(data stored in SCRATCH zone)

EMBL: CU928162

ID   CU928162; SV 2; circular; genomic DNA; STD; PRO; 5209548 BP.
AC   CU928162;
PR   Project:PRJNA33409;
DT   17-DEC-2008 (Rel. 98, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
DE   Escherichia coli ED1a chromosome, complete genome.
KW   .
OS   Escherichia coli ED1a
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
RN   [1]
RP   1-5209548
RA   Genoscope - CEA;
RT   ;
RL   Submitted (14-DEC-2008) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
DR   MD5; 7ce2bac967862ee40a388b81591f8601.
DR   BioSample; SAMEA3138232.
DR   EnsemblGenomes-Gn; EBG00001025262.
DR   EnsemblGenomes-Gn; EBG00001025265.
DR   EnsemblGenomes-Gn; EBG00001025267.
DR   EnsemblGenomes-Gn; EBG00001025269.
DR   EnsemblGenomes-Gn; EBG00001025271.
DR   EnsemblGenomes-Gn; EBG00001025273.
DR   EnsemblGenomes-Gn; EBG00001025275.
DR   EnsemblGenomes-Gn; EBG00001025277.
DR   EnsemblGenomes-Gn; EBG00001025279.
DR   EnsemblGenomes-Gn; EBG00001025281.
DR   EnsemblGenomes-Gn; EBG00001025283.
DR   EnsemblGenomes-Gn; EBG00001025285.
DR   EnsemblGenomes-Gn; EBG00001025287.
DR   EnsemblGenomes-Gn; EBG00001025289.
DR   EnsemblGenomes-Gn; EBG00001025291.
DR   EnsemblGenomes-Gn; EBG00001025294.
DR   EnsemblGenomes-Gn; EBG00001025296.
DR   EnsemblGenomes-Gn; EBG00001025298.
DR   EnsemblGenomes-Gn; EBG00001025300.
DR   EnsemblGenomes-Gn; EBG00001025302.
DR   EnsemblGenomes-Gn; EBG00001025304.
DR   EnsemblGenomes-Gn; EBG00001025306.
DR   EnsemblGenomes-Gn; EBG00001025308.
DR   EnsemblGenomes-Gn; EBG00001025310.
DR   EnsemblGenomes-Gn; EBG00001025312.
DR   EnsemblGenomes-Gn; EBG00001025313.
DR   EnsemblGenomes-Gn; EBG00001025315.
DR   EnsemblGenomes-Gn; EBG00001025316.
DR   EnsemblGenomes-Gn; EBG00001025318.
DR   EnsemblGenomes-Gn; EBG00001025320.
DR   EnsemblGenomes-Gn; EBG00001025322.
DR   EnsemblGenomes-Gn; EBG00001025324.
DR   EnsemblGenomes-Gn; EBG00001025326.
DR   EnsemblGenomes-Gn; EBG00001025328.
DR   EnsemblGenomes-Gn; EBG00001025329.
DR   EnsemblGenomes-Gn; EBG00001025331.
DR   EnsemblGenomes-Gn; EBG00001025332.
DR   EnsemblGenomes-Gn; EBG00001025333.
DR   EnsemblGenomes-Gn; EBG00001025335.
DR   EnsemblGenomes-Gn; EBG00001025337.
DR   EnsemblGenomes-Gn; EBG00001025340.
DR   EnsemblGenomes-Gn; EBG00001025342.
DR   EnsemblGenomes-Gn; EBG00001025344.
DR   EnsemblGenomes-Gn; EBG00001025346.
DR   EnsemblGenomes-Gn; EBG00001025348.
DR   EnsemblGenomes-Gn; EBG00001025350.
DR   EnsemblGenomes-Gn; EBG00001025352.
DR   EnsemblGenomes-Gn; EBG00001025354.
DR   EnsemblGenomes-Gn; EBG00001025356.
DR   EnsemblGenomes-Gn; EBG00001025358.
DR   EnsemblGenomes-Gn; EBG00001025360.
DR   EnsemblGenomes-Gn; EBG00001025361.
DR   EnsemblGenomes-Gn; EBG00001025362.
DR   EnsemblGenomes-Gn; EBG00001025363.
DR   EnsemblGenomes-Gn; EBG00001025364.
DR   EnsemblGenomes-Gn; EBG00001025365.
DR   EnsemblGenomes-Gn; EBG00001025366.
DR   EnsemblGenomes-Gn; EBG00001025367.
DR   EnsemblGenomes-Gn; EBG00001025368.
DR   EnsemblGenomes-Gn; EBG00001025369.
DR   EnsemblGenomes-Gn; EBG00001025370.
DR   EnsemblGenomes-Gn; EBG00001025371.
DR   EnsemblGenomes-Gn; EBG00001025372.
DR   EnsemblGenomes-Gn; EBG00001025373.
DR   EnsemblGenomes-Gn; EBG00001025374.
DR   EnsemblGenomes-Gn; EBG00001025375.
DR   EnsemblGenomes-Gn; EBG00001025376.
DR   EnsemblGenomes-Gn; EBG00001025377.
DR   EnsemblGenomes-Gn; EBG00001025378.
DR   EnsemblGenomes-Gn; EBG00001025379.
DR   EnsemblGenomes-Gn; EBG00001025380.
DR   EnsemblGenomes-Gn; EBG00001025381.
DR   EnsemblGenomes-Gn; EBG00001025382.
DR   EnsemblGenomes-Gn; EBG00001025383.
DR   EnsemblGenomes-Gn; EBG00001025384.
DR   EnsemblGenomes-Gn; EBG00001025385.
DR   EnsemblGenomes-Gn; EBG00001025386.
DR   EnsemblGenomes-Gn; EBG00001025387.
DR   EnsemblGenomes-Gn; EBG00001025388.
DR   EnsemblGenomes-Gn; EBG00001025389.
DR   EnsemblGenomes-Gn; EBG00001025390.
DR   EnsemblGenomes-Gn; EBG00001025391.
DR   EnsemblGenomes-Gn; EBG00001025392.
DR   EnsemblGenomes-Gn; EBG00001025393.
DR   EnsemblGenomes-Gn; EBG00001025394.
DR   EnsemblGenomes-Gn; EBG00001025395.
DR   EnsemblGenomes-Gn; EBG00001025396.
DR   EnsemblGenomes-Gn; EBG00001025397.
DR   EnsemblGenomes-Gn; EBG00001025398.
DR   EnsemblGenomes-Gn; EBG00001025399.
DR   EnsemblGenomes-Gn; EBG00001025400.
DR   EnsemblGenomes-Gn; EBG00001025401.
DR   EnsemblGenomes-Gn; EBG00001025402.
DR   EnsemblGenomes-Gn; EBG00001025403.
DR   EnsemblGenomes-Gn; EBG00001025404.
DR   EnsemblGenomes-Gn; EBG00001025405.
DR   EnsemblGenomes-Gn; EBG00001025406.
DR   EnsemblGenomes-Gn; EBG00001025407.
DR   EnsemblGenomes-Gn; EBG00001025408.
DR   EnsemblGenomes-Gn; EBG00001025409.
DR   EnsemblGenomes-Gn; EBG00001025410.
DR   EnsemblGenomes-Gn; EBG00001025411.
DR   EnsemblGenomes-Gn; EBG00001025412.
DR   EnsemblGenomes-Gn; EBG00001025413.
DR   EnsemblGenomes-Gn; EBG00001025414.
DR   EnsemblGenomes-Gn; EBG00001025415.
DR   EnsemblGenomes-Gn; EBG00001025416.
DR   EnsemblGenomes-Gn; EBG00001025417.
DR   EnsemblGenomes-Gn; EBG00001025418.
DR   EnsemblGenomes-Gn; EBG00001025419.
DR   EnsemblGenomes-Gn; EBG00001025420.
DR   EnsemblGenomes-Gn; EBG00001025421.
DR   EnsemblGenomes-Gn; EBG00001025422.
DR   EnsemblGenomes-Gn; EBG00001025423.
DR   EnsemblGenomes-Gn; EBG00001025424.
DR   EnsemblGenomes-Gn; EBG00001025425.
DR   EnsemblGenomes-Gn; EBG00001025426.
DR   EnsemblGenomes-Gn; EBG00001025427.
DR   EnsemblGenomes-Gn; EBG00001025428.
DR   EnsemblGenomes-Gn; EBG00001025429.
DR   EnsemblGenomes-Gn; EBG00001025430.
DR   EnsemblGenomes-Gn; EBG00001025431.
DR   EnsemblGenomes-Gn; EBG00001025432.
DR   EnsemblGenomes-Gn; EBG00001025433.
DR   EnsemblGenomes-Gn; EBG00001025434.
DR   EnsemblGenomes-Gn; EBG00001025435.
DR   EnsemblGenomes-Gn; EBG00001025436.
DR   EnsemblGenomes-Gn; EBG00001025437.
DR   EnsemblGenomes-Gn; EBG00001025438.
DR   EnsemblGenomes-Gn; EBG00001025439.
DR   EnsemblGenomes-Gn; EBG00001025440.
DR   EnsemblGenomes-Gn; EBG00001025441.
DR   EnsemblGenomes-Gn; EBG00001025442.
DR   EnsemblGenomes-Gn; EBG00001025443.
DR   EnsemblGenomes-Gn; EBG00001025444.
DR   EnsemblGenomes-Gn; EBG00001025445.
DR   EnsemblGenomes-Gn; EBG00001025446.
DR   EnsemblGenomes-Gn; EBG00001025447.
DR   EnsemblGenomes-Gn; EBG00001025448.
DR   EnsemblGenomes-Gn; EBG00001025449.
DR   EnsemblGenomes-Gn; EBG00001025450.
DR   EnsemblGenomes-Gn; EBG00001025451.
DR   EnsemblGenomes-Gn; EBG00001025452.
DR   EnsemblGenomes-Gn; EBG00001025453.
DR   EnsemblGenomes-Gn; EBG00001025454.
DR   EnsemblGenomes-Gn; EBG00001025455.
DR   EnsemblGenomes-Gn; EBG00001025456.
DR   EnsemblGenomes-Gn; EBG00001025457.
DR   EnsemblGenomes-Gn; EBG00001025458.
DR   EnsemblGenomes-Gn; EBG00001025459.
DR   EnsemblGenomes-Gn; EBG00001025460.
DR   EnsemblGenomes-Gn; EBG00001025461.
DR   EnsemblGenomes-Gn; EBG00001025462.
DR   EnsemblGenomes-Gn; EBG00001025463.
DR   EnsemblGenomes-Gn; EBG00001025464.
DR   EnsemblGenomes-Gn; EBG00001025465.
DR   EnsemblGenomes-Gn; EBG00001025466.
DR   EnsemblGenomes-Gn; EBG00001025467.
DR   EnsemblGenomes-Gn; EBG00001025468.
DR   EnsemblGenomes-Gn; EBG00001025469.
DR   EnsemblGenomes-Gn; EBG00001025470.
DR   EnsemblGenomes-Gn; EBG00001025471.
DR   EnsemblGenomes-Gn; EBG00001025472.
DR   EnsemblGenomes-Gn; EBG00001025473.
DR   EnsemblGenomes-Gn; EBG00001025474.
DR   EnsemblGenomes-Gn; EBG00001025475.
DR   EnsemblGenomes-Gn; EBG00001025476.
DR   EnsemblGenomes-Gn; EBG00001025477.
DR   EnsemblGenomes-Gn; EBG00001025478.
DR   EnsemblGenomes-Gn; EBG00001025479.
DR   EnsemblGenomes-Gn; EBG00001025480.
DR   EnsemblGenomes-Gn; EBG00001025481.
DR   EnsemblGenomes-Gn; EBG00001025482.
DR   EnsemblGenomes-Gn; EBG00001025483.
DR   EnsemblGenomes-Gn; EBG00001025484.
DR   EnsemblGenomes-Gn; EBG00001025485.
DR   EnsemblGenomes-Gn; EBG00001025486.
DR   EnsemblGenomes-Gn; EBG00001025487.
DR   EnsemblGenomes-Gn; EBG00001025488.
DR   EnsemblGenomes-Gn; EBG00001025489.
DR   EnsemblGenomes-Gn; EBG00001025490.
DR   EnsemblGenomes-Gn; EBG00001025491.
DR   EnsemblGenomes-Gn; EBG00001025492.
DR   EnsemblGenomes-Gn; EBG00001025493.
DR   EnsemblGenomes-Gn; EBG00001025494.
DR   EnsemblGenomes-Gn; EBG00001025495.
DR   EnsemblGenomes-Gn; EBG00001025496.
DR   EnsemblGenomes-Gn; EBG00001025497.
DR   EnsemblGenomes-Gn; EBG00001025498.
DR   EnsemblGenomes-Gn; EBG00001025499.
DR   EnsemblGenomes-Gn; EBG00001025500.
DR   EnsemblGenomes-Gn; EBG00001025501.
DR   EnsemblGenomes-Gn; EBG00001025502.
DR   EnsemblGenomes-Gn; EBG00001025503.
DR   EnsemblGenomes-Gn; EBG00001025504.
DR   EnsemblGenomes-Gn; EBG00001025505.
DR   EnsemblGenomes-Gn; EBG00001025506.
DR   EnsemblGenomes-Gn; EBG00001025507.
DR   EnsemblGenomes-Gn; EBG00001025508.
DR   EnsemblGenomes-Gn; EBG00001025509.
DR   EnsemblGenomes-Gn; EBG00001025510.
DR   EnsemblGenomes-Gn; EBG00001025511.
DR   EnsemblGenomes-Gn; EBG00001025512.
DR   EnsemblGenomes-Gn; EBG00001025513.
DR   EnsemblGenomes-Gn; EBG00001025514.
DR   EnsemblGenomes-Gn; EBG00001025515.
DR   EnsemblGenomes-Gn; EBG00001025516.
DR   EnsemblGenomes-Gn; EBG00001025517.
DR   EnsemblGenomes-Gn; EBG00001025518.
DR   EnsemblGenomes-Gn; EBG00001025519.
DR   EnsemblGenomes-Gn; EBG00001025520.
DR   EnsemblGenomes-Gn; EBG00001025521.
DR   EnsemblGenomes-Gn; EBG00001025522.
DR   EnsemblGenomes-Gn; EBG00001025523.
DR   EnsemblGenomes-Gn; EBG00001025524.
DR   EnsemblGenomes-Gn; EBG00001025525.
DR   EnsemblGenomes-Gn; EBG00001025526.
DR   EnsemblGenomes-Gn; EBG00001025527.
DR   EnsemblGenomes-Gn; EBG00001025528.
DR   EnsemblGenomes-Gn; EBG00001025529.
DR   EnsemblGenomes-Gn; EBG00001025530.
DR   EnsemblGenomes-Gn; EBG00001025531.
DR   EnsemblGenomes-Gn; EBG00001025532.
DR   EnsemblGenomes-Gn; EBG00001025533.
DR   EnsemblGenomes-Gn; EBG00001025534.
DR   EnsemblGenomes-Gn; EBG00001025535.
DR   EnsemblGenomes-Gn; EBG00001025536.
DR   EnsemblGenomes-Gn; EBG00001025537.
DR   EnsemblGenomes-Gn; EBG00001025538.
DR   EnsemblGenomes-Gn; EBG00001025539.
DR   EnsemblGenomes-Gn; EBG00001025540.
DR   EnsemblGenomes-Gn; EBG00001025541.
DR   EnsemblGenomes-Gn; EBG00001025542.
DR   EnsemblGenomes-Gn; EBG00001025543.
DR   EnsemblGenomes-Gn; EBG00001025544.
DR   EnsemblGenomes-Gn; EBG00001025545.
DR   EnsemblGenomes-Gn; EBG00001025546.
DR   EnsemblGenomes-Gn; EBG00001025547.
DR   EnsemblGenomes-Gn; EBG00001025548.
DR   EnsemblGenomes-Gn; EBG00001025549.
DR   EnsemblGenomes-Gn; EBG00001025550.
DR   EnsemblGenomes-Gn; EBG00001025551.
DR   EnsemblGenomes-Gn; EBG00001025552.
DR   EnsemblGenomes-Gn; EBG00001025553.
DR   EnsemblGenomes-Gn; EBG00001025554.
DR   EnsemblGenomes-Gn; EBG00001025555.
DR   EnsemblGenomes-Gn; EBG00001025556.
DR   EnsemblGenomes-Gn; EBG00001025557.
DR   EnsemblGenomes-Gn; EBG00001025558.
DR   EnsemblGenomes-Gn; EBG00001025559.
DR   EnsemblGenomes-Gn; EBG00001025560.
DR   EnsemblGenomes-Gn; EBG00001025561.
DR   EnsemblGenomes-Gn; EBG00001025562.
DR   EnsemblGenomes-Gn; EBG00001025563.
DR   EnsemblGenomes-Gn; EBG00001025564.
DR   EnsemblGenomes-Gn; EBG00001025565.
DR   EnsemblGenomes-Gn; EBG00001025566.
DR   EnsemblGenomes-Gn; EBG00001025567.
DR   EnsemblGenomes-Gn; EBG00001025568.
DR   EnsemblGenomes-Gn; EBG00001025569.
DR   EnsemblGenomes-Gn; EBG00001025570.
DR   EnsemblGenomes-Gn; EBG00001025571.
DR   EnsemblGenomes-Gn; EBG00001025572.
DR   EnsemblGenomes-Gn; EBG00001025573.
DR   EnsemblGenomes-Gn; EBG00001025574.
DR   EnsemblGenomes-Gn; EBG00001025575.
DR   EnsemblGenomes-Gn; EBG00001025576.
DR   EnsemblGenomes-Gn; EBG00001025577.
DR   EnsemblGenomes-Gn; EBG00001025578.
DR   EnsemblGenomes-Gn; EBG00001025579.
DR   EnsemblGenomes-Gn; EBG00001025580.
DR   EnsemblGenomes-Gn; EBG00001025581.
DR   EnsemblGenomes-Gn; EBG00001025582.
DR   EnsemblGenomes-Gn; ECED1_0075.
DR   EnsemblGenomes-Gn; ECED1_0078.
DR   EnsemblGenomes-Gn; ECED1_0113.
DR   EnsemblGenomes-Gn; ECED1_0115.
DR   EnsemblGenomes-Gn; ECED1_0140.
DR   EnsemblGenomes-Gn; ECED1_0223.
DR   EnsemblGenomes-Gn; ECED1_0225.
DR   EnsemblGenomes-Gn; ECED1_0226.
DR   EnsemblGenomes-Gn; ECED1_0261.
DR   EnsemblGenomes-Gn; ECED1_0262.
DR   EnsemblGenomes-Gn; ECED1_0281.
DR   EnsemblGenomes-Gn; ECED1_0282.
DR   EnsemblGenomes-Gn; ECED1_0283.
DR   EnsemblGenomes-Gn; ECED1_0289.
DR   EnsemblGenomes-Gn; ECED1_0290.
DR   EnsemblGenomes-Gn; ECED1_0291.
DR   EnsemblGenomes-Gn; ECED1_0292.
DR   EnsemblGenomes-Gn; ECED1_0308.
DR   EnsemblGenomes-Gn; ECED1_0309.
DR   EnsemblGenomes-Gn; ECED1_0329.
DR   EnsemblGenomes-Gn; ECED1_0338.
DR   EnsemblGenomes-Gn; ECED1_0387.
DR   EnsemblGenomes-Gn; ECED1_0388.
DR   EnsemblGenomes-Gn; ECED1_0551.
DR   EnsemblGenomes-Gn; ECED1_0552.
DR   EnsemblGenomes-Gn; ECED1_0557.
DR   EnsemblGenomes-Gn; ECED1_0560.
DR   EnsemblGenomes-Gn; ECED1_0561.
DR   EnsemblGenomes-Gn; ECED1_0577.
DR   EnsemblGenomes-Gn; ECED1_0578.
DR   EnsemblGenomes-Gn; ECED1_0583.
DR   EnsemblGenomes-Gn; ECED1_0595.
DR   EnsemblGenomes-Gn; ECED1_0596.
DR   EnsemblGenomes-Gn; ECED1_0688.
DR   EnsemblGenomes-Gn; ECED1_0730.
DR   EnsemblGenomes-Gn; ECED1_0731.
DR   EnsemblGenomes-Gn; ECED1_0778.
DR   EnsemblGenomes-Gn; ECED1_0779.
DR   EnsemblGenomes-Gn; ECED1_0820.
DR   EnsemblGenomes-Gn; ECED1_0821.
DR   EnsemblGenomes-Gn; ECED1_1015.
DR   EnsemblGenomes-Gn; ECED1_1078.
DR   EnsemblGenomes-Gn; ECED1_1081.
DR   EnsemblGenomes-Gn; ECED1_1281.
DR   EnsemblGenomes-Gn; ECED1_1285.
DR   EnsemblGenomes-Gn; ECED1_1286.
DR   EnsemblGenomes-Gn; ECED1_1300.
DR   EnsemblGenomes-Gn; ECED1_1308.
DR   EnsemblGenomes-Gn; ECED1_1315.
DR   EnsemblGenomes-Gn; ECED1_1324.
DR   EnsemblGenomes-Gn; ECED1_1344.
DR   EnsemblGenomes-Gn; ECED1_1345.
DR   EnsemblGenomes-Gn; ECED1_1378.
DR   EnsemblGenomes-Gn; ECED1_1380.
DR   EnsemblGenomes-Gn; ECED1_1381.
DR   EnsemblGenomes-Gn; ECED1_1390.
DR   EnsemblGenomes-Gn; ECED1_1391.
DR   EnsemblGenomes-Gn; ECED1_1413.
DR   EnsemblGenomes-Gn; ECED1_1423.
DR   EnsemblGenomes-Gn; ECED1_1424.
DR   EnsemblGenomes-Gn; ECED1_1425.
DR   EnsemblGenomes-Gn; ECED1_1461.
DR   EnsemblGenomes-Gn; ECED1_1462.
DR   EnsemblGenomes-Gn; ECED1_1485.
DR   EnsemblGenomes-Gn; ECED1_1486.
DR   EnsemblGenomes-Gn; ECED1_1536.
DR   EnsemblGenomes-Gn; ECED1_1537.
DR   EnsemblGenomes-Gn; ECED1_1538.
DR   EnsemblGenomes-Gn; ECED1_1556.
DR   EnsemblGenomes-Gn; ECED1_1559.
DR   EnsemblGenomes-Gn; ECED1_1560.
DR   EnsemblGenomes-Gn; ECED1_1577.
DR   EnsemblGenomes-Gn; ECED1_1592.
DR   EnsemblGenomes-Gn; ECED1_1607.
DR   EnsemblGenomes-Gn; ECED1_1608.
DR   EnsemblGenomes-Gn; ECED1_1609.
DR   EnsemblGenomes-Gn; ECED1_1613.
DR   EnsemblGenomes-Gn; ECED1_1629.
DR   EnsemblGenomes-Gn; ECED1_1636.
DR   EnsemblGenomes-Gn; ECED1_1640.
DR   EnsemblGenomes-Gn; ECED1_1646.
DR   EnsemblGenomes-Gn; ECED1_1651.
DR   EnsemblGenomes-Gn; ECED1_1652.
DR   EnsemblGenomes-Gn; ECED1_1662.
DR   EnsemblGenomes-Gn; ECED1_1671.
DR   EnsemblGenomes-Gn; ECED1_1674.
DR   EnsemblGenomes-Gn; ECED1_1686.
DR   EnsemblGenomes-Gn; ECED1_16S_1.
DR   EnsemblGenomes-Gn; ECED1_16S_2.
DR   EnsemblGenomes-Gn; ECED1_16S_3.
DR   EnsemblGenomes-Gn; ECED1_16S_4.
DR   EnsemblGenomes-Gn; ECED1_16S_5.
DR   EnsemblGenomes-Gn; ECED1_16S_6.
DR   EnsemblGenomes-Gn; ECED1_16S_7.
DR   EnsemblGenomes-Gn; ECED1_1755.
DR   EnsemblGenomes-Gn; ECED1_1756.
DR   EnsemblGenomes-Gn; ECED1_1770.
DR   EnsemblGenomes-Gn; ECED1_1792.
DR   EnsemblGenomes-Gn; ECED1_1871.
DR   EnsemblGenomes-Gn; ECED1_1872.
DR   EnsemblGenomes-Gn; ECED1_1919.
DR   EnsemblGenomes-Gn; ECED1_1921.
DR   EnsemblGenomes-Gn; ECED1_1922.
DR   EnsemblGenomes-Gn; ECED1_1923.
DR   EnsemblGenomes-Gn; ECED1_1924.
DR   EnsemblGenomes-Gn; ECED1_1974.
DR   EnsemblGenomes-Gn; ECED1_1975.
DR   EnsemblGenomes-Gn; ECED1_1991.
DR   EnsemblGenomes-Gn; ECED1_1992.
DR   EnsemblGenomes-Gn; ECED1_2006.
DR   EnsemblGenomes-Gn; ECED1_2153.
DR   EnsemblGenomes-Gn; ECED1_2285.
DR   EnsemblGenomes-Gn; ECED1_2286.
DR   EnsemblGenomes-Gn; ECED1_2330.
DR   EnsemblGenomes-Gn; ECED1_2333.
DR   EnsemblGenomes-Gn; ECED1_2338.
DR   EnsemblGenomes-Gn; ECED1_2339.
DR   EnsemblGenomes-Gn; ECED1_2343.
DR   EnsemblGenomes-Gn; ECED1_2344.
DR   EnsemblGenomes-Gn; ECED1_2345.
DR   EnsemblGenomes-Gn; ECED1_2346.
DR   EnsemblGenomes-Gn; ECED1_2356.
DR   EnsemblGenomes-Gn; ECED1_23S_1.
DR   EnsemblGenomes-Gn; ECED1_23S_2.
DR   EnsemblGenomes-Gn; ECED1_23S_3.
DR   EnsemblGenomes-Gn; ECED1_23S_4.
DR   EnsemblGenomes-Gn; ECED1_23S_5.
DR   EnsemblGenomes-Gn; ECED1_23S_6.
DR   EnsemblGenomes-Gn; ECED1_23S_7.
DR   EnsemblGenomes-Gn; ECED1_2436.
DR   EnsemblGenomes-Gn; ECED1_2452.
DR   EnsemblGenomes-Gn; ECED1_2493.
DR   EnsemblGenomes-Gn; ECED1_2618.
DR   EnsemblGenomes-Gn; ECED1_2619.
DR   EnsemblGenomes-Gn; ECED1_2627.
DR   EnsemblGenomes-Gn; ECED1_2628.
DR   EnsemblGenomes-Gn; ECED1_2840.
DR   EnsemblGenomes-Gn; ECED1_2843.
DR   EnsemblGenomes-Gn; ECED1_2937.
DR   EnsemblGenomes-Gn; ECED1_2938.
DR   EnsemblGenomes-Gn; ECED1_3026.
DR   EnsemblGenomes-Gn; ECED1_3072.
DR   EnsemblGenomes-Gn; ECED1_3095.
DR   EnsemblGenomes-Gn; ECED1_3375.
DR   EnsemblGenomes-Gn; ECED1_3391.
DR   EnsemblGenomes-Gn; ECED1_3392.
DR   EnsemblGenomes-Gn; ECED1_3431.
DR   EnsemblGenomes-Gn; ECED1_3441.
DR   EnsemblGenomes-Gn; ECED1_3473.
DR   EnsemblGenomes-Gn; ECED1_3477.
DR   EnsemblGenomes-Gn; ECED1_3496.
DR   EnsemblGenomes-Gn; ECED1_3502.
DR   EnsemblGenomes-Gn; ECED1_3521.
DR   EnsemblGenomes-Gn; ECED1_3522.
DR   EnsemblGenomes-Gn; ECED1_3548.
DR   EnsemblGenomes-Gn; ECED1_3581.
DR   EnsemblGenomes-Gn; ECED1_3583.
DR   EnsemblGenomes-Gn; ECED1_3585.
DR   EnsemblGenomes-Gn; ECED1_3586.
DR   EnsemblGenomes-Gn; ECED1_3620.
DR   EnsemblGenomes-Gn; ECED1_3625.
DR   EnsemblGenomes-Gn; ECED1_3684.
DR   EnsemblGenomes-Gn; ECED1_3693.
DR   EnsemblGenomes-Gn; ECED1_3694.
DR   EnsemblGenomes-Gn; ECED1_3760.
DR   EnsemblGenomes-Gn; ECED1_3761.
DR   EnsemblGenomes-Gn; ECED1_3788.
DR   EnsemblGenomes-Gn; ECED1_3987.
DR   EnsemblGenomes-Gn; ECED1_3988.
DR   EnsemblGenomes-Gn; ECED1_4071.
DR   EnsemblGenomes-Gn; ECED1_4100.
DR   EnsemblGenomes-Gn; ECED1_4116.
DR   EnsemblGenomes-Gn; ECED1_4117.
DR   EnsemblGenomes-Gn; ECED1_4173.
DR   EnsemblGenomes-Gn; ECED1_4178.
DR   EnsemblGenomes-Gn; ECED1_4179.
DR   EnsemblGenomes-Gn; ECED1_4246.
DR   EnsemblGenomes-Gn; ECED1_4247.
DR   EnsemblGenomes-Gn; ECED1_4252.
DR   EnsemblGenomes-Gn; ECED1_4253.
DR   EnsemblGenomes-Gn; ECED1_4769.
DR   EnsemblGenomes-Gn; ECED1_4770.
DR   EnsemblGenomes-Gn; ECED1_4776.
DR   EnsemblGenomes-Gn; ECED1_4777.
DR   EnsemblGenomes-Gn; ECED1_4871.
DR   EnsemblGenomes-Gn; ECED1_4880.
DR   EnsemblGenomes-Gn; ECED1_4885.
DR   EnsemblGenomes-Gn; ECED1_4890.
DR   EnsemblGenomes-Gn; ECED1_4896.
DR   EnsemblGenomes-Gn; ECED1_4897.
DR   EnsemblGenomes-Gn; ECED1_4898.
DR   EnsemblGenomes-Gn; ECED1_4906.
DR   EnsemblGenomes-Gn; ECED1_4920.
DR   EnsemblGenomes-Gn; ECED1_4921.
DR   EnsemblGenomes-Gn; ECED1_4972.
DR   EnsemblGenomes-Gn; ECED1_4973.
DR   EnsemblGenomes-Gn; ECED1_4985.
DR   EnsemblGenomes-Gn; ECED1_4992.
DR   EnsemblGenomes-Gn; ECED1_4995.
DR   EnsemblGenomes-Gn; ECED1_4997.
DR   EnsemblGenomes-Gn; ECED1_5006.
DR   EnsemblGenomes-Gn; ECED1_5007.
DR   EnsemblGenomes-Gn; ECED1_5011.
DR   EnsemblGenomes-Gn; ECED1_5012.
DR   EnsemblGenomes-Gn; ECED1_5022.
DR   EnsemblGenomes-Gn; ECED1_5023.
DR   EnsemblGenomes-Gn; ECED1_5024.
DR   EnsemblGenomes-Gn; ECED1_5025.
DR   EnsemblGenomes-Gn; ECED1_5118.
DR   EnsemblGenomes-Gn; ECED1_5119.
DR   EnsemblGenomes-Gn; ECED1_5126.
DR   EnsemblGenomes-Gn; ECED1_5132.
DR   EnsemblGenomes-Gn; ECED1_5133.
DR   EnsemblGenomes-Gn; ECED1_5146.
DR   EnsemblGenomes-Gn; ECED1_5148.
DR   EnsemblGenomes-Gn; ECED1_5149.
DR   EnsemblGenomes-Gn; ECED1_5164.
DR   EnsemblGenomes-Gn; ECED1_5165.
DR   EnsemblGenomes-Gn; ECED1_5180.
DR   EnsemblGenomes-Gn; ECED1_5192.
DR   EnsemblGenomes-Gn; ECED1_5203.
DR   EnsemblGenomes-Gn; ECED1_5215.
DR   EnsemblGenomes-Gn; ECED1_5S_1.
DR   EnsemblGenomes-Gn; ECED1_5S_2.
DR   EnsemblGenomes-Gn; ECED1_5S_3.
DR   EnsemblGenomes-Gn; ECED1_5S_4.
DR   EnsemblGenomes-Gn; ECED1_5S_5.
DR   EnsemblGenomes-Gn; ECED1_5S_6.
DR   EnsemblGenomes-Gn; ECED1_5S_7.
DR   EnsemblGenomes-Gn; ECED1_5S_8.
DR   EnsemblGenomes-Gn; ECED1_tRNA1.
DR   EnsemblGenomes-Gn; ECED1_tRNA10.
DR   EnsemblGenomes-Gn; ECED1_tRNA11.
DR   EnsemblGenomes-Gn; ECED1_tRNA12.
DR   EnsemblGenomes-Gn; ECED1_tRNA13.
DR   EnsemblGenomes-Gn; ECED1_tRNA14.
DR   EnsemblGenomes-Gn; ECED1_tRNA15.
DR   EnsemblGenomes-Gn; ECED1_tRNA16.
DR   EnsemblGenomes-Gn; ECED1_tRNA17.
DR   EnsemblGenomes-Gn; ECED1_tRNA18.
DR   EnsemblGenomes-Gn; ECED1_tRNA19.
DR   EnsemblGenomes-Gn; ECED1_tRNA2.
DR   EnsemblGenomes-Gn; ECED1_tRNA20.
DR   EnsemblGenomes-Gn; ECED1_tRNA21.
DR   EnsemblGenomes-Gn; ECED1_tRNA22.
DR   EnsemblGenomes-Gn; ECED1_tRNA23.
DR   EnsemblGenomes-Gn; ECED1_tRNA24.
DR   EnsemblGenomes-Gn; ECED1_tRNA25.
DR   EnsemblGenomes-Gn; ECED1_tRNA26.
DR   EnsemblGenomes-Gn; ECED1_tRNA27.
DR   EnsemblGenomes-Gn; ECED1_tRNA28.
DR   EnsemblGenomes-Gn; ECED1_tRNA29.
DR   EnsemblGenomes-Gn; ECED1_tRNA3.
DR   EnsemblGenomes-Gn; ECED1_tRNA30.
DR   EnsemblGenomes-Gn; ECED1_tRNA31.
DR   EnsemblGenomes-Gn; ECED1_tRNA32.
DR   EnsemblGenomes-Gn; ECED1_tRNA33.
DR   EnsemblGenomes-Gn; ECED1_tRNA34.
DR   EnsemblGenomes-Gn; ECED1_tRNA35.
DR   EnsemblGenomes-Gn; ECED1_tRNA36.
DR   EnsemblGenomes-Gn; ECED1_tRNA37.
DR   EnsemblGenomes-Gn; ECED1_tRNA38.
DR   EnsemblGenomes-Gn; ECED1_tRNA39.
DR   EnsemblGenomes-Gn; ECED1_tRNA4.
DR   EnsemblGenomes-Gn; ECED1_tRNA40.
DR   EnsemblGenomes-Gn; ECED1_tRNA41.
DR   EnsemblGenomes-Gn; ECED1_tRNA42.
DR   EnsemblGenomes-Gn; ECED1_tRNA43.
DR   EnsemblGenomes-Gn; ECED1_tRNA44.
DR   EnsemblGenomes-Gn; ECED1_tRNA45.
DR   EnsemblGenomes-Gn; ECED1_tRNA46.
DR   EnsemblGenomes-Gn; ECED1_tRNA47.
DR   EnsemblGenomes-Gn; ECED1_tRNA48.
DR   EnsemblGenomes-Gn; ECED1_tRNA49.
DR   EnsemblGenomes-Gn; ECED1_tRNA5.
DR   EnsemblGenomes-Gn; ECED1_tRNA50.
DR   EnsemblGenomes-Gn; ECED1_tRNA51.
DR   EnsemblGenomes-Gn; ECED1_tRNA52.
DR   EnsemblGenomes-Gn; ECED1_tRNA53.
DR   EnsemblGenomes-Gn; ECED1_tRNA54.
DR   EnsemblGenomes-Gn; ECED1_tRNA55.
DR   EnsemblGenomes-Gn; ECED1_tRNA56.
DR   EnsemblGenomes-Gn; ECED1_tRNA57.
DR   EnsemblGenomes-Gn; ECED1_tRNA58.
DR   EnsemblGenomes-Gn; ECED1_tRNA59.
DR   EnsemblGenomes-Gn; ECED1_tRNA6.
DR   EnsemblGenomes-Gn; ECED1_tRNA60.
DR   EnsemblGenomes-Gn; ECED1_tRNA61.
DR   EnsemblGenomes-Gn; ECED1_tRNA62.
DR   EnsemblGenomes-Gn; ECED1_tRNA63.
DR   EnsemblGenomes-Gn; ECED1_tRNA64.
DR   EnsemblGenomes-Gn; ECED1_tRNA65.
DR   EnsemblGenomes-Gn; ECED1_tRNA66.
DR   EnsemblGenomes-Gn; ECED1_tRNA67.
DR   EnsemblGenomes-Gn; ECED1_tRNA68.
DR   EnsemblGenomes-Gn; ECED1_tRNA69.
DR   EnsemblGenomes-Gn; ECED1_tRNA7.
DR   EnsemblGenomes-Gn; ECED1_tRNA70.
DR   EnsemblGenomes-Gn; ECED1_tRNA71.
DR   EnsemblGenomes-Gn; ECED1_tRNA72.
DR   EnsemblGenomes-Gn; ECED1_tRNA73.
DR   EnsemblGenomes-Gn; ECED1_tRNA74.
DR   EnsemblGenomes-Gn; ECED1_tRNA75.
DR   EnsemblGenomes-Gn; ECED1_tRNA76.
DR   EnsemblGenomes-Gn; ECED1_tRNA77.
DR   EnsemblGenomes-Gn; ECED1_tRNA78.
DR   EnsemblGenomes-Gn; ECED1_tRNA79.
DR   EnsemblGenomes-Gn; ECED1_tRNA8.
DR   EnsemblGenomes-Gn; ECED1_tRNA80.
DR   EnsemblGenomes-Gn; ECED1_tRNA81.
DR   EnsemblGenomes-Gn; ECED1_tRNA82.
DR   EnsemblGenomes-Gn; ECED1_tRNA83.
DR   EnsemblGenomes-Gn; ECED1_tRNA84.
DR   EnsemblGenomes-Gn; ECED1_tRNA85.
DR   EnsemblGenomes-Gn; ECED1_tRNA86.
DR   EnsemblGenomes-Gn; ECED1_tRNA87.
DR   EnsemblGenomes-Gn; ECED1_tRNA88.
DR   EnsemblGenomes-Gn; ECED1_tRNA89.
DR   EnsemblGenomes-Gn; ECED1_tRNA9.
DR   EnsemblGenomes-Gn; ECED1_tRNA90.
DR   EnsemblGenomes-Gn; ECED1_tRNA91.
DR   EnsemblGenomes-Tr; EBT00001628303.
DR   EnsemblGenomes-Tr; EBT00001628304.
DR   EnsemblGenomes-Tr; EBT00001628305.
DR   EnsemblGenomes-Tr; EBT00001628306.
DR   EnsemblGenomes-Tr; EBT00001628307.
DR   EnsemblGenomes-Tr; EBT00001628308.
DR   EnsemblGenomes-Tr; EBT00001628309.
DR   EnsemblGenomes-Tr; EBT00001628310.
DR   EnsemblGenomes-Tr; EBT00001628311.
DR   EnsemblGenomes-Tr; EBT00001628312.
DR   EnsemblGenomes-Tr; EBT00001628313.
DR   EnsemblGenomes-Tr; EBT00001628314.
DR   EnsemblGenomes-Tr; EBT00001628315.
DR   EnsemblGenomes-Tr; EBT00001628316.
DR   EnsemblGenomes-Tr; EBT00001628317.
DR   EnsemblGenomes-Tr; EBT00001628318.
DR   EnsemblGenomes-Tr; EBT00001628319.
DR   EnsemblGenomes-Tr; EBT00001628320.
DR   EnsemblGenomes-Tr; EBT00001628321.
DR   EnsemblGenomes-Tr; EBT00001628322.
DR   EnsemblGenomes-Tr; EBT00001628323.
DR   EnsemblGenomes-Tr; EBT00001628324.
DR   EnsemblGenomes-Tr; EBT00001628325.
DR   EnsemblGenomes-Tr; EBT00001628326.
DR   EnsemblGenomes-Tr; EBT00001628327.
DR   EnsemblGenomes-Tr; EBT00001628328.
DR   EnsemblGenomes-Tr; EBT00001628329.
DR   EnsemblGenomes-Tr; EBT00001628330.
DR   EnsemblGenomes-Tr; EBT00001628331.
DR   EnsemblGenomes-Tr; EBT00001628332.
DR   EnsemblGenomes-Tr; EBT00001628333.
DR   EnsemblGenomes-Tr; EBT00001628334.
DR   EnsemblGenomes-Tr; EBT00001628335.
DR   EnsemblGenomes-Tr; EBT00001628336.
DR   EnsemblGenomes-Tr; EBT00001628337.
DR   EnsemblGenomes-Tr; EBT00001628338.
DR   EnsemblGenomes-Tr; EBT00001628339.
DR   EnsemblGenomes-Tr; EBT00001628340.
DR   EnsemblGenomes-Tr; EBT00001628341.
DR   EnsemblGenomes-Tr; EBT00001628342.
DR   EnsemblGenomes-Tr; EBT00001628343.
DR   EnsemblGenomes-Tr; EBT00001628344.
DR   EnsemblGenomes-Tr; EBT00001628345.
DR   EnsemblGenomes-Tr; EBT00001628346.
DR   EnsemblGenomes-Tr; EBT00001628347.
DR   EnsemblGenomes-Tr; EBT00001628348.
DR   EnsemblGenomes-Tr; EBT00001628349.
DR   EnsemblGenomes-Tr; EBT00001628350.
DR   EnsemblGenomes-Tr; EBT00001628351.
DR   EnsemblGenomes-Tr; EBT00001628352.
DR   EnsemblGenomes-Tr; EBT00001628353.
DR   EnsemblGenomes-Tr; EBT00001628354.
DR   EnsemblGenomes-Tr; EBT00001628355.
DR   EnsemblGenomes-Tr; EBT00001628356.
DR   EnsemblGenomes-Tr; EBT00001628357.
DR   EnsemblGenomes-Tr; EBT00001628358.
DR   EnsemblGenomes-Tr; EBT00001628359.
DR   EnsemblGenomes-Tr; EBT00001628360.
DR   EnsemblGenomes-Tr; EBT00001628361.
DR   EnsemblGenomes-Tr; EBT00001628362.
DR   EnsemblGenomes-Tr; EBT00001628363.
DR   EnsemblGenomes-Tr; EBT00001628364.
DR   EnsemblGenomes-Tr; EBT00001628365.
DR   EnsemblGenomes-Tr; EBT00001628366.
DR   EnsemblGenomes-Tr; EBT00001628367.
DR   EnsemblGenomes-Tr; EBT00001628368.
DR   EnsemblGenomes-Tr; EBT00001628369.
DR   EnsemblGenomes-Tr; EBT00001628370.
DR   EnsemblGenomes-Tr; EBT00001628371.
DR   EnsemblGenomes-Tr; EBT00001628372.
DR   EnsemblGenomes-Tr; EBT00001628373.
DR   EnsemblGenomes-Tr; EBT00001628374.
DR   EnsemblGenomes-Tr; EBT00001628375.
DR   EnsemblGenomes-Tr; EBT00001628376.
DR   EnsemblGenomes-Tr; EBT00001628377.
DR   EnsemblGenomes-Tr; EBT00001628378.
DR   EnsemblGenomes-Tr; EBT00001628379.
DR   EnsemblGenomes-Tr; EBT00001628380.
DR   EnsemblGenomes-Tr; EBT00001628381.
DR   EnsemblGenomes-Tr; EBT00001628382.
DR   EnsemblGenomes-Tr; EBT00001628383.
DR   EnsemblGenomes-Tr; EBT00001628384.
DR   EnsemblGenomes-Tr; EBT00001628385.
DR   EnsemblGenomes-Tr; EBT00001628386.
DR   EnsemblGenomes-Tr; EBT00001628387.
DR   EnsemblGenomes-Tr; EBT00001628388.
DR   EnsemblGenomes-Tr; EBT00001628389.
DR   EnsemblGenomes-Tr; EBT00001628390.
DR   EnsemblGenomes-Tr; EBT00001628391.
DR   EnsemblGenomes-Tr; EBT00001628392.
DR   EnsemblGenomes-Tr; EBT00001628393.
DR   EnsemblGenomes-Tr; EBT00001628394.
DR   EnsemblGenomes-Tr; EBT00001628395.
DR   EnsemblGenomes-Tr; EBT00001628396.
DR   EnsemblGenomes-Tr; EBT00001628397.
DR   EnsemblGenomes-Tr; EBT00001628398.
DR   EnsemblGenomes-Tr; EBT00001628399.
DR   EnsemblGenomes-Tr; EBT00001628400.
DR   EnsemblGenomes-Tr; EBT00001628401.
DR   EnsemblGenomes-Tr; EBT00001628402.
DR   EnsemblGenomes-Tr; EBT00001628403.
DR   EnsemblGenomes-Tr; EBT00001628404.
DR   EnsemblGenomes-Tr; EBT00001628405.
DR   EnsemblGenomes-Tr; EBT00001628406.
DR   EnsemblGenomes-Tr; EBT00001628407.
DR   EnsemblGenomes-Tr; EBT00001628408.
DR   EnsemblGenomes-Tr; EBT00001628409.
DR   EnsemblGenomes-Tr; EBT00001628410.
DR   EnsemblGenomes-Tr; EBT00001628411.
DR   EnsemblGenomes-Tr; EBT00001628412.
DR   EnsemblGenomes-Tr; EBT00001628413.
DR   EnsemblGenomes-Tr; EBT00001628414.
DR   EnsemblGenomes-Tr; EBT00001628415.
DR   EnsemblGenomes-Tr; EBT00001628416.
DR   EnsemblGenomes-Tr; EBT00001628417.
DR   EnsemblGenomes-Tr; EBT00001628418.
DR   EnsemblGenomes-Tr; EBT00001628419.
DR   EnsemblGenomes-Tr; EBT00001628420.
DR   EnsemblGenomes-Tr; EBT00001628421.
DR   EnsemblGenomes-Tr; EBT00001628422.
DR   EnsemblGenomes-Tr; EBT00001628423.
DR   EnsemblGenomes-Tr; EBT00001628424.
DR   EnsemblGenomes-Tr; EBT00001628425.
DR   EnsemblGenomes-Tr; EBT00001628426.
DR   EnsemblGenomes-Tr; EBT00001628427.
DR   EnsemblGenomes-Tr; EBT00001628428.
DR   EnsemblGenomes-Tr; EBT00001628429.
DR   EnsemblGenomes-Tr; EBT00001628430.
DR   EnsemblGenomes-Tr; EBT00001628431.
DR   EnsemblGenomes-Tr; EBT00001628432.
DR   EnsemblGenomes-Tr; EBT00001628433.
DR   EnsemblGenomes-Tr; EBT00001628434.
DR   EnsemblGenomes-Tr; EBT00001628435.
DR   EnsemblGenomes-Tr; EBT00001628436.
DR   EnsemblGenomes-Tr; EBT00001628437.
DR   EnsemblGenomes-Tr; EBT00001628438.
DR   EnsemblGenomes-Tr; EBT00001628439.
DR   EnsemblGenomes-Tr; EBT00001628440.
DR   EnsemblGenomes-Tr; EBT00001628441.
DR   EnsemblGenomes-Tr; EBT00001628442.
DR   EnsemblGenomes-Tr; EBT00001628443.
DR   EnsemblGenomes-Tr; EBT00001628444.
DR   EnsemblGenomes-Tr; EBT00001628445.
DR   EnsemblGenomes-Tr; EBT00001628446.
DR   EnsemblGenomes-Tr; EBT00001628447.
DR   EnsemblGenomes-Tr; EBT00001628448.
DR   EnsemblGenomes-Tr; EBT00001628449.
DR   EnsemblGenomes-Tr; EBT00001628450.
DR   EnsemblGenomes-Tr; EBT00001628451.
DR   EnsemblGenomes-Tr; EBT00001628452.
DR   EnsemblGenomes-Tr; EBT00001628453.
DR   EnsemblGenomes-Tr; EBT00001628454.
DR   EnsemblGenomes-Tr; EBT00001628455.
DR   EnsemblGenomes-Tr; EBT00001628456.
DR   EnsemblGenomes-Tr; EBT00001628457.
DR   EnsemblGenomes-Tr; EBT00001628458.
DR   EnsemblGenomes-Tr; EBT00001628459.
DR   EnsemblGenomes-Tr; EBT00001628460.
DR   EnsemblGenomes-Tr; EBT00001628461.
DR   EnsemblGenomes-Tr; EBT00001628462.
DR   EnsemblGenomes-Tr; EBT00001628463.
DR   EnsemblGenomes-Tr; EBT00001628464.
DR   EnsemblGenomes-Tr; EBT00001628465.
DR   EnsemblGenomes-Tr; EBT00001628466.
DR   EnsemblGenomes-Tr; EBT00001628467.
DR   EnsemblGenomes-Tr; EBT00001628468.
DR   EnsemblGenomes-Tr; EBT00001628469.
DR   EnsemblGenomes-Tr; EBT00001628470.
DR   EnsemblGenomes-Tr; EBT00001628471.
DR   EnsemblGenomes-Tr; EBT00001628472.
DR   EnsemblGenomes-Tr; EBT00001628473.
DR   EnsemblGenomes-Tr; EBT00001628474.
DR   EnsemblGenomes-Tr; EBT00001628475.
DR   EnsemblGenomes-Tr; EBT00001628476.
DR   EnsemblGenomes-Tr; EBT00001628477.
DR   EnsemblGenomes-Tr; EBT00001628478.
DR   EnsemblGenomes-Tr; EBT00001628479.
DR   EnsemblGenomes-Tr; EBT00001628480.
DR   EnsemblGenomes-Tr; EBT00001628481.
DR   EnsemblGenomes-Tr; EBT00001628482.
DR   EnsemblGenomes-Tr; EBT00001628483.
DR   EnsemblGenomes-Tr; EBT00001628484.
DR   EnsemblGenomes-Tr; EBT00001628485.
DR   EnsemblGenomes-Tr; EBT00001628486.
DR   EnsemblGenomes-Tr; EBT00001628487.
DR   EnsemblGenomes-Tr; EBT00001628488.
DR   EnsemblGenomes-Tr; EBT00001628489.
DR   EnsemblGenomes-Tr; EBT00001628490.
DR   EnsemblGenomes-Tr; EBT00001628491.
DR   EnsemblGenomes-Tr; EBT00001628492.
DR   EnsemblGenomes-Tr; EBT00001628493.
DR   EnsemblGenomes-Tr; EBT00001628494.
DR   EnsemblGenomes-Tr; EBT00001628495.
DR   EnsemblGenomes-Tr; EBT00001628496.
DR   EnsemblGenomes-Tr; EBT00001628497.
DR   EnsemblGenomes-Tr; EBT00001628498.
DR   EnsemblGenomes-Tr; EBT00001628499.
DR   EnsemblGenomes-Tr; EBT00001628500.
DR   EnsemblGenomes-Tr; EBT00001628501.
DR   EnsemblGenomes-Tr; EBT00001628502.
DR   EnsemblGenomes-Tr; EBT00001628503.
DR   EnsemblGenomes-Tr; EBT00001628504.
DR   EnsemblGenomes-Tr; EBT00001628505.
DR   EnsemblGenomes-Tr; EBT00001628506.
DR   EnsemblGenomes-Tr; EBT00001628507.
DR   EnsemblGenomes-Tr; EBT00001628508.
DR   EnsemblGenomes-Tr; EBT00001628509.
DR   EnsemblGenomes-Tr; EBT00001628510.
DR   EnsemblGenomes-Tr; EBT00001628511.
DR   EnsemblGenomes-Tr; EBT00001628512.
DR   EnsemblGenomes-Tr; EBT00001628513.
DR   EnsemblGenomes-Tr; EBT00001628514.
DR   EnsemblGenomes-Tr; EBT00001628515.
DR   EnsemblGenomes-Tr; EBT00001628516.
DR   EnsemblGenomes-Tr; EBT00001628517.
DR   EnsemblGenomes-Tr; EBT00001628518.
DR   EnsemblGenomes-Tr; EBT00001628519.
DR   EnsemblGenomes-Tr; EBT00001628520.
DR   EnsemblGenomes-Tr; EBT00001628521.
DR   EnsemblGenomes-Tr; EBT00001628522.
DR   EnsemblGenomes-Tr; EBT00001628523.
DR   EnsemblGenomes-Tr; EBT00001628524.
DR   EnsemblGenomes-Tr; EBT00001628525.
DR   EnsemblGenomes-Tr; EBT00001628526.
DR   EnsemblGenomes-Tr; EBT00001628527.
DR   EnsemblGenomes-Tr; EBT00001628528.
DR   EnsemblGenomes-Tr; EBT00001628529.
DR   EnsemblGenomes-Tr; EBT00001628530.
DR   EnsemblGenomes-Tr; EBT00001628531.
DR   EnsemblGenomes-Tr; EBT00001628532.
DR   EnsemblGenomes-Tr; EBT00001628533.
DR   EnsemblGenomes-Tr; EBT00001628534.
DR   EnsemblGenomes-Tr; EBT00001628535.
DR   EnsemblGenomes-Tr; EBT00001628536.
DR   EnsemblGenomes-Tr; EBT00001628537.
DR   EnsemblGenomes-Tr; EBT00001628538.
DR   EnsemblGenomes-Tr; EBT00001628539.
DR   EnsemblGenomes-Tr; EBT00001628540.
DR   EnsemblGenomes-Tr; EBT00001628541.
DR   EnsemblGenomes-Tr; EBT00001628542.
DR   EnsemblGenomes-Tr; EBT00001628543.
DR   EnsemblGenomes-Tr; EBT00001628544.
DR   EnsemblGenomes-Tr; EBT00001628545.
DR   EnsemblGenomes-Tr; EBT00001628546.
DR   EnsemblGenomes-Tr; EBT00001628547.
DR   EnsemblGenomes-Tr; EBT00001628548.
DR   EnsemblGenomes-Tr; EBT00001628549.
DR   EnsemblGenomes-Tr; EBT00001628550.
DR   EnsemblGenomes-Tr; EBT00001628551.
DR   EnsemblGenomes-Tr; EBT00001628552.
DR   EnsemblGenomes-Tr; EBT00001628553.
DR   EnsemblGenomes-Tr; EBT00001628554.
DR   EnsemblGenomes-Tr; EBT00001628555.
DR   EnsemblGenomes-Tr; EBT00001628556.
DR   EnsemblGenomes-Tr; EBT00001628557.
DR   EnsemblGenomes-Tr; EBT00001628558.
DR   EnsemblGenomes-Tr; EBT00001628559.
DR   EnsemblGenomes-Tr; EBT00001628560.
DR   EnsemblGenomes-Tr; EBT00001628561.
DR   EnsemblGenomes-Tr; EBT00001628562.
DR   EnsemblGenomes-Tr; EBT00001628563.
DR   EnsemblGenomes-Tr; EBT00001628564.
DR   EnsemblGenomes-Tr; EBT00001628565.
DR   EnsemblGenomes-Tr; EBT00001628566.
DR   EnsemblGenomes-Tr; EBT00001628567.
DR   EnsemblGenomes-Tr; EBT00001628568.
DR   EnsemblGenomes-Tr; EBT00001628569.
DR   EnsemblGenomes-Tr; EBT00001628570.
DR   EnsemblGenomes-Tr; EBT00001628571.
DR   EnsemblGenomes-Tr; EBT00001628572.
DR   EnsemblGenomes-Tr; EBT00001628573.
DR   EnsemblGenomes-Tr; EBT00001628574.
DR   EnsemblGenomes-Tr; EBT00001628575.
DR   EnsemblGenomes-Tr; ECED1_0075.
DR   EnsemblGenomes-Tr; ECED1_0078.
DR   EnsemblGenomes-Tr; ECED1_0113.
DR   EnsemblGenomes-Tr; ECED1_0115.
DR   EnsemblGenomes-Tr; ECED1_0140.
DR   EnsemblGenomes-Tr; ECED1_0223.
DR   EnsemblGenomes-Tr; ECED1_0225.
DR   EnsemblGenomes-Tr; ECED1_0226.
DR   EnsemblGenomes-Tr; ECED1_0261.
DR   EnsemblGenomes-Tr; ECED1_0262.
DR   EnsemblGenomes-Tr; ECED1_0281.
DR   EnsemblGenomes-Tr; ECED1_0282.
DR   EnsemblGenomes-Tr; ECED1_0283.
DR   EnsemblGenomes-Tr; ECED1_0289.
DR   EnsemblGenomes-Tr; ECED1_0290.
DR   EnsemblGenomes-Tr; ECED1_0291.
DR   EnsemblGenomes-Tr; ECED1_0292.
DR   EnsemblGenomes-Tr; ECED1_0308.
DR   EnsemblGenomes-Tr; ECED1_0309.
DR   EnsemblGenomes-Tr; ECED1_0329.
DR   EnsemblGenomes-Tr; ECED1_0338.
DR   EnsemblGenomes-Tr; ECED1_0387.
DR   EnsemblGenomes-Tr; ECED1_0388.
DR   EnsemblGenomes-Tr; ECED1_0551.
DR   EnsemblGenomes-Tr; ECED1_0552.
DR   EnsemblGenomes-Tr; ECED1_0557.
DR   EnsemblGenomes-Tr; ECED1_0560.
DR   EnsemblGenomes-Tr; ECED1_0561.
DR   EnsemblGenomes-Tr; ECED1_0577.
DR   EnsemblGenomes-Tr; ECED1_0578.
DR   EnsemblGenomes-Tr; ECED1_0583.
DR   EnsemblGenomes-Tr; ECED1_0595.
DR   EnsemblGenomes-Tr; ECED1_0596.
DR   EnsemblGenomes-Tr; ECED1_0688.
DR   EnsemblGenomes-Tr; ECED1_0730.
DR   EnsemblGenomes-Tr; ECED1_0731.
DR   EnsemblGenomes-Tr; ECED1_0778.
DR   EnsemblGenomes-Tr; ECED1_0779.
DR   EnsemblGenomes-Tr; ECED1_0820.
DR   EnsemblGenomes-Tr; ECED1_0821.
DR   EnsemblGenomes-Tr; ECED1_1015.
DR   EnsemblGenomes-Tr; ECED1_1078.
DR   EnsemblGenomes-Tr; ECED1_1081.
DR   EnsemblGenomes-Tr; ECED1_1281.
DR   EnsemblGenomes-Tr; ECED1_1285.
DR   EnsemblGenomes-Tr; ECED1_1286.
DR   EnsemblGenomes-Tr; ECED1_1300.
DR   EnsemblGenomes-Tr; ECED1_1308.
DR   EnsemblGenomes-Tr; ECED1_1315.
DR   EnsemblGenomes-Tr; ECED1_1324.
DR   EnsemblGenomes-Tr; ECED1_1344.
DR   EnsemblGenomes-Tr; ECED1_1345.
DR   EnsemblGenomes-Tr; ECED1_1378.
DR   EnsemblGenomes-Tr; ECED1_1380.
DR   EnsemblGenomes-Tr; ECED1_1381.
DR   EnsemblGenomes-Tr; ECED1_1390.
DR   EnsemblGenomes-Tr; ECED1_1391.
DR   EnsemblGenomes-Tr; ECED1_1413.
DR   EnsemblGenomes-Tr; ECED1_1423.
DR   EnsemblGenomes-Tr; ECED1_1424.
DR   EnsemblGenomes-Tr; ECED1_1425.
DR   EnsemblGenomes-Tr; ECED1_1461.
DR   EnsemblGenomes-Tr; ECED1_1462.
DR   EnsemblGenomes-Tr; ECED1_1485.
DR   EnsemblGenomes-Tr; ECED1_1486.
DR   EnsemblGenomes-Tr; ECED1_1536.
DR   EnsemblGenomes-Tr; ECED1_1537.
DR   EnsemblGenomes-Tr; ECED1_1538.
DR   EnsemblGenomes-Tr; ECED1_1556.
DR   EnsemblGenomes-Tr; ECED1_1559.
DR   EnsemblGenomes-Tr; ECED1_1560.
DR   EnsemblGenomes-Tr; ECED1_1577.
DR   EnsemblGenomes-Tr; ECED1_1592.
DR   EnsemblGenomes-Tr; ECED1_1607.
DR   EnsemblGenomes-Tr; ECED1_1608.
DR   EnsemblGenomes-Tr; ECED1_1609.
DR   EnsemblGenomes-Tr; ECED1_1613.
DR   EnsemblGenomes-Tr; ECED1_1629.
DR   EnsemblGenomes-Tr; ECED1_1636.
DR   EnsemblGenomes-Tr; ECED1_1640.
DR   EnsemblGenomes-Tr; ECED1_1646.
DR   EnsemblGenomes-Tr; ECED1_1651.
DR   EnsemblGenomes-Tr; ECED1_1652.
DR   EnsemblGenomes-Tr; ECED1_1662.
DR   EnsemblGenomes-Tr; ECED1_1671.
DR   EnsemblGenomes-Tr; ECED1_1674.
DR   EnsemblGenomes-Tr; ECED1_1686.
DR   EnsemblGenomes-Tr; ECED1_16S_1-1.
DR   EnsemblGenomes-Tr; ECED1_16S_2-1.
DR   EnsemblGenomes-Tr; ECED1_16S_3-1.
DR   EnsemblGenomes-Tr; ECED1_16S_4-1.
DR   EnsemblGenomes-Tr; ECED1_16S_5-1.
DR   EnsemblGenomes-Tr; ECED1_16S_6-1.
DR   EnsemblGenomes-Tr; ECED1_16S_7-1.
DR   EnsemblGenomes-Tr; ECED1_1755.
DR   EnsemblGenomes-Tr; ECED1_1756.
DR   EnsemblGenomes-Tr; ECED1_1770.
DR   EnsemblGenomes-Tr; ECED1_1792.
DR   EnsemblGenomes-Tr; ECED1_1871.
DR   EnsemblGenomes-Tr; ECED1_1872.
DR   EnsemblGenomes-Tr; ECED1_1919.
DR   EnsemblGenomes-Tr; ECED1_1921.
DR   EnsemblGenomes-Tr; ECED1_1922.
DR   EnsemblGenomes-Tr; ECED1_1923.
DR   EnsemblGenomes-Tr; ECED1_1924.
DR   EnsemblGenomes-Tr; ECED1_1974.
DR   EnsemblGenomes-Tr; ECED1_1975.
DR   EnsemblGenomes-Tr; ECED1_1991.
DR   EnsemblGenomes-Tr; ECED1_1992.
DR   EnsemblGenomes-Tr; ECED1_2006.
DR   EnsemblGenomes-Tr; ECED1_2153.
DR   EnsemblGenomes-Tr; ECED1_2285.
DR   EnsemblGenomes-Tr; ECED1_2286.
DR   EnsemblGenomes-Tr; ECED1_2330.
DR   EnsemblGenomes-Tr; ECED1_2333.
DR   EnsemblGenomes-Tr; ECED1_2338.
DR   EnsemblGenomes-Tr; ECED1_2339.
DR   EnsemblGenomes-Tr; ECED1_2343.
DR   EnsemblGenomes-Tr; ECED1_2344.
DR   EnsemblGenomes-Tr; ECED1_2345.
DR   EnsemblGenomes-Tr; ECED1_2346.
DR   EnsemblGenomes-Tr; ECED1_2356.
DR   EnsemblGenomes-Tr; ECED1_23S_1-1.
DR   EnsemblGenomes-Tr; ECED1_23S_2-1.
DR   EnsemblGenomes-Tr; ECED1_23S_3-1.
DR   EnsemblGenomes-Tr; ECED1_23S_4-1.
DR   EnsemblGenomes-Tr; ECED1_23S_5-1.
DR   EnsemblGenomes-Tr; ECED1_23S_6-1.
DR   EnsemblGenomes-Tr; ECED1_23S_7-1.
DR   EnsemblGenomes-Tr; ECED1_2436.
DR   EnsemblGenomes-Tr; ECED1_2452.
DR   EnsemblGenomes-Tr; ECED1_2493.
DR   EnsemblGenomes-Tr; ECED1_2618.
DR   EnsemblGenomes-Tr; ECED1_2619.
DR   EnsemblGenomes-Tr; ECED1_2627.
DR   EnsemblGenomes-Tr; ECED1_2628.
DR   EnsemblGenomes-Tr; ECED1_2840.
DR   EnsemblGenomes-Tr; ECED1_2843.
DR   EnsemblGenomes-Tr; ECED1_2937.
DR   EnsemblGenomes-Tr; ECED1_2938.
DR   EnsemblGenomes-Tr; ECED1_3026.
DR   EnsemblGenomes-Tr; ECED1_3072.
DR   EnsemblGenomes-Tr; ECED1_3095.
DR   EnsemblGenomes-Tr; ECED1_3375.
DR   EnsemblGenomes-Tr; ECED1_3391.
DR   EnsemblGenomes-Tr; ECED1_3392.
DR   EnsemblGenomes-Tr; ECED1_3431.
DR   EnsemblGenomes-Tr; ECED1_3441.
DR   EnsemblGenomes-Tr; ECED1_3473.
DR   EnsemblGenomes-Tr; ECED1_3477.
DR   EnsemblGenomes-Tr; ECED1_3496.
DR   EnsemblGenomes-Tr; ECED1_3502.
DR   EnsemblGenomes-Tr; ECED1_3521.
DR   EnsemblGenomes-Tr; ECED1_3522.
DR   EnsemblGenomes-Tr; ECED1_3548.
DR   EnsemblGenomes-Tr; ECED1_3581.
DR   EnsemblGenomes-Tr; ECED1_3583.
DR   EnsemblGenomes-Tr; ECED1_3585.
DR   EnsemblGenomes-Tr; ECED1_3586.
DR   EnsemblGenomes-Tr; ECED1_3620.
DR   EnsemblGenomes-Tr; ECED1_3625.
DR   EnsemblGenomes-Tr; ECED1_3684.
DR   EnsemblGenomes-Tr; ECED1_3693.
DR   EnsemblGenomes-Tr; ECED1_3694.
DR   EnsemblGenomes-Tr; ECED1_3760.
DR   EnsemblGenomes-Tr; ECED1_3761.
DR   EnsemblGenomes-Tr; ECED1_3788.
DR   EnsemblGenomes-Tr; ECED1_3987.
DR   EnsemblGenomes-Tr; ECED1_3988.
DR   EnsemblGenomes-Tr; ECED1_4071.
DR   EnsemblGenomes-Tr; ECED1_4100.
DR   EnsemblGenomes-Tr; ECED1_4116.
DR   EnsemblGenomes-Tr; ECED1_4117.
DR   EnsemblGenomes-Tr; ECED1_4173.
DR   EnsemblGenomes-Tr; ECED1_4178.
DR   EnsemblGenomes-Tr; ECED1_4179.
DR   EnsemblGenomes-Tr; ECED1_4246.
DR   EnsemblGenomes-Tr; ECED1_4247.
DR   EnsemblGenomes-Tr; ECED1_4252.
DR   EnsemblGenomes-Tr; ECED1_4253.
DR   EnsemblGenomes-Tr; ECED1_4769.
DR   EnsemblGenomes-Tr; ECED1_4770.
DR   EnsemblGenomes-Tr; ECED1_4776.
DR   EnsemblGenomes-Tr; ECED1_4777.
DR   EnsemblGenomes-Tr; ECED1_4871.
DR   EnsemblGenomes-Tr; ECED1_4880.
DR   EnsemblGenomes-Tr; ECED1_4885.
DR   EnsemblGenomes-Tr; ECED1_4890.
DR   EnsemblGenomes-Tr; ECED1_4896.
DR   EnsemblGenomes-Tr; ECED1_4897.
DR   EnsemblGenomes-Tr; ECED1_4898.
DR   EnsemblGenomes-Tr; ECED1_4906.
DR   EnsemblGenomes-Tr; ECED1_4920.
DR   EnsemblGenomes-Tr; ECED1_4921.
DR   EnsemblGenomes-Tr; ECED1_4972.
DR   EnsemblGenomes-Tr; ECED1_4973.
DR   EnsemblGenomes-Tr; ECED1_4985.
DR   EnsemblGenomes-Tr; ECED1_4992.
DR   EnsemblGenomes-Tr; ECED1_4995.
DR   EnsemblGenomes-Tr; ECED1_4997.
DR   EnsemblGenomes-Tr; ECED1_5006.
DR   EnsemblGenomes-Tr; ECED1_5007.
DR   EnsemblGenomes-Tr; ECED1_5011.
DR   EnsemblGenomes-Tr; ECED1_5012.
DR   EnsemblGenomes-Tr; ECED1_5022.
DR   EnsemblGenomes-Tr; ECED1_5023.
DR   EnsemblGenomes-Tr; ECED1_5024.
DR   EnsemblGenomes-Tr; ECED1_5025.
DR   EnsemblGenomes-Tr; ECED1_5118.
DR   EnsemblGenomes-Tr; ECED1_5119.
DR   EnsemblGenomes-Tr; ECED1_5126.
DR   EnsemblGenomes-Tr; ECED1_5132.
DR   EnsemblGenomes-Tr; ECED1_5133.
DR   EnsemblGenomes-Tr; ECED1_5146.
DR   EnsemblGenomes-Tr; ECED1_5148.
DR   EnsemblGenomes-Tr; ECED1_5149.
DR   EnsemblGenomes-Tr; ECED1_5164.
DR   EnsemblGenomes-Tr; ECED1_5165.
DR   EnsemblGenomes-Tr; ECED1_5180.
DR   EnsemblGenomes-Tr; ECED1_5192.
DR   EnsemblGenomes-Tr; ECED1_5203.
DR   EnsemblGenomes-Tr; ECED1_5215.
DR   EnsemblGenomes-Tr; ECED1_5S_1-1.
DR   EnsemblGenomes-Tr; ECED1_5S_2-1.
DR   EnsemblGenomes-Tr; ECED1_5S_3-1.
DR   EnsemblGenomes-Tr; ECED1_5S_4-1.
DR   EnsemblGenomes-Tr; ECED1_5S_5-1.
DR   EnsemblGenomes-Tr; ECED1_5S_6-1.
DR   EnsemblGenomes-Tr; ECED1_5S_7-1.
DR   EnsemblGenomes-Tr; ECED1_5S_8-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA1-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA10-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA11-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA12-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA13-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA14-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA15-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA16-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA17-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA18-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA19-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA2-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA20-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA21-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA22-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA23-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA24-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA25-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA26-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA27-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA28-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA29-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA3-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA30-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA31-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA32-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA33-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA34-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA35-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA36-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA37-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA38-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA39-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA4-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA40-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA41-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA42-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA43-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA44-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA45-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA46-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA47-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA48-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA49-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA5-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA50-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA51-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA52-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA53-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA54-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA55-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA56-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA57-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA58-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA59-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA6-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA60-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA61-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA62-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA63-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA64-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA65-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA66-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA67-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA68-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA69-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA7-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA70-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA71-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA72-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA73-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA74-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA75-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA76-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA77-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA78-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA79-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA8-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA80-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA81-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA82-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA83-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA84-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA85-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA86-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA87-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA88-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA89-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA9-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA90-1.
DR   EnsemblGenomes-Tr; ECED1_tRNA91-1.
DR   EuropePMC; PMC2808357; 20098708.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3209187; 21908635.
DR   EuropePMC; PMC3641635; 23493634.
DR   EuropePMC; PMC4001111; 24742173.
DR   EuropePMC; PMC4192283; 25269819.
DR   EuropePMC; PMC4399054; 25667270.
DR   EuropePMC; PMC4495197; 26002893.
DR   EuropePMC; PMC4508402; 25972421.
DR   EuropePMC; PMC5192156; 27795372.
DR   EuropePMC; PMC5382810; 28663823.
DR   EuropePMC; PMC5443543; 28542514.
DR   EuropePMC; PMC5506382; 28785421.
DR   EuropePMC; PMC6033998; 30008706.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00115; IS061.
DR   RFAM; RF00116; C0465.
DR   RFAM; RF00117; C0719.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00119; C0299.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00122; GadY.
DR   RFAM; RF00124; IS102.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00262; sar.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01804; Lambda_thermo.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02083; OrzO-P.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CU928162.
DR   SILVA-SSU; CU928162.
CC   Annotation results relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny conservation (Syntonizer software)
CC   are available in the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage.
FH   Key             Location/Qualifiers
FT   source          1..5209548
FT                   /organism="Escherichia coli ED1a"
FT                   /strain="ED1a"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:585397"
FT   gene            35..2497
FT                   /gene="thrA"
FT                   /locus_tag="ECED1_0001"
FT   CDS_pept        35..2497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="ECED1_0001"
FT                   /product="fused aspartokinase I ; homoserine dehydrogenase
FT                   I"
FT                   /function="1.2 : Aspartate family"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 1598232, 353521,
FT                   78130080, 85080024, 89274327, 387092, 390305, 6298218,
FT                   7003595; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06225"
FT                   /db_xref="GOA:B7N2U1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:B7N2U1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06225.1"
FT                   TLSWKLGV"
FT   gene            2499..3431
FT                   /gene="thrB"
FT                   /locus_tag="ECED1_0002"
FT   CDS_pept        2499..3431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="ECED1_0002"
FT                   /product="homoserine kinase"
FT                   /function="1.2 : Aspartate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 76165260, 81150470;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06226"
FT                   /db_xref="GOA:B7N2U2"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7N2U2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06226.1"
FT   gene            3432..4718
FT                   /gene="thrC"
FT                   /locus_tag="ECED1_0003"
FT   CDS_pept        3432..4718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="ECED1_0003"
FT                   /product="threonine synthase"
FT                   /function="1.2 : Aspartate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 6316258, 94058249,
FT                   9298646, 9600841, 1598232, 6150934; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06227"
FT                   /db_xref="GOA:B7MNL2"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06227.1"
FT   gene            4932..5228
FT                   /gene="yaaX"
FT                   /locus_tag="ECED1_0004"
FT   CDS_pept        4932..5228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="ECED1_0004"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06228"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06228.1"
FT   gene            complement(5278..6054)
FT                   /gene="yaaA"
FT                   /locus_tag="ECED1_0005"
FT   CDS_pept        complement(5278..6054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="ECED1_0005"
FT                   /product="conserved hypothetical protein; family UPF0246"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06229"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06229.1"
FT   gene            complement(6124..7554)
FT                   /gene="yaaJ"
FT                   /locus_tag="ECED1_0006"
FT   CDS_pept        complement(6124..7554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="ECED1_0006"
FT                   /product="putative amino acid sodium/proton transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06230"
FT                   /db_xref="GOA:B7MNL5"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06230.1"
FT                   PEIGRQLSPDAWDDVSQE"
FT   gene            7833..8786
FT                   /gene="talB"
FT                   /locus_tag="ECED1_0008"
FT   CDS_pept        7833..8786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="ECED1_0008"
FT                   /product="transaldolase B"
FT                   /function="6.9 : Pentose phosphate pathway"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 8332529, 92334977,
FT                   11298760, 7592346, 8805555, 9007983, 9298646; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06231"
FT                   /db_xref="GOA:B7MNL6"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06231.1"
FT   gene            8901..9488
FT                   /gene="mogA"
FT                   /locus_tag="ECED1_0009"
FT   CDS_pept        8901..9488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mogA"
FT                   /locus_tag="ECED1_0009"
FT                   /product="molybdochelatase MogA, involved in Moco
FT                   biosynthesis"
FT                   /function="4.6 : Molybdopterin"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 876396, 10636880,
FT                   8088525; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06232"
FT                   /db_xref="GOA:B7MNL7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06232.1"
FT   gene            complement(9693..10259)
FT                   /gene="yaaH"
FT                   /locus_tag="ECED1_0010"
FT   CDS_pept        complement(9693..10259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="ECED1_0010"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein associated with acetate transport"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pm : putative membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06233"
FT                   /db_xref="GOA:B7MNL8"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06233.1"
FT   gene            complement(10408..11121)
FT                   /gene="htpY"
FT                   /locus_tag="ECED1_0011"
FT   CDS_pept        complement(10408..11121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpY"
FT                   /locus_tag="ECED1_0011"
FT                   /product="heat shock protein"
FT                   /function="16.3 : Control"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 8478327; Product type r
FT                   : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06234"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06234.1"
FT                   LQIACLRRMVSATQV"
FT   gene            complement(11147..11551)
FT                   /gene="yaaI"
FT                   /locus_tag="ECED1_0012"
FT   CDS_pept        complement(11147..11551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="ECED1_0012"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06235"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06235.1"
FT   gene            11923..13839
FT                   /gene="dnaK"
FT                   /locus_tag="ECED1_0013"
FT   CDS_pept        11923..13839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ECED1_0013"
FT                   /product="chaperone Hsp70, co-chaperone with DnaJ"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06236"
FT                   /db_xref="GOA:B7MNM1"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06236.1"
FT                   DKK"
FT   gene            13840..13928
FT                   /locus_tag="ECED1_misc_RNA_1"
FT   misc_RNA        13840..13928
FT                   /locus_tag="ECED1_misc_RNA_1"
FT                   /product="SraB"
FT   gene            13928..15058
FT                   /gene="dnaJ"
FT                   /locus_tag="ECED1_0014"
FT   CDS_pept        13928..15058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ECED1_0014"
FT                   /product="chaperone Hsp40, co-chaperone with DnaK"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92236754, 92274451,
FT                   94038895, 9822822, 10210198, 10891270, 1826368, 3003084,
FT                   3003085, 8764403; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06237"
FT                   /db_xref="GOA:B7MNM2"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06237.1"
FT   gene            15364..15418
FT                   /gene="sokC"
FT                   /locus_tag="ECED1_misc_RNA_2"
FT   misc_RNA        15364..15418
FT                   /gene="sokC"
FT                   /locus_tag="ECED1_misc_RNA_2"
FT                   /product="SokC"
FT   gene            15930..16691
FT                   /locus_tag="ECED1_0015"
FT   CDS_pept        15930..16691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0015"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06238"
FT                   /db_xref="GOA:B7MNM3"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06238.1"
FT   gene            16675..18204
FT                   /locus_tag="ECED1_0016"
FT   CDS_pept        16675..18204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0016"
FT                   /product="putative Cerebroside-sulfatase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06239"
FT                   /db_xref="GOA:B7MNM4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06239.1"
FT   gene            18327..19592
FT                   /locus_tag="ECED1_0017"
FT   CDS_pept        18327..19592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0017"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06240"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06240.1"
FT   gene            19827..20993
FT                   /gene="nhaA"
FT                   /locus_tag="ECED1_0018"
FT   CDS_pept        19827..20993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="ECED1_0018"
FT                   /product="sodium-proton antiporter"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91250446, 92283803,
FT                   93131914; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06241"
FT                   /db_xref="GOA:B7MNM6"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06241.1"
FT   gene            21053..21958
FT                   /gene="nhaR"
FT                   /locus_tag="ECED1_0019"
FT   CDS_pept        21053..21958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="ECED1_0019"
FT                   /product="DNA-binding transcriptional activator"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92268083, 94193576,
FT                   2429258, 3413113, 8168494; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06242"
FT                   /db_xref="GOA:B7MNM7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06242.1"
FT   gene            complement(22054..22317)
FT                   /gene="rpsT"
FT                   /locus_tag="ECED1_0020"
FT   CDS_pept        complement(22054..22317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="ECED1_0020"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92011603, 93138304,
FT                   93247500, 10094780, 12244297, 12809609, 2429258, 2985604,
FT                   6267039, 786731; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06243"
FT                   /db_xref="GOA:B7MNM8"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06243.1"
FT   gene            22420..22638
FT                   /gene="yaaY"
FT                   /locus_tag="ECED1_0021"
FT   CDS_pept        22420..22638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaY"
FT                   /locus_tag="ECED1_0021"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06244"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06244.1"
FT   gene            22646..23587
FT                   /gene="ribF"
FT                   /locus_tag="ECED1_0022"
FT   CDS_pept        22646..23587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ECED1_0022"
FT                   /product="bifunctional riboflavin kinase and FAD
FT                   synthetase"
FT                   /function="4.9 : Riboflavin, FMN, and FAD"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 2985604, 9743119;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06245"
FT                   /db_xref="GOA:B7MNN0"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06245.1"
FT   gene            23630..26446
FT                   /gene="ileS"
FT                   /locus_tag="ECED1_0023"
FT   CDS_pept        23630..26446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="ECED1_0023"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /function="10.1 : tRNA aminoacylation"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91222233, 93065273,
FT                   2985604, 6374664, 6378662, 6390679, 7929087, 9554847,
FT                   2011499; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06246"
FT                   /db_xref="GOA:B7MNN1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06246.1"
FT                   DGEKRKFA"
FT   gene            26446..26940
FT                   /gene="lspA"
FT                   /locus_tag="ECED1_0024"
FT   CDS_pept        26446..26940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="ECED1_0024"
FT                   /product="prolipoprotein signal peptidase (signal peptidase
FT                   II)"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="11.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91373397, 6378662;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06247"
FT                   /db_xref="GOA:B7MNN2"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06247.1"
FT                   Q"
FT   gene            27048..27497
FT                   /gene="fkpB"
FT                   /locus_tag="ECED1_0025"
FT   CDS_pept        27048..27497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="ECED1_0025"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 97332650, 2011499;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06248"
FT                   /db_xref="GOA:B7MNN3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06248.1"
FT   gene            27499..28449
FT                   /gene="ispH"
FT                   /locus_tag="ECED1_0026"
FT   CDS_pept        27499..28449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="ECED1_0026"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   reductase, 4Fe-4S protein"
FT                   /function="4 : Biosynthesis of cofactors, prosthetic
FT                   groups, and carriers"
FT                   /function="12 : Regulatory functions"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12198182, 12706830,
FT                   21311595, 21574179, 21819424, 93163053, 98196746; Product
FT                   type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06249"
FT                   /db_xref="GOA:B7MNN4"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06249.1"
FT   gene            28515..29429
FT                   /gene="rihC"
FT                   /locus_tag="ECED1_0027"
FT   CDS_pept        28515..29429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rihC"
FT                   /locus_tag="ECED1_0027"
FT                   /product="ribonucleoside hydrolase 3"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number="3.2.2.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21125610; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06250"
FT                   /db_xref="GOA:B7MNN5"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06250.1"
FT   gene            29452..29817
FT                   /locus_tag="ECED1_0028"
FT   CDS_pept        29452..29817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0028"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06251"
FT                   /db_xref="GOA:B7MNN6"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06251.1"
FT                   VILLILCCLPSKSQDQA"
FT   gene            29978..30799
FT                   /gene="dapB"
FT                   /locus_tag="ECED1_0029"
FT   CDS_pept        29978..30799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="ECED1_0029"
FT                   /product="dihydrodipicolinate reductase"
FT                   /function="1.2 : Aspartate family"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 74169519, 85054974,
FT                   6377309, 7893645, 9398235; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06252"
FT                   /db_xref="GOA:B7MNN7"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06252.1"
FT   gene            31255..32403
FT                   /gene="carA"
FT                   /locus_tag="ECED1_0030"
FT   CDS_pept        31255..32403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ECED1_0030"
FT                   /product="carbamoyl phosphate synthetase small subunit,
FT                   glutamine amidotransferase"
FT                   /function="1.3 : Glutamate family"
FT                   /function="2.4 : Pyrimidine ribonucleotide biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91113685, 91217057,
FT                   92172854, 10029528, 10089390, 10428826, 10587438, 1334233,
FT                   6308632, 6330744, 6377309, 9174345, 9298646, 9636022;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06253"
FT                   /db_xref="GOA:B7MNN8"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06253.1"
FT   gene            32421..35642
FT                   /gene="carB"
FT                   /locus_tag="ECED1_0031"
FT   CDS_pept        32421..35642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="ECED1_0031"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /function="1.3 : Glutamate family"
FT                   /function="2.4 : Pyrimidine ribonucleotide biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91110549, 91113685,
FT                   91159438, 91217057, 91332909, 92172854, 99357782, 10029528,
FT                   10089390, 10587438, 6308632, 6330744, 6377309, 9174345,
FT                   9636022; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06254"
FT                   /db_xref="GOA:B7MNN9"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06254.1"
FT   gene            complement(35650..35868)
FT                   /locus_tag="ECED1_0032"
FT   CDS_pept        complement(35650..35868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0032"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 7815937, 6308632"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06255"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06255.1"
FT   gene            35903..36298
FT                   /gene="caiF"
FT                   /locus_tag="ECED1_0033"
FT   CDS_pept        35903..36298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiF"
FT                   /locus_tag="ECED1_0033"
FT                   /product="transcriptional activator"
FT                   /function="5 : Central intermediary metabolism"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 96200092; Product type r
FT                   : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06256"
FT                   /db_xref="GOA:B7MNP1"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06256.1"
FT   gene            complement(36417..37007)
FT                   /gene="caiE"
FT                   /locus_tag="ECED1_0034"
FT   CDS_pept        complement(36417..37007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="ECED1_0034"
FT                   /product="putative acyl transferase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /function="6.2 : Amino acids and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 95115548, 12793527; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06257"
FT                   /db_xref="GOA:B7MNP2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06257.1"
FT   gene            complement(37013..37903)
FT                   /gene="caiD"
FT                   /locus_tag="ECED1_0035"
FT   CDS_pept        complement(37013..37903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="ECED1_0035"
FT                   /product="crotonobetainyl CoA hydratase"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="4.2.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21435666, 97189569,
FT                   7815937; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06258"
FT                   /db_xref="GOA:B7MNP3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06258.1"
FT                   PLAFAEKRDPVWKGR"
FT   gene            complement(37904..39472)
FT                   /gene="caiC"
FT                   /locus_tag="ECED1_0036"
FT   CDS_pept        complement(37904..39472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="ECED1_0036"
FT                   /product="putative crotonobetaine CoA ligase:carnitine CoA
FT                   ligase"
FT                   /function="16.1 : Circulate"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="6.3.2.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15731894, 97189569, 7815937; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06259"
FT                   /db_xref="GOA:B7MNP4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06259.1"
FT                   RKNLK"
FT   gene            complement(39530..40747)
FT                   /gene="caiB"
FT                   /locus_tag="ECED1_0037"
FT   CDS_pept        complement(39530..40747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="ECED1_0037"
FT                   /product="crotonobetainyl CoA:carnitine CoA transferase"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="2.8.3.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21435666, 94245624,
FT                   95115548, 99227081, 15518548, 10339822; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06260"
FT                   /db_xref="GOA:B7MNP5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06260.1"
FT                   LAKVED"
FT   gene            complement(40875..42017)
FT                   /gene="caiA"
FT                   /locus_tag="ECED1_0038"
FT   CDS_pept        complement(40875..42017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="ECED1_0038"
FT                   /product="crotonobetaine reductase subunit II, FAD-binding"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.12 : TCA cycle"
FT                   /EC_number="1.3.99.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 97189569, 99227081,
FT                   7815937; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06261"
FT                   /db_xref="GOA:B7MNP6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06261.1"
FT   gene            complement(42048..43562)
FT                   /gene="caiT"
FT                   /locus_tag="ECED1_0039"
FT   CDS_pept        complement(42048..43562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="ECED1_0039"
FT                   /product="L-carnitine/gamma-butyrobetaine antiporter"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /function="6 : Energy metabolism"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12163501, 9573142,
FT                   9871325, 7815937; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06262"
FT                   /db_xref="GOA:B7MNP7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06262.1"
FT   gene            44036..44806
FT                   /gene="fixA"
FT                   /locus_tag="ECED1_0040"
FT   CDS_pept        44036..44806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="ECED1_0040"
FT                   /product="putative electron transfer flavoprotein subunit,
FT                   ETFP adenine nucleotide-binding domain"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9573142, 96066354, 12081978; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06263"
FT                   /db_xref="GOA:B7MNP8"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06263.1"
FT   gene            44821..45762
FT                   /gene="fixB"
FT                   /locus_tag="ECED1_0041"
FT   CDS_pept        44821..45762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="ECED1_0041"
FT                   /product="putative electron transfer flavoprotein,
FT                   NAD/FAD-binding domain and ETFP adenine nucleotide-binding
FT                   domain-like"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9573142, 96066354, 12081978; Product
FT                   type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06264"
FT                   /db_xref="GOA:B7MNP9"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06264.1"
FT   gene            45813..47099
FT                   /gene="fixC"
FT                   /locus_tag="ECED1_0042"
FT   CDS_pept        45813..47099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="ECED1_0042"
FT                   /product="putative oxidoreductase with FAD/NAD(P)-binding
FT                   domain"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 96066354, 12081978; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06265"
FT                   /db_xref="GOA:B7MNQ0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06265.1"
FT   gene            47096..47383
FT                   /gene="fixX"
FT                   /locus_tag="ECED1_0043"
FT   CDS_pept        47096..47383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="ECED1_0043"
FT                   /product="putative 4Fe-4S ferredoxin"
FT                   /function="16.1 : Circulate"
FT                   /function="6.2 : Amino acids and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 96066354, 12081978; Product type pc :
FT                   putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06266"
FT                   /db_xref="GOA:B7MNQ1"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06266.1"
FT   gene            47442..48773
FT                   /gene="yaaU"
FT                   /locus_tag="ECED1_0044"
FT   CDS_pept        47442..48773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="ECED1_0044"
FT                   /product="putative transporter"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06267"
FT                   /db_xref="GOA:B7MNQ2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06267.1"
FT   gene            48881..49411
FT                   /gene="kefF"
FT                   /locus_tag="ECED1_0045"
FT   CDS_pept        48881..49411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="ECED1_0045"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein KefF"
FT                   /function="16.5 : Explore"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9312097, 20507830,
FT                   11053405; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06268"
FT                   /db_xref="GOA:B7MNQ3"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06268.1"
FT                   KQRLLEWQEAHHG"
FT   gene            49404..51266
FT                   /gene="kefC"
FT                   /locus_tag="ECED1_0046"
FT   CDS_pept        49404..51266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="ECED1_0046"
FT                   /product="potassium:proton antiporter"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10092637, 90286917,
FT                   91260444, 1325937, 6159575; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06269"
FT                   /db_xref="GOA:B7MNQ4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06269.1"
FT   gene            51458..51937
FT                   /gene="folA"
FT                   /locus_tag="ECED1_0047"
FT   CDS_pept        51458..51937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="ECED1_0047"
FT                   /product="dihydrofolate reductase"
FT                   /function="4.2 : Folic acid"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15139807, 90280385,
FT                   91152032, 92008630, 1998681, 2185835, 320005, 350268,
FT                   3549289, 6159575, 6815179, 7007370; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06270"
FT                   /db_xref="GOA:B7MNQ5"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06270.1"
FT   gene            52023..52256
FT                   /locus_tag="ECED1_0048"
FT   CDS_pept        52023..52256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0048"
FT                   /product="putative antitoxin of gyrase inhibiting
FT                   toxin-antitoxin system"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06271"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06271.1"
FT   gene            52259..52573
FT                   /locus_tag="ECED1_0049"
FT   CDS_pept        52259..52573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0049"
FT                   /product="putative toxin of gyrase inhibiting
FT                   toxin-antitoxin system"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06272"
FT                   /db_xref="GOA:B7MNQ7"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06272.1"
FT                   "
FT   gene            complement(52570..53418)
FT                   /gene="apaH"
FT                   /locus_tag="ECED1_0050"
FT   CDS_pept        complement(52570..53418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="ECED1_0050"
FT                   /product="diadenosine tetraphosphatase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89296933, 89359108,
FT                   92037553, 3031429, 6317672; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06273"
FT                   /db_xref="GOA:B7MNQ8"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06273.1"
FT                   S"
FT   gene            complement(53425..53802)
FT                   /gene="apaG"
FT                   /locus_tag="ECED1_0051"
FT   CDS_pept        complement(53425..53802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="ECED1_0051"
FT                   /product="protein associated with Co2+ and Mg2+ efflux"
FT                   /function="16.6 : Maintain"
FT                   /function="16.3 : Control"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06274"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06274.1"
FT   gene            complement(53805..54626)
FT                   /gene="ksgA"
FT                   /locus_tag="ECED1_0052"
FT   CDS_pept        complement(53805..54626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="ECED1_0052"
FT                   /product="S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
FT                   dimethyltransferase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12876362, 15136037,
FT                   89291753, 9748462, 2670894, 3031429, 3122846, 3905517;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06275"
FT                   /db_xref="GOA:B7MNR0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06275.1"
FT   gene            complement(54623..55612)
FT                   /gene="pdxA"
FT                   /locus_tag="ECED1_0053"
FT   CDS_pept        complement(54623..55612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="ECED1_0053"
FT                   /product="4-hydroxy-L-threonine phosphate dehydrogenase,
FT                   NAD-dependent"
FT                   /function="4.8 : Pyridoxine"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06276"
FT                   /db_xref="GOA:B7MNR1"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06276.1"
FT   gene            complement(55612..56898)
FT                   /gene="surA"
FT                   /locus_tag="ECED1_0054"
FT   CDS_pept        complement(55612..56898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="ECED1_0054"
FT                   /product="peptidyl-prolyl cis-trans isomerase (PPIase)"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21145448, 21588133,
FT                   97032152, 2165476, 2670894, 8626309, 9298646, 9600841;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06277"
FT                   /db_xref="GOA:B7MNR2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06277.1"
FT   gene            complement(56951..59305)
FT                   /gene="imp"
FT                   /locus_tag="ECED1_0055"
FT   CDS_pept        complement(56951..59305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="ECED1_0055"
FT                   /product="exported protein required for envelope
FT                   biosynthesis and integrity"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12207697, 95110156,
FT                   2547691, 9298646; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06278"
FT                   /db_xref="GOA:B7MNR3"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06278.1"
FT   gene            59560..60375
FT                   /gene="djlA"
FT                   /locus_tag="ECED1_0056"
FT   CDS_pept        59560..60375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="ECED1_0056"
FT                   /product="DnaJ-like protein, membrane anchored"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21269341, 9364917,
FT                   9364918, 12664169, 8809778, 11106641; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06279"
FT                   /db_xref="GOA:B7MNR4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06279.1"
FT   gene            complement(60493..61152)
FT                   /gene="rluA"
FT                   /locus_tag="ECED1_0057"
FT   CDS_pept        complement(60493..61152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="ECED1_0057"
FT                   /product="pseudouridine synthase for 23S rRNA (position
FT                   746) and tRNAphe(position 32)"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 99315821, 10529181,
FT                   10924141, 7493321, 7958944; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06280"
FT                   /db_xref="GOA:B7MNR5"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06280.1"
FT   gene            complement(61164..64070)
FT                   /gene="hepA"
FT                   /locus_tag="ECED1_0058"
FT   CDS_pept        complement(61164..64070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="ECED1_0058"
FT                   /product="RNA polymerase-associated helicase protein
FT                   (ATPase and RNA polymerase recycling factor)"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /function="12.1 : DNA interactions"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11751638, 20357329,
FT                   92250435, 92334977, 11772406, 11567013, 2034216, 8382805,
FT                   9507009, 9614128; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06281"
FT                   /db_xref="GOA:B7MNR6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06281.1"
FT   gene            complement(64234..66585)
FT                   /gene="polB"
FT                   /locus_tag="ECED1_0059"
FT   CDS_pept        complement(64234..66585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="ECED1_0059"
FT                   /product="DNA polymerase II"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.5 : Detoxification"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10217781, 91083835,
FT                   91154268, 99362739, 2034216, 2217198, 9079692; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06282"
FT                   /db_xref="GOA:B7MNR7"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06282.1"
FT   gene            complement(66660..67355)
FT                   /gene="araD"
FT                   /locus_tag="ECED1_0060"
FT   CDS_pept        complement(66660..67355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="ECED1_0060"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 87163495, 2034216,
FT                   2217198, 2251150, 2261080; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06283"
FT                   /db_xref="GOA:B7MNR8"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06283.1"
FT                   HGAKAYYGQ"
FT   gene            complement(67640..69142)
FT                   /gene="araA"
FT                   /locus_tag="ECED1_0061"
FT   CDS_pept        complement(67640..69142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="ECED1_0061"
FT                   /product="L-arabinose isomerase"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 87163495, 91162650;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06284"
FT                   /db_xref="GOA:B7MNR9"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06284.1"
FT   gene            complement(69153..70853)
FT                   /gene="araB"
FT                   /locus_tag="ECED1_0062"
FT   CDS_pept        complement(69153..70853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="ECED1_0062"
FT                   /product="L-ribulokinase"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 87163495, 91162650,
FT                   189315, 357433; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06285"
FT                   /db_xref="GOA:B7MNS0"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06285.1"
FT   gene            71141..72037
FT                   /gene="araC"
FT                   /locus_tag="ECED1_0063"
FT   CDS_pept        71141..72037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="ECED1_0063"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /function="6 : Energy metabolism"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 88097378, 90251626,
FT                   91162650, 6160371, 6283093, 7008027, 7019009, 9103202,
FT                   9367758; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06286"
FT                   /db_xref="GOA:B7MNS1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06286.1"
FT                   FKKCTGASPSEFRAGCE"
FT   gene            72549..73400
FT                   /locus_tag="ECED1_0064"
FT   CDS_pept        72549..73400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0064"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06287"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06287.1"
FT                   RS"
FT   gene            73407..73829
FT                   /locus_tag="ECED1_0065"
FT   CDS_pept        73407..73829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0065"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06288"
FT                   /db_xref="GOA:B7MNS3"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06288.1"
FT   gene            73984..74748
FT                   /gene="yabI"
FT                   /locus_tag="ECED1_0066"
FT   CDS_pept        73984..74748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="ECED1_0066"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pm : putative membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06289"
FT                   /db_xref="GOA:B7MNS4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06289.1"
FT   gene            complement(74862..75560)
FT                   /gene="thiQ"
FT                   /locus_tag="ECED1_0067"
FT   CDS_pept        complement(74862..75560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="ECED1_0067"
FT                   /product="thiamin transporter subunit ; ATP-binding
FT                   component of ABC superfamily"
FT                   /function="4.11 : Thiamine"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 99311269; Product type t
FT                   : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06290"
FT                   /db_xref="GOA:B7MNS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06290.1"
FT                   SASALLGIKG"
FT   gene            complement(75544..77154)
FT                   /gene="thiP"
FT                   /locus_tag="ECED1_0068"
FT   CDS_pept        complement(75544..77154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="ECED1_0068"
FT                   /product="fused thiamin transporter subunits of ABC
FT                   superfamily: membrane components"
FT                   /function="4.11 : Thiamine"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 99311269; Product type t
FT                   : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06291"
FT                   /db_xref="GOA:B7MNS6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06291.1"
FT   gene            complement(77130..78113)
FT                   /gene="tbpA"
FT                   /locus_tag="ECED1_0069"
FT   CDS_pept        complement(77130..78113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="ECED1_0069"
FT                   /product="thiamin transporter subunit ; periplasmic-binding
FT                   component of ABC superfamily"
FT                   /function="4.11 : Thiamine"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12182833, 4869219,
FT                   8432721, 99311269, 9535878; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06292"
FT                   /db_xref="GOA:B7MNS7"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06292.1"
FT   gene            complement(78144..78243)
FT                   /locus_tag="ECED1_misc_RNA_3"
FT   misc_RNA        complement(78144..78243)
FT                   /locus_tag="ECED1_misc_RNA_3"
FT                   /product="THI"
FT   gene            complement(78277..79932)
FT                   /gene="sgrR"
FT                   /locus_tag="ECED1_0070"
FT   CDS_pept        complement(78277..79932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgrR"
FT                   /locus_tag="ECED1_0070"
FT                   /product="DNA-binding transcriptional regulator"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15522088; Product type r
FT                   : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06293"
FT                   /db_xref="GOA:B7MNS8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023767"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06293.1"
FT   gene            80000..80225
FT                   /gene="sgrS"
FT                   /locus_tag="ECED1_misc_RNA_4"
FT   misc_RNA        80000..80225
FT                   /gene="sgrS"
FT                   /locus_tag="ECED1_misc_RNA_4"
FT                   /product="SgrS"
FT   gene            complement(80260..80865)
FT                   /gene="leuD"
FT                   /locus_tag="ECED1_0071"
FT   CDS_pept        complement(80260..80865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="ECED1_0071"
FT                   /product="3-isopropylmalate isomerase subunit"
FT                   /function="1.4 : Pyruvate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 374346, 9600841,
FT                   2993799; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06294"
FT                   /db_xref="GOA:B7MNS9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06294.1"
FT   gene            complement(80876..82276)
FT                   /gene="leuC"
FT                   /locus_tag="ECED1_0072"
FT   CDS_pept        complement(80876..82276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="ECED1_0072"
FT                   /product="3-isopropylmalate isomerase subunit, dehydratase
FT                   component"
FT                   /function="1.4 : Pyruvate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 374346, 2124684,
FT                   2993799, 8119295, 9298646, 9600841, 9740056; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06295"
FT                   /db_xref="GOA:B7MNT0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06295.1"
FT                   FADIRNIK"
FT   gene            complement(82279..83370)
FT                   /gene="leuB"
FT                   /locus_tag="ECED1_0073"
FT   CDS_pept        complement(82279..83370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="ECED1_0073"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /function="1.4 : Pyruvate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 204639, 8119295,
FT                   8875643, 9086278, 9298646; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06296"
FT                   /db_xref="GOA:B7MNT1"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06296.1"
FT   gene            complement(83370..84941)
FT                   /gene="leuA"
FT                   /locus_tag="ECED1_0074"
FT   CDS_pept        complement(83370..84941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="ECED1_0074"
FT                   /product="2-isopropylmalate synthase"
FT                   /function="1.4 : Pyruvate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 4570778, 6195343,
FT                   6171647, 9298646; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06297"
FT                   /db_xref="GOA:B7MNT2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06297.1"
FT                   NNKETV"
FT   gene            complement(85034..85120)
FT                   /gene="leuL"
FT                   /locus_tag="ECED1_5276"
FT   CDS_pept        complement(85034..85120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuL"
FT                   /locus_tag="ECED1_5276"
FT                   /product="leu operon leader peptide"
FT                   /function="1.4 : Pyruvate family"
FT                   /note="Evidence 1c : Function experimentally demonstrated
FT                   in the studied genus; Product type l : leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_5276"
FT                   /db_xref="EnsemblGenomes-Tr:CAV17694"
FT                   /db_xref="GOA:B7N2U3"
FT                   /db_xref="InterPro:IPR012570"
FT                   /db_xref="UniProtKB/TrEMBL:B7N2U3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV17694.1"
FT                   /translation="MTHIVRFIGPLLLNASSLRGRLVSGIQN"
FT   gene            85694..86395
FT                   /pseudo
FT                   /gene="leuO"
FT                   /locus_tag="ECED1_0075"
FT   CDS_pept        85694..86395
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="ECED1_0075"
FT                   /product="fragment of DNA-binding transcriptional activator
FT                   (part 1)"
FT                   /function="1.4 : Pyruvate family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 7 : Gene remnant; Product type r :
FT                   regulator"
FT                   /db_xref="PSEUDO:CAR06298.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            86446..86721
FT                   /gene="insA"
FT                   /locus_tag="ECED1_0076"
FT   CDS_pept        86446..86721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insA"
FT                   /locus_tag="ECED1_0076"
FT                   /product="IS1 repressor protein InsA"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9689094; Product type h
FT                   : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06299"
FT                   /db_xref="GOA:B7MNT4"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06299.1"
FT   gene            86640..87143
FT                   /gene="insB"
FT                   /locus_tag="ECED1_0077"
FT   CDS_pept        86640..87143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="ECED1_0077"
FT                   /product="IS1 transposase InsAB'"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9689094; Product type h
FT                   : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06300"
FT                   /db_xref="GOA:B7MNT5"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06300.1"
FT                   KHYQ"
FT   gene            87275..87499
FT                   /pseudo
FT                   /gene="leuO"
FT                   /locus_tag="ECED1_0078"
FT   CDS_pept        87275..87499
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="ECED1_0078"
FT                   /product="fragment of DNA-binding transcriptional activator
FT                   (part 2)"
FT                   /function="1.4 : Pyruvate family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 7 : Gene remnant; Product type r :
FT                   regulator"
FT                   /db_xref="PSEUDO:CAR06301.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            87817..89541
FT                   /gene="ilvI"
FT                   /locus_tag="ECED1_0079"
FT   CDS_pept        87817..89541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="ECED1_0079"
FT                   /product="acetolactate synthase III, large subunit"
FT                   /function="1.4 : Pyruvate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89155476, 92380929,
FT                   3891724, 6308579, 9298646; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06302"
FT                   /db_xref="GOA:B7MNT7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06302.1"
FT   gene            89544..90035
FT                   /gene="ilvH"
FT                   /locus_tag="ECED1_0080"
FT   CDS_pept        89544..90035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="ECED1_0080"
FT                   /product="acetolactate synthase III, thiamin-dependent,
FT                   small subunit"
FT                   /function="1.4 : Pyruvate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89033904, 89155476,
FT                   92380929, 1851954, 2198273, 6308579; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06303"
FT                   /db_xref="GOA:B7MNT8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06303.1"
FT                   "
FT   gene            90215..91219
FT                   /gene="fruR"
FT                   /locus_tag="ECED1_0081"
FT   CDS_pept        90215..91219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="ECED1_0081"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /function="6.6 : Entner-Doudoroff"
FT                   /function="6.8 : Glycolysis/gluconeogenesis"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89384462, 94018607,
FT                   94047069, 96421533, 1851954, 2198273, 8655535, 9237914;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06304"
FT                   /db_xref="GOA:B7MNT9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06304.1"
FT   gene            91821..92279
FT                   /gene="mraZ"
FT                   /locus_tag="ECED1_0082"
FT   CDS_pept        91821..92279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="ECED1_0082"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 20042184, 2187182"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06305"
FT                   /db_xref="GOA:B7MNU0"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06305.1"
FT   gene            92281..93222
FT                   /gene="mraW"
FT                   /locus_tag="ECED1_0083"
FT   CDS_pept        92281..93222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="ECED1_0083"
FT                   /product="S-adenosyl-dependent methyltransferase activity
FT                   on membrane-located substrates"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 20042184, 10493123,
FT                   2187182, 6350821; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06306"
FT                   /db_xref="GOA:B7MNU1"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06306.1"
FT   gene            93219..93584
FT                   /gene="ftsL"
FT                   /locus_tag="ECED1_0084"
FT   CDS_pept        93219..93584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ECED1_0084"
FT                   /product="membrane bound cell division protein at septum
FT                   containing leucine zipper motif"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10027987, 93077455,
FT                   94079315, 1447153, 2187182, 6350821; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06307"
FT                   /db_xref="GOA:B7MNU2"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06307.1"
FT                   LQMQHVDPSQENIVVQK"
FT   gene            93600..95366
FT                   /gene="ftsI"
FT                   /locus_tag="ECED1_0085"
FT   CDS_pept        93600..95366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ECED1_0085"
FT                   /product="transpeptidase involved in septal peptidoglycan
FT                   synthesis (penicillin-binding protein 3)"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="15.1 : Cell division"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91072213, 92202178,
FT                   94095121, 9603865, 9614966, 1332942, 1447153, 2198024,
FT                   2677607, 2681146, 3049550, 3911028, 6350821; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06308"
FT                   /db_xref="GOA:B7MNU3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06308.1"
FT                   VINQGEGTGGRS"
FT   gene            95353..96840
FT                   /gene="murE"
FT                   /locus_tag="ECED1_0086"
FT   CDS_pept        95353..96840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="ECED1_0086"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-diaminopimelate
FT                   ligase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 88273095, 90036700,
FT                   91310568, 2198024, 2269304, 2692800, 9166795; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06309"
FT                   /db_xref="GOA:B7MNU4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06309.1"
FT   gene            96837..98195
FT                   /gene="murF"
FT                   /locus_tag="ECED1_0087"
FT   CDS_pept        96837..98195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ECED1_0087"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine
FT                   ligase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="15.1 : Cell division"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 88273095, 90248455,
FT                   91310568, 97128642, 11090285, 2668880, 9166795; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06310"
FT                   /db_xref="GOA:B7MNU5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06310.1"
FT   gene            98189..99271
FT                   /gene="mraY"
FT                   /locus_tag="ECED1_0088"
FT   CDS_pept        98189..99271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="ECED1_0088"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide
FT                   transferase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91123172, 10564498,
FT                   215212, 2179861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06311"
FT                   /db_xref="GOA:B7MNU6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06311.1"
FT   gene            99274..100590
FT                   /gene="murD"
FT                   /locus_tag="ECED1_0089"
FT   CDS_pept        99274..100590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="ECED1_0089"
FT                   /product="UDP-N-acetylmuramoyl-L-alanine:D-glutamate
FT                   ligase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 88273095, 90036700,
FT                   91310568, 99330160, 10966819, 1765076, 2129548, 2179861,
FT                   2509435, 9218784; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06312"
FT                   /db_xref="GOA:B7MNU7"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06312.1"
FT   gene            100590..101834
FT                   /gene="ftsW"
FT                   /locus_tag="ECED1_0090"
FT   CDS_pept        100590..101834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ECED1_0090"
FT                   /product="integral membrane protein involved in stabilizing
FT                   FstZ ring during cell division"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90036736, 9603865,
FT                   2197603, 7961485, 9006034, 9218774; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06313"
FT                   /db_xref="GOA:B7MNU8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06313.1"
FT                   ETRLEKAQAFVRGSR"
FT   gene            101831..102898
FT                   /gene="murG"
FT                   /locus_tag="ECED1_0091"
FT   CDS_pept        101831..102898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ECED1_0091"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12538870, 88273095,
FT                   91310568, 99268472, 10892798, 2187180, 2197603, 8449890;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06314"
FT                   /db_xref="GOA:B7MNU9"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06314.1"
FT                   ATERVANEVSRAARA"
FT   gene            102952..104427
FT                   /gene="murC"
FT                   /locus_tag="ECED1_0092"
FT   CDS_pept        102952..104427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="ECED1_0092"
FT                   /product="UDP-N-acetylmuramate:L-alanine ligase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12876369, 88273095,
FT                   91310568, 99330160, 2197603, 7601127, 9166795; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06315"
FT                   /db_xref="GOA:B7MNV0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06315.1"
FT   gene            104420..105340
FT                   /gene="ddlB"
FT                   /locus_tag="ECED1_0093"
FT   CDS_pept        104420..105340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="ECED1_0093"
FT                   /product="D-alanine:D-alanine ligase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="15.1 : Cell division"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91129242, 95200896,
FT                   1554356, 2197603, 3528126, 7939684, 9054558; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06316"
FT                   /db_xref="GOA:B7MNV1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06316.1"
FT   gene            105342..106172
FT                   /gene="ftsQ"
FT                   /locus_tag="ECED1_0094"
FT   CDS_pept        105342..106172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ECED1_0094"
FT                   /product="membrane anchored protein involved in growth of
FT                   wall at septum"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92021787, 93015653,
FT                   9882666, 2995680, 3528126, 6094474; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06317"
FT                   /db_xref="GOA:B7MNV2"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06317.1"
FT   gene            106169..107431
FT                   /gene="ftsA"
FT                   /locus_tag="ECED1_0095"
FT   CDS_pept        106169..107431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ECED1_0095"
FT                   /product="ATP-binding cell division protein involved in
FT                   recruitment of FtsK to Z ring"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11847116, 20507805,
FT                   93015653, 94079315, 2846985, 2995680, 3000876, 6094474;
FT                   Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06318"
FT                   /db_xref="GOA:B7MNV3"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06318.1"
FT   gene            107492..108643
FT                   /gene="ftsZ"
FT                   /locus_tag="ECED1_0096"
FT   CDS_pept        107492..108643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="ECED1_0096"
FT                   /product="GTP-binding tubulin-like cell division protein"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 94018635, 94193533,
FT                   94222860, 99248407, 1528267, 1528268, 1944597, 2824434,
FT                   2995680, 3000876, 6094474, 8016071, 8083192, 9298646;
FT                   Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06319"
FT                   /db_xref="GOA:B7MNV4"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06319.1"
FT   gene            108744..109661
FT                   /gene="lpxC"
FT                   /locus_tag="ECED1_0097"
FT   CDS_pept        108744..109661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="ECED1_0097"
FT                   /product="UDP-3-O-acyl N-acetylglucosamine deacetylase"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="3.5.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92021797, 94079315,
FT                   99152380, 2824434, 3000876, 8752330; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06320"
FT                   /db_xref="GOA:B7MNV5"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06320.1"
FT   gene            109892..110404
FT                   /gene="secM"
FT                   /locus_tag="ECED1_0098"
FT   CDS_pept        109892..110404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secM"
FT                   /locus_tag="ECED1_0098"
FT                   /product="regulator of secA translation"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 20444210, 21111078;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06321"
FT                   /db_xref="GOA:B7MNV6"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06321.1"
FT                   AGPQRLS"
FT   gene            110466..113171
FT                   /gene="secA"
FT                   /locus_tag="ECED1_0099"
FT   CDS_pept        110466..113171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="ECED1_0099"
FT                   /product="preprotein translocase subunit, ATPase"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12403785, 91170263,
FT                   92135194, 94292446, 9644254, 9705302, 9829959, 2542029,
FT                   2824434, 2841285; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06322"
FT                   /db_xref="GOA:B7MNV7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06322.1"
FT   gene            113231..113629
FT                   /gene="mutT"
FT                   /locus_tag="ECED1_0100"
FT   CDS_pept        113231..113629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="ECED1_0100"
FT                   /product="nucleoside triphosphate pyrophosphohydrolase,
FT                   marked preference for dGTP"
FT                   /function="2.1 : 2'-Deoxyribonucleotide metabolism"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10218109, 89264540,
FT                   90136514, 91225007, 97444511, 1309939, 2841285, 3033442,
FT                   3288626, 7578113, 9063868; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06323"
FT                   /db_xref="GOA:B7MNV8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06323.1"
FT   gene            complement(114040..114783)
FT                   /gene="yacF"
FT                   /locus_tag="ECED1_0101"
FT   CDS_pept        complement(114040..114783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="ECED1_0101"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06324"
FT                   /db_xref="GOA:B7MNV9"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06324.1"
FT   gene            complement(114783..115403)
FT                   /gene="coaE"
FT                   /locus_tag="ECED1_0102"
FT   CDS_pept        complement(114783..115403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="ECED1_0102"
FT                   /product="dephospho-CoA kinase"
FT                   /function="4.7 : Pantothenate and coenzyme A"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21189301, 10493123;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06325"
FT                   /db_xref="GOA:B7MNW0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06325.1"
FT   gene            115628..116671
FT                   /gene="guaC"
FT                   /locus_tag="ECED1_0103"
FT   CDS_pept        115628..116671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="ECED1_0103"
FT                   /product="GMP reductase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89061679; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06326"
FT                   /db_xref="GOA:B7MNW1"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06326.1"
FT                   NRIFNNL"
FT   gene            complement(116706..117908)
FT                   /gene="hofC"
FT                   /locus_tag="ECED1_0104"
FT   CDS_pept        complement(116706..117908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="ECED1_0104"
FT                   /product="assembly protein in type IV pilin biogenesis,
FT                   transmembrane protein"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 96099298, 2904262,
FT                   7959070; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06327"
FT                   /db_xref="GOA:B7MNW2"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06327.1"
FT                   G"
FT   gene            complement(117898..119283)
FT                   /gene="hofB"
FT                   /locus_tag="ECED1_0105"
FT   CDS_pept        complement(117898..119283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="ECED1_0105"
FT                   /product="putative protein transport with triphosphate
FT                   hydrolase domain"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 96099298, 7959070; Product type pt :
FT                   putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06328"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06328.1"
FT                   HGE"
FT   gene            complement(119293..119733)
FT                   /gene="ppdD"
FT                   /locus_tag="ECED1_0106"
FT   CDS_pept        complement(119293..119733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="ECED1_0106"
FT                   /product="putative major pilin subunit"
FT                   /function="16.1 : Circulate"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 20100782, 20271862, 96099298, 7959070;
FT                   Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06329"
FT                   /db_xref="GOA:B7MNW4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06329.1"
FT   gene            complement(119937..120830)
FT                   /gene="nadC"
FT                   /locus_tag="ECED1_0107"
FT   CDS_pept        complement(119937..120830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="ECED1_0107"
FT                   /product="quinolinate phosphoribosyltransferase"
FT                   /function="4.12 : Pyridine nucleotides"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 4319723; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06330"
FT                   /db_xref="GOA:B7MNW5"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06330.1"
FT                   ALTKHVQALDLSMRFR"
FT   gene            120918..121469
FT                   /gene="ampD"
FT                   /locus_tag="ECED1_0108"
FT   CDS_pept        120918..121469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="ECED1_0108"
FT                   /product="N-acetyl-anhydromuranmyl-L-alanine amidase"
FT                   /function="12 : Regulatory functions"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90113890, 95047240,
FT                   2607970, 7959070; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06331"
FT                   /db_xref="GOA:B7MNW6"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06331.1"
FT   gene            121466..122320
FT                   /gene="ampE"
FT                   /locus_tag="ECED1_0109"
FT   CDS_pept        121466..122320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="ECED1_0109"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 90113890, 2607970; Product
FT                   type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06332"
FT                   /db_xref="GOA:B7MNW7"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06332.1"
FT                   ALV"
FT   gene            complement(122363..123733)
FT                   /gene="aroP"
FT                   /locus_tag="ECED1_0110"
FT   CDS_pept        complement(122363..123733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="ECED1_0110"
FT                   /product="aromatic amino acid transporter"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 1104763, 90174991,
FT                   9150230; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06333"
FT                   /db_xref="GOA:B7MNW8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06333.1"
FT   gene            124261..126042
FT                   /locus_tag="ECED1_0111"
FT   CDS_pept        124261..126042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0111"
FT                   /product="conserved hypothetical protein in uropathogenic
FT                   strain containing a pyocin/colicin endonuclease-like domain
FT                   (usp-like)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 10702359"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06334"
FT                   /db_xref="GOA:B7MNW9"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR016128"
FT                   /db_xref="InterPro:IPR036302"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="InterPro:IPR037146"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06334.1"
FT                   NLRIVTPRLHDEIHYRR"
FT   gene            126045..126329
FT                   /locus_tag="ECED1_0112"
FT   CDS_pept        126045..126329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0112"
FT                   /product="Putative Colicin E7 immunity protein (ImmE7)
FT                   (Microcin E7 immunity protein)"
FT                   /function="15 : Cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06335"
FT                   /db_xref="GOA:B7MNX0"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06335.1"
FT   gene            126497..126736
FT                   /pseudo
FT                   /locus_tag="ECED1_0113"
FT   CDS_pept        126497..126736
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0113"
FT                   /product="conserved hypothetical protein; uropathogenic
FT                   specific protein (usp-like) (fragment)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 10702359"
FT                   /db_xref="PSEUDO:CAR06336.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            126737..127027
FT                   /locus_tag="ECED1_0114"
FT   CDS_pept        126737..127027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0114"
FT                   /product="Putative Colicin E7 immunity protein (ImmE7)
FT                   (Microcin E7 immunity protein)"
FT                   /function="15 : Cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06337"
FT                   /db_xref="GOA:B7MNX2"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06337.1"
FT   gene            127194..127382
FT                   /pseudo
FT                   /locus_tag="ECED1_0115"
FT   CDS_pept        127194..127382
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0115"
FT                   /product="uropathogenic specific protein (usp-like)
FT                   (fragment)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 10702359"
FT                   /db_xref="PSEUDO:CAR06338.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            127430..127726
FT                   /locus_tag="ECED1_0116"
FT   CDS_pept        127430..127726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0116"
FT                   /product="Putative Colicin E7 immunity protein (ImmE7)
FT                   (Microcin E7 immunity protein)"
FT                   /function="15 : Cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06339"
FT                   /db_xref="GOA:B7MNX4"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06339.1"
FT   gene            128182..128946
FT                   /gene="pdhR"
FT                   /locus_tag="ECED1_0117"
FT   CDS_pept        128182..128946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="ECED1_0117"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /function="6.8 : Glycolysis/gluconeogenesis"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 94085588, 94178454,
FT                   94335636, 6343085; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06340"
FT                   /db_xref="GOA:B7MNX5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06340.1"
FT   gene            complement(128787..128947)
FT                   /locus_tag="ECED1_misc_RNA_5"
FT   misc_RNA        complement(128787..128947)
FT                   /locus_tag="ECED1_misc_RNA_5"
FT                   /product="yybP-ykoY"
FT   gene            129107..131770
FT                   /gene="aceE"
FT                   /locus_tag="ECED1_0118"
FT   CDS_pept        129107..131770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="ECED1_0118"
FT                   /product="pyruvate dehydrogenase, decarboxylase component
FT                   E1, thiamin-binding"
FT                   /function="6.3 : Anaerobic"
FT                   /function="6.10 : Pyruvate dehydrogenase"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89076356, 89247334,
FT                   90242938, 11955070, 6343085, 8262214, 9298646; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06341"
FT                   /db_xref="GOA:B7MNX6"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06341.1"
FT                   IAKFNIDADKVNPRLA"
FT   gene            131785..133677
FT                   /gene="aceF"
FT                   /locus_tag="ECED1_0119"
FT   CDS_pept        131785..133677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="ECED1_0119"
FT                   /product="pyruvate dehydrogenase,
FT                   dihydrolipoyltransacetylase component E2"
FT                   /function="6.3 : Anaerobic"
FT                   /function="6.10 : Pyruvate dehydrogenase"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 80009188, 92037610,
FT                   92207996, 2121129, 2201286, 6345153, 6821375, 9298646;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06342"
FT                   /db_xref="GOA:B7MNX7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06342.1"
FT   gene            133885..135309
FT                   /gene="lpd"
FT                   /locus_tag="ECED1_0120"
FT   CDS_pept        133885..135309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="ECED1_0120"
FT                   /product="lipoamide dehydrogenase, E3 component is part of
FT                   three enzyme complexes"
FT                   /function="4.2 : Folic acid"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="6.3 : Anaerobic"
FT                   /function="6.10 : Pyruvate dehydrogenase"
FT                   /function="6.12 : TCA cycle"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89134177, 91008999,
FT                   6352260, 9298646; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06343"
FT                   /db_xref="GOA:B7MNX8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06343.1"
FT                   FEGSITDLPNPKAKKK"
FT   gene            complement(135551..137308)
FT                   /gene="yacH"
FT                   /locus_tag="ECED1_0121"
FT   CDS_pept        complement(135551..137308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="ECED1_0121"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06344"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06344.1"
FT                   ERGARRLER"
FT   gene            137663..140260
FT                   /gene="acnB"
FT                   /locus_tag="ECED1_0122"
FT   CDS_pept        137663..140260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="ECED1_0122"
FT                   /product="bifunctional aconitate hydratase 2 and
FT                   2-methylisocitrate dehydratase"
FT                   /function="6.3 : Anaerobic"
FT                   /function="6.12 : TCA cycle"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12473114, 20053887,
FT                   9421904, 95093601, 11992126, 8932712, 9298646; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06345"
FT                   /db_xref="GOA:B7MNY0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06345.1"
FT   gene            140435..140797
FT                   /gene="yacL"
FT                   /locus_tag="ECED1_0123"
FT   CDS_pept        140435..140797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="ECED1_0123"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 2666401, 7567469"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06346"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06346.1"
FT                   DFLQVVAAYRNFVQQK"
FT   gene            complement(140835..141629)
FT                   /gene="speD"
FT                   /locus_tag="ECED1_0124"
FT   CDS_pept        complement(140835..141629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="ECED1_0124"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /function="5.4 : Polyamine biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 88058963, 89327165,
FT                   2181453, 3546296; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06347"
FT                   /db_xref="GOA:B7MNY2"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06347.1"
FT   gene            complement(141645..142511)
FT                   /gene="speE"
FT                   /locus_tag="ECED1_0125"
FT   CDS_pept        complement(141645..142511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="ECED1_0125"
FT                   /product="spermidine synthase (putrescine
FT                   aminopropyltransferase)"
FT                   /function="5.4 : Polyamine biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 88058963, 89327165,
FT                   3526348; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06348"
FT                   /db_xref="GOA:B7MNY3"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06348.1"
FT                   ALASQPS"
FT   gene            complement(142617..143135)
FT                   /gene="yacC"
FT                   /locus_tag="ECED1_0126"
FT   CDS_pept        complement(142617..143135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="ECED1_0126"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 2666401"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06349"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06349.1"
FT                   SLSLLAYVK"
FT   gene            143130..144680
FT                   /gene="cueO"
FT                   /locus_tag="ECED1_0127"
FT   CDS_pept        143130..144680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="ECED1_0127"
FT                   /product="multicopper oxidase (laccase)"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11867755, 21125583,
FT                   21359329, 10493123, 10915804, 11399769, 11527384, 9298646;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06350"
FT                   /db_xref="GOA:B7MNY5"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06350.1"
FT   gene            complement(144727..147117)
FT                   /gene="gcd"
FT                   /locus_tag="ECED1_0128"
FT   CDS_pept        complement(144727..147117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="ECED1_0128"
FT                   /product="glucose dehydrogenase"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10359647, 11604400,
FT                   14612441, 91035240, 93123180, 93286127; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06351"
FT                   /db_xref="GOA:B7MNY6"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06351.1"
FT   gene            147323..147859
FT                   /gene="hpt"
FT                   /locus_tag="ECED1_0129"
FT   CDS_pept        147323..147859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="ECED1_0129"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 13808016, 339828,
FT                   6787390, 6801015, 12070315; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06352"
FT                   /db_xref="GOA:B7MNY7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06352.1"
FT                   YRHLPYIGKVILLDE"
FT   gene            complement(147900..148562)
FT                   /gene="can"
FT                   /locus_tag="ECED1_0130"
FT   CDS_pept        complement(147900..148562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="can"
FT                   /locus_tag="ECED1_0130"
FT                   /product="carbonic anhydrase"
FT                   /function="15.5 : Detoxification"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12784642; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06353"
FT                   /db_xref="GOA:B7MNY8"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06353.1"
FT   gene            148671..149597
FT                   /gene="yadG"
FT                   /locus_tag="ECED1_0131"
FT   CDS_pept        148671..149597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="ECED1_0131"
FT                   /product="putative transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06354"
FT                   /db_xref="GOA:B7MNY9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06354.1"
FT   gene            149594..150364
FT                   /gene="yadH"
FT                   /locus_tag="ECED1_0133"
FT   CDS_pept        149594..150364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="ECED1_0133"
FT                   /product="putative transporter subunit: membrane component
FT                   of ABC superfamily"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10474187; Product type pt : putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06355"
FT                   /db_xref="GOA:B7MNZ0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06355.1"
FT   gene            150469..150909
FT                   /gene="yadI"
FT                   /locus_tag="ECED1_0134"
FT   CDS_pept        150469..150909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="ECED1_0134"
FT                   /product="putative PTS Enzyme IIA"
FT                   /function="13.2 : PTS"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06356"
FT                   /db_xref="GOA:B7MNZ1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06356.1"
FT   gene            150973..152202
FT                   /gene="yadE"
FT                   /locus_tag="ECED1_0135"
FT   CDS_pept        150973..152202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="ECED1_0135"
FT                   /product="putative exported polysaccharide deacetylase"
FT                   /function="16.1 : Circulate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06357"
FT                   /db_xref="GOA:B7MNZ2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06357.1"
FT                   SRLVSNQPQG"
FT   gene            complement(152206..152586)
FT                   /gene="panD"
FT                   /locus_tag="ECED1_0136"
FT   CDS_pept        complement(152206..152586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="ECED1_0136"
FT                   /product="aspartate 1-decarboxylase"
FT                   /function="4.7 : Pantothenate and coenzyme A"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 7037743, 9169598,
FT                   9546220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06358"
FT                   /db_xref="GOA:B7MNZ3"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06358.1"
FT   gene            152860..153840
FT                   /gene="yadD"
FT                   /locus_tag="ECED1_0137"
FT   CDS_pept        152860..153840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadD"
FT                   /locus_tag="ECED1_0137"
FT                   /product="putative transposase"
FT                   /function="16.1 : Circulate"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11319082; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06359"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06359.1"
FT   gene            complement(153922..154773)
FT                   /gene="panC"
FT                   /locus_tag="ECED1_0138"
FT   CDS_pept        complement(153922..154773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="ECED1_0138"
FT                   /product="pantothenate synthetase"
FT                   /function="4.7 : Pantothenate and coenzyme A"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 7037743, 12999714;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06360"
FT                   /db_xref="GOA:B7MNZ5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06360.1"
FT                   LA"
FT   gene            complement(154785..155579)
FT                   /gene="panB"
FT                   /locus_tag="ECED1_0139"
FT   CDS_pept        complement(154785..155579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="ECED1_0139"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /function="4.7 : Pantothenate and coenzyme A"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12837791, 7037743,
FT                   93209959, 9298646; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06361"
FT                   /db_xref="GOA:B7MNZ6"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MNZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06361.1"
FT   gene            complement(155691..156716)
FT                   /pseudo
FT                   /locus_tag="ECED1_0140"
FT   CDS_pept        complement(155691..156716)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0140"
FT                   /product="fragment of putative exported protein yadC,
FT                   putative fimbrial-like adhesin protein (partial)"
FT                   /note="Evidence 7 : Gene remnant; Product type ps :
FT                   putative structure"
FT                   /db_xref="PSEUDO:CAR06362.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(157002..157598)
FT                   /locus_tag="ECED1_0141"
FT   CDS_pept        complement(157002..157598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0141"
FT                   /product="protein yadK, putative fimbrial-like adhesin"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06363"
FT                   /db_xref="GOA:B7MNZ8"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06363.1"
FT   gene            complement(157625..158239)
FT                   /locus_tag="ECED1_0142"
FT   CDS_pept        complement(157625..158239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0142"
FT                   /product="putative fimbrial-like adhesin protein YadL"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06364"
FT                   /db_xref="GOA:B7MNZ9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06364.1"
FT   gene            complement(158245..158811)
FT                   /locus_tag="ECED1_0143"
FT   CDS_pept        complement(158245..158811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0143"
FT                   /product="putative fimbrial-like adhesin protein YadM"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06365"
FT                   /db_xref="GOA:B7MP00"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06365.1"
FT   gene            complement(158828..161416)
FT                   /gene="htrE"
FT                   /locus_tag="ECED1_0144"
FT   CDS_pept        complement(158828..161416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="ECED1_0144"
FT                   /product="outer membrane usher protein"
FT                   /function="16.8 : Protect"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 93352405, 8102362, 15561151; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06366"
FT                   /db_xref="GOA:B7MP01"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06366.1"
FT   gene            complement(161451..162191)
FT                   /gene="ecpD"
FT                   /locus_tag="ECED1_0145"
FT   CDS_pept        complement(161451..162191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpD"
FT                   /locus_tag="ECED1_0145"
FT                   /product="periplasmic pilin chaperone"
FT                   /function="16.5 : Explore"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 93352405, 8102362, 15561151; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06367"
FT                   /db_xref="GOA:B7MP02"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06367.1"
FT   gene            complement(162300..162914)
FT                   /gene="yadN"
FT                   /locus_tag="ECED1_0146"
FT   CDS_pept        complement(162300..162914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="ECED1_0146"
FT                   /product="putative fimbrial-like adhesin exported protein"
FT                   /function="16.3 : Control"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06368"
FT                   /db_xref="GOA:B7MP03"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06368.1"
FT   gene            complement(163254..163733)
FT                   /gene="folK"
FT                   /locus_tag="ECED1_0147"
FT   CDS_pept        complement(163254..163733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="ECED1_0147"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihyropteridine
FT                   pyrophosphokinase"
FT                   /function="4.2 : Folic acid"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92041593, 92394901,
FT                   10378268, 10452528, 2537812; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06369"
FT                   /db_xref="GOA:B7MP04"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06369.1"
FT   gene            complement(163730..165148)
FT                   /gene="pcnB"
FT                   /locus_tag="ECED1_0148"
FT   CDS_pept        complement(163730..165148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="ECED1_0148"
FT                   /product="poly(A) polymerase I"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10594833, 20300915,
FT                   20504447, 21316493, 22195892, 7533264, 93066242, 93342068,
FT                   94128084, 95020645, 98445341, 99291044, 1691435, 2537812;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06370"
FT                   /db_xref="GOA:B7MP05"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06370.1"
FT                   RRPRKRAPRREGTA"
FT   gene            complement(165187..166113)
FT                   /gene="yadB"
FT                   /locus_tag="ECED1_0149"
FT   CDS_pept        complement(165187..166113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadB"
FT                   /locus_tag="ECED1_0149"
FT                   /product="glutamyl-Q tRNA(Asp) synthetase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number="6.1.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15003446, 15150343,
FT                   2180916; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06371"
FT                   /db_xref="GOA:B7MP06"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06371.1"
FT   gene            complement(166150..166605)
FT                   /gene="dksA"
FT                   /locus_tag="ECED1_0150"
FT   CDS_pept        complement(166150..166605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="ECED1_0150"
FT                   /product="DNA-binding transcriptional regulator of rRNA
FT                   transcription, DnaK suppressor protein"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15294157, 90202727,
FT                   2013578, 9298646, 9600841; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06372"
FT                   /db_xref="GOA:B7MP07"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06372.1"
FT   gene            complement(166783..167487)
FT                   /gene="sfsA"
FT                   /locus_tag="ECED1_0151"
FT   CDS_pept        complement(166783..167487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="ECED1_0151"
FT                   /product="putative regulator"
FT                   /function="16.6 : Maintain"
FT                   /function="16.3 : Control"
FT                   /function="6 : Energy metabolism"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 91193225, 2180916, 11272834; Product
FT                   type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06373"
FT                   /db_xref="GOA:B7MP08"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06373.1"
FT                   GMALKKSLPVTL"
FT   gene            complement(167502..168032)
FT                   /gene="ligT"
FT                   /locus_tag="ECED1_0152"
FT   CDS_pept        complement(167502..168032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="ECED1_0152"
FT                   /product="2'-5' RNA ligase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number="6.5.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 97094878; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06374"
FT                   /db_xref="GOA:B7MP09"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06374.1"
FT                   TRYTPLKRWALTQ"
FT   gene            168106..170535
FT                   /gene="hrpB"
FT                   /locus_tag="ECED1_0153"
FT   CDS_pept        168106..170535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="ECED1_0153"
FT                   /product="ATP-dependent (RNA) helicase"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 95206938; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06375"
FT                   /db_xref="GOA:B7MP10"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06375.1"
FT   gene            170629..173163
FT                   /gene="mrcB"
FT                   /locus_tag="ECED1_0154"
FT   CDS_pept        170629..173163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="ECED1_0154"
FT                   /product="fused glycosyl transferase ; transpeptidase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="15.1 : Cell division"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /EC_number=""
FT                   /EC_number="3.4.-.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 20032350, 3882429,
FT                   3906031, 99406903; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06376"
FT                   /db_xref="GOA:B7MP11"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06376.1"
FT   gene            173383..175641
FT                   /gene="fhuA"
FT                   /locus_tag="ECED1_0156"
FT   CDS_pept        173383..175641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="ECED1_0156"
FT                   /product="ferrichrome outer membrane transporter"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="7.6 : Porins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12383253, 12896986,
FT                   12944258, 92276324, 93139053, 93345445, 9613584, 99406910,
FT                   10850805, 2823072, 3079747, 7515827, 8617231, 9856937,
FT                   9865695; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06377"
FT                   /db_xref="GOA:B7MP12"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06377.1"
FT   gene            175692..176489
FT                   /gene="fhuC"
FT                   /locus_tag="ECED1_0157"
FT   CDS_pept        175692..176489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="ECED1_0157"
FT                   /product="iron-hydroxamate transporter subunit ;
FT                   ATP-binding component of ABC superfamily"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89364703, 91307893,
FT                   92202160, 9613584, 2823072, 3301821; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06378"
FT                   /db_xref="GOA:B7MP13"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06378.1"
FT   gene            176489..177379
FT                   /gene="fhuD"
FT                   /locus_tag="ECED1_0158"
FT   CDS_pept        176489..177379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ECED1_0158"
FT                   /product="iron-hydroxamate transporter subunit ;
FT                   periplasmic-binding component of ABC superfamily"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89364703, 91072323,
FT                   91307893, 9613584, 10742172, 2823072, 3301821; Product type
FT                   t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06379"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06379.1"
FT                   MHFVRILDNAIGGKA"
FT   gene            177376..179358
FT                   /gene="fhuB"
FT                   /locus_tag="ECED1_0159"
FT   CDS_pept        177376..179358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="ECED1_0159"
FT                   /product="fused iron-hydroxamate transporter subunits of
FT                   ABC superfamily: membrane components"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89364703, 91307893,
FT                   92202160, 9613584, 2823072, 3020380; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06380"
FT                   /db_xref="GOA:B7MP15"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06380.1"
FT   gene            complement(179393..180673)
FT                   /gene="hemL"
FT                   /locus_tag="ECED1_0160"
FT   CDS_pept        complement(179393..180673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="ECED1_0160"
FT                   /product="glutamate-1-semialdehyde aminotransferase
FT                   (aminomutase)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91155920, 91258321,
FT                   92353044; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06381"
FT                   /db_xref="GOA:B7MP16"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06381.1"
FT   gene            180898..182319
FT                   /gene="clcA"
FT                   /locus_tag="ECED1_0161"
FT   CDS_pept        180898..182319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clcA"
FT                   /locus_tag="ECED1_0161"
FT                   /product="chloride channel, voltage-gated"
FT                   /function="7.2 : Anions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10539975, 10648805,
FT                   11196649, 11796999, 12384697; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06382"
FT                   /db_xref="GOA:B7MP17"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06382.1"
FT                   EQLARSKAASASENT"
FT   gene            182401..182745
FT                   /gene="yadR"
FT                   /locus_tag="ECED1_0163"
FT   CDS_pept        182401..182745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="ECED1_0163"
FT                   /product="putative chaperone involved in Fe-S cluster
FT                   assembly and activation; hesB-like"
FT                   /function="16.6 : Maintain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06383"
FT                   /db_xref="GOA:B7MP18"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06383.1"
FT                   TCGCGSSFSI"
FT   gene            complement(182792..183415)
FT                   /gene="yadS"
FT                   /locus_tag="ECED1_0164"
FT   CDS_pept        complement(182792..183415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="ECED1_0164"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pm : putative membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06384"
FT                   /db_xref="GOA:B7MP19"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06384.1"
FT   gene            complement(183453..184253)
FT                   /gene="btuF"
FT                   /locus_tag="ECED1_0165"
FT   CDS_pept        complement(183453..184253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="ECED1_0165"
FT                   /product="vitamin B12 transporter subunit:
FT                   periplasmic-binding component of ABC superfamily"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11790740; Product type t
FT                   : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06385"
FT                   /db_xref="GOA:B7MP20"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06385.1"
FT   gene            complement(184246..184944)
FT                   /gene="pfs"
FT                   /locus_tag="ECED1_0166"
FT   CDS_pept        complement(184246..184944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="ECED1_0166"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9524204, 98417441,
FT                   2157212; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06386"
FT                   /db_xref="GOA:B7MP21"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06386.1"
FT                   ESLVQKLAHG"
FT   gene            185028..186545
FT                   /gene="dgt"
FT                   /locus_tag="ECED1_0167"
FT   CDS_pept        185028..186545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="ECED1_0167"
FT                   /product="deoxyguanosine triphosphate triphosphohydrolase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90136066, 90207273,
FT                   90323597, 13563461, 2826481; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06387"
FT                   /db_xref="GOA:B7MP22"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06387.1"
FT   gene            186675..188099
FT                   /gene="degP"
FT                   /locus_tag="ECED1_0168"
FT   CDS_pept        186675..188099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="ECED1_0168"
FT                   /product="serine endoprotease (protease Do),
FT                   membrane-associated"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12057188, 20069954,
FT                   90202693, 91222240, 99444919, 12878036, 2157212, 2165018,
FT                   3057437, 9600841, 2180903; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06388"
FT                   /db_xref="GOA:B7MP23"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06388.1"
FT                   ALNIQRGDSTIYLLMQ"
FT   gene            188254..189411
FT                   /gene="cdaR"
FT                   /locus_tag="ECED1_0169"
FT   CDS_pept        188254..189411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="ECED1_0169"
FT                   /product="DNA-binding transcriptional activator"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 20225875, 10762278;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06389"
FT                   /db_xref="GOA:B7MP24"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06389.1"
FT   gene            complement(189465..189851)
FT                   /gene="yaeH"
FT                   /locus_tag="ECED1_0170"
FT   CDS_pept        complement(189465..189851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="ECED1_0170"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06390"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06390.1"
FT   gene            complement(190163..190987)
FT                   /gene="dapD"
FT                   /locus_tag="ECED1_0171"
FT   CDS_pept        complement(190163..190987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="ECED1_0171"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /function="1.2 : Aspartate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 71136282, 85054973,
FT                   8412694, 9298646; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06391"
FT                   /db_xref="GOA:B7MP26"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06391.1"
FT   gene            complement(191018..193690)
FT                   /gene="glnD"
FT                   /locus_tag="ECED1_0172"
FT   CDS_pept        complement(191018..193690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="ECED1_0172"
FT                   /product="uridylyltransferase"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /function="5.7 : Nitrogen metabolism"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92325045, 9737855,
FT                   8412694; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06392"
FT                   /db_xref="GOA:B7MP27"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06392.1"
FT   gene            complement(193752..194546)
FT                   /gene="map"
FT                   /locus_tag="ECED1_0173"
FT   CDS_pept        complement(193752..194546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="ECED1_0173"
FT                   /product="methionine aminopeptidase"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 87109068, 10387007,
FT                   10555963, 8471602; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06393"
FT                   /db_xref="GOA:B7MP28"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06393.1"
FT   gene            194752..194887
FT                   /locus_tag="ECED1_misc_RNA_6"
FT   misc_RNA        194752..194887
FT                   /locus_tag="ECED1_misc_RNA_6"
FT                   /product="SraH"
FT   gene            194914..195639
FT                   /gene="rpsB"
FT                   /locus_tag="ECED1_0175"
FT   CDS_pept        194914..195639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="ECED1_0175"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 6272196, 10094780,
FT                   12244297, 12809609, 1575737, 7023985, 7556101, 9298646,
FT                   9716382; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06394"
FT                   /db_xref="GOA:B7MP29"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06394.1"
FT   gene            195774..196625
FT                   /gene="tsf"
FT                   /locus_tag="ECED1_0176"
FT   CDS_pept        195774..196625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="ECED1_0176"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 6272196, 93054499,
FT                   1447125, 8596629, 9298646, 9468511, 9600841; Product type f
FT                   : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06395"
FT                   /db_xref="GOA:B7MP30"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06395.1"
FT                   QS"
FT   gene            196772..197497
FT                   /gene="pyrH"
FT                   /locus_tag="ECED1_0177"
FT   CDS_pept        196772..197497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="ECED1_0177"
FT                   /product="uridylate kinase"
FT                   /function="2.4 : Pyrimidine ribonucleotide biosynthesis"
FT                   /EC_number="2.7.4.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 169229, 89125613,
FT                   94247361, 9677289, 1447125, 7711027, 9457846; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06396"
FT                   /db_xref="GOA:B7MP31"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06396.1"
FT   gene            197647..198204
FT                   /gene="frr"
FT                   /locus_tag="ECED1_0178"
FT   CDS_pept        197647..198204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="ECED1_0178"
FT                   /product="ribosome recycling factor"
FT                   /function="10.4 : Translation factors"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90062117, 91317739,
FT                   1447125, 8183897, 9298646; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06397"
FT                   /db_xref="GOA:B7MP32"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06397.1"
FT   gene            198296..199492
FT                   /gene="dxr"
FT                   /locus_tag="ECED1_0179"
FT   CDS_pept        198296..199492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="ECED1_0179"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /function="4 : Biosynthesis of cofactors, prosthetic
FT                   groups, and carriers"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 98374274, 99290045,
FT                   10631325, 10787409, 1447125, 7567469; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06398"
FT                   /db_xref="GOA:B7MP33"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06398.1"
FT   gene            199678..200439
FT                   /gene="ispU"
FT                   /locus_tag="ECED1_0180"
FT   CDS_pept        199678..200439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispU"
FT                   /locus_tag="ECED1_0180"
FT                   /product="undecaprenyl pyrophosphate synthase"
FT                   /function="4 : Biosynthesis of cofactors, prosthetic
FT                   groups, and carriers"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10217761, 12756244,
FT                   9882662; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06399"
FT                   /db_xref="GOA:B7MP34"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06399.1"
FT   gene            200452..201309
FT                   /gene="cdsA"
FT                   /locus_tag="ECED1_0181"
FT   CDS_pept        200452..201309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="ECED1_0181"
FT                   /product="CDP-diglyceride synthase"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 86008268, 2995359;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06400"
FT                   /db_xref="GOA:B7MP35"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06400.1"
FT                   FRTL"
FT   gene            201321..202673
FT                   /gene="yaeL"
FT                   /locus_tag="ECED1_0182"
FT   CDS_pept        201321..202673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeL"
FT                   /locus_tag="ECED1_0182"
FT                   /product="zinc metallopeptidase"
FT                   /function="12.3 : Protein interactions"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="3.4.24.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11750129, 14633997,
FT                   15066031, 21547928, 15496982, 11274153, 2995358, 7984428;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06401"
FT                   /db_xref="GOA:B7MP36"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06401.1"
FT   gene            202703..205135
FT                   /gene="yaeT"
FT                   /locus_tag="ECED1_0183"
FT   CDS_pept        202703..205135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="ECED1_0183"
FT                   /product="outer membrane protein assembly factor"
FT                   /function="16.13 : Shape"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15851030, 16861298,
FT                   11274153, 9298646; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06402"
FT                   /db_xref="GOA:B7MP37"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06402.1"
FT   gene            205257..205742
FT                   /gene="hlpA"
FT                   /locus_tag="ECED1_0184"
FT   CDS_pept        205257..205742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlpA"
FT                   /locus_tag="ECED1_0184"
FT                   /product="periplasmic chaperone"
FT                   /function="8.4 : Chromosome-associated proteins"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15101556, 90201355,
FT                   97032152, 99386928, 1987124, 2843433, 9298646, 2167239;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06403"
FT                   /db_xref="GOA:B7MP38"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06403.1"
FT   gene            205746..206771
FT                   /gene="lpxD"
FT                   /locus_tag="ECED1_0185"
FT   CDS_pept        205746..206771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="ECED1_0185"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 93185653, 93374989,
FT                   94179097, 1429432, 1602961, 1987124; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06404"
FT                   /db_xref="GOA:B7MP39"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06404.1"
FT                   D"
FT   gene            206876..207331
FT                   /gene="fabZ"
FT                   /locus_tag="ECED1_0186"
FT   CDS_pept        206876..207331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="ECED1_0186"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydratase"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number="4.2.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 789345, 8910376; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06405"
FT                   /db_xref="GOA:B7MP40"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06405.1"
FT   gene            207335..208123
FT                   /gene="lpxA"
FT                   /locus_tag="ECED1_0187"
FT   CDS_pept        207335..208123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="ECED1_0187"
FT                   /product="UDP-N-acetylglucosamine acetyltransferase"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 88058790, 89008361,
FT                   90202920, 3277952, 7481807; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06406"
FT                   /db_xref="GOA:B7MP41"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06406.1"
FT   gene            208123..209271
FT                   /gene="lpxB"
FT                   /locus_tag="ECED1_0188"
FT   CDS_pept        208123..209271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="ECED1_0188"
FT                   /product="tetraacyldisaccharide-1-P synthase"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 88058790, 89008361,
FT                   3277952; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06407"
FT                   /db_xref="GOA:B7MP42"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06407.1"
FT   gene            209268..209864
FT                   /gene="rnhB"
FT                   /locus_tag="ECED1_0189"
FT   CDS_pept        209268..209864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="ECED1_0189"
FT                   /product="ribonuclease HII, degrades RNA of DNA-RNA
FT                   hybrids"
FT                   /function="9.1 : Degradation of RNA"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 20250850, 91046040,
FT                   3316192, 9888800; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06408"
FT                   /db_xref="GOA:B7MP43"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06408.1"
FT   gene            209901..213383
FT                   /gene="dnaE"
FT                   /locus_tag="ECED1_0190"
FT   CDS_pept        209901..213383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="ECED1_0190"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91250451, 92147649,
FT                   92156151, 1575709, 3316192, 7678242, 8375647; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06409"
FT                   /db_xref="GOA:B7MP44"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06409.1"
FT   gene            213396..214355
FT                   /gene="accA"
FT                   /locus_tag="ECED1_0191"
FT   CDS_pept        213396..214355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="ECED1_0191"
FT                   /product="acetyl-CoA carboxylase, carboxytransferase, alpha
FT                   subunit"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11157970, 92380982,
FT                   93123150, 9668099, 9226257, 9298646; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06410"
FT                   /db_xref="GOA:B7MP45"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06410.1"
FT   gene            214453..216594
FT                   /gene="ldcC"
FT                   /locus_tag="ECED1_0192"
FT   CDS_pept        214453..216594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="ECED1_0192"
FT                   /product="lysine decarboxylase 2, constitutive"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 97480927, 98195734,
FT                   98357244, 9226257, 9723924; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06411"
FT                   /db_xref="GOA:B7MP46"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06411.1"
FT   gene            216651..217040
FT                   /gene="yaeR"
FT                   /locus_tag="ECED1_0193"
FT   CDS_pept        216651..217040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="ECED1_0193"
FT                   /product="putative S-C lyase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06412"
FT                   /db_xref="GOA:B7MP47"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06412.1"
FT   gene            217105..218418
FT                   /gene="tilS"
FT                   /locus_tag="ECED1_0194"
FT   CDS_pept        217105..218418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="ECED1_0194"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 14527414; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06413"
FT                   /db_xref="GOA:B7MP48"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06413.1"
FT   gene            complement(218452..218706)
FT                   /gene="rof"
FT                   /locus_tag="ECED1_0195"
FT   CDS_pept        complement(218452..218706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="ECED1_0195"
FT                   /product="modulator of Rho-dependent transcription
FT                   termination"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9723924; Product type f
FT                   : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06414"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06414.1"
FT   gene            complement(218699..218899)
FT                   /gene="yaeP"
FT                   /locus_tag="ECED1_0196"
FT   CDS_pept        complement(218699..218899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="ECED1_0196"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06415"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06415.1"
FT   gene            219065..219610
FT                   /gene="yaeQ"
FT                   /locus_tag="ECED1_0197"
FT   CDS_pept        219065..219610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="ECED1_0197"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06416"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06416.1"
FT                   SDDKNNLEVNLTVWQQPS"
FT   gene            219607..220029
FT                   /gene="yaeJ"
FT                   /locus_tag="ECED1_0198"
FT   CDS_pept        219607..220029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="ECED1_0198"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06417"
FT                   /db_xref="GOA:B7MP52"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06417.1"
FT   gene            220043..220753
FT                   /gene="nlpE"
FT                   /locus_tag="ECED1_0199"
FT   CDS_pept        220043..220753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpE"
FT                   /locus_tag="ECED1_0199"
FT                   /product="lipoprotein involved with copper homeostasis and
FT                   adhesion"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11830644, 95362641,
FT                   95362642; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06418"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06418.1"
FT                   GKFYPNQDCSSLGL"
FT   gene            complement(220909..221733)
FT                   /gene="yaeF"
FT                   /locus_tag="ECED1_0200"
FT   CDS_pept        complement(220909..221733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeF"
FT                   /locus_tag="ECED1_0200"
FT                   /product="putative lipoprotein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06419"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06419.1"
FT   gene            complement(221786..223504)
FT                   /gene="proS"
FT                   /locus_tag="ECED1_0201"
FT   CDS_pept        complement(221786..223504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="ECED1_0201"
FT                   /product="prolyl-tRNA synthetase"
FT                   /function="10.1 : tRNA aminoacylation"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91305088, 1688424,
FT                   2203971, 9298646; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06420"
FT                   /db_xref="GOA:B7MP55"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06420.1"
FT   gene            complement(223615..224322)
FT                   /gene="yaeB"
FT                   /locus_tag="ECED1_0202"
FT   CDS_pept        complement(223615..224322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeB"
FT                   /locus_tag="ECED1_0202"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06421"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06421.1"
FT                   TDAGFEVFALEPR"
FT   gene            complement(224319..224723)
FT                   /gene="rcsF"
FT                   /locus_tag="ECED1_0203"
FT   CDS_pept        complement(224319..224723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="ECED1_0203"
FT                   /product="conserved hypothetical protein; putative outer
FT                   membrane protein, signal"
FT                   /function="12 : Regulatory functions"
FT                   /function="13.1 : Two-component systems"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 93094132; Product type pr :
FT                   putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06422"
FT                   /db_xref="GOA:B7MP57"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06422.1"
FT   gene            complement(224841..225656)
FT                   /gene="metQ"
FT                   /locus_tag="ECED1_0204"
FT   CDS_pept        complement(224841..225656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="ECED1_0204"
FT                   /product="DL-methionine transporter subunit ;
FT                   periplasmic-binding component of ABC superfamily"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12169620, 12218041,
FT                   12819857, 1459951; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06423"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06423.1"
FT   gene            complement(225696..226349)
FT                   /gene="metI"
FT                   /locus_tag="ECED1_0205"
FT   CDS_pept        complement(225696..226349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="ECED1_0205"
FT                   /product="DL-methionine transporter subunit ; membrane
FT                   component protein of ABC superfamily"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12169620, 12218041,
FT                   12819857; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06424"
FT                   /db_xref="GOA:B7MP59"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06424.1"
FT   gene            complement(226342..227373)
FT                   /gene="metN"
FT                   /locus_tag="ECED1_0206"
FT   CDS_pept        complement(226342..227373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="ECED1_0206"
FT                   /product="DL-methionine transporter subunit ; ATP-binding
FT                   component of ABC superfamily"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12169620, 12218041,
FT                   94124004; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06425"
FT                   /db_xref="GOA:B7MP60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06425.1"
FT                   GYV"
FT   gene            227561..228133
FT                   /gene="gmhB"
FT                   /locus_tag="ECED1_0207"
FT   CDS_pept        227561..228133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="ECED1_0207"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11751812; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06426"
FT                   /db_xref="GOA:B7MP61"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06426.1"
FT   gene            228499..230040
FT                   /locus_tag="ECED1_16S_3"
FT   rRNA            228499..230040
FT                   /locus_tag="ECED1_16S_3"
FT                   /product="ribosomal RNA 16S"
FT   gene            230109..230185
FT                   /locus_tag="ECED1_tRNA1"
FT   tRNA            230109..230185
FT                   /locus_tag="ECED1_tRNA1"
FT                   /product="tRNA-Ile"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            230228..230303
FT                   /locus_tag="ECED1_tRNA2"
FT   tRNA            230228..230303
FT                   /locus_tag="ECED1_tRNA2"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            230487..233390
FT                   /locus_tag="ECED1_23S_3"
FT   rRNA            230487..233390
FT                   /locus_tag="ECED1_23S_3"
FT                   /product="ribosomal RNA 23S"
FT   gene            233483..233602
FT                   /locus_tag="ECED1_5S_4"
FT   rRNA            233483..233602
FT                   /locus_tag="ECED1_5S_4"
FT                   /product="ribosomal RNA 5S"
FT   gene            233654..233730
FT                   /locus_tag="ECED1_tRNA3"
FT   tRNA            233654..233730
FT                   /locus_tag="ECED1_tRNA3"
FT                   /product="tRNA-Asp"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            233893..234696
FT                   /gene="dkgB"
FT                   /locus_tag="ECED1_0212"
FT   CDS_pept        233893..234696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="ECED1_0212"
FT                   /product="2,5-diketo-D-gluconate reductase B"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 99357626, 6255418;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06428"
FT                   /db_xref="GOA:B7MP62"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06428.1"
FT   gene            complement(234693..235607)
FT                   /gene="yafC"
FT                   /locus_tag="ECED1_0213"
FT   CDS_pept        complement(234693..235607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="ECED1_0213"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06429"
FT                   /db_xref="GOA:B7MP63"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06429.1"
FT   gene            235848..236648
FT                   /gene="yafD"
FT                   /locus_tag="ECED1_0214"
FT   CDS_pept        235848..236648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="ECED1_0214"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 1663890"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06430"
FT                   /db_xref="GOA:B7MP64"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06430.1"
FT   gene            236726..237496
FT                   /gene="yafE"
FT                   /locus_tag="ECED1_0215"
FT   CDS_pept        236726..237496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="ECED1_0215"
FT                   /product="putative S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /function="16.6 : Maintain"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /function="4.1 : Biotin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06431"
FT                   /db_xref="GOA:B7MQ19"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06431.1"
FT   gene            complement(237543..238901)
FT                   /gene="mltD"
FT                   /locus_tag="ECED1_0216"
FT   CDS_pept        complement(237543..238901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="ECED1_0216"
FT                   /product="membrane-bound lytic murein transglycosylase D"
FT                   /function="9 : Transcription"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10843862, 20304905,
FT                   92137666, 8203016; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06432"
FT                   /db_xref="GOA:B7MQ20"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06432.1"
FT   gene            complement(238973..239728)
FT                   /gene="gloB"
FT                   /locus_tag="ECED1_0217"
FT   CDS_pept        complement(238973..239728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="ECED1_0217"
FT                   /product="putative hydroxyacylglutathione hydrolase"
FT                   /function="16.3 : Control"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06433"
FT                   /db_xref="GOA:B7MQ21"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQ21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06433.1"
FT   gene            239762..240484
FT                   /gene="yafS"
FT                   /locus_tag="ECED1_0218"
FT   CDS_pept        239762..240484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafS"
FT                   /locus_tag="ECED1_0218"
FT                   /product="putative S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06434"
FT                   /db_xref="GOA:B7MQ22"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06434.1"
FT                   PRIRQAVGATRQCRKPQA"
FT   gene            complement(240481..240948)
FT                   /gene="rnhA"
FT                   /locus_tag="ECED1_0219"
FT   CDS_pept        complement(240481..240948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="ECED1_0219"
FT                   /product="ribonuclease HI, degrades RNA of DNA-RNA hybrids"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="9.1 : Degradation of RNA"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91120714, 91326034,
FT                   94051590, 1311386, 1646006, 1698262, 2169648, 2171503,
FT                   3023634, 6296074, 6316347, 8381958, 8408067, 8527428,
FT                   8931125; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06435"
FT                   /db_xref="GOA:B7MQ23"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQ23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06435.1"
FT   gene            241013..241744
FT                   /gene="dnaQ"
FT                   /locus_tag="ECED1_0220"
FT   CDS_pept        241013..241744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ECED1_0220"
FT                   /product="DNA polymerase III epsilon subunit"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11772007, 91250451,
FT                   92011792, 92156151, 1575709, 3023634, 3540531, 6316347;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06436"
FT                   /db_xref="GOA:B7MQ24"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06436.1"
FT   gene            241877..241953
FT                   /locus_tag="ECED1_tRNA4"
FT   tRNA            241877..241953
FT                   /locus_tag="ECED1_tRNA4"
FT                   /product="tRNA-Asp"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            242282..243067
FT                   /gene="yafT"
FT                   /locus_tag="ECED1_0221"
FT   CDS_pept        242282..243067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafT"
FT                   /locus_tag="ECED1_0221"
FT                   /product="putative aminopeptidase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06437"
FT                   /db_xref="GOA:B7MQ25"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06437.1"
FT   gene            complement(243407..243907)
FT                   /locus_tag="ECED1_0222"
FT   CDS_pept        complement(243407..243907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0222"
FT                   /product="Conserved hypothetical protein Aec32 (Hcp-like)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06438"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06438.1"
FT                   RIF"
FT   gene            complement(243904..244023)
FT                   /pseudo
FT                   /locus_tag="ECED1_0223"
FT   CDS_pept        complement(243904..244023)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0223"
FT                   /product="fragment of Conserved hypothetical protein Aec31,
FT                   putative ImpA-related N-termina domain (part 3)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAR06439.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(244078..244617)
FT                   /pseudo
FT                   /locus_tag="ECED1_0225"
FT   CDS_pept        complement(244078..244617)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0225"
FT                   /product="fragment of Conserved hypothetical protein Aec31,
FT                   putative ImpA-related N-termina domain (part 2)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAR06440.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(244554..245345)
FT                   /pseudo
FT                   /locus_tag="ECED1_0226"
FT   CDS_pept        complement(244554..245345)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0226"
FT                   /product="fragment of Conserved hypothetical protein Aec31,
FT                   putative ImpA-related N-termina domain (part 1)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAR06441.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(245272..248799)
FT                   /locus_tag="ECED1_0227"
FT   CDS_pept        complement(245272..248799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0227"
FT                   /product="Conserved hypothetical protein Aec30, putative
FT                   macrophage toxin, IcmF-like protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06442"
FT                   /db_xref="GOA:B7MQ30"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06442.1"
FT                   LFRLPDTLY"
FT   gene            complement(248819..250327)
FT                   /locus_tag="ECED1_0228"
FT   CDS_pept        complement(248819..250327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0228"
FT                   /product="conserved hypothetical protein Aec29, contains a
FT                   TPR-like_helical domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06443"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06443.1"
FT   gene            complement(250266..251009)
FT                   /locus_tag="ECED1_0229"
FT   CDS_pept        complement(250266..251009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0229"
FT                   /product="conserved hypothetical protein Aec28"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06444"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06444.1"
FT   gene            complement(251006..253768)
FT                   /locus_tag="ECED1_0230"
FT   CDS_pept        complement(251006..253768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0230"
FT                   /product="putative ATP-dependent Clp proteinase Aec27
FT                   ATP-binding chain, with chaperone activity"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06445"
FT                   /db_xref="GOA:B7MQ33"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06445.1"
FT   gene            complement(253778..254542)
FT                   /locus_tag="ECED1_0231"
FT   CDS_pept        complement(253778..254542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0231"
FT                   /product="Putative membrane protein Aec26"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06446"
FT                   /db_xref="GOA:B7MQ34"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06446.1"
FT   gene            complement(254547..255893)
FT                   /locus_tag="ECED1_0232"
FT   CDS_pept        complement(254547..255893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0232"
FT                   /product="conserved hypothetical protein Aec25"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06447"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06447.1"
FT   gene            complement(255896..256420)
FT                   /locus_tag="ECED1_0233"
FT   CDS_pept        complement(255896..256420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0233"
FT                   /product="conserved hypothetical protein Aec24; putative
FT                   lipoprotein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06448"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06448.1"
FT                   ASAIEMKKEEN"
FT   gene            complement(256417..257709)
FT                   /locus_tag="ECED1_0234"
FT   CDS_pept        complement(256417..257709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0234"
FT                   /product="conserved hypothetical protein Aec23, contains
FT                   FHA domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06449"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06449.1"
FT   gene            complement(257714..258763)
FT                   /locus_tag="ECED1_0235"
FT   CDS_pept        complement(257714..258763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0235"
FT                   /product="conserved hypothetical protein Aec22"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06450"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06450.1"
FT                   PAITIRIRE"
FT   gene            complement(258727..260586)
FT                   /locus_tag="ECED1_0236"
FT   CDS_pept        complement(258727..260586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0236"
FT                   /product="conserved hypothetical protein Aec21"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06451"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06451.1"
FT   gene            complement(260574..260999)
FT                   /locus_tag="ECED1_0237"
FT   CDS_pept        complement(260574..260999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0237"
FT                   /product="conserved hypothetical protein Aec19"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06452"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06452.1"
FT   gene            complement(261004..262488)
FT                   /locus_tag="ECED1_0238"
FT   CDS_pept        complement(261004..262488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0238"
FT                   /product="conserved hypothetical protein Aec18"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06453"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06453.1"
FT   gene            complement(262511..263065)
FT                   /locus_tag="ECED1_0239"
FT   CDS_pept        complement(262511..263065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0239"
FT                   /product="conserved hypothetical protein Aec17"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06454"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06454.1"
FT   gene            263724..264242
FT                   /locus_tag="ECED1_0240"
FT   CDS_pept        263724..264242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0240"
FT                   /product="Conserved hypothetical protein Aec16 (Hcp-like)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06455"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06455.1"
FT                   DDWRAPLEA"
FT   gene            264463..266694
FT                   /locus_tag="ECED1_0241"
FT   CDS_pept        264463..266694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0241"
FT                   /product="conserved hypothetical protein, putative VgrG/E
FT                   protein associated with Rhs elements"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06456"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06456.1"
FT   gene            266707..267483
FT                   /locus_tag="ECED1_0242"
FT   CDS_pept        266707..267483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0242"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06457"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06457.1"
FT   gene            complement(267712..267909)
FT                   /locus_tag="ECED1_0243"
FT   CDS_pept        complement(267712..267909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0243"
FT                   /product="hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06458"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06458.1"
FT   gene            267911..268174
FT                   /locus_tag="ECED1_0244"
FT   CDS_pept        267911..268174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0244"
FT                   /product="hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06459"
FT                   /db_xref="InterPro:IPR021733"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06459.1"
FT   gene            268144..268464
FT                   /locus_tag="ECED1_0245"
FT   CDS_pept        268144..268464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0245"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06460"
FT                   /db_xref="InterPro:IPR021733"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06460.1"
FT                   SK"
FT   gene            268449..269003
FT                   /locus_tag="ECED1_0246"
FT   CDS_pept        268449..269003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0246"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06461"
FT                   /db_xref="InterPro:IPR021733"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06461.1"
FT   gene            268988..269530
FT                   /locus_tag="ECED1_0247"
FT   CDS_pept        268988..269530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0247"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06462"
FT                   /db_xref="InterPro:IPR021733"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06462.1"
FT                   PIKEPREMKEPATCPAK"
FT   gene            269515..271191
FT                   /locus_tag="ECED1_0248"
FT   CDS_pept        269515..271191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0248"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06463"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06463.1"
FT   gene            271467..271646
FT                   /locus_tag="ECED1_0249"
FT   CDS_pept        271467..271646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0249"
FT                   /product="putative H-repeat associated protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06464"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06464.1"
FT                   RYRGFGETHPYFLK"
FT   gene            271746..272147
FT                   /locus_tag="ECED1_0250"
FT   CDS_pept        271746..272147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0250"
FT                   /product="putative transposase; similar to Aec9"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06465"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06465.1"
FT   gene            272460..272963
FT                   /locus_tag="ECED1_0251"
FT   CDS_pept        272460..272963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0251"
FT                   /product="Conserved hypothetical protein Aec8; Rhs element
FT                   associated"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06466"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06466.1"
FT                   HIGQ"
FT   gene            273033..273545
FT                   /locus_tag="ECED1_0252"
FT   CDS_pept        273033..273545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0252"
FT                   /product="conserved hypothetical protein Aec7"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06467"
FT                   /db_xref="InterPro:IPR021300"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06467.1"
FT                   TEMEISQ"
FT   gene            complement(273816..274586)
FT                   /gene="yafV"
FT                   /locus_tag="ECED1_0253"
FT   CDS_pept        complement(273816..274586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="ECED1_0253"
FT                   /product="putative C-N hydrolase family amidase"
FT                   /function="16.6 : Maintain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8526497; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06468"
FT                   /db_xref="GOA:B7MQ56"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06468.1"
FT   gene            274740..275213
FT                   /gene="ivy"
FT                   /locus_tag="ECED1_0254"
FT   CDS_pept        274740..275213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ivy"
FT                   /locus_tag="ECED1_0254"
FT                   /product="inhibitor of vertebrate C-lysozyme"
FT                   /function="12.3 : Protein interactions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21264642, 11278658,
FT                   9868784, 8740179; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06469"
FT                   /db_xref="GOA:B7MQ57"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06469.1"
FT   gene            complement(275256..277700)
FT                   /gene="fadE"
FT                   /locus_tag="ECED1_0255"
FT   CDS_pept        complement(275256..277700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="ECED1_0255"
FT                   /product="acyl coenzyme A dehydrogenase"
FT                   /function="3.2 : Degradation"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12057976, 99140134;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06470"
FT                   /db_xref="GOA:B7MQ58"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06470.1"
FT                   AA"
FT   gene            277940..278518
FT                   /gene="lpcA"
FT                   /locus_tag="ECED1_0256"
FT   CDS_pept        277940..278518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpcA"
FT                   /locus_tag="ECED1_0256"
FT                   /product="D-sedoheptulose 7-phosphate isomerase"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="5.-.-.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11751812, 4926688,
FT                   785207; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06471"
FT                   /db_xref="GOA:B7MQ59"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQ59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06471.1"
FT   gene            278723..279490
FT                   /gene="yafJ"
FT                   /locus_tag="ECED1_0257"
FT   CDS_pept        278723..279490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="ECED1_0257"
FT                   /product="putative glutamine amidotransferases class-II"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06472"
FT                   /db_xref="GOA:B7MQ60"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06472.1"
FT   gene            complement(279461..280201)
FT                   /gene="yafK"
FT                   /locus_tag="ECED1_0258"
FT   CDS_pept        complement(279461..280201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="ECED1_0258"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06473"
FT                   /db_xref="GOA:B7MQ61"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06473.1"
FT   gene            280504..281262
FT                   /gene="yafL"
FT                   /locus_tag="ECED1_0260"
FT   CDS_pept        280504..281262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafL"
FT                   /locus_tag="ECED1_0260"
FT                   /product="putative exported hydrolase"
FT                   /function="16.8 : Protect"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06474"
FT                   /db_xref="GOA:B7MQ62"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06474.1"
FT   gene            281438..281596
FT                   /pseudo
FT                   /gene="yafM"
FT                   /locus_tag="ECED1_0261"
FT   CDS_pept        281438..281596
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafM"
FT                   /locus_tag="ECED1_0261"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   1)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAR06475.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            281603..281935
FT                   /pseudo
FT                   /gene="yafM"
FT                   /locus_tag="ECED1_0262"
FT   CDS_pept        281603..281935
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafM"
FT                   /locus_tag="ECED1_0262"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   2)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAR06476.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(282354..284093)
FT                   /gene="fhiA"
FT                   /locus_tag="ECED1_0263"
FT   CDS_pept        complement(282354..284093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhiA"
FT                   /locus_tag="ECED1_0263"
FT                   /product="flagellar system protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 7 : Gene remnant; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06477"
FT                   /db_xref="GOA:B7MQ65"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06477.1"
FT                   ALM"
FT   gene            283933..284823
FT                   /gene="mbhA"
FT                   /locus_tag="ECED1_0264"
FT   CDS_pept        283933..284823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhA"
FT                   /locus_tag="ECED1_0264"
FT                   /product="flagellar system protein"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15687208; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06478"
FT                   /db_xref="GOA:B7MQ66"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06478.1"
FT                   VQKLDKQQVLSQRAR"
FT   gene            284894..285949
FT                   /gene="dinB"
FT                   /locus_tag="ECED1_0265"
FT   CDS_pept        284894..285949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="ECED1_0265"
FT                   /product="DNA polymerase IV"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9391106, 99417968,
FT                   99429869, 11080171, 11463382, 11587937, 11595180, 11751576,
FT                   12045089, 12060704, 6771759, 7596361; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06479"
FT                   /db_xref="GOA:B7MQ67"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06479.1"
FT                   PQMERQLVLGL"
FT   gene            286001..286294
FT                   /gene="yafN"
FT                   /locus_tag="ECED1_0266"
FT   CDS_pept        286001..286294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafN"
FT                   /locus_tag="ECED1_0266"
FT                   /product="putative antitoxin of the YafO-YafN
FT                   toxin-antitoxin system"
FT                   /function="16.8 : Protect"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12813093, 14594833; Product type pf :
FT                   putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06480"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06480.1"
FT   gene            286297..286695
FT                   /gene="yafO"
FT                   /locus_tag="ECED1_0267"
FT   CDS_pept        286297..286695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafO"
FT                   /locus_tag="ECED1_0267"
FT                   /product="putative toxin of the YafO-YafN toxin-antitoxin
FT                   system"
FT                   /function="16.3 : Control"
FT                   /function="16.8 : Protect"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12813093, 14594833; Product type pf :
FT                   putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06481"
FT                   /db_xref="InterPro:IPR020353"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06481.1"
FT   gene            286705..287157
FT                   /gene="yafP"
FT                   /locus_tag="ECED1_0268"
FT   CDS_pept        286705..287157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="ECED1_0268"
FT                   /product="putative acyltransferase with acyl-CoA
FT                   N-acyltransferase domain"
FT                   /function="16.8 : Protect"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12813093; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06482"
FT                   /db_xref="GOA:B7MQ70"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06482.1"
FT   gene            287335..288486
FT                   /locus_tag="ECED1_0269"
FT   CDS_pept        287335..288486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0269"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06483"
FT                   /db_xref="GOA:B7MQ71"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR017510"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06483.1"
FT   gene            288597..289097
FT                   /gene="prfH"
FT                   /locus_tag="ECED1_0270"
FT   CDS_pept        288597..289097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="ECED1_0270"
FT                   /product="putative peptide chain release factor"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 93027135, 1408743; Product type pf :
FT                   putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06484"
FT                   /db_xref="GOA:B7MQ72"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06484.1"
FT                   IEG"
FT   gene            complement(289154..290611)
FT                   /gene="pepD"
FT                   /locus_tag="ECED1_0271"
FT   CDS_pept        complement(289154..290611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="ECED1_0271"
FT                   /product="aminoacyl-histidine dipeptidase (peptidase D)"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 1695895, 21101837,
FT                   88121730, 92204123, 2651887; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06485"
FT                   /db_xref="GOA:B7MQ73"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06485.1"
FT   gene            290872..291330
FT                   /gene="gpt"
FT                   /locus_tag="ECED1_0272"
FT   CDS_pept        290872..291330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="ECED1_0272"
FT                   /product="guanine-hypoxanthine phosphoribosyltransferase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 339828, 6787390,
FT                   6801015, 3540961, 6100966, 6324102, 6324103, 6396164,
FT                   6397401, 9100006, 9743633; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06486"
FT                   /db_xref="GOA:B7MQ74"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQ74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06486.1"
FT   gene            291422..292666
FT                   /gene="frsA"
FT                   /locus_tag="ECED1_0273"
FT   CDS_pept        291422..292666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frsA"
FT                   /locus_tag="ECED1_0273"
FT                   /product="hydrolase, binds to enzyme IIA(Glc)"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15169777, 6397401;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06487"
FT                   /db_xref="GOA:B7MQ75"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQ75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06487.1"
FT                   KGLQEITDWIEKRLC"
FT   gene            292724..293125
FT                   /gene="crl"
FT                   /locus_tag="ECED1_0274"
FT   CDS_pept        292724..293125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="ECED1_0274"
FT                   /product="DNA-binding transcriptional regulator"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 14978043, 89201357,
FT                   93023873, 6341601; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06488"
FT                   /db_xref="GOA:B7MQ76"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQ76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06488.1"
FT   gene            complement(293164..294219)
FT                   /gene="phoE"
FT                   /locus_tag="ECED1_0275"
FT   CDS_pept        complement(293164..294219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="ECED1_0275"
FT                   /product="outer membrane phosphoporin protein E"
FT                   /function="7.6 : Porins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89178658, 89380253,
FT                   92219258, 98090453, 1380671, 1848301, 1848682, 6089111,
FT                   6341601, 7679770; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06489"
FT                   /db_xref="GOA:B7MQ77"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06489.1"
FT                   DIVAVGMTYQF"
FT   gene            294508..295611
FT                   /gene="proB"
FT                   /locus_tag="ECED1_0276"
FT   CDS_pept        294508..295611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="ECED1_0276"
FT                   /product="gamma-glutamate kinase"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 6255065, 89291886,
FT                   6089111, 6341601; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06490"
FT                   /db_xref="GOA:B7MQ78"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQ78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06490.1"
FT   gene            295623..296876
FT                   /gene="proA"
FT                   /locus_tag="ECED1_0277"
FT   CDS_pept        295623..296876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="ECED1_0277"
FT                   /product="gamma-glutamylphosphate reductase"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 6255065, 89291886,
FT                   1282191, 6089111, 6337636; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06491"
FT                   /db_xref="GOA:B7MQ79"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQ79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06491.1"
FT                   EALTTYKWIGIGDYTIRA"
FT   gene            296991..297066
FT                   /locus_tag="ECED1_tRNA5"
FT   tRNA            296991..297066
FT                   /locus_tag="ECED1_tRNA5"
FT                   /product="tRNA-Thr"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            297377..298057
FT                   /locus_tag="ECED1_0278"
FT   CDS_pept        297377..298057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0278"
FT                   /product="hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06492"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06492.1"
FT                   LSHL"
FT   gene            complement(298059..299696)
FT                   /locus_tag="ECED1_0279"
FT   CDS_pept        complement(298059..299696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0279"
FT                   /product="hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06493"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06493.1"
FT   gene            300366..300614
FT                   /locus_tag="ECED1_0280"
FT   CDS_pept        300366..300614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0280"
FT                   /product="putative AlpA-family regulatory protein from
FT                   prophage"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06494"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06494.1"
FT   gene            300720..300947
FT                   /pseudo
FT                   /gene="yfjI"
FT                   /locus_tag="ECED1_0281"
FT   CDS_pept        300720..300947
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjI"
FT                   /locus_tag="ECED1_0281"
FT                   /product="fragment of conserved hypothetical protein;
FT                   CP4-57 prophage (part 1)"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 7 : Gene remnant; Product type h :
FT                   extrachromosomal origin"
FT                   /db_xref="PSEUDO:CAR06495.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            301178..301948
FT                   /pseudo
FT                   /gene="yfjI"
FT                   /locus_tag="ECED1_0282"
FT   CDS_pept        301178..301948
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjI"
FT                   /locus_tag="ECED1_0282"
FT                   /product="fragment of conserved hypothetical protein;
FT                   CP4-57 prophage (part 1)"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 7 : Gene remnant; Product type h :
FT                   extrachromosomal origin"
FT                   /db_xref="PSEUDO:CAR06496.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            301924..302628
FT                   /pseudo
FT                   /gene="yfjI"
FT                   /locus_tag="ECED1_0283"
FT   CDS_pept        301924..302628
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjI"
FT                   /locus_tag="ECED1_0283"
FT                   /product="fragment of conserved hypothetical protein;
FT                   CP4-57 prophage (part 3)"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 7 : Gene remnant; Product type h :
FT                   extrachromosomal origin"
FT                   /db_xref="PSEUDO:CAR06497.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            303545..304108
FT                   /locus_tag="ECED1_0284"
FT   CDS_pept        303545..304108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0284"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06498"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06498.1"
FT   gene            304239..306629
FT                   /locus_tag="ECED1_0285"
FT   CDS_pept        304239..306629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0285"
FT                   /product="putative helicase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06499"
FT                   /db_xref="GOA:B7MQ87"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06499.1"
FT   gene            complement(306647..307027)
FT                   /locus_tag="ECED1_0286"
FT   CDS_pept        complement(306647..307027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0286"
FT                   /product="hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06500"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06500.1"
FT   gene            306893..307204
FT                   /locus_tag="ECED1_0287"
FT   CDS_pept        306893..307204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0287"
FT                   /product="hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06501"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06501.1"
FT   gene            307301..308278
FT                   /locus_tag="ECED1_0288"
FT   CDS_pept        307301..308278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0288"
FT                   /product="conserved hypothetical protein, YhgA-like"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06502"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06502.1"
FT   gene            308471..308839
FT                   /pseudo
FT                   /locus_tag="ECED1_0289"
FT   CDS_pept        308471..308839
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0289"
FT                   /product="fragment of putative type I
FT                   restriction-modification system methyltransferase subunit;
FT                   (hsdM-like) (part 1)"
FT                   /function="8.2 : Restriction/modification"
FT                   /EC_number=""
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAR06503.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            308840..309061
FT                   /pseudo
FT                   /locus_tag="ECED1_0290"
FT   CDS_pept        308840..309061
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0290"
FT                   /product="putative type I restriction enzyme HindVIIP M
FT                   protein"
FT                   /function="8.2 : Restriction/modification"
FT                   /EC_number=""
FT                   /note="Evidence 7 : Gene remnant; PubMedId : 8939428,
FT                   11600708; Product type pe : putative enzyme"
FT                   /db_xref="PSEUDO:CAR06504.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            308985..309311
FT                   /pseudo
FT                   /locus_tag="ECED1_0291"
FT   CDS_pept        308985..309311
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0291"
FT                   /product="fragment of putative type I
FT                   restriction-modification system methyltransferase subunit;
FT                   (hsdM-like) (part 2)"
FT                   /function="8.2 : Restriction/modification"
FT                   /EC_number=""
FT                   /note="Evidence 7 : Gene remnant; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAR06505.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            309469..309777
FT                   /pseudo
FT                   /gene="yjeK"
FT                   /locus_tag="ECED1_0292"
FT   CDS_pept        309469..309777
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeK"
FT                   /locus_tag="ECED1_0292"
FT                   /product="fragment of putative lysine aminomutase
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAR06506.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            310012..310845
FT                   /locus_tag="ECED1_0293"
FT   CDS_pept        310012..310845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0293"
FT                   /product="putative transcriptional regulator"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06507"
FT                   /db_xref="GOA:B7MQ95"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06507.1"
FT   gene            311068..312057
FT                   /locus_tag="ECED1_0294"
FT   CDS_pept        311068..312057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0294"
FT                   /product="transposase, IS110 family"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06508"
FT                   /db_xref="GOA:B7MQ96"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06508.1"
FT   gene            312033..312131
FT                   /locus_tag="ECED1_0295"
FT   CDS_pept        312033..312131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0295"
FT                   /product="hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06509"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06509.1"
FT                   /translation="MPESNFVVTCALANKLARIAWALTTRQQTYEA"
FT   gene            complement(312475..313968)
FT                   /gene="xylE"
FT                   /locus_tag="ECED1_0296"
FT   CDS_pept        complement(312475..313968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylE"
FT                   /locus_tag="ECED1_0296"
FT                   /product="D-xylose-proton symporter (D-xylose transporter)"
FT                   /function="6 : Energy metabolism"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 2820984, 88007632,
FT                   91154204, 2836810, 3543693; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06510"
FT                   /db_xref="GOA:B7MQ98"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06510.1"
FT   gene            314379..315815
FT                   /locus_tag="ECED1_0297"
FT   CDS_pept        314379..315815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0297"
FT                   /product="Sugar (And other) transporter"
FT                   /function="6 : Energy metabolism"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06511"
FT                   /db_xref="GOA:B7MQ99"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQ99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06511.1"
FT   gene            complement(316227..316709)
FT                   /locus_tag="ECED1_0298"
FT   CDS_pept        complement(316227..316709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0298"
FT                   /product="transposase IS605 family, IS200 group"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06512"
FT                   /db_xref="GOA:B7MQA0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06512.1"
FT   gene            complement(316850..317659)
FT                   /locus_tag="ECED1_0299"
FT   CDS_pept        complement(316850..317659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0299"
FT                   /product="conserved hypothetical protein, putative inner
FT                   membrane protein (similar to myo-inositol catabolism iolB)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06513"
FT                   /db_xref="GOA:B7MQA1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06513.1"
FT   gene            complement(317684..319189)
FT                   /locus_tag="ECED1_0300"
FT   CDS_pept        complement(317684..319189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0300"
FT                   /product="Methylmalonate-semialdehyde dehydrogenase
FT                   [acylating](MMSDH)"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1339433; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06514"
FT                   /db_xref="GOA:B7MQA2"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06514.1"
FT   gene            319579..320448
FT                   /locus_tag="ECED1_0301"
FT   CDS_pept        319579..320448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0301"
FT                   /product="putative AraC-type DNA-binding domain-containing
FT                   protein"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06515"
FT                   /db_xref="GOA:B7MQA3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06515.1"
FT                   ANYLLFEY"
FT   gene            321325..322245
FT                   /gene="iolE"
FT                   /locus_tag="ECED1_0303"
FT   CDS_pept        321325..322245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolE"
FT                   /locus_tag="ECED1_0303"
FT                   /product="2-keto-myo-inositol dehydratase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="4.2.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14993306; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06516"
FT                   /db_xref="GOA:B7MQA4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR023952"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06516.1"
FT   gene            322246..323274
FT                   /gene="iolG"
FT                   /locus_tag="ECED1_0304"
FT   CDS_pept        322246..323274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolG"
FT                   /locus_tag="ECED1_0304"
FT                   /product="inositol 2-dehydrogenase"
FT                   /function="3.2 : Degradation"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1761221, 112095; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06517"
FT                   /db_xref="GOA:B7MQA5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR023794"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06517.1"
FT                   YK"
FT   gene            323372..324715
FT                   /gene="srfJ"
FT                   /locus_tag="ECED1_0305"
FT   CDS_pept        323372..324715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfJ"
FT                   /locus_tag="ECED1_0305"
FT                   /product="putative glucosylceramidase"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10844662; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06518"
FT                   /db_xref="GOA:B7MQA6"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06518.1"
FT   gene            324716..325549
FT                   /locus_tag="ECED1_0306"
FT   CDS_pept        324716..325549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0306"
FT                   /product="putative myo-inositol catabolism protein
FT                   (iolI-like)"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06519"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06519.1"
FT   gene            complement(325546..326712)
FT                   /locus_tag="ECED1_0307"
FT   CDS_pept        complement(325546..326712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0307"
FT                   /product="putative transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06520"
FT                   /db_xref="GOA:B7MQA8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037541"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06520.1"
FT   gene            complement(326915..327598)
FT                   /pseudo
FT                   /locus_tag="ECED1_0308"
FT   CDS_pept        complement(326915..327598)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0308"
FT                   /product="transposase IS91 (part 2)"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAR06521.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(327683..328102)
FT                   /pseudo
FT                   /locus_tag="ECED1_0309"
FT   CDS_pept        complement(327683..328102)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0309"
FT                   /product="transposase IS91 (part 1)"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="PSEUDO:CAR06522.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(328106..328453)
FT                   /locus_tag="ECED1_0310"
FT   CDS_pept        complement(328106..328453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0310"
FT                   /product="conserved hypothetical protein, putative IS91
FT                   orf2"
FT                   /function="17.1 : Plasmid functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 1310503, 1321417"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06523"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06523.1"
FT                   PLCGTSHLPPA"
FT   gene            complement(328589..330526)
FT                   /locus_tag="ECED1_0311"
FT   CDS_pept        complement(328589..330526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0311"
FT                   /product="putative carbohydrate kinase"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06524"
FT                   /db_xref="GOA:B7MQB2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018659"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06524.1"
FT                   DYWREYRPAR"
FT   gene            330931..332880
FT                   /locus_tag="ECED1_0314"
FT   CDS_pept        330931..332880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0314"
FT                   /product="putative malonic semialdehyde oxidative
FT                   decarboxylase (iolD-like)"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1577690, 11497462; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06525"
FT                   /db_xref="GOA:B7MQB3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06525.1"
FT                   ARMLEEHIGQARQY"
FT   gene            333061..334083
FT                   /locus_tag="ECED1_0315"
FT   CDS_pept        333061..334083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0315"
FT                   /product="putative myo-inositol 2-dehydrogenase
FT                   (iolG-like)"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06526"
FT                   /db_xref="GOA:B7MQB4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06526.1"
FT                   "
FT   gene            334156..335382
FT                   /locus_tag="ECED1_0316"
FT   CDS_pept        334156..335382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0316"
FT                   /product="putative permeases of the major facilitator
FT                   superfamily MFS"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9099855; Product type pt : putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06527"
FT                   /db_xref="GOA:B7MQB5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06527.1"
FT                   QFLKVPGEK"
FT   gene            complement(335519..335662)
FT                   /locus_tag="ECED1_0317"
FT   CDS_pept        complement(335519..335662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0317"
FT                   /product="hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06528"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06528.1"
FT                   RI"
FT   gene            335652..336053
FT                   /locus_tag="ECED1_0318"
FT   CDS_pept        335652..336053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0318"
FT                   /product="conserved hypothetical protein, putative
FT                   transposase, IS3 family"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06529"
FT                   /db_xref="GOA:B7MQB7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06529.1"
FT   gene            336050..336397
FT                   /locus_tag="ECED1_0319"
FT   CDS_pept        336050..336397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0319"
FT                   /product="conserved hypothetical protein, putative
FT                   transposase ORF2, IS66 family"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06530"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06530.1"
FT                   PKRLLTSLTML"
FT   gene            336447..337853
FT                   /locus_tag="ECED1_0320"
FT   CDS_pept        336447..337853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0320"
FT                   /product="putative transposase ORF 1, IS66 family"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06531"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06531.1"
FT                   TDSGNMKIAA"
FT   gene            338061..338222
FT                   /locus_tag="ECED1_0321"
FT   CDS_pept        338061..338222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0321"
FT                   /product="hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06532"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06532.1"
FT                   GKQGRTHS"
FT   gene            338315..339547
FT                   /locus_tag="ECED1_0322"
FT   CDS_pept        338315..339547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0322"
FT                   /product="Putative reverse transcriptase"
FT                   /function="17.2 : Prophage functions"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06533"
FT                   /db_xref="GOA:B7MQC1"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06533.1"
FT                   VHWYLLRASNE"
FT   gene            339550..339627
FT                   /locus_tag="ECED1_misc_RNA_7"
FT   misc_RNA        339550..339627
FT                   /locus_tag="ECED1_misc_RNA_7"
FT                   /product="SraG"
FT   gene            339663..339809
FT                   /locus_tag="ECED1_0323"
FT   CDS_pept        339663..339809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0323"
FT                   /product="conserved hypothetical protein, putative
FT                   transposase (fragment)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06534"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06534.1"
FT                   SSQ"
FT   gene            complement(339839..340378)
FT                   /gene="deoM"
FT                   /locus_tag="ECED1_0324"
FT   CDS_pept        complement(339839..340378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoM"
FT                   /locus_tag="ECED1_0324"
FT                   /product="Deoxyribose specific mutarotase (partial)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15385522, 15075407; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06535"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06535.1"
FT                   IKMAVTNLASVDMPLQ"
FT   gene            complement(340390..341706)
FT                   /gene="deoP"
FT                   /locus_tag="ECED1_0325"
FT   CDS_pept        complement(340390..341706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoP"
FT                   /locus_tag="ECED1_0325"
FT                   /product="putative L-fucose permease"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 5385522, 15075407, 10648508; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06536"
FT                   /db_xref="GOA:B7MP65"
FT                   /db_xref="InterPro:IPR005275"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06536.1"
FT   gene            complement(341734..342750)
FT                   /gene="deoK"
FT                   /locus_tag="ECED1_0326"
FT   CDS_pept        complement(341734..342750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoK"
FT                   /locus_tag="ECED1_0326"
FT                   /product="Deoxyribokinase"
FT                   /function="6.9 : Pentose phosphate pathway"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10648508, 15385522; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06537"
FT                   /db_xref="GOA:B7MP66"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06537.1"
FT   gene            342954..343739
FT                   /gene="deoQ"
FT                   /locus_tag="ECED1_0327"
FT   CDS_pept        342954..343739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoQ"
FT                   /locus_tag="ECED1_0327"
FT                   /product="putative transcriptional regulator"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15385522, 10648508; Product type pr :
FT                   putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06538"
FT                   /db_xref="GOA:B7MP67"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06538.1"
FT   gene            343916..344089
FT                   /locus_tag="ECED1_0328"
FT   CDS_pept        343916..344089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0328"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06539"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06539.1"
FT                   ITTGRIFKYYWR"
FT   gene            344158..344403
FT                   /pseudo
FT                   /locus_tag="ECED1_0329"
FT   CDS_pept        344158..344403
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0329"
FT                   /product="fragment of putative NADH-dependent flavin
FT                   oxidoreductase (partial)"
FT                   /EC_number=""
FT                   /note="Evidence 7 : Gene remnant; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CAR06540.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            345343..345606
FT                   /gene="ykgM"
FT                   /locus_tag="ECED1_0331"
FT   CDS_pept        345343..345606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgM"
FT                   /locus_tag="ECED1_0331"
FT                   /product="putative ribosomal protein"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06542"
FT                   /db_xref="GOA:B7MP70"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06542.1"
FT   gene            346782..347372
FT                   /gene="ykgK"
FT                   /locus_tag="ECED1_0332"
FT   CDS_pept        346782..347372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgK"
FT                   /locus_tag="ECED1_0332"
FT                   /product="putative transcriptional regulator"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06543"
FT                   /db_xref="GOA:B7MP71"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MP71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06543.1"
FT   gene            347496..347771
FT                   /gene="insA"
FT                   /locus_tag="ECED1_0333"
FT   CDS_pept        347496..347771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insA"
FT                   /locus_tag="ECED1_0333"
FT                   /product="IS1 repressor protein InsA"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9689094; Product type h
FT                   : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06544"
FT                   /db_xref="GOA:B7MNT4"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06544.1"
FT   gene            347690..348193
FT                   /gene="insB"
FT                   /locus_tag="ECED1_0334"
FT   CDS_pept        347690..348193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="ECED1_0334"
FT                   /product="IS1 transposase InsAB'"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9689094; Product type h
FT                   : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06545"
FT                   /db_xref="GOA:B7MNT5"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06545.1"
FT                   KHYQ"
FT   gene            348223..348810
FT                   /gene="ecpA"
FT                   /locus_tag="ECED1_0335"
FT   CDS_pept        348223..348810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpA"
FT                   /locus_tag="ECED1_0335"
FT                   /product="E. coli common pilus (ECP)"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 17563352, 11466275; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06546"
FT                   /db_xref="GOA:P0C900"
FT                   /db_xref="InterPro:IPR016514"
FT                   /db_xref="InterPro:IPR038478"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C900"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06546.1"
FT   gene            348867..349535
FT                   /gene="yagY"
FT                   /locus_tag="ECED1_0336"
FT   CDS_pept        348867..349535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagY"
FT                   /locus_tag="ECED1_0336"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06547"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06547.1"
FT                   "
FT   gene            349561..352086
FT                   /gene="yagX"
FT                   /locus_tag="ECED1_0337"
FT   CDS_pept        349561..352086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagX"
FT                   /locus_tag="ECED1_0337"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06548"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06548.1"
FT   gene            352076..353161
FT                   /pseudo
FT                   /gene="yagW"
FT                   /locus_tag="ECED1_0338"
FT   CDS_pept        352076..353161
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagW"
FT                   /locus_tag="ECED1_0338"
FT                   /product="fragment of putative surface or exported protein
FT                   (partial)"
FT                   /note="Evidence 7 : Gene remnant; Product type pr :
FT                   putative regulator"
FT                   /db_xref="PSEUDO:CAR06549.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            353155..353931
FT                   /locus_tag="ECED1_0339"
FT   CDS_pept        353155..353931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0339"
FT                   /product="putative reductase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06550"
FT                   /db_xref="GOA:B7MP78"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06550.1"
FT   gene            complement(354091..354684)
FT                   /gene="ykgB"
FT                   /locus_tag="ECED1_0340"
FT   CDS_pept        complement(354091..354684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgB"
FT                   /locus_tag="ECED1_0340"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pm : putative membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06551"
FT                   /db_xref="GOA:B7MP79"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06551.1"
FT   gene            complement(354696..354932)
FT                   /gene="ykgI"
FT                   /locus_tag="ECED1_0341"
FT   CDS_pept        complement(354696..354932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgI"
FT                   /locus_tag="ECED1_0341"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06552"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06552.1"
FT   gene            complement(355041..356366)
FT                   /gene="ykgC"
FT                   /locus_tag="ECED1_0342"
FT   CDS_pept        complement(355041..356366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgC"
FT                   /locus_tag="ECED1_0342"
FT                   /product="putative pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06553"
FT                   /db_xref="GOA:B7MP81"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06553.1"
FT   gene            356593..357447
FT                   /gene="ykgD"
FT                   /locus_tag="ECED1_0343"
FT   CDS_pept        356593..357447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgD"
FT                   /locus_tag="ECED1_0343"
FT                   /product="putative AraC-type DNA-binding transcriptional
FT                   regulator"
FT                   /function="16.3 : Control"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06554"
FT                   /db_xref="GOA:B7MP82"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06554.1"
FT                   LAP"
FT   gene            357974..358693
FT                   /gene="ykgE"
FT                   /locus_tag="ECED1_0344"
FT   CDS_pept        357974..358693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="ECED1_0344"
FT                   /product="putative hydroxyacid oxidoreductase (Fe-S
FT                   centre)"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06555"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06555.1"
FT                   EGQKVKVMHIAEVLMSR"
FT   gene            358704..360131
FT                   /gene="ykgF"
FT                   /locus_tag="ECED1_0345"
FT   CDS_pept        358704..360131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="ECED1_0345"
FT                   /product="putative oxidoreductase subunit with
FT                   NAD(P)-binding domain and ferridoxin-like domain"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06556"
FT                   /db_xref="GOA:B7MP84"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06556.1"
FT                   SFRSWFKKHQAQEKKNG"
FT   gene            360124..360819
FT                   /gene="ykgG"
FT                   /locus_tag="ECED1_0346"
FT   CDS_pept        360124..360819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="ECED1_0346"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06557"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06557.1"
FT                   AVYLIIEDC"
FT   gene            complement(360893..361090)
FT                   /locus_tag="ECED1_0347"
FT   CDS_pept        complement(360893..361090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0347"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06558"
FT                   /db_xref="GOA:B7MP86"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06558.1"
FT   gene            complement(361062..361730)
FT                   /gene="ykgH"
FT                   /locus_tag="ECED1_0348"
FT   CDS_pept        complement(361062..361730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgH"
FT                   /locus_tag="ECED1_0348"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pm : putative membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06559"
FT                   /db_xref="GOA:B7MP87"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06559.1"
FT                   "
FT   gene            complement(361914..363905)
FT                   /locus_tag="ECED1_0349"
FT   CDS_pept        complement(361914..363905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0349"
FT                   /product="Putative adhesin; putative outer membrane
FT                   autotransporter barrel"
FT                   /function="14 : Cell envelope"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06560"
FT                   /db_xref="GOA:B7MP88"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06560.1"
FT   gene            364115..365425
FT                   /gene="yahF"
FT                   /locus_tag="ECED1_0350"
FT   CDS_pept        364115..365425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="ECED1_0350"
FT                   /product="putative enzyme with acyl-CoA domain"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06561"
FT                   /db_xref="GOA:B7MP89"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06561.1"
FT   gene            365425..366843
FT                   /gene="yahG"
FT                   /locus_tag="ECED1_0351"
FT   CDS_pept        365425..366843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="ECED1_0351"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06562"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06562.1"
FT                   FEKAIFGWCERYGV"
FT   gene            367090..368040
FT                   /gene="yahI"
FT                   /locus_tag="ECED1_0352"
FT   CDS_pept        367090..368040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="ECED1_0352"
FT                   /product="putative carbamate kinase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="2.7.2.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7711027, 11523892; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06563"
FT                   /db_xref="GOA:B7MP91"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06563.1"
FT   gene            368050..369432
FT                   /gene="yahJ"
FT                   /locus_tag="ECED1_0353"
FT   CDS_pept        368050..369432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="ECED1_0353"
FT                   /product="putative deaminase/amidohydrolase with
FT                   metallo-dependent hydrolase domain"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /function="6.2 : Amino acids and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06564"
FT                   /db_xref="GOA:B7MP92"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06564.1"
FT                   AG"
FT   gene            369696..370139
FT                   /locus_tag="ECED1_0354"
FT   CDS_pept        369696..370139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0354"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06565"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06565.1"
FT   gene            370390..371376
FT                   /locus_tag="ECED1_0355"
FT   CDS_pept        370390..371376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0355"
FT                   /product="putative periplasmic binding protein, substrate
FT                   ribose (sugar-binding protein), ABC-type transport system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06566"
FT                   /db_xref="GOA:B7MP94"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06566.1"
FT   gene            371410..372909
FT                   /locus_tag="ECED1_0356"
FT   CDS_pept        371410..372909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0356"
FT                   /product="Putative ATP-binding component of ABC sugar
FT                   transport system"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06567"
FT                   /db_xref="GOA:B7MP95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06567.1"
FT   gene            372902..373873
FT                   /locus_tag="ECED1_0357"
FT   CDS_pept        372902..373873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0357"
FT                   /product="putative permease component of sugar ABC
FT                   transport system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06568"
FT                   /db_xref="GOA:B7MP96"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06568.1"
FT   gene            373840..374826
FT                   /locus_tag="ECED1_0358"
FT   CDS_pept        373840..374826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0358"
FT                   /product="putative permease component of sugar ABC
FT                   transport system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06569"
FT                   /db_xref="GOA:B7MP97"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06569.1"
FT   gene            374913..375962
FT                   /gene="yahK"
FT                   /locus_tag="ECED1_0359"
FT   CDS_pept        374913..375962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahK"
FT                   /locus_tag="ECED1_0359"
FT                   /product="putative oxidoreductase, Zn-dependent and
FT                   NAD(P)-binding"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06570"
FT                   /db_xref="GOA:B7MP98"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06570.1"
FT                   VIDNRTLTD"
FT   gene            376514..376594
FT                   /locus_tag="ECED1_tRNA6"
FT   tRNA            376514..376594
FT                   /locus_tag="ECED1_tRNA6"
FT                   /note="Pseudo tRNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            376554..376733
FT                   /locus_tag="ECED1_0360"
FT   CDS_pept        376554..376733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0360"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06571"
FT                   /db_xref="UniProtKB/TrEMBL:B7MP99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06571.1"
FT                   MKKPTQGRVAETGS"
FT   gene            complement(376844..377515)
FT                   /gene="yahN"
FT                   /locus_tag="ECED1_0361"
FT   CDS_pept        complement(376844..377515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="ECED1_0361"
FT                   /product="neutral amino-acid efflux system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12879215; Product type t
FT                   : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06572"
FT                   /db_xref="GOA:B7MPA0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06572.1"
FT                   R"
FT   gene            377662..377937
FT                   /gene="yahO"
FT                   /locus_tag="ECED1_0362"
FT   CDS_pept        377662..377937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="ECED1_0362"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06573"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06573.1"
FT   gene            complement(378038..379624)
FT                   /gene="prpR"
FT                   /locus_tag="ECED1_0363"
FT   CDS_pept        complement(378038..379624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="ECED1_0363"
FT                   /product="DNA-binding transcriptional activator"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9325432, 15805526;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06574"
FT                   /db_xref="GOA:B7MPA2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06574.1"
FT                   SRTTFWRRLKS"
FT   gene            379863..380753
FT                   /gene="prpB"
FT                   /locus_tag="ECED1_0364"
FT   CDS_pept        379863..380753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="ECED1_0364"
FT                   /product="2-methylisocitrate lyase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11422389, 12473114,
FT                   9325432; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06575"
FT                   /db_xref="GOA:B7MPA3"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06575.1"
FT                   YEEKLDDLFARGQVK"
FT   gene            380913..382082
FT                   /gene="prpC"
FT                   /locus_tag="ECED1_0365"
FT   CDS_pept        380913..382082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="ECED1_0365"
FT                   /product="2-methylcitrate synthase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12473114, 9579066,
FT                   8508809, 9325432; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06576"
FT                   /db_xref="GOA:B7MPA4"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06576.1"
FT   gene            382116..383567
FT                   /gene="prpD"
FT                   /locus_tag="ECED1_0366"
FT   CDS_pept        382116..383567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="ECED1_0366"
FT                   /product="2-methylcitrate dehydratase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12473114, 21642584;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06577"
FT                   /db_xref="GOA:B7MPA5"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06577.1"
FT   gene            383607..385493
FT                   /gene="prpE"
FT                   /locus_tag="ECED1_0367"
FT   CDS_pept        383607..385493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="ECED1_0367"
FT                   /product="propionyl-CoA synthetase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10482501, 10411265; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06578"
FT                   /db_xref="GOA:B7MPA6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06578.1"
FT   gene            385724..386983
FT                   /gene="codB"
FT                   /locus_tag="ECED1_0368"
FT   CDS_pept        385724..386983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="ECED1_0368"
FT                   /product="cytosine transporter"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /function="7.5 : Nucleosides, purines and pyrimidines"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92349961; Product type t
FT                   : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06579"
FT                   /db_xref="GOA:B7MPA7"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06579.1"
FT   gene            386973..388256
FT                   /gene="codA"
FT                   /locus_tag="ECED1_0369"
FT   CDS_pept        386973..388256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="ECED1_0369"
FT                   /product="cytosine deaminase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92349961, 8450832;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06580"
FT                   /db_xref="GOA:B7MPA8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06580.1"
FT   gene            complement(388377..388988)
FT                   /gene="lacA"
FT                   /locus_tag="ECED1_0370"
FT   CDS_pept        complement(388377..388988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /locus_tag="ECED1_0370"
FT                   /product="thiogalactoside acetyltransferase"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 789355, 3901000,
FT                   3922433, 6444453, 14085376, 12793527; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06581"
FT                   /db_xref="GOA:B7MPA9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06581.1"
FT   gene            complement(389054..390307)
FT                   /gene="lacY"
FT                   /locus_tag="ECED1_0371"
FT   CDS_pept        complement(389054..390307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacY"
FT                   /locus_tag="ECED1_0371"
FT                   /product="lactose/galactose transporter"
FT                   /function="6 : Energy metabolism"
FT                   /function="7.3 : Carbohydrates, organic alcohols, and
FT                   acids"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12893935, 14630326,
FT                   90272706, 90366577, 91154204, 10485888, 1644770, 1848449,
FT                   2164211, 6444453, 7578103; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06582"
FT                   /db_xref="GOA:B7MPB0"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR018457"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06582.1"
FT                   LSGPGPLSLLRRQVNEVA"
FT   gene            complement(390359..393433)
FT                   /gene="lacZ"
FT                   /locus_tag="ECED1_0372"
FT   CDS_pept        complement(390359..393433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="ECED1_0372"
FT                   /product="beta-D-galactosidase"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92283812, 11732897,
FT                   6246435, 6313347, 6411710, 6420154, 6444453, 8008071,
FT                   97298; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06583"
FT                   /db_xref="GOA:B7MPB1"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06583.1"
FT   gene            complement(393556..394638)
FT                   /gene="lacI"
FT                   /locus_tag="ECED1_0373"
FT   CDS_pept        complement(393556..394638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="ECED1_0373"
FT                   /product="DNA-binding transcriptional repressor"
FT                   /function="6 : Energy metabolism"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91278090, 93027237,
FT                   93066276, 10647179, 1107032, 2040302, 2178920, 2742823,
FT                   3064080, 3286877, 355891, 4571224, 4594037, 8046748,
FT                   8638105, 8683581; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06584"
FT                   /db_xref="GOA:B7MPB2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06584.1"
FT   gene            complement(394715..395629)
FT                   /gene="mhpR"
FT                   /locus_tag="ECED1_0374"
FT   CDS_pept        complement(394715..395629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpR"
FT                   /locus_tag="ECED1_0374"
FT                   /product="DNA-binding transcriptional activator,
FT                   3HPP-binding"
FT                   /function="3.2 : Degradation"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 97252486; Product type r
FT                   : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06585"
FT                   /db_xref="GOA:B7MPB3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06585.1"
FT   gene            395740..397404
FT                   /gene="mhpA"
FT                   /locus_tag="ECED1_0375"
FT   CDS_pept        395740..397404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpA"
FT                   /locus_tag="ECED1_0375"
FT                   /product="3-(3-hydroxyphenyl)propionate hydroxylase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 87008429, 94002258;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06586"
FT                   /db_xref="GOA:B7MPB4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR023786"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06586.1"
FT   gene            397406..398350
FT                   /gene="mhpB"
FT                   /locus_tag="ECED1_0376"
FT   CDS_pept        397406..398350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpB"
FT                   /locus_tag="ECED1_0376"
FT                   /product="2,3-dihydroxyphenylpropionate 1,2-dioxygenase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="1.13.11.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 87008429, 94002258,
FT                   8752345; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06587"
FT                   /db_xref="GOA:B7MPB5"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06587.1"
FT   gene            398353..399234
FT                   /gene="mhpC"
FT                   /locus_tag="ECED1_0377"
FT   CDS_pept        398353..399234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="ECED1_0377"
FT                   /product="2-hydroxy-6-ketonona-2,4-dienedioic acid
FT                   hydrolase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="3.7.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 87008429, 94002258,
FT                   15663942; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06588"
FT                   /db_xref="GOA:B7MPB6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR023791"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06588.1"
FT                   FNQLVLNFLARA"
FT   gene            399244..400053
FT                   /gene="mhpD"
FT                   /locus_tag="ECED1_0378"
FT   CDS_pept        399244..400053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpD"
FT                   /locus_tag="ECED1_0378"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 87008429, 94002258,
FT                   9492273; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06589"
FT                   /db_xref="GOA:B7MPB7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR023793"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06589.1"
FT   gene            400050..401000
FT                   /gene="mhpF"
FT                   /locus_tag="ECED1_0379"
FT   CDS_pept        400050..401000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpF"
FT                   /locus_tag="ECED1_0379"
FT                   /product="acetaldehyde-CoA dehydrogenase II, NAD-binding"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 87008429, 94002258;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06590"
FT                   /db_xref="GOA:B7MPB8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06590.1"
FT   gene            400997..402010
FT                   /gene="mhpE"
FT                   /locus_tag="ECED1_0380"
FT   CDS_pept        400997..402010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpE"
FT                   /locus_tag="ECED1_0380"
FT                   /product="4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic
FT                   acid aldolase, class I"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="4.1.3.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 87008429, 94002258,
FT                   98432850; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06591"
FT                   /db_xref="GOA:B7MPB9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06591.1"
FT   gene            402186..403397
FT                   /gene="mhpT"
FT                   /locus_tag="ECED1_0381"
FT   CDS_pept        402186..403397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpT"
FT                   /locus_tag="ECED1_0381"
FT                   /product="hydroxy-aromatic acid transporter"
FT                   /function="3.2 : Degradation"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7961399; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06592"
FT                   /db_xref="GOA:B7MPC0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06592.1"
FT                   CADA"
FT   gene            403499..404038
FT                   /gene="yaiL"
FT                   /locus_tag="ECED1_0382"
FT   CDS_pept        403499..404038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="ECED1_0382"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /function="8.4 : Chromosome-associated proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15115803, 12878731,
FT                   13129938; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06593"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06593.1"
FT                   EDDPYADFKVPDDLMW"
FT   gene            complement(404265..405098)
FT                   /gene="frmB"
FT                   /locus_tag="ECED1_0383"
FT   CDS_pept        complement(404265..405098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmB"
FT                   /locus_tag="ECED1_0383"
FT                   /product="S-formylglutathione hydrolase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /function="16.8 : Protect"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 16567800, 15466022;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06594"
FT                   /db_xref="GOA:B7MPC2"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06594.1"
FT   gene            complement(405191..406300)
FT                   /gene="frmA"
FT                   /locus_tag="ECED1_0384"
FT   CDS_pept        complement(405191..406300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmA"
FT                   /locus_tag="ECED1_0384"
FT                   /product="alcohol dehydrogenase class
FT                   III/glutathione-dependent formaldehyde dehydrogenase"
FT                   /function="6.7 : Fermentation"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15466022, 87172301,
FT                   1731906; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06595"
FT                   /db_xref="GOA:B7MPC3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06595.1"
FT   gene            complement(406335..406610)
FT                   /gene="frmR"
FT                   /locus_tag="ECED1_0385"
FT   CDS_pept        complement(406335..406610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmR"
FT                   /locus_tag="ECED1_0385"
FT                   /product="regulator protein that represses frmRAB operon"
FT                   /function="16.3 : Control"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15466022, 17143269;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06596"
FT                   /db_xref="GOA:B7MPC4"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06596.1"
FT   gene            complement(406799..406942)
FT                   /pseudo
FT                   /gene="yaiO"
FT                   /locus_tag="ECED1_0387"
FT   CDS_pept        complement(406799..406942)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiO"
FT                   /locus_tag="ECED1_0387"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   2)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAR06597.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(406999..407571)
FT                   /pseudo
FT                   /gene="yaiO"
FT                   /locus_tag="ECED1_0388"
FT   CDS_pept        complement(406999..407571)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiO"
FT                   /locus_tag="ECED1_0388"
FT                   /product="fragment of conserved hypothetical protein (part
FT                   1)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 7 : Gene remnant"
FT                   /db_xref="PSEUDO:CAR06598.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(407573..408283)
FT                   /gene="yaiX"
FT                   /locus_tag="ECED1_0389"
FT   CDS_pept        complement(407573..408283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiX"
FT                   /locus_tag="ECED1_0389"
FT                   /product="putative transferase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06599"
FT                   /db_xref="GOA:B7MPC7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06599.1"
FT                   GTYSLRQELIRTGD"
FT   gene            complement(408132..409328)
FT                   /gene="yaiP"
FT                   /locus_tag="ECED1_0390"
FT   CDS_pept        complement(408132..409328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiP"
FT                   /locus_tag="ECED1_0390"
FT                   /product="putative membrane-associated glycosyltransferase"
FT                   /function="16.8 : Protect"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06600"
FT                   /db_xref="GOA:B7MPC8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06600.1"
FT   gene            complement(409338..410024)
FT                   /gene="yaiS"
FT                   /locus_tag="ECED1_0391"
FT   CDS_pept        complement(409338..410024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiS"
FT                   /locus_tag="ECED1_0391"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06601"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06601.1"
FT                   IHKMIL"
FT   gene            410617..411579
FT                   /gene="tauA"
FT                   /locus_tag="ECED1_0392"
FT   CDS_pept        410617..411579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="ECED1_0392"
FT                   /product="taurine transporter subunit ; periplasmic-binding
FT                   component of ABC superfamily"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9401024, 96404792,
FT                   8774726; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06602"
FT                   /db_xref="GOA:B7MPD0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06602.1"
FT   gene            411592..412359
FT                   /gene="tauB"
FT                   /locus_tag="ECED1_0393"
FT   CDS_pept        411592..412359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="ECED1_0393"
FT                   /product="taurine transporter subunit ; ATP-binding
FT                   component of ABC superfamily"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9401024, 96404792;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06603"
FT                   /db_xref="GOA:B7MPD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06603.1"
FT   gene            412356..413183
FT                   /gene="tauC"
FT                   /locus_tag="ECED1_0394"
FT   CDS_pept        412356..413183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="ECED1_0394"
FT                   /product="taurine transporter subunit ; membrane component
FT                   of ABC superfamily"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9401024, 96404792;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06604"
FT                   /db_xref="GOA:B7MPD2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06604.1"
FT   gene            413180..414031
FT                   /gene="tauD"
FT                   /locus_tag="ECED1_0395"
FT   CDS_pept        413180..414031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="ECED1_0395"
FT                   /product="taurine dioxygenase, 2-oxoglutarate-dependent"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9401024, 96404792,
FT                   11955067, 2656410, 7984428, 8774726, 9287300; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06605"
FT                   /db_xref="GOA:B7MPD3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06605.1"
FT                   AG"
FT   gene            complement(414071..415045)
FT                   /gene="hemB"
FT                   /locus_tag="ECED1_0396"
FT   CDS_pept        complement(414071..415045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="ECED1_0396"
FT                   /product="porphobilinogen synthase"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91100324, 93143310,
FT                   93176130, 10194344, 11444968, 11909869, 2464127, 2656410;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06606"
FT                   /db_xref="GOA:B7MPD4"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06606.1"
FT   gene            complement(415220..415723)
FT                   /gene="insB"
FT                   /locus_tag="ECED1_0397"
FT   CDS_pept        complement(415220..415723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="ECED1_0397"
FT                   /product="IS1 transposase InsAB'"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9689094; Product type h
FT                   : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06607"
FT                   /db_xref="GOA:B7MNT5"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06607.1"
FT                   KHYQ"
FT   gene            complement(415642..415917)
FT                   /gene="insA"
FT                   /locus_tag="ECED1_0398"
FT   CDS_pept        complement(415642..415917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insA"
FT                   /locus_tag="ECED1_0398"
FT                   /product="IS1 repressor protein InsA"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9689094; Product type h
FT                   : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06608"
FT                   /db_xref="GOA:B7MNT4"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:B7MNT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06608.1"
FT   gene            complement(416099..417256)
FT                   /gene="ampH"
FT                   /locus_tag="ECED1_0399"
FT   CDS_pept        complement(416099..417256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="ECED1_0399"
FT                   /product="beta-lactamase/D-alanine carboxypeptidase"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 97464439, 7567469;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06609"
FT                   /db_xref="GOA:B7MPD7"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06609.1"
FT   gene            417608..418828
FT                   /gene="sbmA"
FT                   /locus_tag="ECED1_0400"
FT   CDS_pept        417608..418828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="ECED1_0400"
FT                   /product="transporter involved in cell envelope
FT                   modification"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 87111440, 94143997, 12414155, 15044696; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06610"
FT                   /db_xref="GOA:B7MPD8"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06610.1"
FT                   EVTHTLS"
FT   gene            418841..419935
FT                   /gene="yaiW"
FT                   /locus_tag="ECED1_0401"
FT   CDS_pept        418841..419935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="ECED1_0401"
FT                   /product="putative lipoprotein"
FT                   /function="14 : Cell envelope"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06611"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06611.1"
FT   gene            complement(419993..420301)
FT                   /gene="yaiY"
FT                   /locus_tag="ECED1_0402"
FT   CDS_pept        complement(419993..420301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="ECED1_0402"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pm : putative membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06612"
FT                   /db_xref="GOA:B7MPE0"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06612.1"
FT   gene            420429..420773
FT                   /gene="yaiZ"
FT                   /locus_tag="ECED1_0403"
FT   CDS_pept        420429..420773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="ECED1_0403"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06613"
FT                   /db_xref="GOA:B7MPE1"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06613.1"
FT                   RRDEETENAQ"
FT   gene            complement(420797..421891)
FT                   /gene="ddlA"
FT                   /locus_tag="ECED1_0404"
FT   CDS_pept        complement(420797..421891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="ECED1_0404"
FT                   /product="D-alanine-D-alanine ligase A"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91129242, 92207163;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06614"
FT                   /db_xref="GOA:B7MPE2"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06614.1"
FT   gene            422354..422614
FT                   /gene="yaiB"
FT                   /locus_tag="ECED1_0405"
FT   CDS_pept        422354..422614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiB"
FT                   /locus_tag="ECED1_0405"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06615"
FT                   /db_xref="GOA:B7MPE3"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06615.1"
FT   gene            422715..424130
FT                   /gene="phoA"
FT                   /locus_tag="ECED1_0406"
FT   CDS_pept        422715..424130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="ECED1_0406"
FT                   /product="bacterial alkaline phosphatase"
FT                   /function="5.3 : Phosphorus compounds"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06616"
FT                   /db_xref="GOA:B7MPE4"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06616.1"
FT                   DLFYTMKAALGLK"
FT   gene            424249..424569
FT                   /gene="psiF"
FT                   /locus_tag="ECED1_0407"
FT   CDS_pept        424249..424569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ECED1_0407"
FT                   /product="phosphate starvation-inducible protein"
FT                   /function="5.3 : Phosphorus compounds"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 3533724, 2160940;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06617"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06617.1"
FT                   AA"
FT   gene            424671..425786
FT                   /gene="yaiC"
FT                   /locus_tag="ECED1_0408"
FT   CDS_pept        424671..425786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiC"
FT                   /locus_tag="ECED1_0408"
FT                   /product="putative diguanylate cyclase"
FT                   /function="16.3 : Control"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15716451, 10760159; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06618"
FT                   /db_xref="GOA:B7MPE6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06618.1"
FT   gene            complement(425803..426612)
FT                   /gene="proC"
FT                   /locus_tag="ECED1_0409"
FT   CDS_pept        complement(425803..426612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="ECED1_0409"
FT                   /product="pyrroline-5-carboxylate reductase,
FT                   NAD(P)-binding"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 6255065, 83116986;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06619"
FT                   /db_xref="GOA:B7MPE7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06619.1"
FT   gene            426732..427190
FT                   /gene="yaiI"
FT                   /locus_tag="ECED1_0410"
FT   CDS_pept        426732..427190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="ECED1_0410"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06620"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06620.1"
FT   gene            427373..427897
FT                   /gene="aroL"
FT                   /locus_tag="ECED1_0411"
FT   CDS_pept        427373..427897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="ECED1_0411"
FT                   /product="shikimate kinase II"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 86085675, 92104984,
FT                   3001025, 3026317; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06621"
FT                   /db_xref="GOA:B7MPE9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06621.1"
FT                   IRSALAQTINC"
FT   gene            427947..428138
FT                   /gene="yaiA"
FT                   /locus_tag="ECED1_0412"
FT   CDS_pept        427947..428138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="ECED1_0412"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06622"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06622.1"
FT                   TAQEAMDAKKRYEDPDKE"
FT   gene            428396..429073
FT                   /gene="aroM"
FT                   /locus_tag="ECED1_0413"
FT   CDS_pept        428396..429073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="ECED1_0413"
FT                   /product="conserved hypothetical protein"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 86085675, 3001025"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06623"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06623.1"
FT                   LLM"
FT   gene            429145..429429
FT                   /gene="yaiE"
FT                   /locus_tag="ECED1_0414"
FT   CDS_pept        429145..429429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="ECED1_0414"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06624"
FT                   /db_xref="GOA:B7MPF2"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06624.1"
FT   gene            429637..429915
FT                   /gene="ykiA"
FT                   /locus_tag="ECED1_0415"
FT   CDS_pept        429637..429915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykiA"
FT                   /locus_tag="ECED1_0415"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06625"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06625.1"
FT   gene            complement(430073..430984)
FT                   /gene="rdgC"
FT                   /locus_tag="ECED1_0416"
FT   CDS_pept        complement(430073..430984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="ECED1_0416"
FT                   /product="DNA-binding protein, non-specific"
FT                   /function="8 : DNA metabolism"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 8807285, 99296598,
FT                   12554673; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06626"
FT                   /db_xref="GOA:B7MPF4"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06626.1"
FT   gene            431109..432017
FT                   /gene="mak"
FT                   /locus_tag="ECED1_0417"
FT   CDS_pept        431109..432017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="ECED1_0417"
FT                   /product="manno(fructo)kinase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11742072, 1744033;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06627"
FT                   /db_xref="GOA:B7MPF5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06627.1"
FT   gene            complement(432286..433470)
FT                   /gene="araJ"
FT                   /locus_tag="ECED1_0418"
FT   CDS_pept        complement(432286..433470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="ECED1_0418"
FT                   /product="putative major facilitator class transporter"
FT                   /function="16.1 : Circulate"
FT                   /function="6 : Energy metabolism"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 92078081, 1744033; Product type pt :
FT                   putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06628"
FT                   /db_xref="GOA:B7MPF6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06628.1"
FT   gene            complement(433596..436739)
FT                   /gene="sbcC"
FT                   /locus_tag="ECED1_0419"
FT   CDS_pept        complement(433596..436739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="ECED1_0419"
FT                   /product="exonuclease, dsDNA, ATP-dependent"
FT                   /function="8.3 : Degradation of DNA"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12826280, 90045931,
FT                   93146416, 93214998, 98318595, 9927737, 10886369, 1744033;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06629"
FT                   /db_xref="GOA:B7MPF7"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06629.1"
FT   gene            complement(436736..437938)
FT                   /gene="sbcD"
FT                   /locus_tag="ECED1_0420"
FT   CDS_pept        complement(436736..437938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="ECED1_0420"
FT                   /product="exonuclease, dsDNA, ATP-dependent"
FT                   /function="8.3 : Degradation of DNA"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12826280, 92138614,
FT                   93146416, 93214998, 98318595, 9927737, 2530497; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06630"
FT                   /db_xref="GOA:B7MPF8"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06630.1"
FT                   A"
FT   gene            438128..438817
FT                   /gene="phoB"
FT                   /locus_tag="ECED1_0421"
FT   CDS_pept        438128..438817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="ECED1_0421"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system with PhoR (or CreC)"
FT                   /function="5.3 : Phosphorus compounds"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90133909, 91100346;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06631"
FT                   /db_xref="GOA:B7MPF9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06631.1"
FT                   YRFSTRF"
FT   gene            438875..440170
FT                   /gene="phoR"
FT                   /locus_tag="ECED1_0422"
FT   CDS_pept        438875..440170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ECED1_0422"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with PhoB"
FT                   /function="5.3 : Phosphorus compounds"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="12.3 : Protein interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.3.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90133909, 90251245,
FT                   93163134, 3550103, 8391104; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06632"
FT                   /db_xref="GOA:B7MPG0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06632.1"
FT   gene            complement(440181..440291)
FT                   /locus_tag="ECED1_0423"
FT   CDS_pept        complement(440181..440291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0423"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06633"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06633.1"
FT   gene            440577..441896
FT                   /gene="brnQ"
FT                   /locus_tag="ECED1_0424"
FT   CDS_pept        440577..441896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="ECED1_0424"
FT                   /product="branched chain amino acid transporter (LIV-II)"
FT                   /function="1.4 : Pyruvate family"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3078876, 6998958, 3550103, 7984428; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06634"
FT                   /db_xref="GOA:B7MPG2"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06634.1"
FT   gene            441972..443345
FT                   /gene="proY"
FT                   /locus_tag="ECED1_0425"
FT   CDS_pept        441972..443345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="ECED1_0425"
FT                   /product="proline transporter"
FT                   /function="16.1 : Circulate"
FT                   /function="1.3 : Glutamate family"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9308174; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06635"
FT                   /db_xref="GOA:B7MPG3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06635.1"
FT   gene            443501..445318
FT                   /gene="malZ"
FT                   /locus_tag="ECED1_0426"
FT   CDS_pept        443501..445318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="ECED1_0426"
FT                   /product="maltodextrin glucosidase"
FT                   /function="6.14 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92184757, 1706703,
FT                   1918057; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06636"
FT                   /db_xref="GOA:B7MPG4"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06636.1"
FT   gene            complement(445323..445904)
FT                   /gene="acpH"
FT                   /locus_tag="ECED1_0427"
FT   CDS_pept        complement(445323..445904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="ECED1_0427"
FT                   /product="acyl carrier protein phosphodiesterase"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 1706703, 16107329;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06637"
FT                   /db_xref="GOA:B7MPG5"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06637.1"
FT   gene            445997..447067
FT                   /gene="queA"
FT                   /locus_tag="ECED1_0428"
FT   CDS_pept        445997..447067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="ECED1_0428"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91177815, 93349860;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06638"
FT                   /db_xref="GOA:B7MPG6"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06638.1"
FT                   MFITYNPQAINERVGE"
FT   gene            447122..448249
FT                   /gene="tgt"
FT                   /locus_tag="ECED1_0429"
FT   CDS_pept        447122..448249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="ECED1_0429"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11751936, 89155457,
FT                   92165719, 9714557, 1706703, 2170107, 7507921, 7893665,
FT                   8003468, 8323579, 9055203; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06639"
FT                   /db_xref="GOA:B7MPG7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MPG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06639.1"
FT   gene            448272..448604
FT                   /gene="yajC"
FT                   /locus_tag="ECED1_0430"
FT   CDS_pept        448272..448604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="ECED1_0430"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9305629, 1706703,
FT                   2170107, 7507921, 8045893; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06640"
FT                   /db_xref="GOA:B7MPG8"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06640.1"
FT                   GTMKAL"
FT   gene            448632..450479
FT                   /gene="secD"
FT                   /locus_tag="ECED1_0431"
FT   CDS_pept        448632..450479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ECED1_0431"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92210494, 92338228,
FT                   94131960, 2170107, 2249673; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06641"
FT                   /db_xref="GOA:B7MPG9"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:B7MPG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06641.1"
FT   gene            450490..451461
FT                   /gene="secF"
FT                   /locus_tag="ECED1_0432"
FT   CDS_pept        450490..451461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ECED1_0432"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92210494, 92338228,
FT                   94292431, 2170107, 2249673; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06642"
FT                   /db_xref="GOA:B7MQC4"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06642.1"
FT   gene            451591..451938
FT                   /gene="yajD"
FT                   /locus_tag="ECED1_0433"
FT   CDS_pept        451591..451938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="ECED1_0433"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06643"
FT                   /db_xref="GOA:B7MQC5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06643.1"
FT                   ADLKAMMNKKK"
FT   gene            complement(451976..452860)
FT                   /gene="tsx"
FT                   /locus_tag="ECED1_0434"
FT   CDS_pept        complement(451976..452860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="ECED1_0434"
FT                   /product="nucleoside channel, receptor of phage T6 and
FT                   colicin K"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /function="7.5 : Nucleosides, purines and pyrimidines"
FT                   /function="7.6 : Porins"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91092502, 91358319,
FT                   93352541; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06644"
FT                   /db_xref="GOA:B7MQC6"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06644.1"
FT                   TGWGGYLVVGYNF"
FT   gene            complement(453159..453698)
FT                   /gene="yajI"
FT                   /locus_tag="ECED1_0435"
FT   CDS_pept        complement(453159..453698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajI"
FT                   /locus_tag="ECED1_0435"
FT                   /product="putative lipoprotein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06645"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06645.1"
FT                   DQLGFVRIHDIQPVMQ"
FT   gene            453849..454298
FT                   /gene="nrdR"
FT                   /locus_tag="ECED1_0436"
FT   CDS_pept        453849..454298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="ECED1_0436"
FT                   /product="transcriptional repressor of nrd genes"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06646"
FT                   /db_xref="GOA:B7MQC8"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06646.1"
FT   gene            454302..455405
FT                   /gene="ribD"
FT                   /locus_tag="ECED1_0437"
FT   CDS_pept        454302..455405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="ECED1_0437"
FT                   /product="fused diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase; 5-amino-6-(5-phosphoribosylamino) uracil
FT                   reductase"
FT                   /function="4.9 : Riboflavin, FMN, and FAD"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9068650; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06647"
FT                   /db_xref="GOA:B7MQC9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06647.1"
FT   gene            455494..455964
FT                   /gene="ribE"
FT                   /locus_tag="ECED1_0438"
FT   CDS_pept        455494..455964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="ECED1_0438"
FT                   /product="riboflavin synthase beta chain"
FT                   /function="4.9 : Riboflavin, FMN, and FAD"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06648"
FT                   /db_xref="GOA:B7MQD0"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06648.1"
FT   gene            455984..456403
FT                   /gene="nusB"
FT                   /locus_tag="ECED1_0439"
FT   CDS_pept        455984..456403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="ECED1_0439"
FT                   /product="transcription antitermination protein"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91331320, 93024316,
FT                   93145327, 99316017, 10881193, 3019094, 6330693, 6330694,
FT                   9670024; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06649"
FT                   /db_xref="GOA:B7MQD1"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06649.1"
FT   gene            456481..457458
FT                   /gene="thiL"
FT                   /locus_tag="ECED1_0440"
FT   CDS_pept        456481..457458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ECED1_0440"
FT                   /product="thiamin-monophosphate kinase"
FT                   /function="4.11 : Thiamine"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 6284709; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06650"
FT                   /db_xref="GOA:B7MQD2"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06650.1"
FT   gene            457436..457954
FT                   /gene="pgpA"
FT                   /locus_tag="ECED1_0441"
FT   CDS_pept        457436..457954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="ECED1_0441"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89033892, 92104964;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06651"
FT                   /db_xref="GOA:B7MQD3"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06651.1"
FT                   HHWPLGILS"
FT   gene            complement(458008..458982)
FT                   /gene="yajO"
FT                   /locus_tag="ECED1_0442"
FT   CDS_pept        complement(458008..458982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="ECED1_0442"
FT                   /product="aldoketo-oxidoreductase, NADP-binding"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15292217, 16077126;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06652"
FT                   /db_xref="GOA:B7MQD4"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06652.1"
FT   gene            complement(459037..460899)
FT                   /gene="dxs"
FT                   /locus_tag="ECED1_0443"
FT   CDS_pept        complement(459037..460899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="ECED1_0443"
FT                   /product="1-deoxyxylulose-5-phosphate synthase,
FT                   thiamine-requiring, FAD-requiring"
FT                   /function="4.8 : Pyridoxine"
FT                   /function="4.11 : Thiamine"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 98151473, 10648511,
FT                   9371765; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06653"
FT                   /db_xref="GOA:B7MQD5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06653.1"
FT   gene            complement(460924..461823)
FT                   /gene="ispA"
FT                   /locus_tag="ECED1_0444"
FT   CDS_pept        complement(460924..461823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="ECED1_0444"
FT                   /product="geranyltranstransferase"
FT                   /function="4 : Biosynthesis of cofactors, prosthetic
FT                   groups, and carriers"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89291702, 91210228;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06654"
FT                   /db_xref="GOA:B7MQD6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06654.1"
FT                   LDTSALEALADYIIQRNK"
FT   gene            complement(461823..462065)
FT                   /gene="xseB"
FT                   /locus_tag="ECED1_0445"
FT   CDS_pept        complement(461823..462065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="ECED1_0445"
FT                   /product="exonuclease VII small subunit"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="8.3 : Degradation of DNA"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21287280, 6284744,
FT                   6350262, 2089044; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06655"
FT                   /db_xref="GOA:B7MQD7"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06655.1"
FT   gene            462271..463719
FT                   /gene="thiI"
FT                   /locus_tag="ECED1_0446"
FT   CDS_pept        462271..463719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="ECED1_0446"
FT                   /product="sulfurtransferase required for thiamine and
FT                   4-thiouridine biosynthesis"
FT                   /function="4.11 : Thiamine"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 20187532, 20206733,
FT                   357427, 7007049; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06656"
FT                   /db_xref="GOA:B7MQD8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06656.1"
FT   gene            complement(463773..464363)
FT                   /gene="yajL"
FT                   /locus_tag="ECED1_0447"
FT   CDS_pept        complement(463773..464363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajL"
FT                   /locus_tag="ECED1_0447"
FT                   /product="conserved hypothetical protein"
FT                   /function="4.11 : Thiamine"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 97039868, 99173753,
FT                   99311269"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06657"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06657.1"
FT   gene            complement(464326..465237)
FT                   /gene="panE"
FT                   /locus_tag="ECED1_0448"
FT   CDS_pept        complement(464326..465237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="ECED1_0448"
FT                   /product="2-dehydropantoate reductase, NADPH-specific"
FT                   /function="2.4 : Pyrimidine ribonucleotide biosynthesis"
FT                   /function="4.7 : Pantothenate and coenzyme A"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10613889, 20021227,
FT                   10736170, 11123955, 11724562; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06658"
FT                   /db_xref="GOA:B7MQE0"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06658.1"
FT   gene            465405..465896
FT                   /gene="yajQ"
FT                   /locus_tag="ECED1_0449"
FT   CDS_pept        465405..465896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="ECED1_0449"
FT                   /product="putative nucleotide binding protein (UPF0234
FT                   protein)"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12381839, 12943362; Product type pf :
FT                   putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06659"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06659.1"
FT                   "
FT   gene            complement(466024..467388)
FT                   /gene="yajR"
FT                   /locus_tag="ECED1_0450"
FT   CDS_pept        complement(466024..467388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="ECED1_0450"
FT                   /product="putative transporter, major facilitator family"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06660"
FT                   /db_xref="GOA:B7MQE2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06660.1"
FT   gene            complement(467537..468427)
FT                   /gene="cyoE"
FT                   /locus_tag="ECED1_0451"
FT   CDS_pept        complement(467537..468427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="ECED1_0451"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="2.5.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90330636, 90366572,
FT                   92345252, 9378722, 1336371, 2162835, 8253713, 8262927;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06661"
FT                   /db_xref="GOA:B7MQE3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06661.1"
FT                   DFMVPDSHTLLAAVW"
FT   gene            complement(468439..468768)
FT                   /gene="cyoD"
FT                   /locus_tag="ECED1_0452"
FT   CDS_pept        complement(468439..468768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="ECED1_0452"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.10.3.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90330636, 90366572,
FT                   92345252, 9378722, 98021084, 11017202, 2162835; Product
FT                   type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06662"
FT                   /db_xref="GOA:B7MQE4"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06662.1"
FT                   NMMMH"
FT   gene            complement(468768..469382)
FT                   /gene="cyoC"
FT                   /locus_tag="ECED1_0453"
FT   CDS_pept        complement(468768..469382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="ECED1_0453"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number="1.10.3.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90330636, 92345252,
FT                   93349845, 9378722, 98021084, 11017202, 2162835, 2168206;
FT                   Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06663"
FT                   /db_xref="GOA:B7MQE5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06663.1"
FT   gene            complement(469372..471363)
FT                   /gene="cyoB"
FT                   /locus_tag="ECED1_0454"
FT   CDS_pept        complement(469372..471363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="ECED1_0454"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number="1.10.3.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90330636, 92345252,
FT                   93349845, 9378722, 98021084, 11017202, 2162835, 2168206;
FT                   Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06664"
FT                   /db_xref="GOA:B7MQE6"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06664.1"
FT   gene            complement(471385..472332)
FT                   /gene="cyoA"
FT                   /locus_tag="ECED1_0455"
FT   CDS_pept        complement(471385..472332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="ECED1_0455"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number="1.10.3.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 92112945, 92371427,
FT                   9378722, 98021084, 11017202, 1322173, 2162835, 2162837,
FT                   2165491, 2168206, 8231804, 8618822; Product type c :
FT                   carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06665"
FT                   /db_xref="GOA:B7MQE7"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06665.1"
FT   gene            complement(472792..474267)
FT                   /gene="ampG"
FT                   /locus_tag="ECED1_0456"
FT   CDS_pept        complement(472792..474267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="ECED1_0456"
FT                   /product="muropeptide transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12426329, 94049112,
FT                   7773404; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06666"
FT                   /db_xref="GOA:B7MQE8"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06666.1"
FT   gene            complement(474311..474889)
FT                   /gene="yajG"
FT                   /locus_tag="ECED1_0457"
FT   CDS_pept        complement(474311..474889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajG"
FT                   /locus_tag="ECED1_0457"
FT                   /product="putative lipoprotein"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06667"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06667.1"
FT   gene            475194..475511
FT                   /gene="bolA"
FT                   /locus_tag="ECED1_0458"
FT   CDS_pept        475194..475511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="ECED1_0458"
FT                   /product="regulator of penicillin binding proteins and beta
FT                   lactamase transcription (morphogene)"
FT                   /function="12 : Regulatory functions"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12354237, 90059998,
FT                   99291046, 8231804, 15345459, 10361282, 3053647, 2684651;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06668"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06668.1"
FT                   A"
FT   gene            475445..475708
FT                   /locus_tag="ECED1_0459"
FT   CDS_pept        475445..475708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0459"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06669"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06669.1"
FT   gene            475855..477153
FT                   /gene="tig"
FT                   /locus_tag="ECED1_0460"
FT   CDS_pept        475855..477153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="ECED1_0460"
FT                   /product="peptidyl-prolyl cis/trans isomerase (trigger
FT                   factor)"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15084258, 15175291,
FT                   91008922, 97446330, 99385349, 2197275, 2684651, 2843289,
FT                   8521806, 8612805, 9298646; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06670"
FT                   /db_xref="GOA:B7MQF2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06670.1"
FT   gene            477399..478022
FT                   /gene="clpP"
FT                   /locus_tag="ECED1_0461"
FT   CDS_pept        477399..478022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="ECED1_0461"
FT                   /product="proteolytic subunit of ClpA-ClpP and ClpX-ClpP
FT                   ATP-dependent serine proteases"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="12.3 : Protein interactions"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90324245, 90324246,
FT                   93015925, 9573050, 9575205, 2211522, 8407953, 8831780,
FT                   9390554; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06671"
FT                   /db_xref="GOA:B7MQF3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06671.1"
FT   gene            478148..479422
FT                   /gene="clpX"
FT                   /locus_tag="ECED1_0462"
FT   CDS_pept        478148..479422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="ECED1_0462"
FT                   /product="ATPase and specificity subunit of ClpX-ClpP
FT                   ATP-dependent serine protease"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12912910, 14525985,
FT                   21369885, 94043019, 94043020, 9573050, 9575205, 7743994;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06672"
FT                   /db_xref="GOA:B7MQF4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06672.1"
FT   gene            complement(479447..479602)
FT                   /locus_tag="ECED1_misc_RNA_8"
FT   misc_RNA        complement(479447..479602)
FT                   /locus_tag="ECED1_misc_RNA_8"
FT                   /product="SraJ"
FT   gene            479610..481964
FT                   /gene="lon"
FT                   /locus_tag="ECED1_0463"
FT   CDS_pept        479610..481964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="ECED1_0463"
FT                   /product="DNA-binding ATP-dependent protease La"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="12.3 : Protein interactions"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10094703, 14665623,
FT                   8939438, 91072263, 97137085, 2984174, 3042779, 3289547,
FT                   7988699, 8226758, 8294008; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06673"
FT                   /db_xref="GOA:B7MQF5"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06673.1"
FT   gene            482173..482445
FT                   /gene="hupB"
FT                   /locus_tag="ECED1_0464"
FT   CDS_pept        482173..482445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="ECED1_0464"
FT                   /product="HU, DNA-binding transcriptional regulator, beta
FT                   subunit"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="8.4 : Chromosome-associated proteins"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21150454, 21175605,
FT                   91210175, 92380498, 93013008, 9367749, 9683467, 97338083,
FT                   215461, 2187099, 2265752, 3003540, 6987059, 9298646,
FT                   9868784; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06674"
FT                   /db_xref="GOA:B7MQF6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06674.1"
FT   gene            482637..484508
FT                   /gene="ppiD"
FT                   /locus_tag="ECED1_0465"
FT   CDS_pept        482637..484508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="ECED1_0465"
FT                   /product="peptidyl-prolyl cis-trans isomerase (rotamase D)"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9670013; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06675"
FT                   /db_xref="GOA:B7MQF7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06675.1"
FT   gene            484659..485030
FT                   /gene="ybaV"
FT                   /locus_tag="ECED1_0466"
FT   CDS_pept        484659..485030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="ECED1_0466"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06676"
FT                   /db_xref="GOA:B7MQF8"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06676.1"
FT   gene            485136..485534
FT                   /gene="ybaW"
FT                   /locus_tag="ECED1_0467"
FT   CDS_pept        485136..485534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="ECED1_0467"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06677"
FT                   /db_xref="GOA:B7MQF9"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06677.1"
FT   gene            complement(485586..486281)
FT                   /gene="queC"
FT                   /locus_tag="ECED1_0468"
FT   CDS_pept        complement(485586..486281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="ECED1_0468"
FT                   /product="queuosine biosynthesis protein"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 16199558, 9367855;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06678"
FT                   /db_xref="GOA:B7MQG0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06678.1"
FT                   AMKQKTGLK"
FT   gene            complement(486346..488046)
FT                   /gene="ybaE"
FT                   /locus_tag="ECED1_0469"
FT   CDS_pept        complement(486346..488046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="ECED1_0469"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06679"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06679.1"
FT   gene            488146..488964
FT                   /gene="cof"
FT                   /locus_tag="ECED1_0470"
FT   CDS_pept        488146..488964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="ECED1_0470"
FT                   /product="thiamin pyrimidine pyrophosphate hydrolase"
FT                   /function="4.11 : Thiamine"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15292217; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06680"
FT                   /db_xref="GOA:B7MQG2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06680.1"
FT   gene            488889..489575
FT                   /gene="ybaO"
FT                   /locus_tag="ECED1_0471"
FT   CDS_pept        488889..489575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaO"
FT                   /locus_tag="ECED1_0471"
FT                   /product="putative DNA-binding transcriptional regulator
FT                   (Lrp-like)"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06681"
FT                   /db_xref="GOA:B7MQG3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06681.1"
FT                   TSLPIE"
FT   gene            489605..491377
FT                   /gene="mdlA"
FT                   /locus_tag="ECED1_0472"
FT   CDS_pept        489605..491377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="ECED1_0472"
FT                   /product="putative fused ATPase and permease component of
FT                   metabolite transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 94124004, 10850996; Product type pt :
FT                   putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06682"
FT                   /db_xref="GOA:B7MQG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06682.1"
FT                   LDDAPEIREEAIDA"
FT   gene            491370..493151
FT                   /gene="mdlB"
FT                   /locus_tag="ECED1_0473"
FT   CDS_pept        491370..493151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="ECED1_0473"
FT                   /product="putative fused ATPase and permease component of
FT                   metabolite ABC transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 94124004; Product type pt : putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06683"
FT                   /db_xref="GOA:B7MQG5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06683.1"
FT                   AGEELAASVREEESLSA"
FT   gene            493332..493670
FT                   /gene="glnK"
FT                   /locus_tag="ECED1_0474"
FT   CDS_pept        493332..493670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="ECED1_0474"
FT                   /product="nitrogen assimilation regulatory protein for
FT                   GlnL, GlnE, and AmtB"
FT                   /function="5.7 : Nitrogen metabolism"
FT                   /function="12 : Regulatory functions"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11847102, 8843440,
FT                   9720863, 99248410, 7590157, 7904973, 9733647; Product type
FT                   r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06684"
FT                   /db_xref="GOA:B7MQG6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06684.1"
FT                   GEADEAAL"
FT   gene            493700..494986
FT                   /gene="amtB"
FT                   /locus_tag="ECED1_0475"
FT   CDS_pept        493700..494986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="ECED1_0475"
FT                   /product="ammonium transporter"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 22020597, 9618533,
FT                   10931328, 1645722, 7984428; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06685"
FT                   /db_xref="GOA:B7MQG7"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06685.1"
FT   gene            complement(495035..495895)
FT                   /gene="tesB"
FT                   /locus_tag="ECED1_0476"
FT   CDS_pept        complement(495035..495895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="ECED1_0476"
FT                   /product="acyl-CoA thioesterase II"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="3.1.2.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 86139906, 91250410,
FT                   10876240; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06686"
FT                   /db_xref="GOA:B7MQG8"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06686.1"
FT                   MRNHN"
FT   gene            496113..496685
FT                   /gene="ybaY"
FT                   /locus_tag="ECED1_0477"
FT   CDS_pept        496113..496685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaY"
FT                   /locus_tag="ECED1_0477"
FT                   /product="putative lipoprotein"
FT                   /function="16.1 : Circulate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06687"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06687.1"
FT   gene            complement(496716..497105)
FT                   /gene="ybaZ"
FT                   /locus_tag="ECED1_0478"
FT   CDS_pept        complement(496716..497105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaZ"
FT                   /locus_tag="ECED1_0478"
FT                   /product="putative methylated DNA-protein cysteine
FT                   alkyltransferase"
FT                   /function="16.6 : Maintain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06688"
FT                   /db_xref="GOA:B7MQH0"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06688.1"
FT   gene            497159..497296
FT                   /gene="ffs"
FT                   /locus_tag="ECED1_misc_RNA_9"
FT   misc_RNA        497159..497296
FT                   /gene="ffs"
FT                   /locus_tag="ECED1_misc_RNA_9"
FT                   /product="4.5S"
FT   gene            497406..497759
FT                   /gene="ybaA"
FT                   /locus_tag="ECED1_0479"
FT   CDS_pept        497406..497759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="ECED1_0479"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06689"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06689.1"
FT                   RMIYGGFESIIDE"
FT   gene            complement(497801..499351)
FT                   /gene="ylaB"
FT                   /locus_tag="ECED1_0480"
FT   CDS_pept        complement(497801..499351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="ECED1_0480"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pm : putative membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06690"
FT                   /db_xref="GOA:B7MQH2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06690.1"
FT   gene            complement(499515..499985)
FT                   /gene="ylaC"
FT                   /locus_tag="ECED1_0481"
FT   CDS_pept        complement(499515..499985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="ECED1_0481"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pm : putative membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06691"
FT                   /db_xref="GOA:B7MQH3"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06691.1"
FT   gene            complement(500101..500652)
FT                   /gene="maa"
FT                   /locus_tag="ECED1_0482"
FT   CDS_pept        complement(500101..500652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="ECED1_0482"
FT                   /product="maltose O-acetyltransferase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 82180540, 91310703,
FT                   9600841; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06692"
FT                   /db_xref="GOA:B7MQH4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06692.1"
FT   gene            complement(500825..501043)
FT                   /gene="hha"
FT                   /locus_tag="ECED1_0483"
FT   CDS_pept        complement(500825..501043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="ECED1_0483"
FT                   /product="modulator of gene expression, with H-NS"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /function="13 : Signal transduction"
FT                   /function="15 : Cellular processes"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10322001, 20239026,
FT                   92065825, 98193934, 1484495, 8145648; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06693"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06693.1"
FT   gene            complement(501069..501443)
FT                   /gene="ybaJ"
FT                   /locus_tag="ECED1_0484"
FT   CDS_pept        complement(501069..501443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="ECED1_0484"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 1956303, 7984428, 14645275"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06694"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06694.1"
FT   gene            complement(501988..505137)
FT                   /gene="acrB"
FT                   /locus_tag="ECED1_0485"
FT   CDS_pept        complement(501988..505137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="ECED1_0485"
FT                   /product="multidrug efflux system protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12351840, 12654283,
FT                   15111118, 15155734, 21450803, 94012493, 10920254, 7651136;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06695"
FT                   /db_xref="GOA:B7MQH7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06695.1"
FT                   H"
FT   gene            complement(505160..506353)
FT                   /gene="acrA"
FT                   /locus_tag="ECED1_0486"
FT   CDS_pept        complement(505160..506353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="ECED1_0486"
FT                   /product="multidrug efflux system"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15155734, 21450803,
FT                   383699, 390095, 94012493, 10920254, 7651136; Product type t
FT                   : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06696"
FT                   /db_xref="GOA:B7MQH8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06696.1"
FT   gene            506495..507142
FT                   /gene="acrR"
FT                   /locus_tag="ECED1_0487"
FT   CDS_pept        506495..507142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="ECED1_0487"
FT                   /product="DNA-binding transcriptional repressor"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 96419167, 8407802,
FT                   8821940; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06697"
FT                   /db_xref="GOA:B7MQH9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06697.1"
FT   gene            507270..510632
FT                   /gene="kefA"
FT                   /locus_tag="ECED1_0488"
FT   CDS_pept        507270..510632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefA"
FT                   /locus_tag="ECED1_0488"
FT                   /product="fused conserved hypothetical protein ;
FT                   mechanosensitive channel protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 10202137; Product type t
FT                   : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06698"
FT                   /db_xref="GOA:B7MQI0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06698.1"
FT                   RDYKGDDPTPAVG"
FT   gene            complement(510844..511005)
FT                   /gene="ybaM"
FT                   /locus_tag="ECED1_0489"
FT   CDS_pept        complement(510844..511005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="ECED1_0489"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06699"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06699.1"
FT                   TRDDEAEK"
FT   gene            complement(511019..511546)
FT                   /gene="priC"
FT                   /locus_tag="ECED1_0490"
FT   CDS_pept        complement(511019..511546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="ECED1_0490"
FT                   /product="primosomal replication protein N''"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91310687, 93374896;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06700"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06700.1"
FT                   EKIENRLARLTR"
FT   gene            511616..511993
FT                   /gene="ybaN"
FT                   /locus_tag="ECED1_0491"
FT   CDS_pept        511616..511993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="ECED1_0491"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pm : putative membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06701"
FT                   /db_xref="GOA:B7MQI3"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06701.1"
FT   gene            512146..512697
FT                   /gene="apt"
FT                   /locus_tag="ECED1_0492"
FT   CDS_pept        512146..512697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="ECED1_0492"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 397764, 6787390,
FT                   6801015, 3527873, 3534795, 9573169; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06702"
FT                   /db_xref="GOA:B7MQI4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06702.1"
FT   gene            512826..514757
FT                   /gene="dnaX"
FT                   /locus_tag="ECED1_0493"
FT   CDS_pept        512826..514757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="ECED1_0493"
FT                   /product="DNA polymerase III/DNA elongation factor III, tau
FT                   and gamma subunits"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90036845, 92011792,
FT                   92156151; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06703"
FT                   /db_xref="GOA:B7MQI5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06703.1"
FT                   DEESIRPI"
FT   gene            514810..515139
FT                   /gene="ybaB"
FT                   /locus_tag="ECED1_0494"
FT   CDS_pept        514810..515139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="ECED1_0494"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 15322138, 1698765, 2674903"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06704"
FT                   /db_xref="GOA:B7MQI6"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06704.1"
FT                   FKMPF"
FT   gene            515139..515744
FT                   /gene="recR"
FT                   /locus_tag="ECED1_0495"
FT   CDS_pept        515139..515744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="ECED1_0495"
FT                   /product="gap repair protein"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11743007, 12769856,
FT                   89313692, 95166174, 95166183, 98196719, 1698765, 2674903;
FT                   Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06705"
FT                   /db_xref="GOA:B7MQI7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06705.1"
FT   gene            515854..517728
FT                   /gene="htpG"
FT                   /locus_tag="ECED1_0496"
FT   CDS_pept        515854..517728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="ECED1_0496"
FT                   /product="molecular chaperone HSP90 family"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21134381, 89174688,
FT                   91174616, 11606187, 3299380, 8419347, 9298646; Product type
FT                   f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06706"
FT                   /db_xref="GOA:B7MQI8"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06706.1"
FT   gene            517909..518553
FT                   /gene="adk"
FT                   /locus_tag="ECED1_0497"
FT   CDS_pept        517909..518553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="ECED1_0497"
FT                   /product="adenylate kinase"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 89000670, 92084653,
FT                   93156056, 99421681, 1548697, 2051480, 2223776, 2997739,
FT                   3299380, 8451239, 9298646, 9600841; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06707"
FT                   /db_xref="GOA:B7MQI9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06707.1"
FT   gene            518685..519647
FT                   /gene="hemH"
FT                   /locus_tag="ECED1_0498"
FT   CDS_pept        518685..519647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="ECED1_0498"
FT                   /product="ferrochelatase"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 93011927, 93209964,
FT                   2051480, 8056770; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06708"
FT                   /db_xref="GOA:B7MQJ0"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06708.1"
FT   gene            complement(519644..520603)
FT                   /gene="aes"
FT                   /locus_tag="ECED1_0499"
FT   CDS_pept        complement(519644..520603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="ECED1_0499"
FT                   /product="acetyl esterase"
FT                   /function="12.3 : Protein interactions"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 9401025, 98244813,
FT                   2051480, 7721718; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06709"
FT                   /db_xref="GOA:B7MQJ1"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR023508"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06709.1"
FT   gene            520755..522059
FT                   /gene="gsk"
FT                   /locus_tag="ECED1_0500"
FT   CDS_pept        520755..522059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="ECED1_0500"
FT                   /product="inosine/guanosine kinase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 90155203, 95238302,
FT                   2051480; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06710"
FT                   /db_xref="GOA:B7MQJ2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06710.1"
FT   gene            complement(522189..523865)
FT                   /gene="ybaL"
FT                   /locus_tag="ECED1_0501"
FT   CDS_pept        complement(522189..523865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="ECED1_0501"
FT                   /product="putative monovalent cation:proton antiporter
FT                   (CPA2 family)"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06711"
FT                   /db_xref="GOA:B7MQJ3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06711.1"
FT   gene            complement(524103..525323)
FT                   /gene="fsr"
FT                   /locus_tag="ECED1_0502"
FT   CDS_pept        complement(524103..525323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="ECED1_0502"
FT                   /product="fosmidomycin efflux system, member of the major
FT                   facilitator superfamily"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21450803, 97074653,
FT                   8917080; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06712"
FT                   /db_xref="GOA:B7MQJ4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06712.1"
FT                   PDNRHKD"
FT   gene            525359..525544
FT                   /locus_tag="ECED1_0503"
FT   CDS_pept        525359..525544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0503"
FT                   /product="hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06713"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06713.1"
FT                   RHTIFQHVEIRSGREV"
FT   gene            525541..527193
FT                   /gene="ushA"
FT                   /locus_tag="ECED1_0504"
FT   CDS_pept        525541..527193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="ECED1_0504"
FT                   /product="bifunctional UDP-sugar hydrolase and
FT                   5'-nucleotidase"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 11802543, 86232561,
FT                   88268957, 10331872, 9298646, 3012467; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06714"
FT                   /db_xref="GOA:B7MQJ6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06714.1"
FT   gene            complement(527032..527145)
FT                   /gene="rybC"
FT                   /locus_tag="ECED1_misc_RNA_10"
FT   misc_RNA        complement(527032..527145)
FT                   /gene="rybC"
FT                   /locus_tag="ECED1_misc_RNA_10"
FT                   /product="RybC"
FT   gene            complement(527230..527709)
FT                   /gene="ybaK"
FT                   /locus_tag="ECED1_0505"
FT   CDS_pept        complement(527230..527709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="ECED1_0505"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06715"
FT                   /db_xref="GOA:B7MQJ7"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06715.1"
FT   gene            527832..527914
FT                   /locus_tag="ECED1_misc_RNA_11"
FT   misc_RNA        527832..527914
FT                   /locus_tag="ECED1_misc_RNA_11"
FT                   /product="SRP_bact"
FT   gene            complement(527913..528707)
FT                   /gene="ybaP"
FT                   /locus_tag="ECED1_0506"
FT   CDS_pept        complement(527913..528707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="ECED1_0506"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06716"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06716.1"
FT   gene            528810..529142
FT                   /locus_tag="ECED1_0508"
FT   CDS_pept        528810..529142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0508"
FT                   /product="putative RelE/ParE family protein, cytotoxic
FT                   translational repressor of toxin-antitoxin stability
FT                   system"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06717"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06717.1"
FT                   LDPHNY"
FT   gene            529178..529519
FT                   /gene="ybaQ"
FT                   /locus_tag="ECED1_0509"
FT   CDS_pept        529178..529519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaQ"
FT                   /locus_tag="ECED1_0509"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /function="16.3 : Control"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06718"
FT                   /db_xref="GOA:B7MQK0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06718.1"
FT                   REERAKKVA"
FT   gene            complement(529577..532081)
FT                   /gene="copA"
FT                   /locus_tag="ECED1_0510"
FT   CDS_pept        complement(529577..532081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="ECED1_0510"
FT                   /product="copper transporter"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 12351646, 20105527,
FT                   11167016, 11500054, 9868784; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06719"
FT                   /db_xref="GOA:B7MQK1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06719.1"
FT   gene            532343..533275
FT                   /gene="ybaS"
FT                   /locus_tag="ECED1_0511"
FT   CDS_pept        532343..533275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaS"
FT                   /locus_tag="ECED1_0511"
FT                   /product="amidase, possibly glutaminase"
FT                   /function="6.2 : Amino acids and amines"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12952533, 10095071; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06720"
FT                   /db_xref="GOA:B7MQK2"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06720.1"
FT   gene            533278..534570
FT                   /gene="ybaT"
FT                   /locus_tag="ECED1_0512"
FT   CDS_pept        533278..534570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaT"
FT                   /locus_tag="ECED1_0512"
FT                   /product="putative nitrogen-containing metabolite
FT                   transporter"
FT                   /function="16.1 : Circulate"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06721"
FT                   /db_xref="GOA:B7MQK3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06721.1"
FT   gene            534695..535102
FT                   /gene="cueR"
FT                   /locus_tag="ECED1_0513"
FT   CDS_pept        534695..535102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="ECED1_0513"
FT                   /product="DNA-binding transcriptional activator of
FT                   copper-responsive regulon genes"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 21065101, 10915804,
FT                   11399769, 12958362; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06722"
FT                   /db_xref="GOA:B7MQK4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06722.1"
FT   gene            complement(535103..536326)
FT                   /locus_tag="ECED1_0514"
FT   CDS_pept        complement(535103..536326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECED1_0514"
FT                   /product="conserved hypothetical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06723"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06723.1"
FT                   MDDYFRKP"
FT   gene            complement(536444..536899)
FT                   /gene="ybbJ"
FT                   /locus_tag="ECED1_0515"
FT   CDS_pept        complement(536444..536899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="ECED1_0515"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pm : putative membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06724"
FT                   /db_xref="GOA:B7MQK6"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06724.1"
FT   gene            complement(536899..537816)
FT                   /gene="ybbK"
FT                   /locus_tag="ECED1_0516"
FT   CDS_pept        complement(536899..537816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="ECED1_0516"
FT                   /product="putative protease, membrane anchored"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06725"
FT                   /db_xref="GOA:B7MQK7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06725.1"
FT   gene            537962..538639
FT                   /gene="ybbL"
FT                   /locus_tag="ECED1_0517"
FT   CDS_pept        537962..538639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="ECED1_0517"
FT                   /product="putative transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06726"
FT                   /db_xref="GOA:B7MQK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06726.1"
FT                   ELA"
FT   gene            538626..539405
FT                   /gene="ybbM"
FT                   /locus_tag="ECED1_0518"
FT   CDS_pept        538626..539405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="ECED1_0518"
FT                   /product="putative permease of an ABC transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06727"
FT                   /db_xref="GOA:B7MQK9"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06727.1"
FT   gene            complement(539468..540322)
FT                   /gene="ybbN"
FT                   /locus_tag="ECED1_0519"
FT   CDS_pept        complement(539468..540322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="ECED1_0519"
FT                   /product="putative thioredoxin domain-containing protein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06728"
FT                   /db_xref="GOA:B7MQL0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06728.1"
FT                   LLY"
FT   gene            complement(540383..541192)
FT                   /gene="ybbO"
FT                   /locus_tag="ECED1_0520"
FT   CDS_pept        complement(540383..541192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbO"
FT                   /locus_tag="ECED1_0520"
FT                   /product="putative oxidoreductase with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06729"
FT                   /db_xref="GOA:B7MQL1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06729.1"
FT   gene            complement(541182..541808)
FT                   /gene="tesA"
FT                   /locus_tag="ECED1_0521"
FT   CDS_pept        complement(541182..541808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /locus_tag="ECED1_0521"
FT                   /product="multifunctional acyl-CoA thioesterase I and
FT                   protease I and lysophospholipase L1"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="3.1.2.-"
FT                   /EC_number=""
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 91270121, 91324311,
FT                   93163029, 93252782, 94179121, 99353977, 1864840, 8432696,
FT                   8098033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06730"
FT                   /db_xref="GOA:B7MQL2"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06730.1"
FT   gene            541776..542462
FT                   /gene="ybbA"
FT                   /locus_tag="ECED1_0522"
FT   CDS_pept        541776..542462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="ECED1_0522"
FT                   /product="putative transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06731"
FT                   /db_xref="GOA:B7MQL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06731.1"
FT                   QLQEEA"
FT   gene            542459..544873
FT                   /gene="ybbP"
FT                   /locus_tag="ECED1_0523"
FT   CDS_pept        542459..544873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="ECED1_0523"
FT                   /product="putative ABC transporter permease"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06732"
FT                   /db_xref="GOA:B7MQL4"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06732.1"
FT   gene            complement(545114..546208)
FT                   /gene="ybbB"
FT                   /locus_tag="ECED1_0524"
FT   CDS_pept        complement(545114..546208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="ECED1_0524"
FT                   /product="tRNA 2-selenouridine synthase,
FT                   selenophosphate-dependent"
FT                   /function="10 : Protein synthesis"
FT                   /function="12.3 : Protein interactions"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 14594807, 1766878;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06733"
FT                   /db_xref="GOA:B7MQL5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7MQL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06733.1"
FT   gene            complement(546277..547203)
FT                   /gene="ybbS"
FT                   /locus_tag="ECED1_0525"
FT   CDS_pept        complement(546277..547203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbS"
FT                   /locus_tag="ECED1_0525"
FT                   /product="putative DNA-binding transcriptional activator of
FT                   the allD operon"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12460564, 10601204; Product type pr :
FT                   putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECED1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAR06734"
FT                   /db_xref="GOA:B7MQL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7MQL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAR06734.1"
FT   gene            547433..547915
FT                   /gene="allA"
FT                   /locus_tag="ECED1_0526"
FT   CDS_pept        547433..547915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="ECED1_0526"
FT                   /product="u