLAYLPQRIGGEPVRYIVLDDASDPTQGAKAARRFVAEDKVDIILGSSAVAPSI
FT                   AIAEVADEAQTVQLAFSPIELKPGRGAWTFRLAQPVRLMANAVAATAKTHGVKTMGFIG
FT                   FADAYGETWLKDFTAAATANGIRLIATERYGRADTSVTAQVLKLIAARPDAILIAGAGT
FT                   GAALPHTTLRERGYGGTLYQTHGAATRDLIRIGGRLVNGAILPAGPVIVPEQLPAGDPV
FT                   RKPALDYVTRYEKQYGAETRTQFGAHAYDAGLVLERIVPVALKQARPGTPAFRQALRHA
FT                   LETERDIVVSHGVLNFSAQDHYGFDQRGRVMVTIENGNWKLLK"
FT   gene            complement(547872..549125)
FT                   /locus_tag="RALTA_A0534"
FT   CDS_pept        complement(547872..549125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0534"
FT                   /product="putative Salicylate 1-monooxygenase"
FT                   /function="1.4 : Energy production/transport"
FT                   /EC_number="1.14.13.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63201"
FT                   /db_xref="GOA:B2AHF2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63201.1"
FT                   /translation="MKIAIAGGGIGGLTLALLCHRHGIEAEVWEASESLRPLGVGINLL
FT                   PHAVRVLSELGLRDALAAIAVETSSLSYYNKLGQRIWHEPRGLAAGYDWPQFSIHRGEF
FT                   QMLLHRTVVERLGAGAVHTGHSFDTVLDTGAHGQARFMLRRRADNAAVESSADVLVGAD
FT                   GIHSAVRRHFYPAGDLPRFSRRLLWRAVTEAPPYLDGRSMFMAGHQDQKFVAYPISEPL
FT                   RRQGRALVNWIAELRVPDSVPDTPPRSDWNKQVDKAVFRARFAGWQWDWIDIPALIDGA
FT                   GAIYEFPMVDKDPLPRWTFDRVTLLGDAAHPMYPIGSNGSAQAILDARYLVDSLLGTRD
FT                   TGYALREYEAERLPRTAGIVLRNRMNGPEQVMQLAEERAPQGFSDIDQVIPRAELEAIS
FT                   LRYKQLAGFDRQSMQGKA"
FT   gene            complement(549408..549872)
FT                   /locus_tag="RALTA_A0535"
FT   CDS_pept        complement(549408..549872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0535"
FT                   /product="conserved hypothetical protein; Transmembrane
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63202"
FT                   /db_xref="GOA:B2AHF3"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63202.1"
FT                   /translation="MRNTRDRIRHAVGFEVVGLLIFAPLASWAFGYELHQMGLIGAVAS
FT                   LVATGWNYLYNVLFDKGMLRFTGQLRKSVPVRVLHAVLFELGLLVVFLPSLAWYLGISL
FT                   IDALIMDIAVAGFYMVYALVYNWLYDIVFPVPSLKAKSAAPANPENAALG"
FT   gene            549981..550883
FT                   /locus_tag="RALTA_A0536"
FT   CDS_pept        549981..550883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0536"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /function="3.1.2 : Transcriptional level"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63203"
FT                   /db_xref="GOA:B2AHF4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63203.1"
FT                   /translation="MSLSLEQLQAFVAAADTGSFSAAARRLGKAQSVVSAAVSNLEIDA
FT                   GNALFDRTGRYPVLTPAGERLLAEARVILERCEHFRGVAKSLGEGVETRLVLAVDELYP
FT                   EETLGALLVEFSGRFPAVELELLFPLMEDVSRLVLEGGADLGIMWRQEVLPPELGFHAL
FT                   GWMPMQILCAPDHPLASQRVDWEELKRYRQLMVATRTDSEEKMRLRVAADVWWVESQWV
FT                   IVELVKRGLGWAFVPWHVVANSPAAAQLVSPPLAFQQQDWPVAMELVWHKQRPLGKAAT
FT                   WLRERICAQPLPSAPQRGG"
FT   gene            complement(550880..552412)
FT                   /gene="mdtD"
FT                   /locus_tag="RALTA_A0537"
FT   CDS_pept        complement(550880..552412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdtD"
FT                   /locus_tag="RALTA_A0537"
FT                   /product="RND efflux system, outer membrane lipoprotein"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /function="4.2.A.6 : The Resistance-Nodulation-Cell
FT                   Division (RND) Superfamily"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12107134; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63204"
FT                   /db_xref="GOA:B2AHF5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63204.1"
FT                   /translation="MRRLDMNAFTRFLTPALPLPLACALLLAGCAVGPDYQRPDAPMSA
FT                   EFKEASADTATPAWTGDWKPAEPQDALARADWWTVFGDAQLDALMAEVQISNQNIKAAE
FT                   AQYRQALASLQAARAGFFPLVDAQAGASRARGASGNTLNGQNATLGATWELDVWGRVRR
FT                   QVESSEASAQASEADLASTLLSTQATLAQSYFLLRVADAQKALLDRTVADYQKSLQLVQ
FT                   NQYAAGTAQRSDVLQSETQLKSAQAQQIDIQITRAQLEHAIAVLVGKPPAALSLAAGEF
FT                   RAAPPRVPAAVPSQLLERRPDIGAAERRMASANAQIGVAQAAYYPTLSLSASGGLTAST
FT                   LARWMSLPDRIWSIGGGLAGTLFDGGARRAAKAQAVAAYDQTVANYRQTVLGAFQEVED
FT                   NLAAQRLLEQEAVVQNDALRSAREALALVNNRYRAGTAGLLDVLTAQTSAYTAERTALS
FT                   ITGRQYTAAVVLIKALGGGWHAQPAGAGGSASDSGNDSDSGQAAAPATIGQR"
FT   gene            complement(552415..555714)
FT                   /gene="mdtC"
FT                   /locus_tag="RALTA_A0538"
FT   CDS_pept        complement(552415..555714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdtC"
FT                   /locus_tag="RALTA_A0538"
FT                   /product="multidrug efflux system, subunit C"
FT                   /function="4.2.A.6 : The Resistance-Nodulation-Cell
FT                   Division (RND) Superfamily"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /function="6.1 : Membrane"
FT                   /function="7.4 : Outer membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12107134; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63205"
FT                   /db_xref="GOA:B2AHF6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63205.1"
FT                   /translation="MNLSAAFIHRPVATALLTLGILLAGLAALRLLPVSPLPQVDFPTI
FT                   SVSASLPGASPETMAATVATPLERALGTIAGVTEITSSSSLGSTRVTLQFDLSRDIDGA
FT                   ARDVQAAINASRATLPTSLPNNPTYRKVNPADAPIMIIALTSPTMTRGQLYDAASTILA
FT                   QKLSQVEGVGQVTIGGASLPAVRVELNPTALNNYGISLEDVRNTISATNANRPLGTLEN
FT                   ASNNWQVYANDQAMKAEDYMPLIIRYATPGTYSSASAGALIASTANATASGGVSTKVVN
FT                   GVTVTTLTTSSGTTTITSGATGGTSATSGPNSFAVPVRLRDVANVVDSVQDIRNAGSAN
FT                   GKPSVLLVLNRSPGANIIETVDRVNEMLPNLQKMIPAAISMDVMMDRTPTIRASLREVE
FT                   HTLMISVALVIMVVFVFLRNVRATLIPSVAVPVSLIGTFSVMYLAGFSLNNLSLMALTI
FT                   ATGFVVDDAIVVLENISRHIEEGMKPLAAALRGAREVGFTVLSMSLSLIAVFIPLLMMG
FT                   GIVGRLFQEFAITLSVAILVSLVVSLTTTPMMCARMLRPVEPEKQGRFFRATERMFQWL
FT                   HDGYARSLSTALRLSPLVWLVLIATIALNVYLYVIVPKGFFPQQDTGRLIGFIRADQAT
FT                   SFQAMRGKLDNFIKIVQSDPAVVNVTGFTGGSQRNTGQMFVTLKPLSERKESADAIIAR
FT                   LRGKLAKEPGASLFLQSVQDIRVGGRQSSSQYQFTLQSDDLEVLRAWEPKVRAALSNLK
FT                   GLEDIDTDTNDKGLQTSVIIDRDAASRLGVTAQQVDAVLNDAFGQRLVSTIYHPLNQYR
FT                   VVMELSQEYLQGPDALKDIYVVTGNGNRVPLAAFARVTPSSTPLGVNHQGQFAASTISF
FT                   NLAEGTSLSQATDAINREMARIGAPETLRANFQGGAKAFQDSLKSQPALILAALITIYI
FT                   VLGVLYESYVHPLTILSTLPSAGVGALLALLASKTDFSIIALIGVILLIGIVKKNAIMM
FT                   IDFAIDAERREGLSPRDAIYRACLLRFRPILMTTMAALLGAVPLALGRGDGAELRAPLG
FT                   ISIVGGLVVSQLLTLYTTPVVYLTLDRWRLKVRAWRQRRRGTGTPDQPAAV"
FT   gene            complement(555717..558839)
FT                   /gene="mdtB"
FT                   /locus_tag="RALTA_A0539"
FT   CDS_pept        complement(555717..558839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdtB"
FT                   /locus_tag="RALTA_A0539"
FT                   /product="multidrug efflux system, subunit B"
FT                   /function="4.2.A.6 : The Resistance-Nodulation-Cell
FT                   Division (RND) Superfamily"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /function="6.1 : Membrane"
FT                   /function="7.4 : Outer membrane"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12107134; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAP63206"
FT                   /db_xref="GOA:B2AHF7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2AHF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAP63206.1"
FT                   /translation="MNPSRLFIERPVATALLMLAILLSGLVAYRLLPLSALPEVDYPTI
FT                   QVTTLYPGASPDVMTSSVTAPLERQFGQMPGLKQMSSSSSGGASVITLQFELTLPLDVA
FT                   EQEVQAAINAGSNLLPSDLPMPPVYSKVNPADAPIMTIAMTSDTMPLPKLQDMVDTRVA
FT                   QKISQIQGVGLVTISGGQRPAVRIQANPTALASLGMSIDDLRTAIGASNVNGAKGSFDG
FT                   PQRASTIDANDQLRSADEYRQIILGYKNGAPIRITDVAEIVDGPENSRLAAWANDKPAI
FT                   VLNIQRQPGANVIEVVDRIKALLPQLQNALPASVHVQLLTDRTTTIRASVEDVQFELLL
FT                   AIALVVLVIFLFLRNIPATIIPGVAVPLSLVGTFGVMYLAGFSINNLTLMALTIATGFV
FT                   VDDAIVMIENIMRYIEKGDSPMQAALKGSKQIGFTIISLTFSLVAVLIPLLFMGDVVGR
FT                   LFREFAITLAVSILISAVVSLTLTPMMCARLLHHVPEEKLSRFHRATGRFFDNVIERYG
FT                   RGLEWVLDRQKATLVVAVATLALTVLLYLLVPKGFFPVQDTGVIQGITEAAQTTSFNAM
FT                   ARKQEAVAKVVMQDPAVASLSSFIGVDGSNATLNAGRMLINLKPKGERDPIDVVTQRLQ
FT                   QSVQSLGGVSLFTQPVQDLTIEDKVSRTQYQFTVEDPDPATLAAWVPKLVERLRQEPEL
FT                   RDVTSDQQNNGLRAYVDIDRDAAARFGITTAVIDSALYSAFGQRLVSTIFTQSSQYRVV
FT                   LETMPEFRTSPQSLAELRLPSSSGGQVPLGAFARITERTGPLVINHQGQFPAATISFNL
FT                   AHGESLGAAVDKITRVEQELGLPISMQTSFQGAALAFRASLSNTLWLILAAVVTMYIVL
FT                   GVLYESTIHPVTILSTLPSAGVGALLALLVAGMDLGIIAIIGIILLIGIVKKNAIMMID
FT                   FALEAEREQGMSPRDAIFQACLLRFRPILMTTMAALLAALPLMLGSGIGSELRRPLGVT
FT                   MVGGLLVSQVLTLFTTPVIYLAFDRVATRVKGWRKRRFGDPEEGGTGEEPV"
FT   gene            complement(558849..560333)
FT                   /gene="mdtA"
FT                   /locus_tag="RALTA_A0540"
FT   CDS_pept        complement(558849..560333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdtA"
FT                   /locus_tag="RALTA_A0540"
FT                   /product="multidrug efflux system, subunit A"
FT                   /function="4.2.A.6 : The Resistance-Nodulation-Cell
FT                   Division (RND) Superfamily"
FT                   /function="5.6.4 : Drug resistance/sensitivity"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12107134; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ68525"
FT                   /db_xref="GOA:B3R0V1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B3R0V1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAQ68525.1"
FT                   /translation="MSNPEHGQPNPTPSPSSPPPGSSGTPPRRNRRRLYAGLLVLLLAG
FT                   GAWYWHAHRGDASKGSPGGPGGASGPAAAGPGGPGGRPGMPRSPVVVATVAQRDMDVVL
FT                   NGLGNVTPVSNVTVRAQVSGPLLKVLFKEGQMVTAGDVLAEIDPRPFQAALDQAVGQLA
FT                   RDQALLQNAKLDQQRYRTLLGQDSISKQQVDTQDALVRQYEGVVKTDQGNVANARLQLG
FT                   YTKIVAPVSGRIGLRQVDPGNIVNTSDTNGIALITQIQPIAVMYTIPEDNLPSVLKKLN
FT                   AGEKLPVQAWDRQVRNQLGEGTLLTTDNQIDTTTGTVKLKAVFPNADGMLFPNQFVNVR
FT                   TRVDTLRDATVIPVAAIQRGQQGTFVYTVDEASKVKVQVVELGPGDGARTAVLKGLEPG
FT                   QRVVVDGADRLKEGMTVETVDPAARAAAVVPASQPRARGRRHRDGASGAGGAGGASGAQ
FT                   ADAGATGAASASAPQGERRRHREAGASAPAARAPQQ"
FT   gene            560659..561402
FT                   /locus_tag="RALTA_A0541"
FT   CDS_pept        560659..561402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0541"
FT                   /product="putative response regulator, OmpR family"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12107134; Product type pr : putative
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ68526"
FT                   /db_xref="GOA:B3R0V2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B3R0V2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAQ68526.1"
FT                   /translation="MRTNQPTQILVVDDDPELRDLLREYLTQQGFAVSVMHDGDGLQAR
FT                   LERERPALIVLDLMMPKVDGLTALRNLRARNDDIPVILLTARSDEIDRIVGLEIGADDY
FT                   LGKPFSPRELLARINAVLRRKLARPAAAPEDRESVAFGPFRVNFRQRTLARAGQALSIS
FT                   DTEFALLKLLLMHPLEVLSRERIVELMYGSASGISDRGIDVQIWRLRRLLDEDAQRPRY
FT                   IQTVRGRGYTFVPDEAEEIPAGLPE"
FT   gene            561470..562741
FT                   /locus_tag="RALTA_A0542"
FT   CDS_pept        561470..562741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0542"
FT                   /product="putative sensor histine kinase"
FT                   /function="3.1.2.4.3 : Two-component regulatory systems
FT                   (external signal)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12107134; Product type prc : putative
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ68527"
FT                   /db_xref="GOA:B3R0V3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B3R0V3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAQ68527.1"
FT                   /translation="MKLRRIDTLFGRIALLIAAVLVISHFSWLAILRMDRRQQQVDYSV
FT                   EQMLFQLDSIERALDARPPAKLPSLVETANTADADEHATAPKGGRSRRLVEQFISRLPQ
FT                   GTEIRLEDETTPRIWIKLPSRADWIAMPILWVHNPPPDNRLVPGVMLVVGVAIVFAVLI
FT                   AWQIQRPVRDMANAAALLSRQHAVPPLRERGPHELRQLIERFNRMVADLARIDQERNTM
FT                   LAGIAHDLKTPLARLRLRAEMLADPKAAAGVTRDVDSMAAIVEQFLSFAQTSESTARPV
FT                   PVDRRVNELAASLAEQERQVVLSLDAGEGFRMIATQLDRIVGNLVDNAYAYGKPPVCIA
FT                   TSRTPDGYMLVVEDQGDGIPDDDKERATLPFVRLDPARGGNAHSGLGLAIVDRLVRQAG
FT                   GKLNLVNAEGGGLRVEMLFGAATV"
FT   gene            complement(562882..563490)
FT                   /locus_tag="RALTA_A0543"
FT   CDS_pept        complement(562882..563490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0543"
FT                   /product="conserved hypothetical protein, DUF205"
FT                   /function="6.1 : Membrane"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ68528"
FT                   /db_xref="GOA:B3R0V4"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3R0V4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAQ68528.1"
FT                   /translation="MANLLFALAAYLIGSVSFAVVVSKLMGLPDPHSYGSGNPGATNVL
FT                   RTGNKKAAILTLIGDALKGWLAVWLAARFGPAHGLNDTGLAMVALAVFLGHLFPVFHRF
FT                   AGGKGVATAAGILLAIDPILGLGTLATWLIIAFFFRYSSLAALVAAIFAPFFHVLMNGV
FT                   DVMAGAIFVISVLLIARHRQNIAKLLAGKESRIGEKKKV"
FT   gene            complement(563614..564105)
FT                   /locus_tag="RALTA_A0544"
FT   CDS_pept        complement(563614..564105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0544"
FT                   /product="conserved hypothetical protein; putative
FT                   nucleotide/oligonucleotide binding protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ68529"
FT                   /db_xref="GOA:B3R0V5"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B3R0V5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAQ68529.1"
FT                   /translation="MSKTKHVSETPATQFLRKHGVAFGEHPYDYVEHGGTGESARQLDV
FT                   PEHDVVKTLVMEDERAQPLVVLMHGDCSVSTKNLARQTGRKSVQPCKPEVAQRHSGYLV
FT                   GGTSPFGTKKRMPVYVESTVLDLARIYINGGRRGYLVSLDPKLLPTLLDAQPVQCALPD
FT                   "
FT   gene            complement(564125..565063)
FT                   /gene="xerD"
FT                   /locus_tag="RALTA_A0545"
FT   CDS_pept        complement(564125..565063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="RALTA_A0545"
FT                   /product="site-specific tyrosine recombinase"
FT                   /function="2.1.3 : DNA recombination"
FT                   /function="5.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RALTA_A0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ68530"
FT                   /db_xref="GOA:B3R0V6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B3R0V6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAQ68530.1"
FT                   /translation="MSGAPAAAEPTAVASAADVALVGRFCDALWLEDGLSRNTIDAYRR
FT                   DLTLLARWLQHEQRGELLDADDGALSAYFSARHTQTRASSANRRLAVFRRFYQWALREH
FT                   LVQVDPCLLLRPAKQPPRHPKTLSEAQVEALLEAPDTETPLGLRDRTMLELMYASGLRV
FT                   SELTQMKTVEIGLNEGVARVVGGKGDKERLVPFGQQAGDWLRRYLASARPVLLAGRACD
FT                   ALFVTQRGEGMTRQAFWHLIKRHARDAGVHAPLSPHTLRHAFATHLLNHGADLRVVQLL
FT                   LGHADISTTQIYTHVARERLRELHQQHHPRG"
FT   gene            complement(565060..565539)
FT                   /locus_tag="RALTA_A0546"
FT   CDS_pept        complement(565060..565539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RALTA_A0546"
FT                   /product="putative METHYLATED-DNA--PROTEIN-CYSTEINE
FT                   METHYLTRANSFERASE"
FT                   /function="2.1.4 : DNA repair"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product t