(data stored in ACNUC22050 zone)

EMBL: CU928165

ID   CU928165; SV 1; linear; genomic DNA; STD; FUN; 687718 BP.
XX
AC   CU928165;
XX
PR   Project:PRJNA12499;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Lachancea thermotolerans CBS 6340 chromosome A complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans CBS 6340
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-687718
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-687718
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   MD5; c43e3f57650863ee88e3738dfca1527c.
DR   BioSample; SAMEA3138300.
DR   CABRI; CBS 6340.
DR   EnsemblGenomes-Gn; ENSRNA049513220.
DR   EnsemblGenomes-Gn; ENSRNA049513275.
DR   EnsemblGenomes-Gn; ENSRNA049513317.
DR   EnsemblGenomes-Gn; ENSRNA049561151.
DR   EnsemblGenomes-Gn; ENSRNA049561212.
DR   EnsemblGenomes-Gn; ENSRNA049561248.
DR   EnsemblGenomes-Gn; ENSRNA049561298.
DR   EnsemblGenomes-Gn; ENSRNA049561354.
DR   EnsemblGenomes-Gn; ENSRNA049561408.
DR   EnsemblGenomes-Gn; ENSRNA049561465.
DR   EnsemblGenomes-Gn; ENSRNA049561518.
DR   EnsemblGenomes-Gn; ENSRNA049561572.
DR   EnsemblGenomes-Gn; ENSRNA049561618.
DR   EnsemblGenomes-Gn; ENSRNA049561668.
DR   EnsemblGenomes-Gn; ENSRNA049561723.
DR   EnsemblGenomes-Gn; ENSRNA049561810.
DR   EnsemblGenomes-Gn; ENSRNA049561848.
DR   EnsemblGenomes-Gn; KLTH0A00330r.
DR   EnsemblGenomes-Gn; KLTH0A01100r.
DR   EnsemblGenomes-Gn; KLTH0A01518r.
DR   EnsemblGenomes-Gn; KLTH0A01606r.
DR   EnsemblGenomes-Gn; KLTH0A01738r.
DR   EnsemblGenomes-Gn; KLTH0A02002r.
DR   EnsemblGenomes-Gn; KLTH0A02574r.
DR   EnsemblGenomes-Gn; KLTH0A03014r.
DR   EnsemblGenomes-Gn; KLTH0A03784r.
DR   EnsemblGenomes-Gn; KLTH0A03806r.
DR   EnsemblGenomes-Gn; KLTH0A03828r.
DR   EnsemblGenomes-Gn; KLTH0A04488r.
DR   EnsemblGenomes-Gn; KLTH0A06490r.
DR   EnsemblGenomes-Gn; KLTH0A07788r.
DR   EnsemblGenomes-Gn; KLTH0A07898r.
DR   EnsemblGenomes-Tr; EFT00001979013.
DR   EnsemblGenomes-Tr; EFT00001979014.
DR   EnsemblGenomes-Tr; EFT00001979015.
DR   EnsemblGenomes-Tr; EFT00001979016.
DR   EnsemblGenomes-Tr; EFT00001979017.
DR   EnsemblGenomes-Tr; EFT00001979018.
DR   EnsemblGenomes-Tr; EFT00001979019.
DR   EnsemblGenomes-Tr; EFT00001979020.
DR   EnsemblGenomes-Tr; EFT00001979022.
DR   EnsemblGenomes-Tr; EFT00001979023.
DR   EnsemblGenomes-Tr; EFT00001979024.
DR   EnsemblGenomes-Tr; EFT00001979025.
DR   EnsemblGenomes-Tr; EFT00001979026.
DR   EnsemblGenomes-Tr; EFT00001979027.
DR   EnsemblGenomes-Tr; EFT00001979028.
DR   EnsemblGenomes-Tr; EFT00001979029.
DR   EnsemblGenomes-Tr; KLTH0A00330r-1.
DR   EnsemblGenomes-Tr; KLTH0A01100r-1.
DR   EnsemblGenomes-Tr; KLTH0A01518r-1.
DR   EnsemblGenomes-Tr; KLTH0A01606r-1.
DR   EnsemblGenomes-Tr; KLTH0A01738r-1.
DR   EnsemblGenomes-Tr; KLTH0A02002r-1.
DR   EnsemblGenomes-Tr; KLTH0A02574r-1.
DR   EnsemblGenomes-Tr; KLTH0A03014r-1.
DR   EnsemblGenomes-Tr; KLTH0A03784r-1.
DR   EnsemblGenomes-Tr; KLTH0A03806r-1.
DR   EnsemblGenomes-Tr; KLTH0A03828r-1.
DR   EnsemblGenomes-Tr; KLTH0A04488r-1.
DR   EnsemblGenomes-Tr; KLTH0A06490r-1.
DR   EnsemblGenomes-Tr; KLTH0A07788r-1.
DR   EnsemblGenomes-Tr; KLTH0A07898r-1.
DR   EuropePMC; PMC2765284; 19525356.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF01201; snR40.
DR   RFAM; RF01239; snR49.
DR   RFAM; RF01263; snR191.
DR   StrainInfo; 318472; 0.
XX
CC   The Lachancea thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..687718
FT                   /organism="Lachancea thermotolerans CBS 6340"
FT                   /chromosome="A"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0A"
FT                   /db_xref="taxon:559295"
FT   gene            complement(<2436..>2909)
FT                   /locus_tag="KLTH0A00110g"
FT                   /old_locus_tag="KLTH-ORF17112"
FT   CDS_pept        complement(2436..2909)
FT                   /locus_tag="KLTH0A00110g"
FT                   /old_locus_tag="KLTH-ORF17112"
FT                   /product="KLTH0A00110p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21032"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB75"
FT                   /protein_id="CAR21032.1"
FT                   /translation="MKVCTRVEINAPASVVRETLLDFSGHAKWNPFFTSIVLFEHDGHD
FT                   LSSQIKPGDRLEVTMKDIRSGKVNKFTPTVLANTVNKFKWEGSLIGQWFFSGIHTFEFQ
FT                   EENGGQKCTLLQHETFSGVALPLLKPVLGGAQRNFEAMNNALKKACESQDEHK"
FT   repeat_region   3693..4109
FT                   /locus_tag="KLTH0A00132t"
FT                   /old_locus_tag="Klth0A.LTR.1"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <5329..>6715
FT                   /pseudo
FT                   /locus_tag="KLTH0A00154g"
FT                   /old_locus_tag="pseudo-Klth0A-5329-6715"
FT   gene            <7412..>9082
FT                   /pseudo
FT                   /locus_tag="KLTH0A00176g"
FT                   /old_locus_tag="pseudo-Klth0A-7412-9082"
FT   gene            <10527..>11932
FT                   /pseudo
FT                   /locus_tag="KLTH0A00198g"
FT                   /old_locus_tag="pseudo-Klth0A-10527-11932"
FT   gene            complement(<17344..>17547)
FT                   /locus_tag="KLTH0A00220g"
FT                   /old_locus_tag="KLTH-ORF17090"
FT   CDS_pept        complement(17344..17547)
FT                   /locus_tag="KLTH0A00220g"
FT                   /old_locus_tag="KLTH-ORF17090"
FT                   /product="KLTH0A00220p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21033"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB76"
FT                   /protein_id="CAR21033.1"
FT                   /translation="MPELGGSAPALIIFTGKVVIFELNSTAVHFKRFMEFHNSQLDGTV
FT                   ETLKNHSQYCQIALTPSEYIYS"
FT   gene            <18502..>19083
FT                   /locus_tag="KLTH0A00242g"
FT                   /old_locus_tag="KLTH-ORF17089"
FT   CDS_pept        18502..19083
FT                   /locus_tag="KLTH0A00242g"
FT                   /old_locus_tag="KLTH-ORF17089"
FT                   /product="KLTH0A00242p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21034"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB77"
FT                   /protein_id="CAR21034.1"
FT                   /translation="MAVKHILMIAGDFVEDYEIMVPFQILLMVGHKVDVVSPEKKAGEK
FT                   IATAIHDFEGHQTYTEKPGHNFMLNATYSNVQADDYDALVIPGGRAPEHLGTNESVLNL
FT                   VRAFANANKPIAAICHGPQLLAAANVISGRKVSAYPACRAEIIVAGAQYQAIAIDGAVT
FT                   DGKLVTAPAWPAHPAWMSQFLKVLGSKIEA"
FT   gene            complement(<21453..>21722)
FT                   /locus_tag="KLTH0A00264g"
FT                   /old_locus_tag="KLTH-ORF17085"
FT   CDS_pept        complement(21453..21722)
FT                   /locus_tag="KLTH0A00264g"
FT                   /old_locus_tag="KLTH-ORF17085"
FT                   /product="KLTH0A00264p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21035"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB78"
FT                   /protein_id="CAR21035.1"
FT                   /translation="MNELLYSSGKWPSPRCVFEGEQCHFIFQNIVEDPGQYDLHDKELI
FT                   ESAMRIYNTQFGAWWREFLETRISNITEGIKDILPRDNYRCTSL"
FT   repeat_region   complement(22324..22612)
FT                   /locus_tag="KLTH0A00286t"
FT                   /old_locus_tag="Klth0A.LTR.2"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <23428..>25053
FT                   /locus_tag="KLTH0A00308g"
FT                   /old_locus_tag="KLTH-ORF17082"
FT   CDS_pept        23428..25053
FT                   /locus_tag="KLTH0A00308g"
FT                   /old_locus_tag="KLTH-ORF17082"
FT                   /product="KLTH0A00308p"
FT                   /note="weakly similar to uniprot|P53388 Saccharomyces
FT                   cerevisiae YPL265W Dicarboxylic amino acid permease,
FT                   mediates high-affinity and high-capacity transport of L-
FT                   glutamate and L-aspartate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21036"
FT                   /db_xref="GOA:C5DB79"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB79"
FT                   /protein_id="CAR21036.1"
FT                   /translation="MTNEKEELPSGELKKTEAVQVCETYEADSVEPQNANEPEEGVLYN
FT                   DRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQI
FT                   AIAEVASFMPATGATIRHAEQFIDESVGFTFGWISTYSSLMPGELSATAVVMRYWTDIN
FT                   PAVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGAKQERLG
FT                   FHYWREPGPFAEYIVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHG
FT                   ARNVFLRIIVLYLIAVLVLTLIVPYNDKLIATGTGTAKSSPYVIAIQRANIKILPHIIN
FT                   AIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFLPLSY
FT                   MSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCLGPF
FT                   AAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTKYLRP
FT                   AEVDLESIFEDIRQNPEITLATTT"
FT   gene            complement(<27377..>27449)
FT                   /locus_tag="KLTH0A00330r"
FT                   /old_locus_tag="Klth0A.tLys.CTT.14"
FT   tRNA            complement(27377..27449)
FT                   /locus_tag="KLTH0A00330r"
FT                   /old_locus_tag="Klth0A.tLys.CTT.14"
FT                   /note="tRNA-Lys (CTT) cove score=77.79"
FT   repeat_region   complement(27559..27975)
FT                   /locus_tag="KLTH0A00352t"
FT                   /old_locus_tag="Klth0A.LTR.3"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <29810..>30532
FT                   /locus_tag="KLTH0A00374g"
FT                   /old_locus_tag="KLTH-ORF17077"
FT   CDS_pept        29810..30532
FT                   /locus_tag="KLTH0A00374g"
FT                   /old_locus_tag="KLTH-ORF17077"
FT                   /product="KLTH0A00374p"
FT                   /note="similar to uniprot|P36087 Saccharomyces cerevisiae
FT                   YKL070W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21037"
FT                   /db_xref="GOA:C5DB80"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB80"
FT                   /protein_id="CAR21037.1"
FT                   /translation="MYIPKLTSVDDFDKQARTIKDHPLGILFSYSAPKIALTDFLLGDK
FT                   IDKPVDSEMCATHVPFFLQKSQDGSCRLVAHLAGKNQQIKLLKENPSCMVVFQGPNSYV
FT                   TPAWYPEKEETHKFVPTWDYSCVHVYGKAKIIEEKEWLLKMLDSLTDQEENKRPDRDEF
FT                   ESKWKVEQTNQKYLDSLIKGIVGLEIEVSHIQSKLKVHQNQNPKNVNGVLRGYEMEMGD
FT                   DTAKQMCKLVRENYPREL"
FT   gene            <31516..>33679
FT                   /pseudo
FT                   /locus_tag="KLTH0A00396g"
FT                   /old_locus_tag="pseudo-Klth0A-31516-33679"
FT   gene            complement(<34685..>35755)
FT                   /locus_tag="KLTH0A00418g"
FT                   /old_locus_tag="KLTH-ORF17070"
FT   CDS_pept        complement(34685..35755)
FT                   /locus_tag="KLTH0A00418g"
FT                   /old_locus_tag="KLTH-ORF17070"
FT                   /product="KLTH0A00418p"
FT                   /note="similar to uniprot|P00331 Saccharomyces cerevisiae
FT                   YMR303C ADH2 Glucose-repressible alcohol dehydrogenase II
FT                   involved in the production of certain carboxylate esters"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21038"
FT                   /db_xref="GOA:C5DB81"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB81"
FT                   /protein_id="CAR21038.1"
FT                   /translation="MTEKLPSSIPLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVK
FT                   FSGVCHSDLHAWKGDWPTKTKLPLVGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCC
FT                   MSCEQCELSNEPNCAYADISGFTRDGSFQQYATADAVQAARIPPGTNLAEVSPVLCAGI
FT                   TVFKALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYSVVGIDSGAEKEHLFNDLGG
FT                   DVFLDFSKSENLVPEVVSATGGGGGAHGVLNLSASENAINTSVRFCRANGVIVLVGIPS
FT                   GATCVSEVFDHVVKSIKIVGSSVGNRADTREALDFYSRGLIRPAIKVAGLSQVPQIFKK
FT                   MDNGEIVGRCVVNTGE"
FT   gene            <37100..>38848
FT                   /locus_tag="KLTH0A00440g"
FT                   /old_locus_tag="KLTH-ORF17068"
FT   CDS_pept        37100..38848
FT                   /locus_tag="KLTH0A00440g"
FT                   /old_locus_tag="KLTH-ORF17068"
FT                   /product="KLTH0A00440p"
FT                   /note="weakly similar to uniprot|P53389 Saccharomyces
FT                   cerevisiae YNR055C HOL1 Putative ion transporter similar to
FT                   the major facilitator superfamily of transporters;
FT                   mutations in membrane-spanning domains permit nonselective
FT                   cation uptake"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21039"
FT                   /db_xref="GOA:C5DB82"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB82"
FT                   /protein_id="CAR21039.1"
FT                   /translation="MTTVIDYNVIPGDSHLVDFDETRKSGEREGKIVLNPTPSDDPDDP
FT                   LNWTPRRKWTAVACVLIYTLGACIPTAAIYSVLPNIEANTNITLSELNNGTGYMFLFLG
FT                   LGCLIFQPLALQFGKRPIYLFSMLATALICVWPPYTKSNGEWVASKILQGFVGSSMESL
FT                   PEISMSDLFFEHERSFALSLYGLTLLSASFLAPFVAGFISEGQGWEWVMWWCAIFGAVC
FT                   FVLLFFLMEETNYDRKLKVDAATGEVITLASRKQQLGAVFTNIDEVIASNSEGNNAGEK
FT                   NETKTNDIGASLQTEEYPENINIVNQVSNVEVVDSNSYAPNYEGTKTYLQKLSLFGGRR
FT                   KKFLLQHYIFAPFLMARFPVVLWAGFLYGSSLVWFNVLNATAALILGGSPYDFSSSTIG
FT                   VAYLSPTIFSVILFFISGLCSDWLKVRVALWRGTGLSKPEDRLWILVIYCVLGCAASIL
FT                   WGVGAYYEIHWFGLVFGMGLLGGCGIFGIASSATYVVDTYKELDTEAMVVVIIIRNCMS
FT                   FGVSYGITDWVTDLGYKKCFISVAFLCFAANFTFLAMVYFGPRLRNRQKHMYWSMVDKY
FT                   RKLGMH"
FT   gene            <40190..>41299
FT                   /locus_tag="KLTH0A00462g"
FT                   /old_locus_tag="KLTH-ORF17065"
FT   CDS_pept        40190..41299
FT                   /locus_tag="KLTH0A00462g"
FT                   /old_locus_tag="KLTH-ORF17065"
FT                   /product="KLTH0A00462p"
FT                   /note="some similarities with uniprot|Q04179 Saccharomyces
FT                   cerevisiae YDR400W URH1 uridine nucleosidase (uridine
FT                   ribohydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21040"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB83"
FT                   /protein_id="CAR21040.1"
FT                   /translation="MKCLQTVLASAICLISKAAAEVFIVDNDTPTALQVLLPLAAGKQV
FT                   LGITTNLGDYDTDAATYEAAMALSTGNLTSCVPVYKGAEQPLLLDYNTYHLWQDLYGDI
FT                   VWQGAWDKDYESPVPVNASYEYNKTVGAPQWIMDTVKNSKDNVTIVAAGTMTNLALALA
FT                   QWPAMAEKVKLVIMGGYVDGQIAQTTGGDFVNDMYTDFNLMVDPEAAQTALSAPWKELV
FT                   IVGNISSEIFPTQDLYNELIAVSGGLAEIKSNKSLGYVSETVGNGTLPSFNLPYWDEVA
FT                   SAIAADPEIVTASYDAYVSVDTSFSSPFYGSLRIYPANLRAKKGVRTGKAKMITSIDEG
FT                   KLNAMIVDALVRDWTNYCKTGSAPSVAIM"
FT   gene            <42443..>44149
FT                   /locus_tag="KLTH0A00484g"
FT                   /old_locus_tag="KLTH-ORF17061"
FT   CDS_pept        42443..44149
FT                   /locus_tag="KLTH0A00484g"
FT                   /old_locus_tag="KLTH-ORF17061"
FT                   /product="KLTH0A00484p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21041"
FT                   /db_xref="GOA:C5DB84"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB84"
FT                   /protein_id="CAR21041.1"
FT                   /translation="MPHRSKTACALCKAEKKCCDKKRPKCSHCTDENVACSYPLTLRWG
FT                   GRPYKDKTKQIKIPKNTVLVDGVLMVRDKSHLSPNRYERRSRLVLINEGPVFTKDITKG
FT                   KVRKAVEGASEESSVQISNPCYFTPQGSMPSLKLLNCSLEHSTFFEFYVYKTSYHFVAL
FT                   NKGCKSNPFHTIVPQMAMFNPSLMKLVMAFGGEHRERFRRLENPQLCYSLDEDFVGKKP
FT                   LTMTGQELLKQGVMELVDQLASPKTVIDDTVLASVLVLASFCIYFGTIENKWHAHLYGA
FT                   EGIILRELKEKSKIEKGLLRYTCEQGPYFFLRRWFAYMRIWGCISSASFRQKTVERPLL
FT                   EIDFEEAQDPRRHKNGDVDYALYTSGMESLVLSYLAQVANLILKSETRPPGSDREYIFR
FT                   DAVELEYKIMNYLGSRKQEGEASLKRFLPLTEGAPCDSTKQYSILIATNMLFGLTGVLQ
FT                   LRRRVLGLTHESLLVQNLVLKITDLIEKKLSTGTFVQPCLLFCFFSCGCELLDESLVPK
FT                   RTLFLNLLDSLIRDGVESARQARSAMQECWRTSKPWWEVLKERGLDICFAI"
FT   gene            complement(<44472..>45476)
FT                   /locus_tag="KLTH0A00506g"
FT                   /old_locus_tag="KLTH-ORF17058"
FT   CDS_pept        complement(44472..45476)
FT                   /locus_tag="KLTH0A00506g"
FT                   /old_locus_tag="KLTH-ORF17058"
FT                   /product="KLTH0A00506p"
FT                   /note="similar to uniprot|Q07589 Saccharomyces cerevisiae
FT                   YDL144C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21042"
FT                   /db_xref="GOA:C5DB85"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB85"
FT                   /protein_id="CAR21042.1"
FT                   /translation="MPNKPNVLLVGAGGVGAMASFALEYSGESSVTSVLRSDYAHVVEN
FT                   GFKINSCDYGRGIRYRPSNVVNSIEASKQYGPFDYVVLATKCIPGVSSMIDIIAPAVSK
FT                   DTAIVLIQNGIGIEDEALFKCPGNVILSGVSMIASSNVKGHIEHSDRDFLSVGYFENVN
FT                   LTNEHQEKVCKRFVSMYKNDKNQCVFDENVKYSRWRKLVYNACLNPVCALTEADVGRLE
FT                   IFGGTDSIIRKAMKEVIAIAKSDGVELSEALMDFMIRSKDPVYYRPSMLVDIDKGNPLE
FT                   VEVICGNPVRIAKKNGVEAPYLTLIYDLLKVVQGRIMEKRGMLIVPKERQVPK"
FT   gene            complement(<46253..>47173)
FT                   /locus_tag="KLTH0A00528g"
FT                   /old_locus_tag="KLTH-ORF17057"
FT   CDS_pept        complement(46253..47173)
FT                   /locus_tag="KLTH0A00528g"
FT                   /old_locus_tag="KLTH-ORF17057"
FT                   /product="KLTH0A00528p"
FT                   /note="similar to uniprot|P14065 Saccharomyces cerevisiae
FT                   YOR120W GCY1 Putative NADP( ) coupled glycerol
FT                   dehydrogenase proposed to be involved in an alternative
FT                   pathway for glycerol catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21043"
FT                   /db_xref="GOA:C5DB86"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB86"
FT                   /protein_id="CAR21043.1"
FT                   /translation="MATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHID
FT                   TAAIYRNEAAVGRAIRDSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYL
FT                   MHFPVALKTDLIKDGNVLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVS
FT                   NFSIKNIEEILKPELGLSVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESS
FT                   MLTDPDLIKLAEKHQVEPAQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQ
FT                   ISKILEKLGSKRYVSPSWAPFPMYE"
FT   gene            complement(<49572..>53438)
FT                   /locus_tag="KLTH0A00550g"
FT                   /old_locus_tag="KLTH-ORF17050"
FT   CDS_pept        complement(49572..53438)
FT                   /locus_tag="KLTH0A00550g"
FT                   /old_locus_tag="KLTH-ORF17050"
FT                   /product="KLTH0A00550p"
FT                   /note="some similarities with uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019C MUC1 GPI-anchored cell surface
FT                   glycoprotein required for diploid pseudohyphal formation
FT                   and haploid invasive growth transcriptionally regulated by
FT                   the MAPK pathway (via Ste12p and Tec1p) and the cAMP
FT                   pathway (via Flo8p)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21044"
FT                   /db_xref="InterPro:IPR018789"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB87"
FT                   /protein_id="CAR21044.1"
FT                   /translation="MRCIWALSALTALTSTAVGSPLQKRCSNPRQNTGPKESQATCTEI
FT                   TNGCPNLDFTWKPKNTGQMLYDISMKKVQWVKDNIYEITVHVQGEKNIAISCIDGLKVI
FT                   GINGPDGGTFWLYDRNNNIAKVDSPTDYDATFRVYGQEDTSNCRVWMPNFQIQYDYNNQ
FT                   CDVYGNSKSFGLITGCNNYDNQGHSKTDAPGFYWSYQCSGKSSCGASSASSVFSTTQLT
FT                   SATSKTCTKNKPTTTSCTKNKPTTTSCTKSKTQTTSESSSTETTETYTKPSCTKSKTQT
FT                   TPETPSTETTETHTKPSCTKSKFSKTSCTKSKTQTTPETPSTETTETHTKPSCTKSKFS
FT                   KTSCTKSKTQTTPETPSTETTETHTKPSCTKSKFSKTSCTKKSKSTTPLTPSTAPGTTV
FT                   PSTTYYPSSSAPVSESSSTCQTVVTSTVSGSTTVYTTTCSTPVSETTTPETPVGPSTAP
FT                   GTTIPGTRSCSTSPGTTVPGTTYYPSSSSSGFGNSSVPVTSAPSSSAPVSEFSSTPVSS
FT                   APSSSAPVSESSSTCQTVVTSTVSGSTTVYTTTCSTPVSETSSTPETTAPSSSAPVSEF
FT                   SSTPVSSAPSSSAPVSEFSSTPVSSAPSSSAPVSEFSSTPVSSAPSSSAPVSESSSTCQ
FT                   TVVTSTVSGSTTVYTTTCSTPVSETSSTPVSSAPSSSAPVSSVPHSTPYYHNTTTAAGT
FT                   GSTSYPVSLSSTPVTSGSGTPATSGSVPATSGSVPATSGTPATSGSVPATSETTPATSG
FT                   TPATSGSVPATSETTPATSGSVPATSGTPATSGSVPATSETTPATSGSVPATSGTPATS
FT                   GSVPATSETTPATSGSIPATSGTPATSGSVPATSETTPATSGTPATSGSVPATSETTPA
FT                   TSGSVPATSGTPATSGSVPATSETTPATSGTPATSGSVPATSETTPATSGSVPATSGTP
FT                   ATSGSVPATSETTPATSGSVPATSGTPATSGSVPATSETTPATSGTPATSGSVPATSGS
FT                   IPTTSTCQTIVKSAVSGTTTIFTTTCPESTLPTTTGPAQTESVVTVTESGTVTSYTTTC
FT                   PITEVEPTTTGPDNAKTVLVSSVSGTVTSYTTTLPASESQPATTAPASSESVVVSSASG
FT                   TVTSYTTTLPASESQPATTAPASSESVVVSSASGTPVTESIVTDTVSGTTTIYTTTCPV
FT                   SSAVETTSPGPANSEIVTTSTISGTETVYTTTAPLSSAQKTEAASPSGSQTKSVESSPA
FT                   YSGSYTTPGASGSYVTQTPSSSLEVQSSSSVAAVSTTAGVSTFEGAANKLRAGLLLAIP
FT                   LALL"
FT   gene            complement(<56698..>58713)
FT                   /locus_tag="KLTH0A00572g"
FT                   /old_locus_tag="KLTH-ORF17023"
FT   CDS_pept        complement(56698..58713)
FT                   /locus_tag="KLTH0A00572g"
FT                   /old_locus_tag="KLTH-ORF17023"
FT                   /product="KLTH0A00572p"
FT                   /note="weakly similar to uniprot|Q08905 Saccharomyces
FT                   cerevisiae YOR381W FRE3 Ferric reductase reduces
FT                   siderophore-bound iron prior to uptake by transporters
FT                   expression induced by low iron levels"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21045"
FT                   /db_xref="GOA:C5DB88"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB88"
FT                   /protein_id="CAR21045.1"
FT                   /translation="MSNALRAVALSFHSRPLPESLQLMITCVSEVNRYAWLWNGDEGGP
FT                   FYGKACGQYAPSMQTALQCFVTYGAEGSVEEKLAPFTKYCSLFAGSQLTLEDYAAALEN
FT                   GTRFLRDGASVGYGQPLATPIVLPERTMLANLKYFHYIYYNFSAAFSFSLLINLAVAAA
FT                   VVIAAVAKHSRANDKVTRFVRAKLLVPSIFGTAHHGETRTLPFYRVLLPTRGEAVLLAA
FT                   FLALNVALACYNYPLVSTGFDTKAMFLLKCVANRTGGLGFGLIPLTVLLAGRNNALQWL
FT                   TGMPFSSMMFFHKWASRTMALHSLAHALLWFVYGIYGQPEPVASMFYDFAYWRWGIYAT
FT                   LACAALLVHSAHSIKARWYEVFVVLHVTLALLFLVACLKHCAEFGWLGWIYLALGIWGS
FT                   DRALRLWRLFFRFGGYTHGYAHVISAEDHIYKIVVPHVDFSRFRFFPGCYAFLHVQGRR
FT                   WFWQSHPFTLMRAGEGLEILLKAKEGLTRDLLRALPRDGAKVPLRLALEGPYGHEAPLQ
FT                   TYRNVLVVSSGAGIPGPMSYLQKLTLAPGHVRRFAFVWAVPTEGLLESMHGSLLAAAEH
FT                   VRAAAATTCFELRIHVTRPRPGAQRPAWVPAEFVVSYGRPRVHEIVRRFCDAADGPIAV
FT                   TSCANPALDDLVRRYVSEQIARSAHRVDYYDELQVW"
FT   gene            complement(<59312..>60421)
FT                   /locus_tag="KLTH0A00594g"
FT                   /old_locus_tag="KLTH-ORF17018"
FT   CDS_pept        complement(59312..60421)
FT                   /locus_tag="KLTH0A00594g"
FT                   /old_locus_tag="KLTH-ORF17018"
FT                   /product="KLTH0A00594p"
FT                   /note="similar to uniprot|P07257 Saccharomyces cerevisiae
FT                   YPR191W QCR2 40 kDa ubiquinol cytochrome-c reductase core
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21046"
FT                   /db_xref="GOA:C5DB89"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB89"
FT                   /protein_id="CAR21046.1"
FT                   /translation="MIGSRTRMAGARQLARHYHISAKDSASKVSTLAVRVHAGARYAPK
FT                   EGLAHLLSRFNFHNTGNKSALRLVRESELLGGRFESTVDREYITLKATFLKEDLPYYVS
FT                   ALGDVVYKTSYRPHELPESVLPAAHHDLAVAQACPVKSAENLLYSTVFRSDLGNAVLYD
FT                   AVQKVSLDDIKAYADKVYTRDNIEIAGQGVNESDLKRFVNDSLFASLPQGTSLAKEATP
FT                   KTFVGETRLRSAEGDSVAAIAVPVAKADFATYQVLATYLTSALSDLSPLVTKAKLDQYS
FT                   NAGLFSLYVKGSDAAVVSENIKKVVATLKTGKDISAAKGAAALQLALHNETAAFPVQLS
FT                   LDNVKDFKLGKFSYAAVGDVAKLPFADEL"
FT   gene            <61421..>63292
FT                   /locus_tag="KLTH0A00616g"
FT                   /old_locus_tag="KLTH-ORF17013"
FT   CDS_pept        61421..63292
FT                   /locus_tag="KLTH0A00616g"
FT                   /old_locus_tag="KLTH-ORF17013"
FT                   /product="KLTH0A00616p"
FT                   /note="similar to uniprot|P32349 Saccharomyces cerevisiae
FT                   YPR190C RPC82 RNA polymerase III subunit C82"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21047"
FT                   /db_xref="GOA:C5DB90"
FT                   /db_xref="InterPro:IPR008806"
FT                   /db_xref="InterPro:IPR013197"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039748"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB90"
FT                   /protein_id="CAR21047.1"
FT                   /translation="MATNSASPESLDDKEVINGSVASLEARGLNPESFLYRELCKTHLG
FT                   ERAAAVMNMLVSKGRLSARELCDRLDMDLKSVKRILVSLVQLRCVQYCAETSVSGRTTV
FT                   YYSYCEDGLLLMLYAGEIVEAMQVHFQSDLAAQIVQNVLALGSLTLKAYLSSGLSEVSP
FT                   SEVSAYFLRLFEAGFLVPLTANDYCPVSELWTRLYKKEYDLIPKNSTLSDLKKRTEAKQ
FT                   KAKKQFYQLVGPPDASSFIVTDPRTSLRQVADSVPLTFSLGRYLKLKRSKQLVQFSAAK
FT                   VGKVPAALYKIALRMTERSSPEITDPLTKTGLLQDADELAATQDEAARAEEKNPGVTFN
FT                   AMDISKHLSDDIDLRGTIASQMKRQRPSSAEVQSHKRVKTEDGFVVPPPPANNGAEADE
FT                   MADDNIDLDLDDSDTDPHSVTLINGHLKLLASSTVSFLQEPQPGLYYVPYTRLMPLLKS
FT                   SVYEALLSYTLGGSACRILRCIRDNNLATEKLINSTALMREKDIRSVIATLIRYNAVEI
FT                   QEVPRTADRAASRSVFLFRNNPRHAYDFMTKNLTWNIANLYHKIEDLKSENSTLLQKAN
FT                   REDVKGKETELLLPSELNQLKMVNERELNALTRTQRLLLLWEVFRFF"
FT   gene            complement(<63363..>67598)
FT                   /locus_tag="KLTH0A00638g"
FT                   /old_locus_tag="KLTH-ORF17010"
FT   CDS_pept        complement(63363..67598)
FT                   /locus_tag="KLTH0A00638g"
FT                   /old_locus_tag="KLTH-ORF17010"
FT                   /product="KLTH0A00638p"
FT                   /note="similar to uniprot|P17883 Saccharomyces cerevisiae
FT                   YPR189W SKI3 dsRNA virus protection family member contains
FT                   8 copies of the tetratricopeptide (TPR) domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21048"
FT                   /db_xref="GOA:C5DB91"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039226"
FT                   /db_xref="InterPro:IPR040962"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB91"
FT                   /protein_id="CAR21048.1"
FT                   /translation="MAELKQLLKDAKNALASEDYEQSIEKSKEVLNLDKNNYFAHVFLG
FT                   KAFSCTGDLAQSKKHYKAAIDMDPGNMLAWKGIFMLFRTANIAPTIVSFDEFFDLCGEY
FT                   AEHLVQQQLPMVDLVNDIRNFKNFYRDCQESYLRHMRPGTPMAERLSRHLITPQDALQG
FT                   LLNIVSAEEQQQVSKLVSRERLKISANQPDYNLKVNSIAWQVYQDSEIDELYQQLINIT
FT                   DDDEKRRGLESKWLEYRIRVLKSMPADIKHHFFTKVRNMVEDMVVVDHDFLLAWQLYFE
FT                   WQDYSDLDCMDVNVISKFLKKFPKEPLAAVLYAWVCSEQSSYNSKEFYEKTFQGEDTDN
FT                   SGTSSVDSINDVVEDGMDESEKRRLQQLVDPSMEEATFGLSEDEVLLSLTENIKKTQQS
FT                   IVAHRIVSHYYVSTREYESALHYTKAGIVLCAQSVKNMGAHLSNSKRELTLDLATTYTY
FT                   FEAPKNHPTALALFEKLLTENSDNVHAKMGKGLIAIERRNWQEAYELLKEVTERYPDNY
FT                   EVLSEFAWSELHLDAPDAAIERFKYILNNVEGSDLKVLEFRSLNHWRMAKGYVYKQHGE
FT                   INAGESSEKEYIKLAFKQLVQAVKTSENFAPGYSTLGDIYSEYYQDPTRAFKCYFKSFE
FT                   MDPSDLTAARYMCEKYCGSCDWQSASLIAERVVKAEKSKSILQNVNWPYRVLGIAHLEK
FT                   QAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEVSPGNAYAHY
FT                   FKALSLSKMGLYDESIEIFRELTAEHPDEESYQVSMVEVLVEHCNVLCSQGFLTRSVAA
FT                   AADAIRKIESIVLHIDYKIHGMWLSLSNALRVICLVQSQVHLLPLESLVNIFEVAELRN
FT                   TDEIDKIDHVTLSGLLSDLEQDNVAIAAQFLVLSGKHAIACSDYASLPRTVRASLWYNL
FT                   GIVELMAFVILKSNSHRDAAIESFKKSIEYQSNTAEAWIGFGIASIDLNVRVAQHCFIK
FT                   ATALNPRETSVWYDMAILALRYNDVAFARAVLMKSQSIAPQDSTPWFGLALASEKEGLT
FT                   QDSARLFAHSFVLSNGKSKGAQLLYAKSVLKTRIGSGDDERDIGPGQELSAVAYGLDDY
FT                   LKKNPDDKFALQCAILTLERLRNYAAARKLSDRLLDILEKRFEKAQDDSELFHFAIVKS
FT                   QLARVYLGLKDYETAIESADLSLGILAEHNNEVAEKCITSNHAVMGLASFFLDDFDQTL
FT                   EHFKVLLDRPGESKQLVILVAKILYNVESEETREVALKELVDYINSNGPDLTVTLTIAV
FT                   ISLLEGIPDDMRAILSELKSLPLSDMISDRHRDIPFLIQQLNTKLSQDCESQQQWQRTA
FT                   FFFPNDSGSWGSLDKKIRARIAAGGQNKVPARKMSEFYSSLGNLSKIQRSIFLCPWNKE
FT                   ALSSLKGCF"
FT   gene            complement(<68319..>68867)
FT                   /locus_tag="KLTH0A00660g"
FT                   /old_locus_tag="Klth0A.mRNA.3217.m"
FT   CDS_pept        complement(join(68319..68766,68848..68867))
FT                   /locus_tag="KLTH0A00660g"
FT                   /old_locus_tag="Klth0A.mRNA.3217.m"
FT                   /product="KLTH0A00660p"
FT                   /note="highly similar to uniprot|P20435 Saccharomyces
FT                   cerevisiae YPR187W RPO26 RNA polymerase subunit ABC23,
FT                   common to RNA polymerases I, II, and III; part of central
FT                   core; similar to bacterial omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21049"
FT                   /db_xref="GOA:C5DB92"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR028363"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB92"
FT                   /protein_id="CAR21049.1"
FT                   /translation="MSDYEEAFNDGPENFEDFDNEHFSDAEVYDAPEEFKDGETKDESG
FT                   KTIITGGTGAEDFQQHESNRKRTLKEKAIPKDERTTTPYMTKYERARILGTRALQISMN
FT                   APVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL"
FT   gene            <69084..>70385
FT                   /locus_tag="KLTH0A00682g"
FT                   /old_locus_tag="KLTH-ORF17000"
FT   CDS_pept        69084..70385
FT                   /locus_tag="KLTH0A00682g"
FT                   /old_locus_tag="KLTH-ORF17000"
FT                   /product="KLTH0A00682p"
FT                   /note="similar to uniprot|P39933 Saccharomyces cerevisiae
FT                   YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
FT                   putative Zn-fingers"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21050"
FT                   /db_xref="GOA:C5DB93"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB93"
FT                   /protein_id="CAR21050.1"
FT                   /translation="MEESEDHSNFWDVGKLGSEDGLPLVRSDSVGSIQSISSAGSTSSS
FT                   RAKTWVCEYEGCSKAFTRPSQLTEHQETVHQGLKPFTCTECGRQFTRKTHLERHMFTHT
FT                   AEKPFHCSHCGKGVTTRQQLRRHEITHTRSFVCPHEGCGESFYKHPQLRSHVLAVHLQK
FT                   LNCEFCGKKFQRPYRLKNHIAKHHNPDTVYKYQCSHGSCVEAFKTWTALQQHVKEAHPK
FT                   LQCPTCGKACVGEQGLQMHMRVHSSMTVIKNWKCESCPDLYFAKKADLVSHCLEHHKDL
FT                   VSTLLNDNEREPAEPSATASPNNIPLESGARPSRLRSSSTKHDSESELESIQTEVKLRK
FT                   YFDSGKSSVSLLLNSAGRKLKCPYLGCYRSFKTEEKYEMHIQKHKIHQLKLKILQEKNQ
FT                   ATSLASEENELESNMERKNGNSQDLESLSAAANR"
FT   gene            complement(<70544..>72592)
FT                   /locus_tag="KLTH0A00704g"
FT                   /old_locus_tag="KLTH-ORF16998"
FT   CDS_pept        complement(70544..72592)
FT                   /locus_tag="KLTH0A00704g"
FT                   /old_locus_tag="KLTH-ORF16998"
FT                   /product="KLTH0A00704p"
FT                   /note="some similarities with uniprot|Q06628 Saccharomyces
FT                   cerevisiae YPR185W ATG13 Phosphorylated protein that
FT                   interacts with Vac8p required for the cytoplasm-to-vacuole
FT                   targeting (Cvt) pathway and autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21051"
FT                   /db_xref="GOA:C5DB94"
FT                   /db_xref="InterPro:IPR018731"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="InterPro:IPR040182"
FT                   /db_xref="PDB:4J2G"
FT                   /db_xref="PDB:4P1W"
FT                   /db_xref="PDB:5JHF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB94"
FT                   /protein_id="CAR21051.1"
FT                   /translation="MTTSLDKQLWELIDNFFLKAALLICHSKGWKGAPAADEGPPTTNS
FT                   WFNIETFGDTKLERELKPWTTFDGSESLPPLVIETYLDLARLSPSQQVTLKDQDGNPWN
FT                   VCKGTKKSEIMLERWLIQLDNGEDSPSLQSSGSEDTDDNVSELYRQLVLLFRYLETLVG
FT                   LLPASELQARLIRPGVSPEAPPPVKLGTRILDGSKPIVSKGRIGLSKSLIATYSNVINE
FT                   TNLPAHLEQRKITPIRTKFGSLRISVSYRKDCDFHVNGSEEYNTQFNQETRSRSAAPVA
FT                   TPSLRRVSMNSNRSMSISPNTTISPSPLAEPSPQKRGTVLARQLQPFKAGSVGSGSLPQ
FT                   VQQGSLSRNPSATSVAAALRAQRPSNGSITAPTSQLHESHLEPSSIGSGSLSKYSSSFG
FT                   RLRRQSSVRRSDSVERSQKPSKLNESPSGDLLDFMKLLDDRKELKLKNKGTKVDISNSL
FT                   LKFQGMRTTNNNLSTDLSMSMSLERPSVSQPRNRSNSHSPNSSFSPSIQYSSIPMRLSQ
FT                   SRSDSYRPEILGELSSARGSTERPKSIISNLNESFYDGRRLGGRTSSNEGYAEDEEDEE
FT                   DEEDLLVGRSAMNPASTNFRNRSTSPGSVRSVSSSFSKSQLPFKSLSNFSGPTTMATPA
FT                   HAKLHKAIVGNSPETNVSDALPKKDDSLNQEEDDDLLFFMSDMNLSK"
FT   gene            complement(<72979..>77517)
FT                   /locus_tag="KLTH0A00726g"
FT                   /old_locus_tag="KLTH-ORF16996"
FT   CDS_pept        complement(72979..77517)
FT                   /locus_tag="KLTH0A00726g"
FT                   /old_locus_tag="KLTH-ORF16996"
FT                   /product="KLTH0A00726p"
FT                   /note="highly similar to uniprot|O93808 Saccharomyces
FT                   cerevisiae YPR184W GDB1 Glycogen debranching enzyme
FT                   containing glucanotranferase and alpha-1 6-
FT                   amyloglucosidase activities required for glycogen
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21052"
FT                   /db_xref="GOA:C5DB95"
FT                   /db_xref="InterPro:IPR006421"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029436"
FT                   /db_xref="InterPro:IPR032788"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032792"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB95"
FT                   /protein_id="CAR21052.1"
FT                   /translation="MERQLLLRVSGKGEPVVSCSYGQGVLTLPSLPVYDGYDESSPLFT
FT                   VKLVIPGGSPVARDGLVWTNCPVDAKTPFVRDKFNKKEIKATFHQDHHVELPVFRPGPF
FT                   CFYFSFRNDRDELETTRRFYFVVPPSLYIDDRYIPLNSLTMQSVVSKWMGSDWDKIFGK
FT                   IASKGYNLIHFTPLQKRGDSNSPYSIYDQLEFDPAFFPNNIDDVSKMVLKLHKEHGILA
FT                   MTDVVLNHTANNSPWLREHPDSGYNHKTAPHLISAMELDKQLLEFSGKLRQLGYPTELN
FT                   STHDLFKIMDGIKIHVLGSLKLWEYYVIDANQALDMVKNDWRQASHDQVEIPDSAKNDL
FT                   VELANFIRDSASCENFGHLGERFSNRLEGSKFVAILKTLYGFELNDAVLEEAQKIVDEI
FT                   NLPLYREYDEDIGDILEQLFNRIKYLRVDDHGPKLGPVTDKSPLTEPYFTRFNGSDGEE
FT                   YALANNGWIWNGNPLVDFASSQSKAYLRREVIVWGDCVKLRYGAKPEDSPFLWKKMSEY
FT                   IETCAKLFDGFRIDNCHSTPLHVGEYYLDLARRHKPNLYVAAELFSGSEAMDCLFVERL
FT                   GTSSLIREAMQAWSEEELSRLVHRHGGRPIGSYKFMPLDDFAYPTNRQVEEFHIHNAKR
FT                   VSEVNIPKNLTATPPHALFMDCTHDNETPFQKRTLEDTLPNAALVSFCSSAIGSVYGYD
FT                   ECFPYLLDVVGEARTYDVTANDGISVARAQLHKIRDEIAQGSADIEDSEMHVHHEGQYI
FT                   TFQRNNAKNGSGWFLVARTKFGEKGEQKLPKIKFTGSRCEFSFAYSLLKAGGVPEDKNI
FT                   IKGIPSKLEELSGFKVDYNEDLGESTIEITDSFPQGSIAVFKTQQNGIDETLLKFLTTG
FT                   ALKASEQLNLYSLNGLLYRCDAEERDISAGSSGVYDVPDFGRLTYCGLQGWVSVLRKII
FT                   FSNDLAHPMSNHLRSGHWALDYVVQRLENYKEQPGISEMQAWLASRFDRVKKLPSFLVP
FT                   TYFALVIGIAYQCCRFRAIQNMPENVGSSTRFVQSLALTSVQMLSEMRSTSLIPEKNVP
FT                   CMAAGLPHFSTDYMRCWGRDVFISLRGLLLTTARFDDAKQHILAFARTLKHGLIPNLLD
FT                   AGRNPRYNARDATWLFIQSIQDYVKMAPDGESILREKIPRRFPLDDTYITVDDPRAFSY
FT                   ETSIEDIIFEILSRHAKGISYREANAGPQLDRVMSDRGFDVKIHVDWSTGLIHGGSQYN
FT                   CGTWMDKMGESEKAGSFGVPGTPRDGAAVEISGLLKSALRFVLELHEKKLFKYTKVEKE
FT                   DGSQVTFKEWNNLVQENFEAKYFVPSDPSKDSEYDIDETLVNRRGIYKDLYKAGKPYED
FT                   YQLRPNFAIAMTVAPELFTPELALQALDNADRIIRGPVGMRTLDPSDYNYRPNYNNGED
FT                   SADFATSKGRNYHQGPEWVWCYGYFMRAFYRFHLAADARCQSKGSSKPSSYLYQQLYNR
FT                   FEGQRNFIYGSPWAGLTELTNKDGALCSDSSPTQAWSSATTLDFFYDLWEH"
FT   gene            complement(<78506..>79303)
FT                   /locus_tag="KLTH0A00748g"
FT                   /old_locus_tag="KLTH-ORF16990"
FT   CDS_pept        complement(78506..79303)
FT                   /locus_tag="KLTH0A00748g"
FT                   /old_locus_tag="KLTH-ORF16990"
FT                   /product="KLTH0A00748p"
FT                   /note="highly similar to uniprot|P14020 Saccharomyces
FT                   cerevisiae YPR183W DPM1 Dolichol phosphate mannose (Dol-P-
FT                   Man) synthase of the ER membrane catalyzes the formation of
FT                   Dol-P-Man from Dol-P and GDP-Man required for glycosyl
FT                   phosphatidylinositol membrane anchoring O mannosylation and
FT                   protein glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21053"
FT                   /db_xref="GOA:C5DB96"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB96"
FT                   /protein_id="CAR21053.1"
FT                   /translation="MAIENSVIVPAYHERLNIKPLTTRLFAALGNDGSKTTELIFVDDN
FT                   SKDGSVEEVDALQKQGYNVRIIVRTDERGLSSAVLKGFHGAQGQYLICMDADLQHPPES
FT                   VPQLFDVLRNHAFVLGTRYAPGVGIDKDWPLYRRVISSGARMMARPLTTASDPMSGFFG
FT                   LQKKYLLNSDAKEINAQGFKIALDLLVKLPLPRQNAIGEVPFSFGVRTEGESKLSGKVI
FT                   VQYLQQLQELYVYKFGANNLVLFLFFWTILALYAFYKLMSLVF"
FT   gene            complement(<80170..>80515)
FT                   /locus_tag="KLTH0A00770g"
FT                   /old_locus_tag="Klth0A.mRNA.3193.m"
FT   CDS_pept        complement(join(80170..80442,80507..80515))
FT                   /locus_tag="KLTH0A00770g"
FT                   /old_locus_tag="Klth0A.mRNA.3193.m"
FT                   /product="KLTH0A00770p"
FT                   /note="similar to uniprot|P54999 Saccharomyces cerevisiae
FT                   YPR182W SMX3 Sm or Sm-like snRNP protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21054"
FT                   /db_xref="GOA:C5DB97"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="InterPro:IPR034100"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB97"
FT                   /protein_id="CAR21054.1"
FT                   /translation="MSELAPTNPKPFLRELINKPIVVTLKFNKTQYKGLLVSTDNYFNL
FT                   QLTEAEEFIEGQSKGKIGDIFIRCNNVLWIGEDLQKKEEEPQTLDQQS"
FT   gene            complement(<80668..>81840)
FT                   /locus_tag="KLTH0A00792g"
FT                   /old_locus_tag="KLTH-ORF16987"
FT   CDS_pept        complement(80668..81840)
FT                   /locus_tag="KLTH0A00792g"
FT                   /old_locus_tag="KLTH-ORF16987"
FT                   /product="KLTH0A00792p"
FT                   /note="similar to uniprot|P41733 Saccharomyces cerevisiae
FT                   YLR459W GAB1 GPI transamidase subunit involved in
FT                   attachment of glycosylphosphatidylinositol (GPI) anchors to
FT                   proteins may have a role in recognition of the attachment
FT                   signal or of the lipid portion of GPI"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21055"
FT                   /db_xref="GOA:C5DB98"
FT                   /db_xref="InterPro:IPR009600"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB98"
FT                   /protein_id="CAR21055.1"
FT                   /translation="MNLRELQVVFACLASRFGAAAVFPLLQQQLDRSVEFSTPVTSFRS
FT                   LQEGVFLLQNDFPLYSGGVMHHAPLLVALMSTFNSNTLISLLFTCADSAIAYQLIAMAK
FT                   CFQNLHLPAWVPGALYVINPLVLLSSVSRSTVVFSNLAISTALLSALQGKAVLSAASIA
FT                   VAAYLSLYPLLLLVPILTLLPKDRFKTVAITFTTLAGLLLSSYKINDENWNYLFSTYGV
FT                   IITFSKIIPNLGLWWYFFVELFEMFIPFFKAVFNLFIVSCIIPFSLRFHKQPFYAFILC
FT                   LCWITLTKSYPTLGEGGFLLSFVPFFRPLFGYFRYSVISTLLFIHVSVLSPVFYHLWVD
FT                   LGSGNSNFFYAISLVYALGLATVLVDLVWAMLRIEYDKGKPNLNLKLTPI"
FT   gene            <84356..>86656
FT                   /locus_tag="KLTH0A00814g"
FT                   /old_locus_tag="KLTH-ORF16980"
FT   CDS_pept        84356..86656
FT                   /locus_tag="KLTH0A00814g"
FT                   /old_locus_tag="KLTH-ORF16980"
FT                   /product="KLTH0A00814p"
FT                   /note="highly similar to uniprot|P15303 Saccharomyces
FT                   cerevisiae YPR181C SEC23 cytoplasmic GTPase-activating
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21056"
FT                   /db_xref="GOA:C5DB99"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036174"
FT                   /db_xref="InterPro:IPR036175"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037364"
FT                   /db_xref="InterPro:IPR037550"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB99"
FT                   /protein_id="CAR21056.1"
FT                   /translation="MDFETNEDINGIRFSWNVFPSSRTDANKNVVPVGCLYTPLKSKED
FT                   LMVMSYNPVVCGGPQCKAVLNPYCEIDLRSNAWACPICNSRNHLPAHYANMSQENMPAE
FT                   LSNTTIEYITNRPVQVPPVFLFVVDITAEEENLQALKESIIASLSLLPPNALVGLITYG
FT                   NVVHLHDLSCDTIDKCNVFRGDREYQLLQLIEMLTGEKSGVAGAAGGAVGANAALNKIT
FT                   PFSLNRFFLPLEQVEFKLTQLLENLSPDQWSIPAGHRPLRATGSALNIATLVLQGCYKN
FT                   VASRIILFASGPGTLAPGLIVSSELKDPLRSHHDIDSDNAKHYKKASKFYSMLADRIAQ
FT                   NGHTVDIFAGCYDQVGMSEMKYLTDTTGGVLLLTDAFSTSIFKQSFLRLFSSDDEGYLT
FT                   MAFNGNMSVKTSRDLKVQGLIGHASPVKKTDATNISDSEIGVGGTSTWKMSSITPNHSY
FT                   AVFFEIANNAAASAGVVGGDRPKLAYTQFVTSYQHASGTNRVRVTTVANQLLPFGSPAI
FT                   AASFDQEAAAVLMARIAVHKAESDDGADVIRWIDRTLIKLCQKYADYNKDDPRSFRLAP
FT                   NFSLYPQFTYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTAFFMEEE
FT                   PQPVLLDSVSVKPNTILLLDTFFYILIYHGEQIAQWRKAGYQDDPQYADFKSLLEEPKL
FT                   EAAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDSYQDQSAGGSTIVLTDDVSLQNF
FT                   MLHLQEVTVSGQT"
FT   gene            complement(<86917..>87879)
FT                   /locus_tag="KLTH0A00836g"
FT                   /old_locus_tag="KLTH-ORF16977"
FT   CDS_pept        complement(86917..87879)
FT                   /locus_tag="KLTH0A00836g"
FT                   /old_locus_tag="KLTH-ORF16977"
FT                   /product="KLTH0A00836p"
FT                   /note="similar to uniprot|Q06624 Saccharomyces cerevisiae
FT                   YPR180W AOS1 Nuclear protein that acts as a heterodimer
FT                   with Uba2p to activate Smt3p (SUMO) before its conjugation
FT                   to proteins (sumoylation) which may play a role in protein
FT                   targeting essential for viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21057"
FT                   /db_xref="GOA:C5DBA0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA0"
FT                   /protein_id="CAR21057.1"
FT                   /translation="MAAQARMRSAKVLLINLGGLGTEIAKNLVLSGVGFLSLVDNHDVS
FT                   EGDLSTQFFLSKDEIGTKRLDSAISRIQDMNPRVTLTVDTEDFRQKPDSFYGQFDLIIA
FT                   TDVSTEEAIRVNQLTRKFNVPFFLCGLNGLSGFIFVDLIRFDATDEKLKSSVKTPLGAL
FT                   SQNREVVEVTEYLNEEQSEVYERIVTRNAYKPFEQVLKEGTLKGKLTKRQVKRLTNAVP
FT                   LTFALFSYRDGYAAVTRHDLEQRATDACVQLGLPSENLKQEYVEQFSQQAGLEFAPVSA
FT                   VIGGTVAQDVINILGKKQSPLNNFIVLDGISLDMHIFEL"
FT   gene            <88180..>90123
FT                   /locus_tag="KLTH0A00858g"
FT                   /old_locus_tag="KLTH-ORF16976"
FT   CDS_pept        88180..90123
FT                   /locus_tag="KLTH0A00858g"
FT                   /old_locus_tag="KLTH-ORF16976"
FT                   /product="KLTH0A00858p"
FT                   /note="similar to uniprot|Q06623 Saccharomyces cerevisiae
FT                   YPR179C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21058"
FT                   /db_xref="GOA:C5DBA1"
FT                   /db_xref="InterPro:IPR021006"
FT                   /db_xref="InterPro:IPR026216"
FT                   /db_xref="InterPro:IPR038609"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA1"
FT                   /protein_id="CAR21058.1"
FT                   /translation="MDLAKILDTAPEPAIVDAQTMGVSGDVSGDYWLPAPMCLYQKELS
FT                   EQIVSLHYSDILKYYETEDYNTDVVLHSMQTMCLNSEYVATHPYLLIDHCVPKSLITKD
FT                   IPNHLAETSGKFAVLKDLITLIQDYETETAIVCRSGRTMDLLEALLLGNRVNIKRYRSP
FT                   SIKTKQKARKHSCTCHLFPSDGFDETSGLPVDPKIYFDLLLCLDPTVDTSMPHIQQILT
FT                   QARPSSGPGKQAPIVRLTTINAIDHCELYHSKLLDPKSREYLVRVSAAVVVLRDVVGTL
FT                   PPDLRPIYSQGLKYLVEWLEDPSIPWPLPDIYPIKTFTPMDVEKSLLTEVRFNQANENL
FT                   AHVFNNGKKRGRKPNSAYSKEGEPISYYQSKRLKNDYSTNPLKQNMAQLTGIATINDGG
FT                   SVNYHLSGGLLTHKLIQSIGEAYYNLDRQSAELQNFETKEQNQVHRLELVMKEHEDIKN
FT                   QLEPAIKAQDYNREESTRLLAVVEEEHKKVASSMEELDTYTETLREKSPDFSKLIDCLL
FT                   EIAKVQEEIEKQQKLKVSRNNEHTYMTEELRRANEALAGFQAEKAPIAEETQQLEQKIE
FT                   EKLAEDRIQSQKSQERIQKLMAQINDEKAILETLDKQVASMTEQLKKTPPSKVRSSNNA
FT                   QRGKHRKHSGNS"
FT   gene            complement(<90125..>91540)
FT                   /locus_tag="KLTH0A00880g"
FT                   /old_locus_tag="KLTH-ORF16974"
FT   CDS_pept        complement(90125..91540)
FT                   /locus_tag="KLTH0A00880g"
FT                   /old_locus_tag="KLTH-ORF16974"
FT                   /product="KLTH0A00880p"
FT                   /note="similar to uniprot|P20053 Saccharomyces cerevisiae
FT                   YPR178W PRP4 Splicing factor component of the U4/U6-U5
FT                   snRNP complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21059"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR014906"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036285"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA2"
FT                   /protein_id="CAR21059.1"
FT                   /translation="MNGQGTISFDEIRVDTSYIVEDGGKKADDTLKSLEFDREQKLTIV
FT                   PTDDTEVRESLVHLGQPEALENESNRDRRDRLSDLLYQNPDIRAQFLERQAKSPSLETG
FT                   PSEASESEDEEFYTPASGSLVECRQFLIQDSLGRARERLRNERGHADSQDVSTTIVQRR
FT                   KLNAELSKYELWGSQVASSRPVSGVLLSPNQKSVACGSWHGDVKIIDSETLEILASFDA
FT                   IHDDKIGGLDWSSDSTLLVTGGADRIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDR
FT                   YVASASFDMTWRLWDVERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMR
FT                   SGQSLMILEGHAKPIYGVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSILAHNNIVSD
FT                   VKFDKVSGRTLVSSSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHDFSHLYSSGWD
FT                   RSVKLWKLGVCNS"
FT   gene            <91636..>92610
FT                   /locus_tag="KLTH0A00902g"
FT                   /old_locus_tag="KLTH-ORF16973"
FT   CDS_pept        91636..92610
FT                   /locus_tag="KLTH0A00902g"
FT                   /old_locus_tag="KLTH-ORF16973"
FT                   /product="KLTH0A00902p"
FT                   /note="highly similar to uniprot|P20133 Saccharomyces
FT                   cerevisiae YPR176C BET2 Beta subunit of Type II
FT                   geranylgeranyltransferase required for vesicular transport
FT                   between the endoplasmic reticulum and the Golgi provides a
FT                   membrane attachment moiety to Rab-like proteins Ypt1p and
FT                   Sec4p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21060"
FT                   /db_xref="GOA:C5DBA3"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR026873"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA3"
FT                   /protein_id="CAR21060.1"
FT                   /translation="MADLKLNKESHVSYIKSLDSKRQDYEYWLSEHLRLNGVYWGLTAL
FT                   CLLDAKNTFNKQEIIEFVRSCWDAKTGGFSAFPGHDAHIHTTLSGIQILATYNALDEVL
FT                   EGEALKQCISFIKDNQLPDGSFQGDRFGEVDARFVYSALNALSILGELTPEVVDPAVAF
FT                   IKRCYNFDGGFGLCPGAESHAAMAFTCIGALAIVGKLGELSADQFENIGWWLCERQVPE
FT                   GGLNGRPSKQPDVCYSWWVLSSLAIIGKLEWISFEKLREFILKSQDPKSGGISDRPDNE
FT                   VDVFHTIFGLAGLSLMGYDGLIEIDPVYCMPTSVTKTFKKYPY"
FT   gene            complement(<92634..>94724)
FT                   /locus_tag="KLTH0A00924g"
FT                   /old_locus_tag="KLTH-ORF16972"
FT   CDS_pept        complement(92634..94724)
FT                   /locus_tag="KLTH0A00924g"
FT                   /old_locus_tag="KLTH-ORF16972"
FT                   /product="KLTH0A00924p"
FT                   /note="similar to uniprot|P24482 Saccharomyces cerevisiae
FT                   YPR175W DPB2 Second largest subunit of DNA polymerase II
FT                   (DNA polymerase epsilon) required for normal yeast
FT                   chromosomal replication expression peaks at the G1/S phase
FT                   boundary potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21061"
FT                   /db_xref="GOA:C5DBA4"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR016266"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA4"
FT                   /protein_id="CAR21061.1"
FT                   /translation="MDPVVALPVKIQPGLLRPLAYRVLSKKYGLNIKSDGLAALADYIG
FT                   NRFGMNWRKDSGTFKFLEQFAAIWDQQERGLFIDRVGVEEVIKEVKERSKASQIPKKVA
FT                   GEESQSSVRPKTLDNFLANRQPSAAEQNILPSSLVAPDVDQDVTDVTEEAQRMEVDEPA
FT                   LPTDSGDLDWQDHFKIIDAFAQQNFIYDHTTRQYRLKGQRARKVIPQAESNVAMFANRY
FT                   HVVKDRVMRNDLFQGHGDTFNPLSSIAGPMSSGPGSFSSQNMTITQIKNLLGRDGRSFL
FT                   LLGLLRPNYKGGWSLEDPSGSVEVDLSQAIPTVGTFYVSGCILLAEGIYFSAGHKFHVA
FT                   SLAHPPGERREATMDAIGNLDLLGVHQQSSPNYISRIDKDLKIRMHLLERELTDHRFAF
FT                   LGGDLFLDQPQILEALRKVFAKLEGDPPTMMVLQGSFSSAPLFPVMSSKNISATSAYKN
FT                   NFDALALLLLNFERLINETTFVFIPGNNDPWSSTVSLGTAGVWPQKPIPGIFAQRINRV
FT                   CKKIHWGSNPTRVAYLSQELILVRDDINGRFKRHNIAFPAIMDDEEYGGEVADSALAQD
FT                   ALMPELNDNYEGIDQLVKSQDQLAASVQESRRLVKTILDQGHISPFVSSTRPVIWNLDH
FT                   TLHLTPIPSLMVICDTTASQFEVTYNGCKSVNVGSFLYKRRARYVEYRPSSRKVVREEV
FT                   YF"
FT   gene            <94999..>95904
FT                   /locus_tag="KLTH0A00946g"
FT                   /old_locus_tag="KLTH-ORF16970"
FT   CDS_pept        94999..95904
FT                   /locus_tag="KLTH0A00946g"
FT                   /old_locus_tag="KLTH-ORF16970"
FT                   /product="KLTH0A00946p"
FT                   /note="weakly similar to uniprot|P52919 Saccharomyces
FT                   cerevisiae YLR457C NBP1 Component of the mitotic apparatus
FT                   containing a coiled-coil domain essential for the G2/M
FT                   transition"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21062"
FT                   /db_xref="InterPro:IPR013743"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA5"
FT                   /protein_id="CAR21062.1"
FT                   /translation="MEAAKNYFKSWFNADEPRKVERGSLDKWRKRSQMLDGLGGRGARR
FT                   GRTSVTLRNKTTGKSLRPKRTAPGIWNLVKGVFSREDQDLREMKNAYTALKLRSNNRGM
FT                   QTRSQVQRRIASSAALKRKLLEKQYDEKRLDELRRGRKPGPRAVALEPRNISQPNFDTD
FT                   RVILLQHKVDALKEQLNEVERELHLTRKRLKFTQEKNALLEGLLNDANVDDDYLKSRRR
FT                   ITNLQREDLKPEYDALPPSPHRAISPLVTSSPRKVELPQDDFYERYRSIPTAELLRRDP
FT                   ESSLSPIRVDLSKYSSSRAP"
FT   gene            <96149..>97432
FT                   /locus_tag="KLTH0A00968g"
FT                   /old_locus_tag="KLTH-ORF16967"
FT   CDS_pept        96149..97432
FT                   /locus_tag="KLTH0A00968g"
FT                   /old_locus_tag="KLTH-ORF16967"
FT                   /product="KLTH0A00968p"
FT                   /note="highly similar to uniprot|P52917 Saccharomyces
FT                   cerevisiae YPR173C VPS4 Defective in vacuolar protein
FT                   sorting homologous to mouse SKD1 and to human hVPS4 AAA-
FT                   type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21063"
FT                   /db_xref="GOA:C5DBA6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036181"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA6"
FT                   /protein_id="CAR21063.1"
FT                   /translation="MSTGDFLTKGIGLIQKAIDLDTATQYEEAYTAYYNGLDYLMLALK
FT                   YEKNPKSKDLIRTKFTEYLNRAEQLKEHLEAKEDTQKSKKDSPAKKTSANSNDDDADDK
FT                   KLRGALSGAILTEKPNVRWEDIAGLEGAKAALKEAVILPVKFPHLFTGNRKPTSGILLF
FT                   GPPGTGKSYLAKAVATEANSTFFSISSSDLVSKWMGESERLVKQLFAMARENKPSIIFI
FT                   DEVDALTGQRGEGESEASRRIKTELLVQMNGVGNDSQGVLVLGATNIPWQLDSAIRRRF
FT                   EKRIYISLPDLAARTRMFELNIGETPCSLTKEDYRTLAQLTEGYSGSDIAVVVKDALMQ
FT                   PIRKIQNATHFKNVSEDPEHRKLTPCSPGDKDAIEMSWVDIEADELQEPELNIKDFLKA
FT                   IKTTRPTVNEEDLRKQIEFTRDFGQEGD"
FT   gene            complement(<97551..>98183)
FT                   /locus_tag="KLTH0A00990g"
FT                   /old_locus_tag="KLTH-ORF16963"
FT   CDS_pept        complement(97551..98183)
FT                   /locus_tag="KLTH0A00990g"
FT                   /old_locus_tag="KLTH-ORF16963"
FT                   /product="KLTH0A00990p"
FT                   /note="similar to uniprot|Q06608 Saccharomyces cerevisiae
FT                   YPR172W Protein of unknown function transcriptionally
FT                   activated by Yrm1p along with genes involved in multidrug
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21064"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA7"
FT                   /protein_id="CAR21064.1"
FT                   /translation="MSCPDSLPEHVLSLLKTSKYLHLATCSKPECIPSVSLMNYTYISP
FT                   EKVFVADKEKGATGERRHYIIMATQRDTEKYENIAQNPEVSVLIHDWVTAKKLSLRKSS
FT                   MSNTPTPEPQSAAAAAAAQNPDHPSRLLNLLQELNQSELSQMSATLRGRAEAVDPSSEE
FT                   FRYYEEALLKANPDAGVYTKGQNVAVVKVRLESAKVSDRENNTSFYD"
FT   gene            complement(<98450..>99379)
FT                   /locus_tag="KLTH0A01012g"
FT                   /old_locus_tag="KLTH-ORF16961"
FT   CDS_pept        complement(98450..99379)
FT                   /locus_tag="KLTH0A01012g"
FT                   /old_locus_tag="KLTH-ORF16961"
FT                   /product="KLTH0A01012p"
FT                   /note="similar to uniprot|Q06188 Saccharomyces cerevisiae
FT                   YLR455W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21065"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA8"
FT                   /protein_id="CAR21065.1"
FT                   /translation="MEQKLTTGDLVLCKVGSFAPWPAVVFPQRLLRKDVYRRRRAECVA
FT                   VCFFNDETYYWDKPARLKRLTKSTIERFLEDAPATEDPGLVGAYEEARDYTSLHEFVMQ
FT                   RLEEENRIEEWEKSAEADTKVEAGQDPFEGRPAGLKAGGAKLRKSSASASPPRGYPKAR
FT                   RAASGSADGSIGTKSSSASLKSRSMPESPSAVKKLSRLDHAKRVEISLLFRCKLQRNLV
FT                   QRELPPGPDEIKESHKLLGKITENTLANPQFFDFEALKHSKLHKLLKVITNDDNLAEFH
FT                   RECNDILASWSPVIAELKKDKLNQRRDT"
FT   gene            <100382..>101902
FT                   /locus_tag="KLTH0A01034g"
FT                   /old_locus_tag="KLTH-ORF16957"
FT   CDS_pept        100382..101902
FT                   /locus_tag="KLTH0A01034g"
FT                   /old_locus_tag="KLTH-ORF16957"
FT                   /product="KLTH0A01034p"
FT                   /note="similar to uniprot|P53322 Saccharomyces cerevisiae
FT                   YGR260W TNA1 High affinity nicotinic acid plasma membrane
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21066"
FT                   /db_xref="GOA:C5DBA9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA9"
FT                   /protein_id="CAR21066.1"
FT                   /translation="MSEAKLEALATVGTSEKASTVSVTSRRSYNGDELSEIQQDLAQKH
FT                   GVKQRKLEWKIDICVVPALVLLYFAAFLDRINISNARLYGMEEDLGLHGNQFNVALTVF
FT                   FVPYIVFELVANYLAKLFKPHWCFSVSMFMFGCSTIGCGFVKSFGGLITVRVFLGVAES
FT                   ATFGLIFYILSSYYTPRQAQRRFSCFFSSVTLAGAAGGSIARQIYTGIGNKHLANWRWI
FT                   FIIEGAATVFIAFLLFFITPDFPETAKFLKPNEKAFLKEKLQLYSRVESGFEVKFNWRD
FT                   YLPLFKEPIFYANALAYLGLLVPSYGYAYFATSIIKLLGYTAVSAQQHSVYPWLAAFGY
FT                   INIVAYLSDRLQNRWCFSVSSSIIGIAGLAMVLGSSAPHVRYGGCFVASLGLYGATPVV
FT                   VCWTSINLGGHLRKSFGTAFQVGLGNIGGIIATFLFLQKDEPKYTSGLSVSIGFVGLSI
FT                   ISQLFIVFYCSFMNKKKMTLTYIERFEELPIEDRVLKGDLNPNFKYLL"
FT   gene            complement(<101960..>104230)
FT                   /locus_tag="KLTH0A01056g"
FT                   /old_locus_tag="KLTH-ORF16956"
FT   CDS_pept        complement(101960..104230)
FT                   /locus_tag="KLTH0A01056g"
FT                   /old_locus_tag="KLTH-ORF16956"
FT                   /product="KLTH0A01056p"
FT                   /note="similar to uniprot|Q06604 Saccharomyces cerevisiae
FT                   YPR171W BSP1 Adapter that links synaptojanins Inp2p and
FT                   Inp53p to the cortical actin cytoskeleton"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21067"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB0"
FT                   /protein_id="CAR21067.1"
FT                   /translation="MEREASSLRDPELEDYLARVERLDSARNGSRRSPDAHDQRPKYRP
FT                   EDLERAQRLLDGDYTGYDSGTSPTKYSGSVPQIAYRSAYNYERTFSPKRGAGSPRRSDA
FT                   GSAPALGLDSSPDGTRRYTVSEQDYLLLQKLKREAVGDPLVSALPSRGRPRENRVVRTV
FT                   TLADDGDDNDEIPPPLPTRRAASPVLPPPDREEDSTPTKPARPLGLSVPSKSVAPAKPA
FT                   RVPDLSMRLKSAAPASPVVETGTKPSTPLQKNTAVSIDNRDSLVPKKPPPRKPASLTEA
FT                   SKADGFIKILSDRAKKPVPPKPETLKKSASYLESLENNKLTTASLDKPSKPSIQSKPSI
FT                   QSKPTSYLDSLQKNKVTVSTPVREPKSPSPIAKPQHTPQMFMNSVLKTESSRPLQDSSA
FT                   QSPKPFVIPPKRKSPQKEPVPESDEKAEVSFLSLRSSLKPAQSFKKSDAREPGFRSDEQ
FT                   KLVIPKLRRPKVQDDSAQFDGQESLKSVPRSIEGNGSASETASQRQRLNVAPPKPERKV
FT                   STPEALSKRESLAKAPPKPARKISTPEALSKRESLNKAPPKPPRKVSALEALSKRESLS
FT                   KAPPKPARKVSTPEAVNKRESLSKPPPKPSRKVSMPEAMKRLEAIKAKKLSQFEGTEVS
FT                   EKPPQKLEPTVESKGSPLKAKTEANNQKAPESELAALIAAKQLANKGKSRTAPELSNRA
FT                   HLPQAIPFMAQLDNDKIAKMLRPASETDISRPRASDGDNQLNHPTKSRARGPKRKLPKG
FT                   VKT"
FT   gene            complement(<104423..>104870)
FT                   /locus_tag="KLTH0A01078g"
FT                   /old_locus_tag="Klth0A.mRNA.gf.449.m"
FT   CDS_pept        complement(join(104423..104531,104620..104750,
FT                   104853..104870))
FT                   /locus_tag="KLTH0A01078g"
FT                   /old_locus_tag="Klth0A.mRNA.gf.449.m"
FT                   /product="KLTH0A01078p"
FT                   /note="highly similar to uniprot|P0C5R9 Saccharomyces
FT                   cerevisiae YPR170W-B"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21068"
FT                   /db_xref="GOA:C5DBB1"
FT                   /db_xref="InterPro:IPR026770"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB1"
FT                   /protein_id="CAR21068.1"
FT                   /translation="MKPVVSSGKAWFCTVISAFGVVILSVIAHLFNTNHESFVGSINDP
FT                   EDGPAVARTVFMAVLVYAVFFVFCGSQIWLGKKKPAIELR"
FT   gene            <105023..>105096
FT                   /locus_tag="KLTH0A01100r"
FT                   /old_locus_tag="Klth0A.tIle.AAT.1"
FT   tRNA            105023..105096
FT                   /locus_tag="KLTH0A01100r"
FT                   /old_locus_tag="Klth0A.tIle.AAT.1"
FT                   /note="tRNA-Ile (AAT) cove score=71.40"
FT   gene            complement(<105295..>106073)
FT                   /locus_tag="KLTH0A01122g"
FT                   /old_locus_tag="Klth0A.mRNA.3161.m"
FT   CDS_pept        complement(join(105295..105709,106054..106073))
FT                   /locus_tag="KLTH0A01122g"
FT                   /old_locus_tag="Klth0A.mRNA.3161.m"
FT                   /product="KLTH0A01122p"
FT                   /note="highly similar to uniprot|P07280 Saccharomyces
FT                   cerevisiae YOL121C RPS19A Protein component of the small
FT                   (40S) ribosomal subunit; nearly identical to Rps19Bp and
FT                   has similarity to rat S19 ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21069"
FT                   /db_xref="GOA:C5DBB2"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR018277"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB2"
FT                   /protein_id="CAR21069.1"
FT                   /translation="MPGVSVRDVPAQDFITAYASFLQRQGKLEVPGYVDIVKTSAGNEM
FT                   PPQDSEGWFYMRAASVARHIYMRKQVGVGKLNKLYGNAKNRGSRPSKHVDASGSVNRKV
FT                   LQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEDDE"
FT   gene            complement(<106916..>107791)
FT                   /locus_tag="KLTH0A01144g"
FT                   /old_locus_tag="Klth0A.mRNA.3142.m"
FT   CDS_pept        complement(join(106916..107364,107680..107791))
FT                   /locus_tag="KLTH0A01144g"
FT                   /old_locus_tag="Klth0A.mRNA.3142.m"
FT                   /product="KLTH0A01144p"
FT                   /note="highly similar to uniprot|P07279 Saccharomyces
FT                   cerevisiae YOL120C RPL18A and highly similar to
FT                   uniprot|P07279 Saccharomyces cerevisiae YNL301C RPL18B
FT                   Protein component of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21070"
FT                   /db_xref="GOA:C5DBB3"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB3"
FT                   /protein_id="CAR21070.1"
FT                   /translation="MGIDHTTKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFN
FT                   KVVLRSLFLSKINRPPVSVSRIGKALNQQGAANKTVVVVGTVTDDNRIFEFPKATVAAL
FT                   RFTAGARATILKAGGECITLDQLAVRAPKGQNTLIVRGPRNSREAVRHFGAGPHKHKAP
FT                   RIMSKGRKFEKARGRRRSRGFKV"
FT   gene            complement(<108732..>110162)
FT                   /locus_tag="KLTH0A01166g"
FT                   /old_locus_tag="KLTH-ORF16936"
FT   CDS_pept        complement(108732..110162)
FT                   /locus_tag="KLTH0A01166g"
FT                   /old_locus_tag="KLTH-ORF16936"
FT                   /product="KLTH0A01166p"
FT                   /note="similar to uniprot|Q08268 Saccharomyces cerevisiae
FT                   YOL119C MCH4 Protein with similarity to mammalian
FT                   monocarboxylate permeases which are involved in transport
FT                   of monocarboxylic acids across the plasma membrane mutant
FT                   is not deficient in monocarboxylate transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21071"
FT                   /db_xref="GOA:C5DBB4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB4"
FT                   /protein_id="CAR21071.1"
FT                   /translation="MVSILPKRPQQLILSPHTRFEAHASGFKPQSGGTGRDSDDHVRES
FT                   TLDQLSHTGSTDDEDESEFPDGGVAAYLALLGSFMGLLPAWGVINSLGALEGYISKHQL
FT                   ASDSSSSVSWIFALYLAIVSASCVLTGAYFDRNGGFGAIVVGTVLFVTSLVATANCHTI
FT                   WQFILAFSVLGGLANGILTTPLVSCVATWFSRKRAMATSCATIGGSLGGIIFPLMLKKL
FT                   YVEVGFPWALRILAFVCLACLSFACLFARERVKQKPQAFSSKHEMAKFYVLGSFNWKYF
FT                   CDAKYVFTTLGFSLAENSILATSTYIASYAMARGNSEGSSFTLITAGNAMQILGRYVPG
FT                   YISDRYAGRFNVVIVMTLMAVVVNFAIWLPFGGNPKALWAYYLLYGFFSGSIFSLTAVC
FT                   IGQISKTRDFGKRYSTAYLLNAMMTLPTIPIAGTIIGRGSVSDYNKFIIFSTCLMLAGG
FT                   LSYAVARFLCAGVRICKV"
FT   gene            complement(<110365..>110928)
FT                   /locus_tag="KLTH0A01188g"
FT                   /old_locus_tag="KLTH-ORF16930"
FT   CDS_pept        complement(110365..110928)
FT                   /locus_tag="KLTH0A01188g"
FT                   /old_locus_tag="KLTH-ORF16930"
FT                   /product="KLTH0A01188p"
FT                   /note="weakly similar to uniprot|P38013 Saccharomyces
FT                   cerevisiae YLR109W AHP1 Thiol-specific peroxiredoxin,
FT                   reduces hydroperoxides to protect against oxidative damage;
FT                   function in vivo requires covalent conjugation to Urm1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21072"
FT                   /db_xref="GOA:C5DBB5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB5"
FT                   /protein_id="CAR21072.1"
FT                   /translation="MLHGIRSAIRPASASGLRFFHNTTRTQMFQVGDVIKTGLAGVQEN
FT                   APSNSIDLGKLVSKGKHIIVGVPAAFSPACSASHVPGYIAHLSDLQAKGVQDVFVTCVN
FT                   DAFVTKAWAESLKTPEQVHIVADTKGEFAKSGDTLFDSEEVFGNKRNYRYAVVVEDGKV
FT                   VSTFEEPDKTGVNVSSAENVLKSL"
FT   gene            <111361..>113199
FT                   /locus_tag="KLTH0A01210g"
FT                   /old_locus_tag="KLTH-ORF16928"
FT   CDS_pept        111361..113199
FT                   /locus_tag="KLTH0A01210g"
FT                   /old_locus_tag="KLTH-ORF16928"
FT                   /product="KLTH0A01210p"
FT                   /note="some similarities with uniprot|Q12348 Saccharomyces
FT                   cerevisiae YOL117W RRI2 subunit of COP9 Signalosome (CSN)
FT                   like protein complex that cleaves the ubiquitin-like
FT                   protein Rub1 from Cdc53 COP9 signalosome (CSN) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21073"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB6"
FT                   /protein_id="CAR21073.1"
FT                   /translation="MTGDDAGYGDFAASEDENYDDFMASDEDVSIEMEDETEDEAENEG
FT                   AAENETGSKTRQGSASRRDDSGAENGAGKPQVESGAAVMASAALQEARRMVQEQRWYEA
FT                   RSALDGVLQSSTLDPDRAFGARLELVRCCYLSWVSRQENAAGPAELTEHSELQEACGHL
FT                   QQLQAYVDWLEPEVLDSAVSRLLDLFAPPLKSKLLFEGPAASGLGPRAAVTLLECCAPL
FT                   ARHESAQDLRSRVLQHRLGFNDPPGGSQRRQMLDELATISGGRLDSLEFLITTHVQQFL
FT                   ADPQGLDVPQLQSLVSHASALLQRSLTQPLRLLSLLSFCEAIIALNNYCSPHDHAKRLS
FT                   ECQTAFWNCYKHLEELGDHSRFRDLTLCAFVLSSMLLTGQAANAHQAITPFELEQIKVI
FT                   ESTPLVQDLKHIYSDFVGYNLSGFADSLRKIKQFHLQLAGLVDALIHLLQTRMLWNRVA
FT                   RLYSCISLSDIRAQLQIGDSPQLSRNDLLTILMKSIMNDTAQVYFKLDLTHDLVYFGKE
FT                   NRRPLCPLSKHLYLSAKSDAVTKSPNTPSCNSLKEWVDNIGVFETKPRRLKDMSAVQFV
FT                   HELQQSRECTAVADSSDQAKPLKYSQLLQCVRDALS"
FT   gene            <113770..>114303
FT                   /locus_tag="KLTH0A01232g"
FT                   /old_locus_tag="KLTH-ORF16920"
FT   CDS_pept        113770..114303
FT                   /locus_tag="KLTH0A01232g"
FT                   /old_locus_tag="KLTH-ORF16920"
FT                   /product="KLTH0A01232p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21074"
FT                   /db_xref="GOA:C5DBB7"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB7"
FT                   /protein_id="CAR21074.1"
FT                   /translation="MKFSIAASVFAAAGVASATIAAVSQIGDGQIQATVPGASTSAATT
FT                   TTTSVATPASTPATVVSASTSATTESASATTFTTTFGGSSISSPVASSQRSSDDITYVD
FT                   ITTTPEVTTSQVKTEKSTSTPYSYTTLATQNSTATGSGSSSSVSLSVFEAGAQNIAAGA
FT                   GIGALAAGALIALL"
FT   gene            <114559..>115443
FT                   /locus_tag="KLTH0A01254g"
FT                   /old_locus_tag="KLTH-ORF16918"
FT   CDS_pept        114559..115443
FT                   /locus_tag="KLTH0A01254g"
FT                   /old_locus_tag="KLTH-ORF16918"
FT                   /product="KLTH0A01254p"
FT                   /note="some similarities with uniprot|P22148 Saccharomyces
FT                   cerevisiae YOL116W MSN1 Transcriptional activator involved
FT                   in regulation of invertase and glucoamylase expression
FT                   invasive growth and pseudohyphal differentiation iron
FT                   uptake chromium accumulation and response to osmotic stress
FT                   localizes to the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21075"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB8"
FT                   /protein_id="CAR21075.1"
FT                   /translation="MDDVSPLIARISGLESQIAMYEKLFQTLSAKLDHHFKKYDTVVNA
FT                   QQQQINSLTDVLFTLLNDRCRYADIQREKLGNTLAGVASTGASLSGVVATAGLGRQPKQ
FT                   ATGPQTSSRHVSGLQSDHQSASLYAEDTPSRREDERRSSDSYYSDNSVTSAESDESEDR
FT                   ENSELRPELHESADAAHKKRKLFDRKFRFLASPQSVAEVWKEYTEGLAGQPSLKEMEST
FT                   YRSSWRRDAAVSRKFYRRKVLCRAIETGLARGYALEEIIDMLESHRQQREGRQDKLPIG
FT                   WLCRRSNLPSIFK"
FT   gene            <115664..>117493
FT                   /locus_tag="KLTH0A01276g"
FT                   /old_locus_tag="KLTH-ORF16917"
FT   CDS_pept        115664..117493
FT                   /locus_tag="KLTH0A01276g"
FT                   /old_locus_tag="KLTH-ORF16917"
FT                   /product="KLTH0A01276p"
FT                   /note="similar to uniprot|P53632 Saccharomyces cerevisiae
FT                   YOL115W TRF4 DNA polymerase sigma involved in mitotic
FT                   chromsome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21076"
FT                   /db_xref="GOA:C5DBB9"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB9"
FT                   /protein_id="CAR21076.1"
FT                   /translation="MGAKEASKNERAGPKSSSKSKPLKNNQRRTKRLRKSSLSKAQRNF
FT                   AVFNKDGAHINKYENLELDNIESEGDDGSERTQESSEAPTTEATPESEEPQKEQAQDNA
FT                   LDDNQDYISLSMSSEEEQESEEEAPDEAGGEHPGGDAAQPRTLNTDYPWILNHDHSKQR
FT                   EIADWLTLEIKDFVAYISPSQEEIRVRNSTISKIRNAVKDLWPDADLHVFGSFATDLYL
FT                   PGSDIDCVINSSSGDKENRNCLYSLASFLKRRKLATQVEVISKARVPIIKFVEPISQIH
FT                   IDISFERVNGLEAARVIRGWLKETPGLRELVLIVKQFLAARRLNMVHTGGLGGFSIICL
FT                   VYAFLQLHPRVISSDIDSMENLGILLIDFFELYGKNFGYDHVAISVTDSGARYLSKELY
FT                   GSLQNPRTSFALAIQDPGDKDNNISRGSFNIRDIKKAFAGAFDLLTNRCFELDAATFKD
FT                   RVGKSILGNVIKYRGKQRDFKDERNLVVNKAIAENETYHRKRGRIVHEEVFTDVSDGEK
FT                   EDDIYTVEEPAKKKPKKAKKAKKAKKETKASSSSVDTLMGLDTQDDADEDGYDPSNEAP
FT                   STLALEDARSDIRKKSVDAQTKRDYWLSKGQAL"
FT   gene            complement(<117599..>118156)
FT                   /locus_tag="KLTH0A01298g"
FT                   /old_locus_tag="KLTH-ORF16914"
FT   CDS_pept        complement(117599..118156)
FT                   /locus_tag="KLTH0A01298g"
FT                   /old_locus_tag="KLTH-ORF16914"
FT                   /product="KLTH0A01298p"
FT                   /note="some similarities with uniprot|Q12322 Saccharomyces
FT                   cerevisiae YOL114C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21077"
FT                   /db_xref="GOA:C5DBC0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC0"
FT                   /protein_id="CAR21077.1"
FT                   /translation="MRFGCRSRLPSLFFMRSVAGLLPIVRQYSAKTSLPAQQWVDSLTV
FT                   RALPEKAFSYNFDRSSGPGGQNVNKVNSKCTLTIHAFSKCDWIPQEVRDQLVQRRFRYL
FT                   SSSRDCVVIQSDQSRSRETNRQICLEKLVSELKTTCWFPKEAQPEDLQRWSAIRRKTSQ
FT                   QRLEGKKIKSDKKKLRRKVTDY"
FT   gene            <118671..>121115
FT                   /locus_tag="KLTH0A01320g"
FT                   /old_locus_tag="KLTH-ORF16912"
FT   CDS_pept        118671..121115
FT                   /locus_tag="KLTH0A01320g"
FT                   /old_locus_tag="KLTH-ORF16912"
FT                   /product="KLTH0A01320p"
FT                   /note="similar to uniprot|P48562 Saccharomyces cerevisiae
FT                   YNL298W CLA4 Involved in localizing cell growth with
FT                   respect to the septin ring protein kinase homologous to
FT                   Ste20p interacts with CDC42"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21078"
FT                   /db_xref="GOA:C5DBC1"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR033923"
FT                   /db_xref="InterPro:IPR036936"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC1"
FT                   /protein_id="CAR21078.1"
FT                   /translation="MSLSAAANKISENDFQNIGPAPRPPGAAFNKTQPITSYLNQLDLQ
FT                   DKRNEQRGAGNGNRKSGWVSYKDDGILSFLWQKRYMVLSDSYLTLYKNEPRAGSDDAVL
FT                   QIPLTTIVSVSRTQLKQNCFEVVRSSDRNSSASGSSVGSSGNGSGGSDGSRKTMYIATK
FT                   TEIDLHSWLDAIFAKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPSNWEKLLKHSRI
FT                   TGEDWNNNSAAVIQVLQFYQEYNGAGTATASNNSSTTSLPKASINQGQYGGQQSRQNSH
FT                   DMLPQRKPPTPPSVQHRPKLQVSTSHQNYQTSQQSPYQSFNNKYASPLQNKPLNSHLPS
FT                   PPAHKLPYPQQVQGQNSSQLKQHRQNGYAQDASRFKHNMQNPYLTSTPPSSSPSSSKEQ
FT                   VSQRHAPQQRPPVNNSPYSNSSTPPPQRLHPQRAAPAVLKPPAQPAPSTAAAAAAMNQS
FT                   RPEAGPKFLQPNREAPKKPDAHPKKDVGVTKQRKPTKPTMSNAEIMAKLKSVTFNTDPT
FT                   PFFQMVEKAGQGASGSVYLAQRTQLPDYGEGDLNEQIGEQHIGDKVAIKQMILSKQPRK
FT                   ELIVNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDLIENSPTNGSNHA
FT                   PLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDHRARVKITDFGFCAKLTDKR
FT                   SKRATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIA
FT                   TNGTPKLKQPEVLSLKIKRFLSVCLCVDVKYRASTEELLHHSFFDMSCDPRDLTSLLEW
FT                   KK"
FT   gene            complement(<121198..>126042)
FT                   /locus_tag="KLTH0A01342g"
FT                   /old_locus_tag="KLTH-ORF16909"
FT   CDS_pept        complement(121198..126042)
FT                   /locus_tag="KLTH0A01342g"
FT                   /old_locus_tag="KLTH-ORF16909"
FT                   /product="KLTH0A01342p"
FT                   /note="similar to uniprot|P48563 Saccharomyces cerevisiae
FT                   YNL297C MON2 Peripheral membrane protein with a role in
FT                   endocytosis and vacuole integrity interacts with Arl1p and
FT                   localizes to the endosome member of the Sec7p family of
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21079"
FT                   /db_xref="GOA:C5DBC2"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR026829"
FT                   /db_xref="InterPro:IPR032629"
FT                   /db_xref="InterPro:IPR032691"
FT                   /db_xref="InterPro:IPR032817"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC2"
FT                   /protein_id="CAR21079.1"
FT                   /translation="MSTKLSFRKFSDELFTELHALSAESKRRSSEVRHASDKSIEILKT
FT                   VHEFEDLPRHPDFVTPFVLSCASKNAKLTSVSVQCLQKMSSVNCIPEDRIEDVLDAFID
FT                   STHLAAEIQLKVLQIIPLFFKTYSQVVVGKLCSKLLLCCSSLIQIPNKAPVVFGTASAT
FT                   LQQLINDILERATIDQESRTCKVAVNNIEFIEVGSFRHDANRLFNDLCNLKNASYSPKD
FT                   CILNVESIPEDYGLEVLESVLRNHRKLFAACPDLQFVLRTRAVPLLLRSISSSKSFPIV
FT                   VRSARCLTLLIQEEFLAILELELEIILFLLINILSNEIESPIWKKIISLELFQLVCKNF
FT                   ALVWGIFKSYDVHPDRRQILKSLLSTLKGILSQKEYHEYLKVLHVLTRGDTPIVSQEYS
FT                   VAKIPFIDLLDKASAPLVDQTYVVYLVLAVTNSISDGMGSQAVSLYQKQAKEEEVKSLK
FT                   LMYSELFDDLFFIHKMFLYASTLDTPLFHSVVRAFQKLSHSAGVLECENKLNKCLRLFG
FT                   IATVESCHIMGEAPEDNESDRSLTTASTVINTISESLIGNSSNAKGSFEANLQHSRAIH
FT                   QRTISVFRALMSLSLSLGSVFSSDSWKEVLKTWQWMSYYLEGPSRDSDHSTHGFKTAQN
FT                   PRASSSDISAAKFSIIKLYESTQHYSSSSFNVMVSSVIQQSKECAELITSNYAPEGHSP
FT                   VDGSKMLNTCIFNRDFFIAQLRELSQINIWRLVNESKWRPSWDLVISYLVEVAASREIA
FT                   NEKLRLSAVDVFNNIISRAAIVSSDPEIPQKTDTEAAQSRLLTALMQMINSIMSLKRTR
FT                   DDVRNGAVETEYDILFQVLRTLKGLLDIFGDSLQGAWDVVFKIINCPFVIMSESSITEL
FT                   SDHEEDSSILETISSKHNGVIKLSFEVFKLIFDDFLQTLPLDVVKNVIDTLLNFVRQDR
FT                   DLNISFSSISQFWLIGDYLRTCVSKVPSEFTDSQKLAFAKKIEDGQLISMISDQNTEPC
FT                   GLYYGLWLYLLKKLVECTNDERVEVKNGAIQTFFRIIDSHSSSFPPWELIVHEVIKPLL
FT                   QQRSNFEEYLESGEYVNLTLKGLIHMFALYLAKFSHTSDFTEAWSLLVCYMADLVILPS
FT                   FEISFIVLSNLRELLQAVLKIQDFPARITSEIYQRWCGYNVIYADPAKSSELKRKTNYD
FT                   CVEELLLCYPFLHQLMGSQGLLDAEKVENILLILNSAARYPLLPEFSTDNQKPSTLQNA
FT                   VLKSIKTFELGQQLDVELLMLDQISTIMALPFDTRTRIQMKLGPKLSSSSRKRIPSFEA
FT                   MSYEACSCFSQRLSGINDLNQSFVSSKRLLKILKSLSIPIINKSLIKGDMNNSAVLWTL
FT                   SSRCFFSLAEKILDVFHYEEVDHIPEEVRDAFFDMFVEVAVVPLKRLDSETDLLTEIDD
FT                   IEEFQHFREKLLQQLNLESLKAKHLKKFVSSVWSASFFHEVDDIEDEIIKSSESLEEVA
FT                   QKLAVFPFDEVLESTRGQKLLSKYKTATLCLQDLTNYMMFEGPGFDKLRAVCLPFLVAR
FT                   YAFSLRRYVSDAILLNRAPIAKDRSMEVALVLSGLRKVLDYISKAKGKVACDKAIRDLQ
FT                   VLYPLILRAIPVSQKVSGLETIVQEVSLDFTKLLH"
FT   gene            <126448..>127878
FT                   /locus_tag="KLTH0A01364g"
FT                   /old_locus_tag="KLTH-ORF16906"
FT   CDS_pept        126448..127878
FT                   /locus_tag="KLTH0A01364g"
FT                   /old_locus_tag="KLTH-ORF16906"
FT                   /product="KLTH0A01364p"
FT                   /note="weakly similar to uniprot|P48564 Saccharomyces
FT                   cerevisiae YNL295W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21080"
FT                   /db_xref="GOA:C5DBC3"
FT                   /db_xref="InterPro:IPR014804"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC3"
FT                   /protein_id="CAR21080.1"
FT                   /translation="MFRNLAHLYNGKFQTLNRTNALWERCSCMRLCSTDANAAEKSKEE
FT                   EEEVEVATKENGKKDGGDWNGSNAYSCGRPSRKSGKGVYLVPKVHSTDHIKQDEIHTEG
FT                   LFAGNKPLFLGELSLSFKRPSGALDGIFGTLTKIKRATDDGGDQEIDVQGIINDLQTGD
FT                   KDISSGEKSAAKRPVIPWDASISGMVYNDQPFKQVPRGVVNKLKPFKLLKIERKNKSGN
FT                   SQDHELVKMRVHNSKVNDELQLVDLNREATRRPPTLELNDSAGKAKRFYTDESKSLTQF
FT                   KFIRSDQHVFKTDVDKLNNLLVKEFLKRTKLKIDSEFRDNQLPLYIYINKTLSSNALLQ
FT                   RFIRKRVTDHISPLFTTILSSYEREDEAKKFEKRIQLRVNSLVEDLAEYFPSVFFAGDI
FT                   VDCVHHPSPVPGYGRLYWLKPGKRHKAIWGRNSESDFVFNLSNTYRITRSGVRYMKYPI
FT                   NIHYRTFHQAFTEWEYRK"
FT   gene            complement(<127952..>129517)
FT                   /locus_tag="KLTH0A01386g"
FT                   /old_locus_tag="KLTH-ORF16904"
FT   CDS_pept        complement(127952..129517)
FT                   /locus_tag="KLTH0A01386g"
FT                   /old_locus_tag="KLTH-ORF16904"
FT                   /product="KLTH0A01386p"
FT                   /note="similar to uniprot|P48565 Saccharomyces cerevisiae
FT                   YNL294C RIM21 Protein proposed to be involved in the
FT                   response to alkaline pH; has similarity to A. nidulans
FT                   PalH"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21081"
FT                   /db_xref="GOA:C5DBC4"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC4"
FT                   /protein_id="CAR21081.1"
FT                   /translation="MVKKTSWRYSQVPKEYQSCGGIDLGNGVLIWKNKWQPVAYFDSVR
FT                   FTSYCDEGNPVYSSLKRNRLSFPYSKALQRDWHTFITSGNDRGPFKYSIYAIIMSFTTN
FT                   FVITLFLTVIVFITIRQKPHRGASNLLKLGSTLASVNLAIFISKALKVLHQDHIYKGVV
FT                   STERVLDLLWMDLTFTCLDLLVVLICQLCQVQIIMRLFSRVKEKRTVFLVGVTLSIISQ
FT                   VLWAIPTLAQSINDNFSGLSYDADGLTLLSPFVYLFRIALAASYACIICFNMFNKRHLC
FT                   FLYQRMMILTLLALIIVLLQPGFFVADVANIWVDDLSEIFNTTCYVGSAVIVWEWVDHI
FT                   LILERKVQAQSVLGRPVYEDDQEDYHFAKYALKVQDAISRDSETGEIGSRNDTANSGTE
FT                   EQRVRWQYGDDTPPRDTNKVEFNEPQPLKNVILEKCSRIWDGMIYYTDHFIVKGLVIKT
FT                   LSIHSKSSSDDHRKRKAKVRRRIGLDRPNEVYVYATRDVVFDSDEDEAESNQGSSVDEE
FT                   RDFP"
FT   gene            <129878..>131578
FT                   /locus_tag="KLTH0A01408g"
FT                   /old_locus_tag="KLTH-ORF16902"
FT   CDS_pept        129878..131578
FT                   /locus_tag="KLTH0A01408g"
FT                   /old_locus_tag="KLTH-ORF16902"
FT                   /product="KLTH0A01408p"
FT                   /note="similar to uniprot|P48566 Saccharomyces cerevisiae
FT                   YNL293W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21082"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC5"
FT                   /protein_id="CAR21082.1"
FT                   /translation="MTKLSDVHDYGSSKTKSRNGGLSGYLASKSPSVPNLTQTFTTRSM
FT                   KETSPERAGYQQFGSPLVEEPTNLSVIDLYGDEDDEDADDDEDADDDEAEGSQSTSGVI
FT                   ADLPVSSTESPSLEAPNAFGAAKDLSQYDRYGFKKQTAHVSQEEYHMWWDQYSRYCIRR
FT                   KRKWQDLLEKSGLAPSNDVPDRFPPRSEKLKRYVRKGIPAEWRGQAWWYFARGQEKLNK
FT                   NAGVYDKLLEGLNNKKDKNNCKDLEVIERDLHRTFPENIHFQKDPKEGQEPLMIQSLRR
FT                   VLLAFSVYNPKIGYCQSMNFLAGLLLLFLDEEKSFWMLVIITSRYLPGVHNVNLEGVNV
FT                   DQGVLMLCVKEYLPDFWQRIIPKEQSRSNEFLYKLPPITLCTASWFMSCFVGVVPIETT
FT                   LRIWDCLFYEESHVLFKISLSIIKICEQELAGSRLAHRGLRARTHGRDDDDIEVFQVIQ
FT                   TVPKKLLDPQDIFDRIIFKRRVPLNNLNQEEIDRCRKYVTSQRLKFKNCAEIMGDRTSA
FT                   KASAKRDLEIGPDFVNNALSSEVYGFRRSLTGAHWNNSIKEKVRQIRRK"
FT   gene            complement(<131610..>132350)
FT                   /locus_tag="KLTH0A01430g"
FT                   /old_locus_tag="KLTH-ORF16897"
FT   CDS_pept        complement(131610..132350)
FT                   /locus_tag="KLTH0A01430g"
FT                   /old_locus_tag="KLTH-ORF16897"
FT                   /product="KLTH0A01430p"
FT                   /note="similar to uniprot|Q12285 Saccharomyces cerevisiae
FT                   YOL111C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21083"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR031765"
FT                   /db_xref="InterPro:IPR040474"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC6"
FT                   /protein_id="CAR21083.1"
FT                   /translation="MSLIKFNFQKANCATKKYPIDHKELPLPIGIKKQKRASMSLPEKE
FT                   FISKFLSLVAQQPIVLKSDFKTPMENITNLGVALPPLKYKYDHKRLKRNGGNGSGSARI
FT                   QLNLKSIRAPKFVYSQEFDQSETIYQVKEFLIQKEDSIHETSQLKVLLKGKVLHDNILL
FT                   SDLKSDKVDLVVMVSKLENAASQGTSAGDSANASIDAEEIAPRSVQVPWVKIEQLLKNE
FT                   MADPQEATAVLQRLQRGWDLADLD"
FT   gene            <132363..>133031
FT                   /locus_tag="KLTH0A01452g"
FT                   /old_locus_tag="KLTH-ORF16896"
FT   CDS_pept        132363..133031
FT                   /locus_tag="KLTH0A01452g"
FT                   /old_locus_tag="KLTH-ORF16896"
FT                   /product="KLTH0A01452p"
FT                   /note="similar to uniprot|P41912 Saccharomyces cerevisiae
FT                   YOL110W SHR5 Subunit of a palmitoyltransferase composed of
FT                   Shr5p and Erf2p that adds a palmitoyl lipid moiety to Ras2p
FT                   through a thioester linkage palmitoylation is required for
FT                   Ras2p localization to the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21084"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC7"
FT                   /protein_id="CAR21084.1"
FT                   /translation="MNSALTSSNSKHVVPDDSDQPKALFFNYHEFSVTDYAEIGKECSE
FT                   HEEELALCITHFPNTYAPLDSIRFKQTRIVRIPRRYEDNLDWPVFCTLLPGHEPAALVN
FT                   QDGSLQFVPYGFYENQIYGLSSVSPLSSYLSPEEFKDIVETVNMYLRQGYDPNTWRNII
FT                   SATFDVLTFNLWNCLMIRLVSSPLLKLENYVETLNKSKLFKNKNIRLISPRRSGFLSVC
FT                   "
FT   gene            <133212..>134447
FT                   /locus_tag="KLTH0A01474g"
FT                   /old_locus_tag="KLTH-ORF16895"
FT   CDS_pept        133212..134447
FT                   /locus_tag="KLTH0A01474g"
FT                   /old_locus_tag="KLTH-ORF16895"
FT                   /product="KLTH0A01474p"
FT                   /note="similar to uniprot|P48567 Saccharomyces cerevisiae
FT                   YNL292W PUS4 catalyzes formation of Psi55 (modified
FT                   uridine) in mitochondrial and cytoplasmic tRNAs
FT                   Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21085"
FT                   /db_xref="GOA:C5DBC8"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC8"
FT                   /protein_id="CAR21085.1"
FT                   /translation="MNGIFAIEKPSGISSSQFLLKLQNVLMNSSVFSREIQRATAERMQ
FT                   QYQRETGKKPSKRKLRKVSKVKMGHGGTLDPLASGVLVVGVGTGTKKLSQYLSGTVKVY
FT                   ESEALFGVSTTSGDVEGEILSMHSVSHLKMDDLKSVEKKMVGSLKQTPPIFAALKMNGK
FT                   PLHEYAREGIPLPRAIEPRQVEIYDLEVFPESLTRDHTYKLLRPATDADKEVVSELSHQ
FT                   GNLLTDKLFFSKQFCESQGWESEEAKVDPPIALSEEEMQQLLAEGDNYRAPLLHFKAKV
FT                   SSGTYIRSLISDIGKAMRSSCYMVKLVRCQQQEWALDKRNVFRMEDFTENDEAVWTKVL
FT                   EQVLEQGSSVDIMQELADAQDAFKKQKEDLEQQLKSELQSCSSAEVAEVDGSANPAKRP
FT                   LDEDDSNSEAKS"
FT   gene            complement(<134444..>136030)
FT                   /locus_tag="KLTH0A01496g"
FT                   /old_locus_tag="KLTH-ORF16892"
FT   CDS_pept        complement(134444..136030)
FT                   /locus_tag="KLTH0A01496g"
FT                   /old_locus_tag="KLTH-ORF16892"
FT                   /product="KLTH0A01496p"
FT                   /note="similar to uniprot|P41821 Saccharomyces cerevisiae
FT                   YNL291C MID1 N-glycosylated integral plasma membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21086"
FT                   /db_xref="GOA:C5DBC9"
FT                   /db_xref="InterPro:IPR024338"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC9"
FT                   /protein_id="CAR21086.1"
FT                   /translation="MTNEMYWGLWAITWIAAFLGTVQGYRDFSVSDEEVQRASLLNSNL
FT                   IQEWTPIESVITAGKRDYFTFQINSTYAHTMSKLDMLVFISGNLHSESARLSNSTELQL
FT                   AVWYSFDQEVTSDTSKGSRALFSAGYMEALAATPLEDQDGNLTEYSNLYLVIEAYNVTS
FT                   NSPLQLTSTTQDLSWNYTIGVSQYDLVFQWDVRSWVELVDSDADSALLVTGNVTSLTTT
FT                   SANSSLYDVGLYELYLYSYDELIAFDKALPHSLRAVQDGPYLASSVNNSAVKIELSNSS
FT                   TPEIVKSLTVRGGSVKEQFYITGLNHSTTYGVYLTKKISDNTEVLSDSGGILFSKATFT
FT                   TMADDSCSLIFGLDFCDGVAYSVPTAKSAGTNKTVTSLIYDGIASSLYSNFSKALQMIP
FT                   CDTEKDARFSPLRTCNDCANSYRNWLCAVTIPRCTTENSSYYIHRDKTQNRNDFLNQQI
FT                   QPIHDYYEILPCIDMCYNLAADCPPDFQFSCPSKTSHSELLYLSYSVWEENDFHTCNYV
FT                   GNSRNLHILNS"
FT   gene            complement(<136291..>136394)
FT                   /locus_tag="KLTH0A01518r"
FT                   /old_locus_tag="Klth0A.tSer.GCT.13"
FT   tRNA            complement(join(136291..136335,136358..136394))
FT                   /locus_tag="KLTH0A01518r"
FT                   /old_locus_tag="Klth0A.tSer.GCT.13"
FT                   /note="tRNA-Ser (GCT) cove"
FT   gene            <137284..>138270
FT                   /locus_tag="KLTH0A01540g"
FT                   /old_locus_tag="KLTH-ORF16886"
FT   CDS_pept        137284..138270
FT                   /locus_tag="KLTH0A01540g"
FT                   /old_locus_tag="KLTH-ORF16886"
FT                   /product="KLTH0A01540p"
FT                   /note="highly similar to uniprot|P38629 Saccharomyces
FT                   cerevisiae YNL290W RFC3 Subunit of heteropentameric
FT                   Replication factor C (RF-C) which is a DNA binding protein
FT                   and ATPase that acts as a clamp loader of the proliferating
FT                   cell nuclear antigen (PCNA) processivity factor for DNA
FT                   polymerases delta and epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21087"
FT                   /db_xref="GOA:C5DBD0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD0"
FT                   /protein_id="CAR21087.1"
FT                   /translation="MNRSAENLPWIEKYRPQTLDDVYGQREIVGTVRKFVKEGRLPHLL
FT                   FYGPPGTGKTSMIVALSREIYGTNYRNMVLELNASDDRGIDVVRNQIKEFASTRQIFSK
FT                   GFKLIILDEADAMTNAAQNALRRIIEKYTKNTRFCILANYAHKLTPALLSRCTRFRFQP
FT                   LPTDAIEKRVNKVLILENLKLSREAFTALLRLSKGDMRRALNVLQASKATLDDPDAEVT
FT                   EDTIYECIGAPHPQDIETALESMLKDDWSTAFFTVNKIRTLKGLALIDLVEGIVETLEG
FT                   YELKPETRVELLCKLSDIEYAMSKGGNDKVQSSAVIGVVKSSFELEA"
FT   gene            complement(<138389..>140236)
FT                   /locus_tag="KLTH0A01562g"
FT                   /old_locus_tag="KLTH-ORF16883"
FT   CDS_pept        complement(138389..140236)
FT                   /locus_tag="KLTH0A01562g"
FT                   /old_locus_tag="KLTH-ORF16883"
FT                   /product="KLTH0A01562p"
FT                   /note="similar to uniprot|P39980 Saccharomyces cerevisiae
FT                   YEL065W SIT1 Ferrioxamine B transporter member of the ARN
FT                   family of transporters that specifically recognize
FT                   siderophore-iron chelates transcription is induced during
FT                   iron deprivation and diauxic shift potentially
FT                   phosphorylated by Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21088"
FT                   /db_xref="GOA:C5DBD1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD1"
FT                   /protein_id="CAR21088.1"
FT                   /translation="MVSFSILLHSGKNSRNKLKKMSLEGHPAKDAKDHAEQILARRKDA
FT                   GVNNIEVYAAQYSHFAYRVALFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLATI
FT                   NCVKAVIAAAGQICFARASDIFGRMTILALAVVLYAVGTIIDSQATNITRYAAGACIYQ
FT                   LGYTGIILILEIIAMDFSNLNWRLMASFVPALPFIINTWISGNALEALGMNWKWGIGMW
FT                   AFIVPLSCVPLFACILHMRFLAHKNAKDQLESEVLLYKHMPWSQYLVEVFFWRLDLLGL
FT                   LLVCVVFGCILVPFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPW
FT                   SLVKDRGIWSALIIAIHINFVWYMQGDYMYTVLMVAVNETAKSAARITSLYSFVSVITG
FT                   FLLGGVIVYARRTKKFILFGIACWFVAFGLLVHYRGDSSSHSGIVGSLCLLGFGAGFFT
FT                   YTTQTSIQASTKSHQDMAVITALYLSHYNIGSALGASISGAIWTNILPRELRKRITDVA
FT                   TYTLAYGSPFVFIEEYLWGTPERMEVVAAYRVVQRILSIVGLCFCVTLLLSAFFLRDHR
FT                   LENAVALEDVDEKSSRKSDELEARIEDNTETKGFERYGI"
FT   gene            <141289..>142134
FT                   /locus_tag="KLTH0A01584g"
FT   CDS_pept        141289..142134
FT                   /locus_tag="KLTH0A01584g"
FT                   /product="KLTH0A01584p"
FT                   /note="similar to uniprot|P24867 Saccharomyces cerevisiae
FT                   YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
FT                   involved in entry into the mitotic cell cycle and
FT                   regulation of morphogenesis localizes to sites of polarized
FT                   cell growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21089"
FT                   /db_xref="GOA:C5DBD2"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD2"
FT                   /protein_id="CAR21089.1"
FT                   /translation="MRRCGMWAGGACGGQSTLSITASNENSVKMSDTKVLKILFKSPVT
FT                   DDMIRYLTNTTLSVLPCAREPRQAYPSPPSSPGAASKRALPSLMTFITRLVRYTNVYTS
FT                   TLLTATCYLEKLRRLLPRDAHGLPSTGHRIFLACLILSAKYHNDSSPQNKHWAAYTDGL
FT                   FCLDDVNLMERQLLQLLDWDLRVEEQELCDALEPLLEPIRHDLARSRKAMARNYYHQRN
FT                   MSTCSSTSTLVSTPSLPSLASMKSLTAMKSLPSLPRLPSKASLYAPLYSQCDYSSATLV
FT                   "
FT   gene            <142562..>142659
FT                   /gene="SNR40"
FT                   /locus_tag="KLTH0A01606r"
FT                   /old_locus_tag="Klth0A_snoRNA_215"
FT   ncRNA           142562..142659
FT                   /gene="SNR40"
FT                   /locus_tag="KLTH0A01606r"
FT                   /old_locus_tag="Klth0A_snoRNA_215"
FT                   /product="snRN40"
FT                   /note="C/D snoRNA monocistronic SNR40"
FT                   /ncRNA_class="snoRNA"
FT   gene            <143444..>144091
FT                   /locus_tag="KLTH0A01628g"
FT                   /old_locus_tag="KLTH-ORF16867"
FT   CDS_pept        143444..144091
FT                   /locus_tag="KLTH0A01628g"
FT                   /old_locus_tag="KLTH-ORF16867"
FT                   /product="KLTH0A01628p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21090"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD3"
FT                   /protein_id="CAR21090.1"
FT                   /translation="MTEQSTPLWLQDRDAVIAQTPAHMWRLGKPTYKFTDRRLNRERQV
FT                   HFEPGSLGDLVTNLARVFEMEATNKANPDDWISVDPRVFRMTVNGSREYTVQDIVTKGG
FT                   YNVFLGDLPNYKASESDYAKSEDAFHKAFRTGFLWEILTLEAELPVATFTWRHWGQQNG
FT                   VFNGHKGDGSVLDIKGTTRATLNDKLQLVRLEHTFDAPGMIDTLSGVCPMAH"
FT   gene            <144813..>145172
FT                   /locus_tag="KLTH0A01650g"
FT                   /old_locus_tag="KLTH-ORF16860"
FT   CDS_pept        144813..145172
FT                   /locus_tag="KLTH0A01650g"
FT                   /old_locus_tag="KLTH-ORF16860"
FT                   /product="KLTH0A01650p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21091"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD4"
FT                   /protein_id="CAR21091.1"
FT                   /translation="MSESLEHKAEQAQQAAAVNAEHAQAKVAEVGDNAERSAQETQEKA
FT                   VAAAEEQAQEAKKEANKVEESAKKEAEGVKESAQDKVDEVKKTTAAEKSETAAAEGEKV
FT                   SPWKRFVAKLKKLLN"
FT   gene            <145378..>146538
FT                   /locus_tag="KLTH0A01672g"
FT   CDS_pept        145378..146538
FT                   /locus_tag="KLTH0A01672g"
FT                   /product="KLTH0A01672p"
FT                   /note="similar to uniprot|P53829 Saccharomyces cerevisiae
FT                   YNL288W CAF40 Evolutionarily conserved subunit of the CCR4-
FT                   NOT complex involved in controlling mRNA initiation
FT                   elongation and degradation binds Cdc39p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21092"
FT                   /db_xref="GOA:C5DBD5"
FT                   /db_xref="InterPro:IPR007216"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD5"
FT                   /protein_id="CAR21092.1"
FT                   /translation="MCRCSCYVVTCPRQYPFPVTNALTANFHTLGSRIARSLELFGPQT
FT                   DSTSLQPQLRMFANPAAAPAASLGFAPSQQPQQSQQPQHAQQAQQAQQAQQAQQPGSTA
FT                   AAAAAKANLHALDDPNVYHWICQLTYGPNKEQALLELGRKREQYEDLAVVLWSSFGVIT
FT                   ALLNEITSVYPMLSPPVLSNQLSNRVCNALVLLQCVASHPETKNLFLQAHIPLLLFPFL
FT                   NTTSRQRTFEYLRLTSLGVIGALVKIDSAEVIAFLLRTDIIPLCLRIMESSSELSKTVA
FT                   IFILQKILLDDAGLQYICATPERFLAVSQVLTYMVEQLTLQQTPGRLLKHVVRCYLRLS
FT                   DNLEARRLLKQVLPRQLKDNTFGEVLRDDLGTKRCLAQLLLTLNED"
FT   gene            <146853..>149654
FT                   /locus_tag="KLTH0A01694g"
FT                   /old_locus_tag="KLTH-ORF16853"
FT   CDS_pept        146853..149654
FT                   /locus_tag="KLTH0A01694g"
FT                   /old_locus_tag="KLTH-ORF16853"
FT                   /product="KLTH0A01694p"
FT                   /note="highly similar to uniprot|P32074 Saccharomyces
FT                   cerevisiae YNL287W SEC21 Gamma subunit of coatomer a
FT                   heptameric protein complex that together with Arf1p forms
FT                   the COPI coat involved in ER to Golgi transport of
FT                   selective cargo"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21093"
FT                   /db_xref="GOA:C5DBD6"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="InterPro:IPR032154"
FT                   /db_xref="InterPro:IPR037067"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD6"
FT                   /protein_id="CAR21093.1"
FT                   /translation="MSTHTYKKFEEADSGILPDKMTIYQDCLNAFNESPVNAKRCRLLI
FT                   SRLLQLLAQGQTFPRTEATALFFAISKLFQHPNDSLRQAVYLAIKELSAVSDDVLMATS
FT                   SIMKDVQNGSDMIKPNAIRSLTRVLDESTAFSAERLFKSAVVSKHPSISSAALVSSYHL
FT                   LPVAESTVKRYANETQEAVSDLKTYPYQSGTSEHYPNSTYIAQYHALGLLYLLRKHDKV
FT                   ALMKLVQQFSAGNLLKNQLAQVQLVKLVGSLLQKDPQLVTQFTPLLLSWLSNKYESVQL
FT                   EDAKLITSLPDRFVSPEIFASAVQTLQGLLTVPRVTTRFAAVRVLNRISMVAPEKIVVC
FT                   NPELESLINDSNRNVSTYAITSLLKTGTSNNIASLIKTITNFIHEISDDFKIIIIDAVR
FT                   TMALKFPEEWKSILNFLINVLKQGEGGFEFKNSIVEALFDLVQFVPQSRELAFENLCDF
FT                   IEDCEYNEILVRILHILGKEGPSMKIPSLYVRHIYNRVVLENSIVRSAAVVALSKFALV
FT                   KNDPTLVESIEILLRRISNDADDEVRDRATISLEFIESIKSKEGASSSAAEDLLQSKYS
FT                   YDLVSLESKLSQYMSAKQESFKAPFDSSSVHRYTEDERKAIDLKRKQEQLFSALPSAGK
FT                   SKRAASSSQDAEKRNGSYAGPASNEVDQDLQSTKFVEELESIEELKSLGPIINTSKEVP
FT                   LTETEAEFVVSGVKHLFKNHVVLQFHITNTLTDVALDNVSVGCTMEQEDSTALQETSTI
FT                   PVDRIMPSETFACYVVYEKSEEVVTEGFLNTLYFTTRELDATTHEPFAGDEGFQDEYEI
FT                   DSLFLTAGDYIKGSFVGNFSACFDELPHSEVAVYNIKENISLQEVVDKLVVNTSCLTLD
FT                   NTQFAPTDSNSHTLKLFGKSVLNGARVALVVRMIKSSKGIALKGEIRSDDANLCNDVVD
FT                   GLI"
FT   gene            <149859..>150749
FT                   /locus_tag="KLTH0A01716g"
FT                   /old_locus_tag="KLTH-ORF16850"
FT   CDS_pept        149859..150749
FT                   /locus_tag="KLTH0A01716g"
FT                   /old_locus_tag="KLTH-ORF16850"
FT                   /product="KLTH0A01716p"
FT                   /note="similar to uniprot|P53830 Saccharomyces cerevisiae
FT                   YNL286W CUS2 Protein that binds to U2 snRNA and Prp11p may
FT                   be involved in U2 snRNA folding contains two RNA
FT                   recognition motifs (RRMs)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21094"
FT                   /db_xref="GOA:C5DBD7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034393"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD7"
FT                   /protein_id="CAR21094.1"
FT                   /translation="MDEEELQLKKELREKKAQELARRKRARDNTERKEDTKRPLKNCAI
FT                   YISHLPLEVTKDEVIEEFTKYGVIRKDLKSSEPKCKFYYGVDGSFEGAALIVYMRPESV
FT                   RMAVDLMDGYSFMGNKLKVEEATFKKEPKDDKKSPNASQEGSRDVSAEPKLNNIHAKLN
FT                   EQERELQDWDDTTDEKTTPREEGSEVDSIPDESENASSRTVVLANVLDLYANLAPQQIA
FT                   EVAADLKEGCEAIGSVSSFEFDEVLGQAKVEYKSSEIAQKCCQLMNGRYFDGRKLVAYN
FT                   LEQGEEEEEDEVAEW"
FT   gene            complement(<151340..>151411)
FT                   /locus_tag="KLTH0A01738r"
FT                   /old_locus_tag="Klth0A.tGly.TCC.12"
FT   tRNA            complement(151340..151411)
FT                   /locus_tag="KLTH0A01738r"
FT                   /old_locus_tag="Klth0A.tGly.TCC.12"
FT                   /note="tRNA-Gly (TCC) cove score=66.72"
FT   repeat_region   complement(151472..151734)
FT                   /locus_tag="KLTH0A01760t"
FT                   /old_locus_tag="Klth0A.LTR.4"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <152482..>153663
FT                   /locus_tag="KLTH0A01782g"
FT                   /old_locus_tag="KLTH-ORF16846"
FT   CDS_pept        152482..153663
FT                   /locus_tag="KLTH0A01782g"
FT                   /old_locus_tag="KLTH-ORF16846"
FT                   /product="KLTH0A01782p"
FT                   /note="highly similar to uniprot|P38219 Saccharomyces
FT                   cerevisiae YBR025C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21095"
FT                   /db_xref="GOA:C5DBD8"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD8"
FT                   /protein_id="CAR21095.1"
FT                   /translation="MPPKKQVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQAITRCPL
FT                   GNPANYPFATIDPEEARVIVPSPRFDALCDIYKPASKVPAHLTVYDIAGLTKGASAGEG
FT                   LGNAFLSHIRAVDSIYQVVRCFDDAEIIHIEGDVDPVRDLDIISTELRLKDIEFAEKHL
FT                   ENVHKITKRGGQSLEVKQKKEEAILVEKIIELLKSGQRVANQNWTTKEVEVINSMFLLT
FT                   AKPSIYLINLSERDFIRKKNKHLMRIKEWIDKYSTGDLVIPFSVCLEERLSHMSPEEAE
FT                   EELKNLKVESALPKIVTTMRQKLDLISFFTSGADEVREWTIRRGTKAPQAAGVIHNDLM
FT                   NTFILAQVMKYEDVVEYKDEVAIKAAGKMQQKGKEYVVEDGDVIYFRAGAGKN"
FT   gene            complement(<153812..>154807)
FT                   /locus_tag="KLTH0A01804g"
FT                   /old_locus_tag="KLTH-ORF16842"
FT   CDS_pept        complement(153812..154807)
FT                   /locus_tag="KLTH0A01804g"
FT                   /old_locus_tag="KLTH-ORF16842"
FT                   /product="KLTH0A01804p"
FT                   /note="similar to uniprot|P23833 Saccharomyces cerevisiae
FT                   YBR037C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21096"
FT                   /db_xref="GOA:C5DBD9"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017276"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD9"
FT                   /protein_id="CAR21096.1"
FT                   /translation="MLSRTGVFTVLKRSTRLSGYALRPLSTRSCLRVEDQGTSRSRVTP
FT                   RGGAPSGASSSTDPSDQSAFSGNTPPKSTTFEDADPKRKPLSRIAIGGTETKSQKATSG
FT                   SIEFATWKAAALVLTLGGTLYYFFSKEKRRLEIEKEAEANRGYGKPLVGGPFKLVDFNG
FT                   NEFTEKNLLGKFSIIYFGFSHCPDICPDELDKLSEWLDGLKKKGIELQPIFITCDPARD
FT                   PPHVLKEYLSEFHPDLIGLTGEYNDIKNACKQYRVYFSTPPSLKPGQDYLVDHSIFFYL
FT                   MDPEGQFIDALGRQYDAETGVAKIEEHVKAYVPREQREKRKEKWYSFLFN"
FT   gene            <155431..>158223
FT                   /locus_tag="KLTH0A01826g"
FT                   /old_locus_tag="KLTH-ORF16838"
FT   CDS_pept        155431..158223
FT                   /locus_tag="KLTH0A01826g"
FT                   /old_locus_tag="KLTH-ORF16838"
FT                   /product="KLTH0A01826p"
FT                   /note="similar to uniprot|P14180 Saccharomyces cerevisiae
FT                   YBR038W CHS2 Chitin synthase II requires activation from
FT                   zymogenic form in order to catalyze the transfer of N-
FT                   acetylglucosamine (GlcNAc) to chitin required for the
FT                   synthesis of chitin in the primary septum during
FT                   cytokinesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21097"
FT                   /db_xref="GOA:C5DBE0"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBE0"
FT                   /protein_id="CAR21097.1"
FT                   /translation="MDYNPFVVDTNNASPVRSPQRAARRGESPWRSQYSANSSNENDLS
FT                   TAFQGFPQAAQVQPQSPSKAAAKYSPQRRNIFARDSAPSSPLRQDRYTANMRESPHRNA
FT                   RAVIEIDEASDDDEEQDLYDIYAQQADGSPSRAASRATRSTYSFESYRKSLDDDSTIYS
FT                   GDTFEQTQFQVNHPQKNYIRRGKSEVRRLPAPTSKKNILKLDNPIPRGLLEILPRRDSL
FT                   EFTEMRYTACTSEPDNYVNEGYSLRFAEMNRECQIAICVTMYNEDKFALSSTLHSIMRN
FT                   ITHMCKRKRSHVWGPQGWKKIQVIIVSDGRNNINKGSLDYLSALGVYQEDMAKSTVNGE
FT                   PVKAHIFELTTQVSIDSHLDYVSKDIVPVQVVFCLKEENQKKINSHRWLFNAFCPILDP
FT                   TVVVLVDVGTKLNDSAIYHLWKAFDRDSNVAGAAGQIKTMKGKWGRKLLNPLVASQNFE
FT                   YKMSNILDKPLESVFGYISVLPGALSAYRYRALKNHADGTGPLNSYFLGETQEGRQHDV
FT                   FTANMYLAEDRILCWELVAKRDAKWVLKYVKEATGETDVPEEPPEFISQRRRWLNGAMF
FT                   AALYAQLHFTQIWKTKHSATRKIFFHLEFFYQFVQMLFSWFSISNFFLTFYFLAGSMNK
FT                   LMKHGDVLFTFFKYLVICDLAALFIISMGNRPQGANHLFIISMIILSICSTYALVCGLV
FT                   FSIKTLQNPGESSMVFVNIVVSLLSTYGLYAFTSIMYLDPWHLITSFVQYLLMLPSFIC
FT                   TLQIFAFCNTHDVSWGTKGSTQDVKPKSEATVKQGPNGQQIVEGTEWPQEVDKKYAEIK
FT                   SRLKEQEIIEPKIDEAQKNNDYYRDIRTRIVMLWMLSNLVLMMIVTQVYGPEDTAKNKY
FT                   LTFILWSVAILALFRALGSMAFLFLKSLRAIVSFKHKAEDSGSLNIPSAKNLFSKPSKM
FT                   "
FT   gene            complement(<158347..>159708)
FT                   /locus_tag="KLTH0A01848g"
FT                   /old_locus_tag="KLTH-ORF16837"
FT   CDS_pept        complement(158347..159708)
FT                   /locus_tag="KLTH0A01848g"
FT                   /old_locus_tag="KLTH-ORF16837"
FT                   /product="KLTH0A01848p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21098"
FT                   /db_xref="GOA:C5DBE1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBE1"
FT                   /protein_id="CAR21098.1"
FT                   /translation="MSTKSTTTTDLTCESGILNIPAAAPLAINPGRLNQTILETGTAYG
FT                   GVARWGSQEHEFGMRRLAGTEEDGKMRGWFIKECEGLGCKIKVDQIGNIFAIFPGKNGG
FT                   NPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKENNYTPNYDVCVVVWFNEEGARFA
FT                   RSCTGSSVWSHDLPLKDAYELMSIGESIPESVYESLSKIGYIGEVSASYQENAIDAHFE
FT                   LHIEQGPILEDEKKEIGIVTGVQAYRWEKCTVFGVGAHAGTTPWRCRKDALLASSKMIV
FT                   AASEIAKKHQGLMTCGVIDAKPYSVNIIPGEVSFTIDIRHPSDEVVAKIFSEVHAQFDL
FT                   IVKDNVAGALTYDLEVLQVSPAVNFNEVCIECVSRSALAQFPASKVRQIWSGAGHDSCQ
FT                   TALHVPTSMIFIPSKDGLSHNFYEYSSAEEVENGFKVLLQAIVNYDNHRAIRGY"
FT   gene            <160925..>164152
FT                   /locus_tag="KLTH0A01870g"
FT                   /old_locus_tag="KLTH-ORF16835"
FT   CDS_pept        160925..164152
FT                   /locus_tag="KLTH0A01870g"
FT                   /old_locus_tag="KLTH-ORF16835"
FT                   /product="KLTH0A01870p"
FT                   /note="similar to uniprot|P29465 Saccharomyces cerevisiae
FT                   YBR023C CHS3 Chitin synthase III catalyzes the transfer of
FT                   N-acetylglucosamine (GlcNAc) to chitin required for
FT                   synthesis of the majority of cell wall chitin the chitin
FT                   ring during bud emergence and spore wall chitosan"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21099"
FT                   /db_xref="GOA:C5DBE2"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBE2"
FT                   /protein_id="CAR21099.1"
FT                   /translation="MVAEDDYYAFDNESLLRSRTGASGVQHGDSLVRRDRNDFADPGNP
FT                   HHYYAQKAQEQRQKGHVQVQESIPLQDMSDRPQKAAQAKKANSLSLWQLYCYVITFWAP
FT                   APLLSLFGMTKKERQFAWREKIALLSVIVYAGAFVAYLTFGFTRTVCSGSILRLRNNEV
FT                   STGYLIINGKSYSLDSSSHPEAAGIEDGTNVLYPPINAGGMDASFLFQNVNGNCKGLIT
FT                   PKDNCSIPYSDDSLAWYFPCKLFSQDGSTQPNFTKSEYYDGWACHTSETAREAYYSLSA
FT                   AADVYFTWDDIKNSTRNLVVYNGHVLDLDLLNWLQTDDLDYPPLFDQLRDSKLQGYDIS
FT                   LVLSDSFERRAARCLSEIIKVGEIDSSTIGCLASQVVLYISLVFILSVVVLKFLIACYF
FT                   RWFVAKKQGAFNDDNKTMNQHAKQIEDWSGDMNAQGPIRKMEPYSRPGDQRRLSTLDLI
FT                   KRNSRMLLNDTVDVTDKFHGMTTMTTQSYLKANTPDINLDKNAFQSPFTNDLISSSQAQ
FT                   ETLDPTIIHPEVVTQPPADYMPSSYPLIHTVCFVTCYSEDEEGLRTTLDSLSTTDYPNS
FT                   HKLIMVVCDGIIKGSGNDRTTPEIALSMVEDFVVPPEEVEPHSYVAVASGSKRHNMAKV
FT                   YAGFYKYNDATIPSELQQRVPMVVVVKCGTPDEQGSMKPGNRGKRDSQVILMSFLQRLT
FT                   FDERMTAFEYQLLKNIWQITGLMAEFYELVLMVDADTKVFPDSLTNMAAEMVKDPEIMG
FT                   LCGETKIANKGTSWVTWIQVFEYYISHHQAKAFESVFGSVTCLPGCFSIYRIKAPKGKD
FT                   GYWVPILANPDIVERYSDNDTGTLHKKNLLLLGEDRFLSSLMLKTFPKRKQVFVPKAAC
FT                   KTIVPDKFKVLLSQRRRWINSTVHNLMELVLVKDLCGSFCFSMQFVIGMELIGTMVLPL
FT                   AICFSIYVVIFAIVSHPTPIVTLVLLAIILGLPGLLIVVTATRISYLGWMFIYLLALPI
FT                   WNFVLPVYAYWKFDDFSWGDTRTIAGGNKSAHEEEEGEFDHSKIRMRTWREFQKEEHSN
FT                   DDDRGQHSRLNSILNLDLLPESSNFHR"
FT   gene            complement(<164315..>164866)
FT                   /locus_tag="KLTH0A01892g"
FT                   /old_locus_tag="KLTH-ORF16832"
FT   CDS_pept        complement(164315..164866)
FT                   /locus_tag="KLTH0A01892g"
FT                   /old_locus_tag="KLTH-ORF16832"
FT                   /product="KLTH0A01892p"
FT                   /note="similar to uniprot|P38218 Saccharomyces cerevisiae
FT                   YBR022W POA1 Phosphatase that is highly specific for ADP-
FT                   ribose 1''-phosphate a tRNA splicing metabolite may have a
FT                   role in regulation of tRNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21100"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBE3"
FT                   /protein_id="CAR21100.1"
FT                   /translation="MGVSNVRYVRGNCLAASISHPRILIHSCNCNGSWGGGIAYQLGAK
FT                   FPKAEGDYIELCEKFGSSLLGKFVLIPSYTDSTLLIGCLFTASFGGSQQGTGDSILSYT
FT                   KQALEDMRIKIFSDTGSGGEIDSFSRKYIQRFKDKLKVPVADYKLEMPQINSGIFGVPW
FT                   PKTEQLLAEQSSLSFTVYVL"
FT   gene            complement(<165071..>169570)
FT                   /locus_tag="KLTH0A01914g"
FT                   /old_locus_tag="KLTH-ORF16831"
FT   CDS_pept        complement(165071..169570)
FT                   /locus_tag="KLTH0A01914g"
FT                   /old_locus_tag="KLTH-ORF16831"
FT                   /product="KLTH0A01914p"
FT                   /note="similar to uniprot|P32568 Saccharomyces cerevisiae
FT                   YDR011W SNQ2 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21101"
FT                   /db_xref="GOA:C5DBE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBE4"
FT                   /protein_id="CAR21101.1"
FT                   /translation="MSADVQAKSGAEPRSGAASSRSEAEHEAAYTGPGTKEEFQDARQS
FT                   DGQAARDHIVRLMARRTSSVGEEEDLDPEVLSRVETLARTLSSHRMRNGVLQVDPDDFD
FT                   AEAIIRAHVRGSEEQGIHLRRAGVIGENFTVVGKDCSSVEAQTFEDILLLPRTIFRGIR
FT                   EAKNRKTRDIVRNANILARPGEMILVLGRPGAGCSSFLKTVSGEVDNFEEVRGEISYDG
FT                   ISQKEMMAKFKTDVIYNGETDVHFPHLTVQQTLDFALSCTTPQKRLDNASRSEYITAMR
FT                   ELYGTIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALASRGSIYCWDNATRGLDAST
FT                   ALEFAQAIRIMTNLQKSVAFVTIYQASENIYECFDKVTVLFDGRQIYYGHVEDAKAYFK
FT                   KLGFLCPARQASAEFLTALTDPNGLHEYVPGFENKVPRTADEFEKLWLESQEYQDLLKD
FT                   IDNYKRETEAEKTKELFSASLAQEKSKLNRKKSKYTVSFAEQVKLCTKRGVQRIYGDKA
FT                   YTITNLIASIIQSLVSGSLYYNLPSGVSGAFSRGGVFYFSILYVSLMGLAKISLDGRPV
FT                   VQKHKSYSLYHPAAEALATSLSEFPFRFLSQTCFYIIIYFLSGLTREANRFFTSFLFLI
FT                   LCSESINAFFELITAFSSSVAQANSIAGTSLMALVLYSTYMIQLESMHPWFKWISYCIP
FT                   IRYTFESMLNSEFHARKMDCTGSIIPAGPAYANVATENQVCAFVGSKPGQDYVNGDDYI
FT                   KANYGYKYDHTWRNLGFLFAFLAVYVALKCLITELNTTSMGSGDTLVFKKGAKRVSPSS
FT                   DEESREKSLTMSEAKKNLDSNASTSGSSAEALQGLKSTGIFIWRNVCYTIPYRGSTRRL
FT                   LDNVSGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGNHIDASFERRTG
FT                   YVQQQDVHVKEMTVRESLQFAARMRRPQSVPEAEKMAYVEDIIEILDMEEYADALVGDV
FT                   GYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQSSWAIVQLMRRLAEAGQSILC
FT                   TIHQPSATLFEQFDRLLLLKKGGQTVYFGPIGKNSRTLLNYFEGNGARKCEHTENPAEY
FT                   ILEAIGAGATASVKEDWHEIWTNSPQFNEANEEIENYLRDSKQNSPPADKNEKISKYAT
FT                   SYSYQFRYVLQRTATIFWRNSEYLIAKMMLYISAGLFIGFTFYNVGTSYRGLQNTMFAA
FT                   FMALIVSAPAMNQIQARAIASRELFEVRESKSNTFHWIFLLLTQYLCEIPYHLVFSTLF
FT                   FVAFYFPLRVHFAATYSGVFFLNYCIMFQLYLVGLGLMLLYAAPNLPSAGVLLSLCLSF
FT                   LISFCGVVQPASLMPGFWTFMWKASPYTYFVQNAISLVLHKKPVRCKKNEMSYVNPPAG
FT                   QTCGEYMSAFLKTAAGYINNPNDTENCGYCVFEVGDDYLSQISVKYSYLWRNFGFFWVY
FT                   ICFNIFAMAVLYYIFHVRSFSLKQTKLGKMIMGKMKKE"
FT   gene            complement(<171070..>172647)
FT                   /locus_tag="KLTH0A01936g"
FT                   /old_locus_tag="KLTH-ORF16822"
FT   CDS_pept        complement(171070..172647)
FT                   /locus_tag="KLTH0A01936g"
FT                   /old_locus_tag="KLTH-ORF16822"
FT                   /product="KLTH0A01936p"
FT                   /note="similar to uniprot|P04385 Saccharomyces cerevisiae
FT                   YBR020W GAL1 Galactokinase phosphorylates alpha-D-
FT                   galactose to alpha-D-galactose-1-phosphate in the first
FT                   step of galactose catabolism expression regulated by Gal4p
FT                   and similar to YDR009W uniprot|P13045 Saccharomyces
FT                   cerevisiae YDR009W GAL3 Transcriptional regulator involved
FT                   in activation of the GAL genes in response to galactose
FT                   forms a complex with Gal80p and Gal4p to relieve inhibition
FT                   by Gal80p binds galactose and ATP but does not have
FT                   galactokinase activity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21102"
FT                   /db_xref="GOA:C5DBE5"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBE5"
FT                   /protein_id="CAR21102.1"
FT                   /translation="MILSNELTSLKLPMSVHSFDTKGLPAGLRPRVSRIVNDFQSVYGQ
FT                   TPHFVSRSPGRVNLIGDHIDYVDFSVLPMAIDADLLCAVGVLSTEDIPSITLINEDPKF
FT                   AQRKFDLPLDGSDISIDPSVSDWSNYFKCGLLVAQQHLKTQFPQKFQEAPLAGMEMYVS
FT                   GNVPTGGGLSSSAAFICAVALAVIRSNTSSNYKVSKQVLTQITVKAEHYVGVNNGGMDQ
FT                   AASVCGESEHALYVEFQPQLKATPFKFPELQNSEIQFIIANTMVVSNKVETAPTNYNLR
FT                   VVEVTVAANVLASKFKVALQRTGNLEKGTLREFMDAYYSRYHGVSEPWDGNAEDGIIRL
FT                   TEMLHVVEKSLTQQEGYSVQDAATALQCSQQEFARDYLTNFPVRFEALKLYQRAKHVFS
FT                   EALRVLLALKLLTSRKSEGDQRFLESFGDLMNESQKSCDTLYGCSCPETDELCRIAKAN
FT                   GAYGSRLTGAGWGGCTVHLVTRDNAEQVRSALANQYYRKRFRNMPSEELREAVFISKPA
FT                   QGSCLFEI"
FT   gene            <172931..>174997
FT                   /locus_tag="KLTH0A01958g"
FT                   /old_locus_tag="KLTH-ORF16817"
FT   CDS_pept        172931..174997
FT                   /locus_tag="KLTH0A01958g"
FT                   /old_locus_tag="KLTH-ORF16817"
FT                   /product="KLTH0A01958p"
FT                   /note="similar to uniprot|P04397 Saccharomyces cerevisiae
FT                   YBR019C GAL10 UDP-glucose-4-epimerase catalyzes the
FT                   interconversion of UDP-galactose and UDP-D-glucose in
FT                   galactose metabolism also catalyzes the conversion of
FT                   alpha-D-glucose or alpha-D-galactose to their beta-
FT                   anomers"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21103"
FT                   /db_xref="GOA:C5DBE6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBE6"
FT                   /protein_id="CAR21103.1"
FT                   /translation="MTGLKQDKDGWVLVTGGAGYIGSHAVAELIESGYRCIVVDNFSNS
FT                   CYEPIARLKVLLETEIPFFKVDLTDADGLEKVFRKFKIDSVIHFAGLKAVGESTKIPLS
FT                   YYYNNITGTLVLLDIMKKYGTEMLVFSSSATVYGDATRFPDMIPIPEECPTGPTNPYGK
FT                   TKLAIEEILEDLHASEPEKWRFAVLRYFNPIGAHPSGLIGEDPLGIPNNLLPYMAQVAV
FT                   KRREKLFVFGNNYSSRDGTPIRDYIHVVDLAKGHIAALKYLNEIKGGQGLCRAWNLGSG
FT                   TGSTVLEVYKAFCHSCGIELPYEIVGRRAGDVLNLTAKPDRATRELKWTTNLKVSDACA
FT                   DLWKWTTKNPYGYQLLGVVDTFFNQPGEYESRLITLGRGSGFEVSLSNIGATIVDLRVD
FT                   GKPVVLGLTSEAEYLDSSNPYLGATIGRYANRLRDGKFNVKGVDYLLDLNEQWSTVHSS
FT                   SQSYHRRRFLGPLILNPMKHQYFAKYVLLDSNTQFPGEVLASVTYSLDVRAKELQIQYE
FT                   GRLLNGDTTIMNLTNHSYFNLNVFQNASYNGTEIQLFSDQAVELDDAKCPSGRIVKVSG
FT                   PSSFTLDECEPPFDTCFVTGTVPCIDTRANELKPVLKAQHPESGLKLIISTTEPSFQFY
FT                   TGGPGILKGYGKKSGFCCEPGRFINAANVPEWKEAVTLESSAVYGSKTSYNFG"
FT   gene            <175574..>176677
FT                   /locus_tag="KLTH0A01980g"
FT                   /old_locus_tag="KLTH-ORF16816"
FT   CDS_pept        175574..176677
FT                   /locus_tag="KLTH0A01980g"
FT                   /old_locus_tag="KLTH-ORF16816"
FT                   /product="KLTH0A01980p"
FT                   /note="similar to uniprot|P08431 Saccharomyces cerevisiae
FT                   YBR018C GAL7 Galactose-1-phosphate uridyl transferase
FT                   synthesizes glucose-1-phosphate and UDP-galactose from UDP-
FT                   D-glucose and alpha-D-galactose-1-phosphate in the second
FT                   step of galactose catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21104"
FT                   /db_xref="GOA:C5DBE7"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBE7"
FT                   /protein_id="CAR21104.1"
FT                   /translation="MTVNSGNFDFTDNSHRRFNPLTNSWVLVSPHRAKRPWMGQQEVPF
FT                   SPNEPEFDAKCYLCPGNTRASGEINPQYPSTFIFPNDFPAVKLNQPNFIDDGKEMTLKD
FT                   RFMRAQQVEGKCFVICFSPKHNLTIPRMKIGELKNVVDAWAKLYLELEAEARTKATPYK
FT                   YLQIFENKGTAMGCSNLHPHGQAWCLSTIPDEVDKEFRSFAKYSKEHSSCLLGDYIALE
FT                   LEERDRIVLQNDSFLVVVPYWAVWPFETLLMSKQHLCSLADFNDQQKLELASIIKKLTT
FT                   KYDNLFETSFPYSMGLHQAPLNAIQQANNSSWFHMHFYPPLLRSATVRKFLVGFELLGE
FT                   PQRDLTAEQAAKRLADLEEEVHFTEIR"
FT   gene            <177135..>177225
FT                   /locus_tag="KLTH0A02002r"
FT                   /old_locus_tag="Klth0A.tPhe.GAA.2"
FT   tRNA            join(177135..177171,177190..177225)
FT                   /locus_tag="KLTH0A02002r"
FT                   /old_locus_tag="Klth0A.tPhe.GAA.2"
FT                   /note="tRNA-Phe (GAA) cove"
FT   gene            complement(<177329..>178861)
FT                   /locus_tag="KLTH0A02024g"
FT                   /old_locus_tag="KLTH-ORF16814"
FT   CDS_pept        complement(177329..178861)
FT                   /locus_tag="KLTH0A02024g"
FT                   /old_locus_tag="KLTH-ORF16814"
FT                   /product="KLTH0A02024p"
FT                   /note="similar to uniprot|P43590 Saccharomyces cerevisiae
FT                   YFR006W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21105"
FT                   /db_xref="GOA:C5DBE8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBE8"
FT                   /protein_id="CAR21105.1"
FT                   /translation="MPFADQLLTFSLAFLAYQLGRDSLEFTFSSRPQQKMSPSDSDLPK
FT                   GKYPAKKHALKIKKNFLSKKGEEQTESTLFVAGGEIEPIKYCDQTKEFRQNRYFFYLTG
FT                   VNIPGSAAFFDFKSEKLTLFLPDVDSDDVMWSGLPLSVEAAYEKFDVDEVLYAKKLPSF
FT                   LSKFESSCIYTTDLDNVHDPNVAEMLVPSDPDLFYALDESRLTKDEYEIGLLRRAAKIT
FT                   DNCHLSVMSALPIEKNEGHFHAEFTYHAIRQGSKHQGYDPICCSGPNCSTLHYVKNDES
FT                   LENKQSVLMDAGAEWENYTADVTRCFPLNGKFTKEHREIYDTVLKMQTEVMDRIKPGVE
FT                   WEKLHILAHRVLIRSFLNLGIFKSGYSEEEILDRKASLCFFPHGLGHLLGMDTHDVGGR
FT                   ANYEDSNPLLKFLRLRRPLEENMVVTNEPGVYFNPFLIEEFLIKYPKRKEVVNEEIMEK
FT                   YMYVGGVRIEDDVLVTADGCENLTGITSDPEEIERIVCDGINKGRSHFHVIA"
FT   gene            <179012..>180424
FT                   /locus_tag="KLTH0A02046g"
FT                   /old_locus_tag="KLTH-ORF16812"
FT   CDS_pept        179012..180424
FT                   /locus_tag="KLTH0A02046g"
FT                   /old_locus_tag="KLTH-ORF16812"
FT                   /product="KLTH0A02046p"
FT                   /note="similar to uniprot|P43589 Saccharomyces cerevisiae
FT                   YFR005C SAD1 Conserved zinc-finger domain protein involved
FT                   in pre-mRNA splicing required for assembly of U4 snRNA into
FT                   the U4/U6 particle"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21106"
FT                   /db_xref="GOA:C5DBE9"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR033809"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBE9"
FT                   /protein_id="CAR21106.1"
FT                   /translation="MAPSRTIEMEKRARSPSQSSDGTPSKKISLAGAQVQPYLETVDVR
FT                   KLDFDLEKLCSVTLSPLNVYCCLVCGRYLQGRGEKTVAFLHSIQEDHHVFINFVSLKTY
FT                   LLPENREVQGVQLLETIKFAISPKYTQEDLLQFPRMCFDKSNTPYINGFIGLNDLGDNT
FT                   HLSVIIQMMAHITPIRDFFLLESQSKIDDELIKRLALLIKKLWSPHILKAHLSPYELLQ
FT                   QLSRVNKNVNSDNRIKDPKSFMLWLINYMIAKAHPLKKVLTRNMRGEVEVRSIVVREKG
FT                   TTGEKNLEFFEDEATKTIVLPKFWSLTLDLPPVSLFNEGSDTNSIPQVTLDSLLGKFSG
FT                   HKKIPTREGMKQYKIVKYPRFLAINFDRFNWDAAMPIRNRNRTLVKFADALRFENKDYR
FT                   LIANVTLYPVGHSRSGDEDVDDEARWKIQLSNPKNAEWFEIDGKNVTAKEKELLFLDEV
FT                   YIQVWEMEQNKS"
FT   gene            complement(<180496..>181434)
FT                   /locus_tag="KLTH0A02068g"
FT                   /old_locus_tag="KLTH-ORF16809"
FT   CDS_pept        complement(180496..181434)
FT                   /locus_tag="KLTH0A02068g"
FT                   /old_locus_tag="KLTH-ORF16809"
FT                   /product="KLTH0A02068p"
FT                   /note="highly similar to uniprot|P43588 Saccharomyces
FT                   cerevisiae YFR004W RPN11 Metalloprotease subunit of the 19S
FT                   regulatory particle of the 26S proteasome lid couples the
FT                   deubiquitination and degradation of proteasome substrates"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21107"
FT                   /db_xref="GOA:C5DBF0"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR024969"
FT                   /db_xref="InterPro:IPR035299"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBF0"
FT                   /protein_id="CAR21107.1"
FT                   /translation="MERLQRLMMNQRAGVMGGAAAAETPMDDTKETVYISSLALLKMLK
FT                   HGRHGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQT
FT                   GRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVVDAFR
FT                   LIDTNMIMRNQEPRQTTSNAGLLNKPNIQALIHGLNRHYYSLNIDYHKTVAETNMLLNL
FT                   HKEQWQSGLKMNDYKEKEHNNLQATQKMLKIAELYSKRIEEEKDLTEEELKTRYVGKQD
FT                   PKKHLADTAEGVLEENIMSVLTAGVNSVAIK"
FT   gene            <181671..>182171
FT                   /locus_tag="KLTH0A02090g"
FT                   /old_locus_tag="KLTH-ORF16808"
FT   CDS_pept        181671..182171
FT                   /locus_tag="KLTH0A02090g"
FT                   /old_locus_tag="KLTH-ORF16808"
FT                   /product="KLTH0A02090p"
FT                   /note="similar to uniprot|P43587 Saccharomyces cerevisiae
FT                   YFR003C YPI1 Inhibitor of the type I protein phosphatase
FT                   Glc7p which is involved in regulation of a variety of
FT                   metabolic processes overproduction causes decreased
FT                   cellular content of glycogen"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21108"
FT                   /db_xref="GOA:C5DBF1"
FT                   /db_xref="InterPro:IPR011107"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBF1"
FT                   /protein_id="CAR21108.1"
FT                   /translation="MRAGKNAGSSRTRALDSTTTSTVQESAPVLQLRGSPNDQREGATH
FT                   TPAATGSQEKREVRWKEDVVDNEHMNKKKSKVCCIFHPQQNFEDMDDECDHCGHSDSSS
FT                   SSSSSSSSSESESEKDLDRESRHNARKERRKRKLAQKRSTSPNAYEIQPDYSQNKDKQT
FT                   NNQ"
FT   gene            complement(<182225..>184768)
FT                   /locus_tag="KLTH0A02112g"
FT                   /old_locus_tag="KLTH-ORF16805"
FT   CDS_pept        complement(182225..184768)
FT                   /locus_tag="KLTH0A02112g"
FT                   /old_locus_tag="KLTH-ORF16805"
FT                   /product="KLTH0A02112p"
FT                   /note="similar to uniprot|P34077 Saccharomyces cerevisiae
FT                   YFR002W NIC96 Component of the nuclear pore complex
FT                   required for nuclear pore formation forms a subcomplex with
FT                   Nsp1p Nup57p and Nup49p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02112g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21109"
FT                   /db_xref="GOA:C5DBF2"
FT                   /db_xref="InterPro:IPR007231"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBF2"
FT                   /protein_id="CAR21109.1"
FT                   /translation="MHSDKPVSMDTYANNEGVLKGSAKTFGNLIETSKNLPTTSSELGT
FT                   ILLSVNEIKKRAHDLRKKAKPKGDHTRAHYLLAGSGLAIQDVELSLNNLKSRQLIEHNV
FT                   TNRETDGDLDTYLRTKKDENILSSIEQSLTSAAKDFDNFVNQTFNLDWEQRKDEVRENF
FT                   GIILKKRRGNDYGKDSLPHPDYPSWGKSGRGILDGDSRLNVNENFATRTKFERYAKIIN
FT                   GFNNARQSGYEFSLAKEISETFSSSAEQAGRQLPEAWSIIEHAQNSTDVVMSSRTFLEK
FT                   QFLNYVDNLYKKNLNEGLPTNVNKVKSFIDYKLKNPNNTWKYGNLTIVNGVPIWAFIFY
FT                   LLRAGLTKEALEVAIANKLSFKKVEQSFLTYFKAYATSKDQRLPNEFVSRLHTEYNQHI
FT                   KNALDGDPFRLAVYKIVGRCDLTRKNISSITLSIEDWLWFHFMLIKQDVSDDDPVYEKY
FT                   DLKDFQTIVTSYGISRFSSTYLHVLLLSGLYELAVQHATSINEIDAVHLAIALAYHKKL
FT                   NISHYKSEHDSNLLSEEDGRFEINFAKLLGNYTKSFKFSDPRIAVEYLILIALNGNKDQ
FT                   IEVCHESLRELVLETKEFTILLGKVNRDGSRIPGVIEERHSLLFLSDEQDFLHRITEQA
FT                   ARRADEDGRVFDSLLLYQLADEYDIVIRIVNKLLSDLLSNTDLNQPLLNLDDNNETSPV
FT                   LIAKKLINVYVNNMEISRKVSSKNKETCLLLLKVVDIRRSFYSQNWQEALSKVEDIDVI
FT                   PFIDEVSSRRKAQEFSSLSPEIAKNIPNLLIITMTCVSNIVAQLNQSEYHSASKDQQIR
FT                   ALRRLAKSCMIYAGMIQYKMPRETYSVLINLEVHL"
FT   gene            complement(<185373..>186002)
FT                   /locus_tag="KLTH0A02134g"
FT                   /old_locus_tag="KLTH-ORF16804"
FT   CDS_pept        complement(185373..186002)
FT                   /locus_tag="KLTH0A02134g"
FT                   /old_locus_tag="KLTH-ORF16804"
FT                   /product="KLTH0A02134p"
FT                   /note="similar to uniprot|P43586 Saccharomyces cerevisiae
FT                   YFR001W LOC1 Nuclear protein involved in asymmetric
FT                   localization of ASH1 mRNA binds double-stranded RNA in
FT                   vitro"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21110"
FT                   /db_xref="GOA:C5DBF3"
FT                   /db_xref="InterPro:IPR037650"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBF3"
FT                   /protein_id="CAR21110.1"
FT                   /translation="MAGKQTKTAKRSNKQNGKREVNPEVFQDSQARNQLSSAPKLTEKS
FT                   ASRKPSKLKVSKEQALARLYGSKNKKVKAYSEKELNIPSLNRAVIPGVKFKRGKKGKKF
FT                   VGDHDELLYSRLISTIGDKQEQLTESKLEKARRLEEIRELKRQEIERKEDAKKDKLDSK
FT                   KDELKKKASVARTLRRKNKRDQYNESKAPAAASNDVGPKKKTVSFA"
FT   misc_feature    complement(186379..186515)
FT                   /locus_tag="KLTH0A02156s"
FT                   /old_locus_tag="centromere.klth0A"
FT                   /note="Centromere Klth0A"
FT   gene            complement(<186546..>187715)
FT                   /locus_tag="KLTH0A02178g"
FT                   /old_locus_tag="KLTH-ORF16803"
FT   CDS_pept        complement(186546..187715)
FT                   /locus_tag="KLTH0A02178g"
FT                   /old_locus_tag="KLTH-ORF16803"
FT                   /product="KLTH0A02178p"
FT                   /note="similar to uniprot|Q12341 Saccharomyces cerevisiae
FT                   YPL001W HAT1 Catalytic subunit of the Hat1p-Hat2p histone
FT                   acetyltransferase complex that uses the cofactor acetyl
FT                   coenzyme A to acetylate free nuclear and cytoplasmic
FT                   histone H4 involved in telomeric silencing and DNA double-
FT                   strand break repair"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21111"
FT                   /db_xref="GOA:C5DBF4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR013523"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017380"
FT                   /db_xref="InterPro:IPR019467"
FT                   /db_xref="InterPro:IPR037113"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBF4"
FT                   /protein_id="CAR21111.1"
FT                   /translation="MADASDLRPEAWTVSSNTAVKLSFVDEEGAVQFTPTFTYPIYGDS
FT                   EQIFGYQDLQILLAFDSVTFKPFCNVKFGAKLADTDDNVQDKLLKYLPDGDVIVKDEIA
FT                   WVDTFNKERESFTLPDESKKVASYSREGHNFAVYKVDLHDDNVKKLHRRMQIFTLFLIE
FT                   SASYIDEGDEGWELYMSFNTGNKQCVGYSTTYKYWKYMGARNFDSTDKTFQTGKISQFL
FT                   VFPPYQGVGHGSELYNAIINDWLADTKVIEITVEDPNEDFDSLRDRNDLKRLYASGIAS
FT                   EIPRELPIKNEWIEAQRSIFKIEKRQFQRLIEMLLLHICSPNFRLQVKKRLYEKNYDLL
FT                   ADLDTPTRNDKLQTAFLSIKEEYDSILASLRFKRHEDLDNTQPSKKIKN"
FT   gene            <187855..>188559
FT                   /locus_tag="KLTH0A02200g"
FT                   /old_locus_tag="KLTH-ORF16802"
FT   CDS_pept        187855..188559
FT                   /locus_tag="KLTH0A02200g"
FT                   /old_locus_tag="KLTH-ORF16802"
FT                   /product="KLTH0A02200p"
FT                   /note="highly similar to uniprot|Q12483 Saccharomyces
FT                   cerevisiae YPL002C SNF8 Component of the ESCRT-II complex
FT                   which is involved in ubiquitin-dependent sorting of
FT                   proteins into the endosome appears to be functionally
FT                   related to SNF7 involved in glucose derepression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21112"
FT                   /db_xref="GOA:C5DBF5"
FT                   /db_xref="InterPro:IPR016689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040608"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBF5"
FT                   /protein_id="CAR21112.1"
FT                   /translation="MKHGLAAFNSDQHNRYSTTASILSKQDRELDEQLNVFQQRLVEFA
FT                   KVHNKELRESPEFRMKFIRMCASIGVDPISLFDKERHLFDVNDFFYEICVKIIEICRKT
FT                   KNLNGGVISFDELHKGYFEQFKVQLNDLQKAVEMLETLDGGFEVFCIRGKKFLRSVPNE
FT                   LTNDQARILEVCSILGYASISLLRLNLEWEPVRSDAILKEMVANGLLWIDSQAQGETLY
FT                   WDPAWIVRSNFA"
FT   gene            complement(<188580..>189911)
FT                   /locus_tag="KLTH0A02222g"
FT                   /old_locus_tag="KLTH-ORF16801"
FT   CDS_pept        complement(188580..189911)
FT                   /locus_tag="KLTH0A02222g"
FT                   /old_locus_tag="KLTH-ORF16801"
FT                   /product="KLTH0A02222p"
FT                   /note="similar to uniprot|P31115 Saccharomyces cerevisiae
FT                   YFL001W DEG1 Non-essential tRNA:pseudouridine synthase
FT                   introduces pseudouridines at position 38 or 39 in tRNA
FT                   important for maintenance of translation efficiency and
FT                   normal cell growth localizes to both the nucleus and
FT                   cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21113"
FT                   /db_xref="GOA:C5DBF6"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR041707"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBF6"
FT                   /protein_id="CAR21113.1"
FT                   /translation="MSLISKLLRFGRNASKSLPEQCEYAKWSKEDLVRKVMELEAENKR
FT                   KAEDEGDRSESKTKKAKRDDLPEKRKRKKKDKPFDFSKYDTRFVAFKFAYLGWNYNGLA
FT                   IQKEPTPLPTVEGTILEAMNACKLVPSMVPQDYNFSRCGRTDKGVSAMNQVISLHVRSN
FT                   LTREEQQDEENDGREIDYIHILNQLLPDDIRISAVCLRPPTNFDARFSCQYRHYRYLFH
FT                   KDGLDIKKMEEAARMYEGEHDFRNFCKLDGSKQINNYKRNIERSRIISLSEDIYCLDLI
FT                   GSAFLWHQVRCMMANLFLIGQGLEDTTLLKDLMDVARVKQKPIYDMASDIPLILFDCKF
FT                   PEMEWKTVDSNNFKSLQSDRRVYALSLDYNLKSTVANIFRETLCVTTSEIQGRTRINLG
FT                   DGKGKVVAVYQKMLERGVMESVESVNQKFREKKAAKKRNRMTTT"
FT   gene            <190077..>191873
FT                   /locus_tag="KLTH0A02244g"
FT                   /old_locus_tag="KLTH-ORF16798"
FT   CDS_pept        190077..191873
FT                   /locus_tag="KLTH0A02244g"
FT                   /old_locus_tag="KLTH-ORF16798"
FT                   /product="KLTH0A02244p"
FT                   /note="similar to uniprot|P25808 Saccharomyces cerevisiae
FT                   YFL002C SPB4 involved in the maturation of 25S ribosomal
FT                   RNA ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21114"
FT                   /db_xref="GOA:C5DBF7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBF7"
FT                   /protein_id="CAR21114.1"
FT                   /translation="MARSLSWDNLKYELQPWIRTAIDAMGFEIMTPVQASTIPMFSGNK
FT                   DVVVESVTGSGKTIAFTIPILEKVVKEVLSGSPLKRGHFYSLIISPTRELSKQIQDVVE
FT                   AFLAYYPSESCPIKSQLIVGTSSCSVRDDVSKFLENAPQILIGTPGRVLDFMKASTVKT
FT                   SSCGVVVLDEADRLLDVSFEKDVESILGMLPKQRRTGLFSATISSAGNQIYRTGMRNPV
FT                   KIAVKSKVQNPESLQINYIVVKPEEKLHHLLNIINNMRYRKCIVYFPTCQAVTYFYSFL
FT                   KHLSDISKTRDDLEVYSLHGKLQTNSRIGTLAKFSTSLNIAVLLTTDVAARGIDIPEVD
FT                   LVLQFDPPTNAEMFLHRCGRTGRANRAGKAITFINCGREEDYIDFLGVKNISLGELEIS
FT                   FRPVDELGVIFKSWVLQDRARFEHGIKAYAAFIRYYSKHSASSIFRLQSLDYVGLAKLY
FT                   GLIRLPRMPEITKYMSADATPSEGWLIDPPLDLDHFSYLNKQMERARQEELKKTKEISD
FT                   KKKLKSELKKKNAAWSNKTTSKETRKERKVKLAEKRKAIEQKIAEAGSEDESDGEEDWK
FT                   DLVRRNKKAKTCSQIQGDFSDL"
FT   gene            complement(<191921..>193264)
FT                   /locus_tag="KLTH0A02266g"
FT                   /old_locus_tag="KLTH-ORF16796"
FT   CDS_pept        complement(191921..193264)
FT                   /locus_tag="KLTH0A02266g"
FT                   /old_locus_tag="KLTH-ORF16796"
FT                   /product="KLTH0A02266p"
FT                   /note="weakly similar to uniprot|Q12059 Saccharomyces
FT                   cerevisiae YPL003W ULA1 Protein that acts together with
FT                   Uba3p to activate Rub1p before its conjugation to proteins
FT                   (neddylation) which may play a role in protein degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21115"
FT                   /db_xref="GOA:C5DBF8"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBF8"
FT                   /protein_id="CAR21115.1"
FT                   /translation="MDKFDRQLRLWGKHGQLELSKAHICIIGNTLLASEILKNLVLPGA
FT                   TKFHLIKETSYVKSDCFLDVEDLKSINEHAEFNEETWNAHLMGNQEYWRYFDLIILTTR
FT                   DVSVIESIRCLPMPPMLACNWREYHGYACFVSQEPHFVTECHRQHKSPDLRIDKPPQPL
FT                   LNFYESIKPSQLSQEQLNDLPFAVIIYHALKSLKENCTKIDRSSLRIEIRRLHEKTLPG
FT                   PECLNFIEAERYLYLGLQDSEIIPDNLLKCFSLASSECVVPFNSMFTDMISSLKDYLKH
FT                   PSSEHQLPLSGLIPDMESSSEMYNAIQEAYLRCASKNLNTFADIVTSHNASVPLSQIKN
FT                   FCSNVQNVRGVVPASHIPTEQDCRTVKQITPAAAAILRKLVKSKHELETIRPSFVESRD
FT                   ELRYYPTCSLLAGIVAQEAVKILTHQFVPLENTLIYDGKAGQVYRVKL"
FT   gene            <193453..>194400
FT                   /locus_tag="KLTH0A02288g"
FT                   /old_locus_tag="KLTH-ORF16795"
FT   CDS_pept        193453..194400
FT                   /locus_tag="KLTH0A02288g"
FT                   /old_locus_tag="KLTH-ORF16795"
FT                   /product="KLTH0A02288p"
FT                   /note="highly similar to uniprot|Q12230 Saccharomyces
FT                   cerevisiae YPL004C LSP1 Long chain base-responsive
FT                   inhibitor of protein kinases Phk1p and Phk2p acts along
FT                   with Pil1p to down-regulate heat stress resistance via
FT                   regulation of the Pkc1p and Ypk1p pathways phosphorylated
FT                   by Phk1p and Phk2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21116"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR028245"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBF9"
FT                   /protein_id="CAR21116.1"
FT                   /translation="MHRTYSLRAQRAPTASQLQSPAPPPSSTRSKFFGKASISSTFRKN
FT                   AAGNFGPDLARKLSQLVKTEKGVLRALEIVAIERRAAAKQLSLWGLDNDDDVSDVTDKL
FT                   GVLIYELGELQDQFIDKYDQYRLTLKGIRNIEASVQPSRDRKQKITDDIARLKYKEPNS
FT                   TKIPVLEQELVRAEAESLVAEAQLSNITREKLKAAFNYQFDSIRELAEKFALIAGYGKA
FT                   LLELLDDSPVTPGETRLAYDGYDASRQIIMDAETALEGWTLDSAAVKPSLSFHQTVDDV
FT                   YEEDDEEEGEAAAAEEEWAGEHEGGEEEVESTRV"
FT   gene            complement(<194663..>196456)
FT                   /locus_tag="KLTH0A02310g"
FT                   /old_locus_tag="KLTH-ORF16794"
FT   CDS_pept        complement(194663..196456)
FT                   /locus_tag="KLTH0A02310g"
FT                   /old_locus_tag="KLTH-ORF16794"
FT                   /product="KLTH0A02310p"
FT                   /note="similar to uniprot|Q12089 Saccharomyces cerevisiae
FT                   YPL005W AEP3 Peripheral mitochondrial inner membrane
FT                   protein located on the matrix face of the membrane
FT                   stabilizes the bicistronic AAP1-ATP6 mRNA encoding subunits
FT                   6 and 8 of the ATP synthase complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02310g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21117"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBG0"
FT                   /protein_id="CAR21117.1"
FT                   /translation="MGLLATLGSGIAKNGIREPSVVAEKSFRAVPTKARCGVDLKVDRQ
FT                   GGVQPTKLKNEYVLRNIHVVGKGSNFERSAVQDYLSPFTSHQFARHKLPCAYNEDRARA
FT                   NFTALKKLKSSKNSETLLFSSSQQYVGEMIPLLVALTPQEVSTGHAKRNFRSEVFEEIP
FT                   SIIDFTQNAESFANYVTLLTHSKFYYKKSSFLNGVIPKILRNILHPSNMKTMQFRDVGV
FT                   FNDVIFFFSEKSDYATCRELFSQMKLEGVKPNTKTFNLMLRNALKNSHIRKSRHPLHDA
FT                   VYYLRQMQHHEIKADAVTWVTCFNLLLEDMSRDVFLENMIKSNVPITPQLVLAVLSSNP
FT                   LNSSQALKFLSEYSVPLNSKLFNFCIKKLLSEEKYEAAWAFVDHAHKNADFNLDHESLN
FT                   AFLRRFAESGRLDLALLTFNTACKRYQISGNLHSFDMLFKALVRNGYTQNFPIVFEYLS
FT                   RKRRRYARGVQIFSYWLSKAHSMVKFNMKHQVTEGDIEKAKSLLDSALWTSKGLRWKCW
FT                   RESEQSQRKVFRYLGCIPTTVKAKTTHFIHDTSPEASAKKVKYKNRIRFLAIQNAMAKR
FT                   IPYAHDRYRALKEELRHRGIM"
FT   gene            complement(<196782..>200321)
FT                   /locus_tag="KLTH0A02332g"
FT                   /old_locus_tag="KLTH-ORF16793"
FT   CDS_pept        complement(196782..200321)
FT                   /locus_tag="KLTH0A02332g"
FT                   /old_locus_tag="KLTH-ORF16793"
FT                   /product="KLTH0A02332p"
FT                   /note="similar to uniprot|Q12200 Saccharomyces cerevisiae
FT                   YPL006W NCR1 Vacuolar membrane protein that transits
FT                   through the biosynthetic vacuolar protein sorting pathway
FT                   involved in sphingolipid metabolism glycoprotein homologous
FT                   to human Niemann Pick C1 (NPC) protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02332g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21118"
FT                   /db_xref="GOA:C5DBG1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="InterPro:IPR032190"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBG1"
FT                   /protein_id="CAR21118.1"
FT                   /translation="MKVARCLLVPVIVSNAVLAGDSFFGISFANSKPASCSIYGSCGKK
FT                   SLFGGELPCPVTEDFVPDPLSEAERESLVDLCGEEWKDVNQVCCNGAQIENLRKNLKKA
FT                   ENLIASCPACDKNFKSLFCHFTCSPQQRVFTNVTETQSSTDGREIVASMNVFLDSHWAS
FT                   EFYDSCKNVKFGATNGYAMDLIGGGAKNYEQFLKFLGDEKPLLGGSPFQINYIYDSQNS
FT                   GIELFNETVYSCDDETYKCACTDCDKSCPKLKPLRRNHCKVAGLPCFSFVILMVYVSLF
FT                   VLILGWHIYYFKNRKEPIIFEQDIEDSYAVANNDRIFQEHAYKAYSFDEKVASVLGQIS
FT                   GFSYRHPKLVILATGVVVVLLTVLAWIFGDLETDPINLWVSKSSPKYKEKEFFDENFGP
FT                   FYRTEQIFIVNETGPVLSYPNLEWWFGVESYITEVLRSEEYQTYQDLCFRPTEDSTCVV
FT                   ESVTQYFNQDLPKEGDWENRLKSCTESPVNCLPSFQQPLKPNLLFSDNDVFKSNALVVT
FT                   LLLSNHSNSALLWEKQLEDYLLNLDLPHGLRLSFNTEMSLEKELNRNNDIYIVLVSYLL
FT                   MFAYASWALRKKGGGSRLLLGFSGILIVLSSVSSATGVLSILGLKSTLIIAEVIPFLIL
FT                   AIGIDNIYLITHEFDRISEGEQTLEVEHIMKKALQKISPSILLSLLCQLCCFLIATFVS
FT                   MPAVRNFAIYSAVSLVFNVLLQLSAYVSILTLYERTFSATENTVSSESTPSKLKSAYVE
FT                   LLTKKRKIVGIFVSLTLFSLFFIPYIEIGLDQTLAVPQDSYLVDYFRDIYKYLNVGPPV
FT                   FFVVKNLDLTSRSNQKKVCGKFTTCDDLSLANTLEQERKRSTVVEPVTNWFDDFMMFLN
FT                   PQLDTCCRLKKGTEDVCPPSFPSRRCETCFSESEWFYDMSGFPTGDEFMHYFNIWINSP
FT                   SDPCPLGGKAPYSSAITYNKTSIKSSTFRSAHKPLKSQQDFIEAYKDAERISKSLFELD
FT                   VFAYSPFYIFFVQYGSLVSLSLKLLASSVLLVLLVSWMFLGSLKTAALVGLTVAMILTD
FT                   IGALMFFLGISLNAVSLVNLIICVGIAVEFCVHIARAFTIVPSNIKTDRDSRMVHAIET
FT                   VGGSVFQGITLTKFIGVSILAFTHSKIFQVFYFRMWFILIIASCAHALFFLPAALSLVG
FT                   GKSYADSEVELED"
FT   gene            <200459..>202174
FT                   /locus_tag="KLTH0A02354g"
FT                   /old_locus_tag="KLTH-ORF16789"
FT   CDS_pept        200459..202174
FT                   /locus_tag="KLTH0A02354g"
FT                   /old_locus_tag="KLTH-ORF16789"
FT                   /product="KLTH0A02354p"
FT                   /note="similar to uniprot|Q12308 Saccharomyces cerevisiae
FT                   YPL007C TFC8 One of six subunits of RNA polymerase III
FT                   transcription initiation factor complex (TFIIIC) part of
FT                   TFIIIC TauB domain that binds BoxB promoter sites of tRNA
FT                   and other genes linker between TauB and TauA domains human
FT                   homolog is TFIIIC-90"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21119"
FT                   /db_xref="InterPro:IPR024764"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBG2"
FT                   /protein_id="CAR21119.1"
FT                   /translation="MKLLKDLAVARKELADWTENLTWAHDGTLYLTTVPDITVCVPVYS
FT                   EATNSSKDLFHIKEYPLPLVNKFEYDLAQKNVMINSVPESSIKICQASPVSDSLAVLTN
FT                   NANACIYSGRGLVAQLDQPERALEERSYHSLAWNVEGNMIAVGNEACEVIVFSVNENFE
FT                   GAEFIYHRTIKINDDATSWVTRLEWYEEGIIVSLSNNSVHLVREDDGPKQIKCSSRFKN
FT                   SDLKGMKGNIIITSAGSVHRYEIGSGTLESLDLGACDDFYVVPLPDYNTALLISNKTSC
FT                   LLSLGHELRLQNDVIISPHIEAKFKKWNNYFNEFNNYETNFLIHGLATSPDGACLALAY
FT                   SLDRLSIRYRIVSEQQYRICLFPLGKAWEIKQGSTGLTWYQNYQIYNKQLPRNFETDEG
FT                   CLDLDTTLSFKSYLQELMNNKRMNNLRFSNFLEQEKDNNLYKRAVYDYAVAHKDEVVNP
FT                   LDKACVQSIADLLALESPVVPEIYTMKGEFIEETFSSPASPNTDVVQSEEGHIWKRCRA
FT                   TFLPLLTSKVKVCPVSNYRIIDIKHDARNDYGWLTRTILQFSNNQSIYSGTRML"
FT   gene            complement(<202248..>204713)
FT                   /locus_tag="KLTH0A02376g"
FT                   /old_locus_tag="KLTH-ORF16786"
FT   CDS_pept        complement(202248..204713)
FT                   /locus_tag="KLTH0A02376g"
FT                   /old_locus_tag="KLTH-ORF16786"
FT                   /product="KLTH0A02376p"
FT                   /note="similar to uniprot|P22516 Saccharomyces cerevisiae
FT                   YPL008W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21120"
FT                   /db_xref="GOA:C5DBG3"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028331"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBG3"
FT                   /protein_id="CAR21120.1"
FT                   /translation="MNGEENYGHPFQPYDIQLQLMHQVYNTLESGKKIGIFESPTGTGK
FT                   TLSLICPTVTWLRRNKAHYMGKSKETSSSVDGNLTKSDDESDEEPSWVKEAFAESVIKE
FT                   KVRALDEYEKYLGSKAFKAKYSSIYLSEDSPKVKRKRNLPHTTVGFEENEFLPDENSSP
FT                   STGCKKYSDVHDDKKKKLINEVNALLGKLDQEAESIDEATQTALPCPIKIFYASRTHSQ
FT                   LGQLASQLRLPNFPPSFESMEHERVKFVPLASRKQLCINPKVSKTSSQVINDYCRDAVS
FT                   KKECVPYTRSKDPEILHAFRDHAFYAIHDIEDMVSLGRATSTCPYYALRELLHDGVEVV
FT                   TLPYQHLLVESTREALGVDLKDSIVIIDEAHNLIDTINAVNSAEVSLADLQSSKLGITM
FT                   YENKFAKRLSPHNRVNLKRLLTLVEVLIVFLQQNYKNGKEFESHEVFEGTNADVLNIHK
FT                   LEQYMKTTKIAYKIDSYIKSQNESAETAAVERQPVLFKVASFLKTLSNPSLEGQFFFEK
FT                   GKVMKYMLLEPSNSFKSIVHAARCVLLAGGTMEPISDFTRDLIPFVDENQINKFACNHV
FT                   IPDNNLNTFIVTEGFEFTYDKREDSRTLSDLYDFFSRLVKIVPDGVVVFLPSYKFLESL
FT                   MRFWNSTCKVGACIGNKKIFYESADKADVFAKYAEEVRKLTGGAILFAVVGGRLSEGIN
FT                   FQNELARAVVMVGLPYPNLFSGELIIKRKHLEQKVLKANGSSQDAKRATREFYENICMK
FT                   AVNQSIGRAIRHAQDYANIYLVDKRYSSIQVQTKLSNWVAKRIRHTTSLDDLFEKSAKW
FT                   YANKAQDDR"
FT   gene            <205005..>205982
FT                   /locus_tag="KLTH0A02398g"
FT                   /old_locus_tag="KLTH-ORF16784"
FT   CDS_pept        205005..205982
FT                   /locus_tag="KLTH0A02398g"
FT                   /old_locus_tag="KLTH-ORF16784"
FT                   /product="KLTH0A02398p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21121"
FT                   /db_xref="GOA:C5DBG4"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBG4"
FT                   /protein_id="CAR21121.1"
FT                   /translation="MASPIFLSRPHSGFSWNAFEVGLRLAVWSLHRFASSFTDFCSRER
FT                   HALLKVCALTLATRLVVFSLRQVMDHFPLMSLAADSMDLLLACYGLSRFAYPEFKRAFW
FT                   SSFHSNFNDFENKKLHSEPGPSLYCMLFSLFRSNFMWLISLLLLSDFMVTSAQVGKPEA
FT                   LTAVSKTVISIMLLTLWTSHMSPALGSLASLAVGGALTASLAPFSNLALLLRLWQLQFL
FT                   VEYLMVPYVSQARFSPTEYAMWLKVRGGVICGFSTFVYVLLSLCGPNLMSPLLVYILAP
FT                   LFANLMSKIAEPVPANIIFGTKAYSRWCARQILWIERKRCLQAR"
FT   gene            <206631..>207812
FT                   /locus_tag="KLTH0A02420g"
FT                   /old_locus_tag="KLTH-ORF16782"
FT   CDS_pept        206631..207812
FT                   /locus_tag="KLTH0A02420g"
FT                   /old_locus_tag="KLTH-ORF16782"
FT                   /product="KLTH0A02420p"
FT                   /note="some similarities with uniprot|Q02606 Saccharomyces
FT                   cerevisiae YPL014W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21122"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBG5"
FT                   /protein_id="CAR21122.1"
FT                   /translation="MLLERFQSKLHGSRLSRHSNSKSRSKCDADAQPVQNIADDLMTGD
FT                   GMSDSDAYASMRELQISTQLCEPRSGTPLNGVSTPVMQPIMPYMYGNQKRQDSVASFAS
FT                   SISDMPGPARTATTPLPTTFSTQFVKMLMEVYQDICSDPTATPFDASNPPSGILNRTAK
FT                   VAVERAEQKGVDMGREKNALLVNSVKQRLLQELRRDAYLSRNSSIVSLPPMPQFNTSDI
FT                   APTACVDYFSTHAEASSNGQLSTPFQMPTSSLGSSQPLQTPFDQRPQVPKLSHRSRNDS
FT                   FISAAGRSRSGSSHMFPSQQQQQQPQPSAALQPSSFIETTTAPRAQFEGNGYFVLTPTN
FT                   SMLGEPQQPFIARERSNASSAFEDMMSGELSRHRQNSFRIEKGSATGSLAMDF"
FT   gene            complement(<207945..>208304)
FT                   /locus_tag="KLTH0A02442g"
FT                   /old_locus_tag="KLTH-ORF16781"
FT   CDS_pept        complement(207945..208304)
FT                   /locus_tag="KLTH0A02442g"
FT                   /old_locus_tag="KLTH-ORF16781"
FT                   /product="KLTH0A02442p"
FT                   /note="similar to uniprot|Q02608 Saccharomyces cerevisiae
FT                   YPL013C MRPS16 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21123"
FT                   /db_xref="GOA:C5DBG6"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBG6"
FT                   /protein_id="CAR21123.1"
FT                   /translation="MSKGLVRIRLARFGRRHSPLYNIVVANASKARDKTPIEVLGTYNP
FT                   IPKPLSKRETKSGAIPTKDVQLDFARTKYWVGVGAQPSETVTKLLKKCNILGSDWGKTY
FT                   TTSRTVVLPKREVLE"
FT   gene            <208530..>212180
FT                   /locus_tag="KLTH0A02464g"
FT                   /old_locus_tag="KLTH-ORF16780"
FT   CDS_pept        208530..212180
FT                   /locus_tag="KLTH0A02464g"
FT                   /old_locus_tag="KLTH-ORF16780"
FT                   /product="KLTH0A02464p"
FT                   /note="similar to uniprot|Q7LH12 Saccharomyces cerevisiae
FT                   YPL012W RRP12 Protein required for normal pre-rRNA
FT                   Processing member of a group of seven genes whose
FT                   expression is repressed during growth on glucose before and
FT                   during the diauxic shift"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21124"
FT                   /db_xref="InterPro:IPR012978"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBG7"
FT                   /protein_id="CAR21124.1"
FT                   /translation="MNQDEIATLLQLEDKLGQIRQQINSKLENQKHVAIILSAVEENMD
FT                   EQQVAAKNIVNYLISLMSLLDQAINPETHEIVELQISTSVAYLLDIVLKYTPKQLLRSK
FT                   FADILTKFAPCITDEKAEAPLIRSAVGCLETLLVAQDAQSWNNTHNLSIAPSRGLNGLL
FT                   ELSLDPRPKVRKRAQEAVGNIMSNPPASPTAEHVAAPLVAEFSISALASAVEEVSSTSN
FT                   KKIRAQGGLKELNAKAIHILKLINTVLSSNQWPSSRFDVLCDLLLEMSRSADQFMVSNA
FT                   FQCFEALFQSIAESAAAFGLAENKFSKVLDIIFSLKPSNSDTHLVGAWIAVVAKGMTTF
FT                   GSCSPLSCLEKIPEVINVLSLYLSSEVPEVYTSASQCVEALLTGCIQDDLLLLPPQVNE
FT                   NVYEKVDETISYLAGAFSDFLSIKYAHCAKEILQNLTTAFKKLRIRSNPDLLPPLEIVG
FT                   GWRTNEDNFLEMRAEIETVIGAAVSAIGPDAVLGCLPLNLTDASGSKPGRAWMIPLIRD
FT                   NTCNSRLAIFVQEFLPLIQFFDEKVTALPSDSVQSKVFETVSGQLWSTLPNFANLPTDL
FT                   RDSFSDQFAADLSSLLYSKVDLRPIICHAIKNLVESNVQHASLLDDNDKLLEQHFPKSE
FT                   SQKNLEYLSTKASNLLAVLFNVYTQTAPNARSYILETIIAVLKITSPEDLTKTFNNVCA
FT                   LLKKSFDEEPADAKSKTSPVKVSATLLDLVVVMASYVPESCYGALFSIFNTTVNSSDAL
FT                   TQKRAYRIITKLSEVDKSSESVLKYVAEIEQILIQSSKVVHTSARASRLSAIKVLVDLL
FT                   PLGHLDFVIQIVPEVILSTKDNNEKSREGAFETLIAMTHKMNTPGSVMKLSKVPGYDAQ
FT                   TPDQPTSVAEFFKIISAGLIGESQHMVSATITAYSCLVFEFKDYVSTGVLIEIYDTIEL
FT                   YLTSNSREIVKSAIGFAKVCCLALPEELMKSKIPSLLPKLLRWSHEHTGHFKARVKHII
FT                   ERLIRKFGYEYIEQNFPEEDNRLLVNIRKTRNRNKKKAAESMETAPKLSEASKKGSRFM
FT                   SALDEALYESSDAENSADDETAPKRGKASRFIVESKENPLDLLDSQTLAHISSTRPRKF
FT                   DAASRKKGRDHVFSFDADGKLLVKDEKKPSESDDVFDSSSSGINAYLEAVKHGPVRGQK
FT                   NKLKFKKGTRAGDNDFSDDEGANKSFKPNMNGKKVQKKKGGPKFRSNRKL"
FT   gene            complement(<212453..>213508)
FT                   /locus_tag="KLTH0A02486g"
FT                   /old_locus_tag="KLTH-ORF16774"
FT   CDS_pept        complement(212453..213508)
FT                   /locus_tag="KLTH0A02486g"
FT                   /old_locus_tag="KLTH-ORF16774"
FT                   /product="KLTH0A02486p"
FT                   /note="similar to uniprot|Q12297 Saccharomyces cerevisiae
FT                   YPL011C TAF3 TFIID subunit (47 kDa) involved in promoter
FT                   binding and RNA polymerase II transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21125"
FT                   /db_xref="GOA:C5DBG8"
FT                   /db_xref="InterPro:IPR006565"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBG8"
FT                   /protein_id="CAR21125.1"
FT                   /translation="MSTSNKEFHFGLLRISMIQLLKSHGFDKAQPSTVDAFTDLYVRFL
FT                   QLLVLEVMKLSRSRMDEYEDIALQDISQALLNVGLLKPMSTLDVYDENPNLVSDIGMQK
FT                   FKEWCLLSPIPKEARAVATPTSELLRPKDKLSKPLSMIPEYINQLDKGSAKDRVDSGQD
FT                   NDIVEQLVRSGDMSDWTRFMIRRQQLMHARKISGREVKDIKSLPPVPGLRSSIFCRDRR
FT                   FDNSEIMPPEPQETESDEKALKEKALITKLAAHQKDNRLDNIRLSFEEEDVDVSHDDID
FT                   LNDVNFDDNDLNEDMAAFEQMENSMNLTLGSENNLQLAEAENLNDTFQRRDSLEFGDEV
FT                   FQGHEFDFNTY"
FT   gene            <213735..>214325
FT                   /locus_tag="KLTH0A02508g"
FT                   /old_locus_tag="KLTH-ORF16773"
FT   CDS_pept        213735..214325
FT                   /locus_tag="KLTH0A02508g"
FT                   /old_locus_tag="KLTH-ORF16773"
FT                   /product="KLTH0A02508p"
FT                   /note="highly similar to uniprot|P53600 Saccharomyces
FT                   cerevisiae YPL010W RET3 Zeta subunit of the coatomer
FT                   complex (COPI) which coats Golgi-derived transport vesicles
FT                   involved in retrograde transport between Golgi and ER"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21126"
FT                   /db_xref="GOA:C5DBG9"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR039652"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBG9"
FT                   /protein_id="CAR21126.1"
FT                   /translation="MAELSLYSVEAVLLLDNEGNRIYTKYYHSPHEKSDSHITKRAIDG
FT                   MSSSSKQQTEYESRLFKKTHKQNSEILIFEDCLVLYKEYVDVSLYLVGSIDENELVLQQ
FT                   AFSAIKDSLELILATGIDKKNIIEHFDMVALAIDESIDDGIILETDPATIASRVTKPPS
FT                   KDAPINIELSEKGLLSAWGFAKSKLAERLQQGL"
FT   gene            complement(<214393..>217569)
FT                   /locus_tag="KLTH0A02530g"
FT                   /old_locus_tag="KLTH-ORF16770"
FT   CDS_pept        complement(214393..217569)
FT                   /locus_tag="KLTH0A02530g"
FT                   /old_locus_tag="KLTH-ORF16770"
FT                   /product="KLTH0A02530p"
FT                   /note="similar to uniprot|Q12532 Saccharomyces cerevisiae
FT                   YPL009C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21127"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="InterPro:IPR021846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBH0"
FT                   /protein_id="CAR21127.1"
FT                   /translation="MKQRISSLDLELLYRELKSQLEGYRLSNIYNIAESSRQFLLKFNK
FT                   PDSKLNAIIDCGLRVHLTDFTRPVPATPSGFVVKLRKHLKSKRLTTVKRVANDRILVLS
FT                   FNDGQFFLVLEFFSAGNVILLDSDRKIIVLQRIVHEHENKVGHIYNMFDGSFLENTRIE
FT                   PPKSKVHSADEVNGWIKEAKDFADSSVKAKTGKGAKVLSIHKLLFLREPQLSSDLISRN
FT                   LKSRGIAPNSPCLNFLDKIDEIVDLLDATESEVNELLRDGCKLGYIIAKKNPHYDSEKG
FT                   DANLEFVYEQFHPFPPHLSEDEKGYTKIIEVPGQYNKTVDDFFSTIESSKYALRIQNQE
FT                   FQAKNRLESAKLDNEKRIQALIDVQTQNEVRGHAIIAAADLVEEAQNAIKALVEQQMDW
FT                   KTIEVLISNEQKKNNRIARLIKLPLDLKNNKFTLSLPRNDEIESDNSDEEEDNLTSSED
FT                   ETSSSDSSDSSLSDFEADDNDEDELTSVSNIKKDRNDNKKKEKPSIDATIDLTLSAYAN
FT                   ASNYFNIKKSNVEKQKKVEKNAQKALKNIEQRIEKDLKKKLKESHDVLNKTRKPYFFEK
FT                   FHWFVSSEGFLVLMGKSGMESDQIYGKYIHDNDVFVSNSFDTHVWIKNPDETEVPPNTL
FT                   MQAGIMCMSASPAWSKKIQSSAWWCFAKELSKFDNYGGEVLPAGTFRLKDEKKKSFLPP
FT                   SQLVMGFALLWKTKDSDEEEEEDGADDEDQDDEEAQKEKSVLDEDAVPGQVQGKDDELE
FT                   ISKDENRRIDEGFVIGKKMEGVKEHQSPTKSTDLKSVKEKSDSDEVPVTTGLYPKISNS
FT                   DSDVQADKEPSEQSETNNNSENGSAFSDKSGSNKETIKKNVRGKKGKMKKMQKKYADQD
FT                   EEERLMRLAVLGTLKGSERQQQKAEEEAAKLKEREQKKFRRERQKKQQSLMFGSEQKVN
FT                   VNYAKIFSEISPVVDDKSKVRDIVPVYAPWPALTKYKYKVKVQPGNAKKTKSLNEILTY
FT                   FSKRKVDETESDKELDWPCEHELIKKLKELDLVSILYTDKLKITIPGQNEVKSKTKGTP
FT                   SSKGKKKGKK"
FT   repeat_region   complement(217982..218242)
FT                   /locus_tag="KLTH0A02552t"
FT                   /old_locus_tag="Klth0A.LTR.5"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <218302..>218375
FT                   /locus_tag="KLTH0A02574r"
FT                   /old_locus_tag="Klth0A.tAsn.GTT.3"
FT   tRNA            218302..218375
FT                   /locus_tag="KLTH0A02574r"
FT                   /old_locus_tag="Klth0A.tAsn.GTT.3"
FT                   /note="tRNA-Asn (GTT) cove score=76.93"
FT   gene            <219197..>220147
FT                   /locus_tag="KLTH0A02596g"
FT                   /old_locus_tag="KLTH-ORF16764"
FT   CDS_pept        219197..220147
FT                   /locus_tag="KLTH0A02596g"
FT                   /old_locus_tag="KLTH-ORF16764"
FT                   /product="KLTH0A02596p"
FT                   /note="similar to uniprot|P53686 Saccharomyces cerevisiae
FT                   YPL015C HST2 Cytoplasmic member of the silencing
FT                   information regulator 2 (Sir2) family of NAD( )-dependent
FT                   protein deacetylases modulates nucleolar (rDNA) and
FT                   telomeric silencing possesses NAD( )-dependent histone
FT                   deacetylase activity in vitro"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21128"
FT                   /db_xref="GOA:C5DBH1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBH1"
FT                   /protein_id="CAR21128.1"
FT                   /translation="MKDNKDTAIKKIAKLISDKPNSKVVFLVGAGISTSCGIPDFRSPG
FT                   TGLYDNLAKLNLPFAEAVFDIEYFEQNPKPFYTLAKELYPGNYKPSKFHQLMRVFQDKG
FT                   KLHRVFTQNIDTLERAAGIHPDLLVEAHGSFAHNHCISCKKEYPQNVFKDKMLVGKNFA
FT                   NCEECKGLIKPQIVFFGENLPRKFFSTWDKDVTELDDESIVVVAGTSLAVYPFASLPEE
FT                   VPTTTTRALINLERVGDFKTTPRNSDVFYKGSADAAATELAKELGWLSELEFLSGLLDN
FT                   DKSSSKTVDEGHEDEAAKVDSITKDLEKLGLKENK"
FT   gene            complement(<220657..>222417)
FT                   /locus_tag="KLTH0A02618g"
FT                   /old_locus_tag="KLTH-ORF16763"
FT   CDS_pept        complement(220657..222417)
FT                   /locus_tag="KLTH0A02618g"
FT                   /old_locus_tag="KLTH-ORF16763"
FT                   /product="KLTH0A02618p"
FT                   /note="similar to uniprot|Q02724 Saccharomyces cerevisiae
FT                   YPL020C ULP1 Ubl (ubiquitin-like protein)-specific protease
FT                   that cleaves Smt3p protein conjugates specifically required
FT                   for cell cycle progression associates with nucleoporins and
FT                   may interact with septin rings during telophase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21129"
FT                   /db_xref="GOA:C5DBH2"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBH2"
FT                   /protein_id="CAR21129.1"
FT                   /translation="MPNLETKTGSKRKRTENYFAPTHSHIATFSFVNGPTVFSPRRRTA
FT                   PFHSCTTEYTTEGPLRMSARLNGPENQTPGIVQDIKGAFFYASRAFKGLIGSTGDSNTQ
FT                   KDLQGSRPVAESTEQSGRSLKRNALQTSSAPCKRPRSSPGVDARLSVPTQKELPGKKSD
FT                   DLTQKLDNCITPEKNGSFAFATKKDPFGWDSSEISLSPAPAHQVPYGSSFYRRKASRAQ
FT                   KPEDSRSLTIRKPSEELSYLRMIFNGEYRAPALIEEQRDTQLKLREQEREGLKSTFKNS
FT                   VASLTERFKAVLAENLGKRESPDDLIIIKERRLPEHENPLKHRTGFQKLRFDTSVLTFE
FT                   EEFKSYKRLIEERRRIQTEVREKRQKKRELVPKLTNEDVVYVKKALSRTDNGVLMNKNN
FT                   IEIKVYDFKTLAPKRWLNDIIVEFFMKHVEITTEHCVAFNSFFYTTLSQRGYQGVRRWM
FT                   KKKKVQVEKLSKIFVPINLNQSHWALGFINIDKKTISYIDSLSSGPSTMGHAILKVLQE
FT                   YLLEESSGKIGRDFELIHEQCPQQPNGFDCGIYVCVNALYLSKELPLSYNHDDANRMRP
FT                   YIGHLILSGD"
FT   gene            complement(<223366..>225870)
FT                   /locus_tag="KLTH0A02640g"
FT                   /old_locus_tag="KLTH-ORF16761"
FT   CDS_pept        complement(223366..225870)
FT                   /locus_tag="KLTH0A02640g"
FT                   /old_locus_tag="KLTH-ORF16761"
FT                   /product="KLTH0A02640p"
FT                   /note="similar to uniprot|P43585 Saccharomyces cerevisiae
FT                   YFL004W VTC2 Phosphate metabolism transcription is
FT                   regulated by PHO system polyphosphate synthetase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21130"
FT                   /db_xref="GOA:C5DBH3"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBH3"
FT                   /protein_id="CAR21130.1"
FT                   /translation="MLFGVRLANQMYPPWKDSYIEYERLKKLLKESIIEDSKFKGRKSQ
FT                   QNKGDLWSEKDESNFVAVLDAELEKVYSFQSTKFNSIMEKLVRLERKTDDEEAIKHLDF
FT                   KHFQQVLEEALSEAQELDNFCRVNYTGFIKIVKKHDKLHPRYPSVKSLLQVRLKELPFN
FT                   SEEYSPLLYKISFLYNILRTNSSTVSKSLANSSKLSSVHNHEESSFRSYTFWIHPDNLM
FT                   EVKTRILRHLPVLVYAAPPSENDDLIGRVESTVMNSDVSFPAAPSSSASDSASLGNKGY
FT                   DPVIRTIYLDNEAFELYNDKLLKSSFNPTLRLRWTGKLADKPDIFLEKRMLVEDRNTGA
FT                   SDFDETRIKLKPKFINGFIFNGDNDYKEKTLKKLKDRGTVDNEISKLSNNFNTIQQFVL
FT                   ENELQPVLRAMYTRTAFQIPGDDRIRISIDSDLMYIREDSFDKENPIRDPKNWHRSDID
FT                   ADIPNPLKFLRPGEYVKFPYAVLDIRIRNPIGDKGGVKDSMRSQLPGKHAQWVEELTNS
FT                   HLVKEVANFSKYAQGVASLYGDDENLDMLPFWLPDLETDIRKDPKQAYEEEKKKLEEQK
FT                   ANQARLAKIKRLSVVQGSGNGSGTPSSQQSGAGSPKAEERDADLEDPESSDDEATEHHS
FT                   RTRKRKQNPNFLNVLVGRNAKLTGVDSEDEEITLPPGVKKPTSYLKNAGPVKVEAKVWL
FT                   ANERTFNRWLSLTSLMSVLTFTIYNSVRRAEFPQLATFLAYAYFCITIFTGLWAYRTYI
FT                   KRLNVIKARSGQHLDAPFGPLMVALVVVFTLVVNFVIAFKEAACKERTEGSSMSLNDAE
FT                   QLPVFARFIERLVFKAIGASEP"
FT   gene            complement(<226313..>226954)
FT                   /locus_tag="KLTH0A02662g"
FT                   /old_locus_tag="KLTH-ORF16759"
FT   CDS_pept        complement(226313..226954)
FT                   /locus_tag="KLTH0A02662g"
FT                   /old_locus_tag="KLTH-ORF16759"
FT                   /product="KLTH0A02662p"
FT                   /note="highly similar to uniprot|P07560 Saccharomyces
FT                   cerevisiae YFL005W SEC4 Secretory vesicle-associated Rab
FT                   GTPase essential for exocytosis associates with the exocyst
FT                   component Sec15p and may regulate polarized delivery of
FT                   transport vesicles to the exocyst at the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21131"
FT                   /db_xref="GOA:C5DBH4"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBH4"
FT                   /protein_id="CAR21131.1"
FT                   /translation="MSGVRTVSSSSANAKSYDSIMKILLVGDSGVGKSCLLVRFVEDKF
FT                   SPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTD
FT                   ERTFSNIKQWFSTVNQHANDEAQLLLVGNKSDMDTRAVSTDQGEALAKELGIPFVEASA
FT                   KDDTNVNDIFFLLAKLIQEKIDSEKLVGNTGRDGSVNVGAAGNNSKSNCC"
FT   gene            complement(<227861..>234283)
FT                   /locus_tag="KLTH0A02684g"
FT                   /old_locus_tag="KLTH-ORF16758"
FT   CDS_pept        complement(227861..234283)
FT                   /locus_tag="KLTH0A02684g"
FT                   /old_locus_tag="KLTH-ORF16758"
FT                   /product="KLTH0A02684p"
FT                   /note="similar to uniprot|P43583 Saccharomyces cerevisiae
FT                   YFL007W BLM3 Protein involved in assembly of proteasomal
FT                   core particles in the nucleus required for normal
FT                   resistance to bleomycin may be involved in protection
FT                   against oxidative damage"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21132"
FT                   /db_xref="GOA:C5DBH5"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021843"
FT                   /db_xref="InterPro:IPR032372"
FT                   /db_xref="InterPro:IPR032430"
FT                   /db_xref="InterPro:IPR035309"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBH5"
FT                   /protein_id="CAR21132.1"
FT                   /translation="MEHFIQAPSPLKPYQNRSLSLKDMKTARSNSGSDLSKSKKAKFLS
FT                   GALKSSMSPSRRPRSTTPLSSQVSYDESSSDSILRERLNHYGLDYIDDQEAHLKEIYDP
FT                   KSKWFCRDIKPKFVIENCLPYKIESHTEQAKYLCHVLVNLYIAICSLDIQGLISISSKD
FT                   LADLKAEIDELALNTDLFRLSTDDEASFNDINNYDEDEDEDEEDEEMVDFDGPQFTATG
FT                   KITAKSATIVNVNHWANELKNCLHFEFPLKLRKVLASTFYSLSLVQGQKVYRVMHVNIF
FT                   EALVSTDDEQTNFTELLLGEGLELDYRPMKKFLDEFLPPPDSTCTRYEISSKSDNQLFR
FT                   LLLKLAHAAKPFYGLNDDSVLKDTMDHYISSLSPTTAYCVFPIITSFVPYRYQKSASIT
FT                   DYFPLIFTLWTTTTPSVGFDTHFYDFIGCIAEDALNKLLHEKAPHLQVLGNVSFREFGL
FT                   LTEDQINFIFNRVQNHLRNDFQVVSFSRTVRPLVFSMNGSRNHEFLDKLQGLVKSIETF
FT                   AHPSNNGPWTKVIAKFVHGFIKMYHERVKMEKNPKANHRCHLKLNSACHTRVVNIFQEV
FT                   IFLGAQNKNSEMANYYISCLAYLLDINPGNKDLVFSKVVLDLYDSLGDLYVHSVHRLVS
FT                   SLKQFTKVARFMIEDHIFRVHITNILFMLVSKIDYNDILLTSNIINCIVSIASFVPIDN
FT                   LVSEDDHLSFTSHAAPFIEKHVFFLKYNKELDSFEYDKSELVAAFKASTTIFEDVLKIY
FT                   LNKVIQLVDSDLEEGFISKVNQTTMIMMESMPDPMFKYFSGVLERTFWENDYFKEKHPN
FT                   YELITIPLGAAARREPAIGAKLFSTLCVNIKDQIAKGAGSVRSSSEIQHRDVKLLTYLT
FT                   ALSDILRQAHSSMLSYREELKDILFFIFDNITNPPLDVHTSLVLHNVLTSLSSTEVIDY
FT                   RLYPEKCSMPRDERWGGLQFDSKRFSKEMMTFKWHVPSKLEVEFGTELLENFTDYCSTN
FT                   ISEMMRSPHTDSAYSDKMKKYILIVTHALSGASLLFDADYSKNKTEILPVDSYKAKLLL
FT                   LKSVRDKICDSQELNMDIEQIRNDTKADSEAESSIDLSEDGLDEIQFTEGGEGSLGGNT
FT                   LFDGVSSAAPSGIATPEPGSRHHTYGVESAINSTLAMRDLDIMGCNYFFGSDKNKKMEN
FT                   FTYLKIHSIRSKIGSLFHKLFKFFSANFEDNTILFKILLHGIKVWFTDIGQETIFDEEP
FT                   TSFLDLEFVENIQNLSHVDDPYTRTCFAAKAHALHEMRVLLHSTNRTPSKLEKVLLNDV
FT                   LRLSTSLYPTIFKPAQGCLAHAMKQLIGSYSMIMKFLLTSLESAMNEGSYKKVEVMLEV
FT                   LLLKKIHRKIMSDYKNLEEIVNLLIRACRVKDFNVSKYADSILTDIALSLKVPSSVCLL
FT                   DMKTIEALRPADKSIGQQVDAVKKAKDKKRYSYISLLSHLQDSLINTLSSGSDLGWKIP
FT                   VFIMKLTYRLQSNLELPPSENVLPCLYEMTKTKHPVMVHLAIKTLLGMCNKIISLGEFN
FT                   YEIRNAFDFDFMKNNIELIKTDTANFNSYFKTEMKNFANPNFFIDSKAYVGYIAWGRSL
FT                   KVIKSSNETKFNLKEKEINCLNLFGQLIDKEWVLQIAKVLIQDNENKGVFSNANIEFFE
FT                   LLVSLITNSCTALKYEDLLNLCRTLYDKSDKASMIMSVEIMAGLIVASKITSSNDLEKR
FT                   DSFLVGFFDECLDHELNQDAVDIWSIVCWWLPTSVDIRRCAPLYRKLFKIKNVLDTASD
FT                   SSADQASKISLLRNMMLSLDFKTPVAEELIPFLTIDHPYDQVRQSISKLLSTLLQSQIS
FT                   PCFSSTSKLVKFTSNETGLGRMIRNIPRAFDDKLKDTFNEIEKERGAITNLPAQEVLKT
FT                   RYYYMTATMLNWITELMKGQNSVILVLYMEKYLAPFLMNLIRMKDVCNLANLEPTTCYI
FT                   AISFWPLRKEYISIMMRVIENMDMQTSHEIRVQLVFAENFYSKNMLQLSMDQKQSILRF
FT                   VVNQIYNRHFVEVRLRAAEVLSGIIHTLSDTEIPNKLIDEFANGLGNHSFANKKKLSKT
FT                   NSQIHSCVIGLGAIISAFPYVSPLPQWIPSKLSSLSSWARTSGMSGTAAKEIISDFKKV
FT                   RADTWHLDREQFSYDELEDLEGVLWRSYYA"
FT   gene            complement(<234723..>238409)
FT                   /locus_tag="KLTH0A02706g"
FT                   /old_locus_tag="KLTH-ORF16757"
FT   CDS_pept        complement(234723..238409)
FT                   /locus_tag="KLTH0A02706g"
FT                   /old_locus_tag="KLTH-ORF16757"
FT                   /product="KLTH0A02706p"
FT                   /note="similar to uniprot|P32908 Saccharomyces cerevisiae
FT                   YFL008W SMC1 Subunit of the multiprotein cohesin complex
FT                   essential protein involved in chromosome segregation and in
FT                   double-strand DNA break repair SMC chromosomal ATPase
FT                   family member binds DNA with a preference for DNA with
FT                   secondary structure"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02706g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21133"
FT                   /db_xref="GOA:C5DBH6"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028468"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBH6"
FT                   /protein_id="CAR21133.1"
FT                   /translation="MGRLLGIELYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDA
FT                   ISFVLGMKSIHLRSHTLADLIYRGTLQDGDADSGYSETHDNENNPSSAYVKAFYSPSGQ
FT                   ENDVAELTRTITLSQESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVAS
FT                   QKPRELTTLFEQVSGSIQYKQEYDRLREELEKARSATSELIQSRKRANIGLKSFKEGVN
FT                   KDEEYRKHLEERNKLQQQLIVWQLFHLQAKRDSLTESLKSSQRELQSLDSELNSEEQIV
FT                   AKKKLSYAKKQTLAAKQRTRLSDKTKKVDHLTSSLLPIKSSKESIDKRLSAAVTKIESL
FT                   QRDIDRQESLVKQYEHQLKVVNKAKTNFQAEIDESAKSSGDFKLNEANLKRYEDLKETF
FT                   LSSGGSELEDKLLLEKNESQEISDEIELYSRQLDASRLKVNEELGAEKEALENEVSELT
FT                   KELSGKTSQVSAAVKKLKELQSRAEYNNNREYEVSFKLKETLTKLDDMNATQRETAKER
FT                   KLRENVSILRRLFPGVRGLVHELCRPKKEKYTVAVSTILGKSFDAVIVDHFSVAQQCVS
FT                   FLKKQRSGILSFIPLDTIDVNKVSMMALDTKGCTLAIDAIDYERDLERAMQYVCSDSII
FT                   CDSLAIAKDLKWRRNVRAKLVSLDGSIVHKAGLMTGGTTKSSGNRWDKEEYQGLMSLKD
FT                   TLLGEISELSSANTIDSERIRSTENELSFLNSDVMSLRTQLNQVKRSLNEKETEIQYQQ
FT                   ELIKGEFEPKIQSLKEAMTAHAKTTARFEEEKDRLLDSVYADFEGDIGFKVSQYEKHSG
FT                   EMMRRQLEDLRKLQMQIAGIEKKLEFETERLQSTQERQQRVQVDIEKAKIKLEALNSDE
FT                   QRITDEIQGVELTINEEQTRLDNLQNEINKDLVELNSSEETIQEATEHLQSAKRMHEAL
FT                   AEDIDKNSLEKANVLKNCKMLNIKLPDGSSSLERVPLDGVSDATIEAANAVFVNFTRLN
FT                   RRLKQSGEAETGNELQRSIDELNELLTVLQPNSKAAGRYEEAKVKYESIFKETEKCKTK
FT                   EKKVNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDE
FT                   DEPYLAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAAL
FT                   DILNVERIATYIRQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTLNLEN
FT                   YED"
FT   gene            complement(<238679..>239092)
FT                   /locus_tag="KLTH0A02728g"
FT                   /old_locus_tag="KLTH-ORF16753"
FT   CDS_pept        complement(238679..239092)
FT                   /locus_tag="KLTH0A02728g"
FT                   /old_locus_tag="KLTH-ORF16753"
FT                   /product="KLTH0A02728p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21134"
FT                   /db_xref="GOA:C5DBH7"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBH7"
FT                   /protein_id="CAR21134.1"
FT                   /translation="MENDGSSSGLLRNRNVARSGKTSEERVFGPRFKSKLLKVQNQPVS
FT                   TLGVFISACSIALSAVAMFLLGVNIVIQYRTIVPEDRAGMTRKASYIVLSAGAIYLLNK
FT                   FNLWFFRKVVSYFSSGPYDRLPAQESFEMEQRA"
FT   gene            complement(<239284..>241545)
FT                   /locus_tag="KLTH0A02750g"
FT                   /old_locus_tag="KLTH-ORF16751"
FT   CDS_pept        complement(239284..241545)
FT                   /locus_tag="KLTH0A02750g"
FT                   /old_locus_tag="KLTH-ORF16751"
FT                   /product="KLTH0A02750p"
FT                   /note="similar to uniprot|P07834 Saccharomyces cerevisiae
FT                   YFL009W CDC4 F-box protein required for G1/S and G2/M
FT                   transition associates with Skp1p and Cdc53p to form a
FT                   complex SCFCdc4 which acts as ubiquitin-protein ligase
FT                   directing ubiquitination of the phosphorylated CDK
FT                   inhibitor Sic1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21135"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR031740"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBH8"
FT                   /protein_id="CAR21135.1"
FT                   /translation="MTSDSTEYPLMGIPIPFRYQVRESGDNVVEEMDLLLCDEPAKNSS
FT                   KRAREGENEASFDSKRLRGNCKSPQRSIIPGNSNFAEDIVPTSTQEPSFSTNSRHKSTP
FT                   HRNNSPLLLEGTKEGLWNGKCDPQYNQQSTQCNNCTPVDDTPAIVANNNSVTNGNGTNP
FT                   LVSAQNEEGLPLSPIASPSCSSSGAPCSPRDAISQQDYLDLVASTAHSRLSPSAYQNLV
FT                   FQLVSKLTRSELSDLGTLVKDNLKRDLISSLPLEVSMNILTNLGFEDISRCLSVNRTWN
FT                   SLINNTSYLWRKLMVTEGFISQEEFKKYSNETPEKSNDESQDGDLFRVHFLKNQSYLKN
FT                   WYNGRFKPHRTTLRGHTMKIVTCLQFEDDYVITGADDKMIRVYDVKSGRFLAQLSGHDG
FT                   GVWALKYGQDGILVSGSTDRSVRVWNIKTGKCTHVFKGHTSTVRCLDIVEHNGGKFIIT
FT                   GSRDHTLHVWRLPNCHSENYDPEVCEIFNTTDTNPYFVGVLRGHMAAVRTVSGHGNIVI
FT                   SGSYDFNLMVWDIAKMKCLYVLTGHTDRIYSTIYDYTRNRCISAGMDSTIKVWDLQNIQ
FT                   KNGHCTTINSTSNPCTKVTGSVLTLQGHTALVGLLGLSDKFLVSAAADGTLRGWDSDNY
FT                   SRQFAYHHKDLSAITTFYVNDNILVSGSEGQFNVYNLRSGKLIHSDLLSDADQIWSVKF
FT                   DNRRLVAAVERDGRSFVEFLDFGKPEQEANVENLPYSSEDREDAEYATLGSRATRLYDP
FT                   "
FT   gene            <242885..>244036
FT                   /locus_tag="KLTH0A02772g"
FT                   /old_locus_tag="KLTH-ORF16747"
FT   CDS_pept        242885..244036
FT                   /locus_tag="KLTH0A02772g"
FT                   /old_locus_tag="KLTH-ORF16747"
FT                   /product="KLTH0A02772p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21136"
FT                   /db_xref="GOA:C5DBH9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006181"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBH9"
FT                   /protein_id="CAR21136.1"
FT                   /translation="MLPGISTEVVAGSKMADLVIAGSGVIGLSVAFELLQSPGLQPARI
FT                   HIIAQHFPGEEPISHEFTSPWAGAHFRPFPHRPESFGADRRESGYTRVTYKRMKTIAAE
FT                   HPESTIEFMKGADYLEQPPSEYDGMSPGYNKDSLENFREIPKGELPPNVKSGFEYTTYC
FT                   LNAPEYLGFLQRQVTALCKAKGVELCFKRMTLRSLAQVYEVVPSCDVIFNCTGLGLQLD
FT                   GSYDPSCFAIRGQTLLLDVPHKTKFAAATVTHQGRDGNWTFVIKRPPVGGKPAQYILGG
FT                   TKQPGDNCVTPRDMDSHAIMERARALYPELLCESEFSVARVNVGFRPARNGGSRVELES
FT                   ASPGPVIHAYGLGGMGYETSLGVAEHCLRIYRGLKCQRSKAKL"
FT   gene            <244936..>245586
FT                   /locus_tag="KLTH0A02794g"
FT                   /old_locus_tag="KLTH-ORF16745"
FT   CDS_pept        244936..245586
FT                   /locus_tag="KLTH0A02794g"
FT                   /old_locus_tag="KLTH-ORF16745"
FT                   /product="KLTH0A02794p"
FT                   /note="weakly similar to uniprot|P43582 Saccharomyces
FT                   cerevisiae YFL010C WWM1 WW domain containing protein
FT                   interacting with Metacaspase (MCA1)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21137"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBI0"
FT                   /protein_id="CAR21137.1"
FT                   /translation="MGHSKSNPPKVPNGWKAVFDEEYRTYFFVDLSNGKSQWEEPKGTT
FT                   WNAESPPPYQEQRPAGAPSAVKGDRKTPATEQRSGYPQQAYPQQPYSQQAYPQQGYGQQ
FT                   AYPQQGYPQQGYPQQGYYPQAYPQQPYYPQAYPQQQYPQQQQGRKKFGGAMTGGLLGVG
FT                   GGLLAGSLLGSALSPHETIVENNYYDDNGGGDYGGGDFGGGDFGGGDFGGGDF"
FT   gene            <245846..>247783
FT                   /locus_tag="KLTH0A02816g"
FT                   /old_locus_tag="KLTH-ORF16743"
FT   CDS_pept        245846..247783
FT                   /locus_tag="KLTH0A02816g"
FT                   /old_locus_tag="KLTH-ORF16743"
FT                   /product="KLTH0A02816p"
FT                   /note="similar to uniprot|P43579 Saccharomyces cerevisiae
FT                   YFL013C IES1 Subunit of the INO80 chromatin remodeling
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21138"
FT                   /db_xref="GOA:C5DBI1"
FT                   /db_xref="InterPro:IPR038014"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBI1"
FT                   /protein_id="CAR21138.1"
FT                   /translation="MGNRVYDPIHDVFQNKSEQEDVPPNEKLAGAEAPYPEEEDGDSTQ
FT                   SDDNATPMNESGPHKRRTKEPSKYMRHLKKPDGEFFTRKDIQFEFLHELCSDRRALFTN
FT                   RYQDFFTIAPTEESEPLNVTDESYVARKFIKNEKLTFSEYYLLTIASSTKCSKILRDKL
FT                   LFDRNVAFSTCALSLLVNTGRLNTTINFFLEMTSQLRTFHSIPCLQRDARDPKSLQDTP
FT                   RLKSILKNLPLGNENLPLTEYYEAPVAGKRLDSNPVNLMFHLCDNVALVNLKFIQEYIS
FT                   GASDLSFFDILENPDYDPSQRAQILLWLVYVHLETDMTDSAIEKSLELFEVDGKFKLES
FT                   APENVDIDTPEEVEFGESQKTKRREFLVKNNRLAHDGYRRSDANRPLMEQTRLDNSSAE
FT                   DVESIDEDKSFTEKTPSRAVQRANQRASRRTGQKPGPKPGAKAAARALAPKRQSRKHAR
FT                   EQANDSMEEEHMPETTSKLEDEDFLAEEEPKLQVQLQSQSQPDDPEALQAPAKKKQKRK
FT                   TGPAAPASQVQRNEALDEKKKDEMEALIEFDKSEEVAQHRTQDALMQELERAQALTRRK
FT                   REELGLVKMFYEFEDVTMATVIGVRGKKRKKFKDGLLGFETDFIRTISGAKRAMLTAQH
FT                   DANEDIYEFK"
FT   gene            complement(<247830..>248717)
FT                   /locus_tag="KLTH0A02838g"
FT                   /old_locus_tag="KLTH-ORF16738"
FT   CDS_pept        complement(247830..248717)
FT                   /locus_tag="KLTH0A02838g"
FT                   /old_locus_tag="KLTH-ORF16738"
FT                   /product="KLTH0A02838p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21139"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBI2"
FT                   /protein_id="CAR21139.1"
FT                   /translation="MHEIPKGPREPGEPAEPTEPVEPGALGEHAGHALRERDALRLRVR
FT                   ALEEQLGSQSATEPQAPSPAGHAQELLHLLARDASASAPASLPASHRFHALPLLDPGSR
FT                   LSCLQEFLPLLQVRSLGPPATVVSFGTQLQLTLEWATQSARVTSLRVLEVSPPQAKLAL
FT                   RPLVTHCERALNVSYLLLGCYEYSRLHAARSDLWQEIARASRRWLVQQRSESCLRVSSL
FT                   PAPAAAAATAPSLAVFVHYRIDFESVPLPQSLLSVELFNGPSTVPHANHVCNALIQEYG
FT                   LRHGLQEFLRAVLS"
FT   gene            complement(<248935..>249249)
FT                   /locus_tag="KLTH0A02860g"
FT                   /old_locus_tag="KLTH-ORF16732"
FT   CDS_pept        complement(248935..249249)
FT                   /locus_tag="KLTH0A02860g"
FT                   /old_locus_tag="KLTH-ORF16732"
FT                   /product="KLTH0A02860p"
FT                   /note="similar to uniprot|P22943 Saccharomyces cerevisiae
FT                   YFL014W HSP12 Plasma membrane localized protein that
FT                   protects membranes from desiccation induced by heat shock
FT                   oxidative stress osmostress stationary phase entry glucose
FT                   depletion oleate and alcohol regulated by the HOG and Ras-
FT                   Pka pathways"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21140"
FT                   /db_xref="InterPro:IPR007250"
FT                   /db_xref="InterPro:IPR038399"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBI3"
FT                   /protein_id="CAR21140.1"
FT                   /translation="MSDSYRKDFSDKAAEKVKPDSQKSYAEQGKEFVTDQADKVAGKMQ
FT                   PEQEKGAFQGVNDAAHKGKSEATGKSMTEQAGEYVDAAKAKLNDAAEYVSSSLHGGEKN
FT                   "
FT   gene            <250221..>251642
FT                   /locus_tag="KLTH0A02882g"
FT                   /old_locus_tag="KLTH-ORF16728"
FT   CDS_pept        250221..251642
FT                   /locus_tag="KLTH0A02882g"
FT                   /old_locus_tag="KLTH-ORF16728"
FT                   /product="KLTH0A02882p"
FT                   /note="similar to uniprot|P35191 Saccharomyces cerevisiae
FT                   YFL016C MDJ1 Protein involved in folding of mitochondrially
FT                   synthesized proteins in the mitochondrial matrix localizes
FT                   to the mitochondrial inner membrane member of the DnaJ
FT                   family of molecular chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21141"
FT                   /db_xref="GOA:C5DBI4"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBI4"
FT                   /protein_id="CAR21141.1"
FT                   /translation="MYRRTLLRLSNPRALAPRLATGPSARLFHASTRLLDELKDPYATL
FT                   GVSKSASGSEIKKAYYKLAKKYHPDINKAEDAQKKFHDLQNAYEILSDDSKRQQWDQFG
FT                   PAAFSQGGAGAPGGGAGGAGAEGFGGFGGFGGAGFGGINFEDLFGAAFGGGAGAGGAGA
FT                   RSRGSMFREYQGSPIELTHRISFKDSVFGTKNVNLKFSAYDPCGTCDGSGLKPGASRTT
FT                   CPGCSGTGTRVHIRAGFQMASTCNQCGGEGSVVRDSDTCATCHGEGASLNKDHAIKVDL
FT                   PHGLQDGDVIRISGQGSYPNIAVDPAMKDTVRLSRGDVLLRIRVDKDPRFQIKNKYDIW
FT                   LTQDIPITTAALGGIVTVPTVDGEQVRLKVAPGTQHNDVVSISQKGVPRGAFGSRGDMK
FT                   VQYKISIKKPQSQAERCLWEALADVTGDTLARRSVLSSQPQQSSHTDNPDAPGALGKLE
FT                   NFISNTFKKIKGDKK"
FT   gene            <251941..>252447
FT                   /locus_tag="KLTH0A02904g"
FT                   /old_locus_tag="KLTH-ORF16720"
FT   CDS_pept        251941..252447
FT                   /locus_tag="KLTH0A02904g"
FT                   /old_locus_tag="KLTH-ORF16720"
FT                   /product="KLTH0A02904p"
FT                   /note="similar to uniprot|Q12155 Saccharomyces cerevisiae
FT                   YLR050C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21142"
FT                   /db_xref="GOA:C5DBI5"
FT                   /db_xref="InterPro:IPR016964"
FT                   /db_xref="InterPro:IPR033118"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBI5"
FT                   /protein_id="CAR21142.1"
FT                   /translation="MLSNGLQKFYYYYFIIHIFTTILIDSSVILPAKFQFTQPLVEWHI
FT                   AQNNDFLLFEKPDWLWYFVLIECVGQLPGFFWFAGKFRQLWSLKESQTKADKMAIRDCE
FT                   KSLSKWLRVYGWNASVTTLICLWTVWTRGYYPSGEFLPMNVQDKIKLMAIYVPYVLIPL
FT                   RLCLA"
FT   gene            <252789..>254021
FT                   /locus_tag="KLTH0A02926g"
FT                   /old_locus_tag="KLTH-ORF16716"
FT   CDS_pept        252789..254021
FT                   /locus_tag="KLTH0A02926g"
FT                   /old_locus_tag="KLTH-ORF16716"
FT                   /product="KLTH0A02926p"
FT                   /note="weakly similar to uniprot|Q12110 Saccharomyces
FT                   cerevisiae YLR049C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21143"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBI6"
FT                   /protein_id="CAR21143.1"
FT                   /translation="MDGPRYVAPSQRLYRARHKITRKDLWKSYTVDDLTLSVDEPALLD
FT                   FSVPVLDFKKPPKKTVSSSERSSSIFSQPCGAGSEYGSQDDLGSTANGELQNLMFRNYS
FT                   LDSMILQNKKRITDHENNVSLLKAVSETSAANNKNYRTCSRPSSLPPKLSKEKVLHENA
FT                   IEELVRHAERLEHRDARVLKYTNRKLLRREAHAQKQWAEIGQKKNKDILLEVRRRGLVL
FT                   DGLPWQHRQRVYDLCLIKNLEAPPSAPLLADIRSAIEDAVEDRGDEIFCNLYARSKWLK
FT                   NGAPPAFNFYQVFELEFESLYYHITITLGLDPVREFVWPLLATVLCHYLNRGPADMVVR
FT                   LVDTLVLTSYYGEIDEVFDKIWEIVLKEQSHKFFGSRESVHDELRSIHAHLPTLLQTLQ
FT                   AQSGQAKEVKQ"
FT   gene            <254216..>254689
FT                   /locus_tag="KLTH0A02948g"
FT                   /old_locus_tag="KLTH-ORF16713"
FT   CDS_pept        254216..254689
FT                   /locus_tag="KLTH0A02948g"
FT                   /old_locus_tag="KLTH-ORF16713"
FT                   /product="KLTH0A02948p"
FT                   /note="similar to uniprot|P43577 Saccharomyces cerevisiae
FT                   YFL017C GNA1 Evolutionarily conserved glucosamine-6-
FT                   phosphate acetyltransferase required for multiple cell
FT                   cycle events including passage through START DNA synthesis
FT                   and mitosis involved in UDP-N-acetylglucosamine synthesis
FT                   forms GlcNAc6P from AcCoA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21144"
FT                   /db_xref="GOA:C5DBI7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBI7"
FT                   /protein_id="CAR21144.1"
FT                   /translation="MPVLPNEYSIRRVKPSDYEGIVETLRVLTVVGDVTKEQFEETVAY
FT                   WNEVTVKSKGEPIKAYNPHVITDGSGKVVATGTVFIERKILHDCGLVGHIEDIAVAKDQ
FT                   QGKKLGQLLIEHLTELALSRGCYKVILDCDEKNVGFYQKCGYSIKGVEMDRRS"
FT   gene            complement(<254751..>255041)
FT                   /locus_tag="KLTH0A02970g"
FT                   /old_locus_tag="Klth0A.mRNA.3099.m"
FT   CDS_pept        complement(join(254751..254954,255015..255041))
FT                   /locus_tag="KLTH0A02970g"
FT                   /old_locus_tag="Klth0A.mRNA.3099.m"
FT                   /product="KLTH0A02970p"
FT                   /note="highly similar to uniprot|P40204 Saccharomyces
FT                   cerevisiae YFL017W-A SMX2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21145"
FT                   /db_xref="GOA:C5DBI8"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034098"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBI8"
FT                   /protein_id="CAR21145.1"
FT                   /translation="MVSTPELKKYMDKKVYIQLNGSRKLVGVLRGFDIFLNVVLDDAVE
FT                   VRKDGTKFAMGSQSVVRGNSIVSLEALETFA"
FT   gene            <255982..>257478
FT                   /locus_tag="KLTH0A02992g"
FT                   /old_locus_tag="KLTH-ORF16710"
FT   CDS_pept        255982..257478
FT                   /locus_tag="KLTH0A02992g"
FT                   /old_locus_tag="KLTH-ORF16710"
FT                   /product="KLTH0A02992p"
FT                   /note="highly similar to uniprot|P09624 Saccharomyces
FT                   cerevisiae YFL018C LPD1 Dihydrolipoamide dehydrogenase the
FT                   lipoamide dehydrogenase component (E3) of the pyruvate
FT                   dehydrogenase and 2-oxoglutarate dehydrogenase multi-
FT                   enzyme complexes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21146"
FT                   /db_xref="GOA:C5DBI9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBI9"
FT                   /protein_id="CAR21146.1"
FT                   /translation="MLRMRLQAGASRRFLSGTSRMLAEKKKHDLVVVGSGPGGYVAAIK
FT                   AAQLGFDTACVEKRGRAGGTCLNVGCIPSKALLNNSHLYHQMKHEAKQRGIDISGDVSV
FT                   NVAQLQKAKDTSVKQLTGGIEMLFKKNGVTYYKGHGSFEDENNIKVSPVEGVEGSVTEE
FT                   TILEAKNIIVATGSEVTPFPGIKIDEERIVSSTGALSLKEVPKRLAIIGGGIIGLEMGS
FT                   VYSRLGSKVSVVEFLPKIGATMDDEVASATQKFLKKQGFDFKLGTKVLSAERNGDVVNI
FT                   EVENVKSGKKESLEADVLLVAIGRRPYIQGLNAEKLGLEVDKRGRLVIDEQFNTKFPHI
FT                   KVIGDVTFGPMLAHKAEEEGIAAVEYLKEGHGHVNYANIPSVMYTHPEVAWVGKTEEQL
FT                   KEAGISYKIGKFPFMANSRAKTNQDSDGFVKILIDAETERILGAHIIGPNAGEMIAEAG
FT                   LALEYGASAEDVARVCHAHPTLSEAFKEANLAAYSKSINF"
FT   gene            complement(<257643..>257715)
FT                   /locus_tag="KLTH0A03014r"
FT                   /old_locus_tag="Klth0A.tAla.AGC.11"
FT   tRNA            complement(257643..257715)
FT                   /locus_tag="KLTH0A03014r"
FT                   /old_locus_tag="Klth0A.tAla.AGC.11"
FT                   /note="tRNA-Ala (AGC) cove score=70.00"
FT   gene            complement(<258170..>260332)
FT                   /locus_tag="KLTH0A03036g"
FT                   /old_locus_tag="KLTH-ORF16706"
FT   CDS_pept        complement(258170..260332)
FT                   /locus_tag="KLTH0A03036g"
FT                   /old_locus_tag="KLTH-ORF16706"
FT                   /product="KLTH0A03036p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03036g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21147"
FT                   /db_xref="GOA:C5DBJ0"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBJ0"
FT                   /protein_id="CAR21147.1"
FT                   /translation="MTERKEDARSRERQCQKKLQEAISDSSAEALWHMYSSAQASLPYR
FT                   DRMVNLTWRMLGARMRKNVPVARQDQDQLYPEQVKYLSQSDKSSPMVPEEIDYMAELRE
FT                   IRGQSLSTAASSTLNMQATDGLAEGRASSSSASAPVKTEPLESKLSISDQIVSGMGRGP
FT                   TSGPTPSNSMKPFSQRDMEPSALGFDDNVHFGSFSNISQHVGFMADVDVDSFNILDGRE
FT                   SASGRELSHEEDEDMGMRAATYSSPALISDSGVSSADNPSYGQQSMSNSTLLNNMDQAS
FT                   ALSTVPNSVTIGGLNSSILGGQTFFDDHDFLHPVNEGNQDNENIFPPLHATNSQISLPD
FT                   LYDRTSNITPISIRRPSSAWQALPNGLGASAPGTSAIAPSSLPNPQVSRRPVSVNSVRK
FT                   KQIKSSNSRRGSLSFTSINGGSIPTGFVGQQEKGSNDAARKPTTNEGTSGASASGGKTD
FT                   TKCTNCHTKTTPLWRRDPQGNPLCNACGLFLKLHGVVRPLSLKTDVIKKRQRSSNKATA
FT                   ANSSAVVGQDNSPSKDAVQNSKSKRPLSRKKTSSVNILGEARPSLPRSQSSFSRRKSKA
FT                   SFNTRDAENASSESGSGTPTPVQASGADTQTMSNTASEMDIDQHSTANVDEGTKHNESS
FT                   FDLILEQWSQPTNSENNSGRTHPQQGSQPQSKQPEGQSAFYFSSSHGREGRRKPEPASG
FT                   LSGPQNPADKKNAGENANWDWLTLSL"
FT   gene            complement(<261659..>262357)
FT                   /locus_tag="KLTH0A03058g"
FT                   /old_locus_tag="KLTH-ORF16700"
FT   CDS_pept        complement(261659..262357)
FT                   /locus_tag="KLTH0A03058g"
FT                   /old_locus_tag="KLTH-ORF16700"
FT                   /product="KLTH0A03058p"
FT                   /note="similar to uniprot|Q12035 Saccharomyces cerevisiae
FT                   YLR051C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21148"
FT                   /db_xref="InterPro:IPR014810"
FT                   /db_xref="InterPro:IPR039883"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBJ1"
FT                   /protein_id="CAR21148.1"
FT                   /translation="MASDSIEDLFAELKKLETAGVTHSAPAGESSTPGENEGFDQDKLE
FT                   FEDDSKIAQQQKTFREIEQRMRKLPRMETGFDSLTLPAGSAVEGTKAVTKVEDPVSILH
FT                   SRKKDAATKKPSTTEQWFTLPKPELTRELKRDLLVLKHRAALDPKRHYKKEKWTVPERF
FT                   SVGTIVEDKTEFYSSRLNNKQRKSTMVGELMDSENTNKYFKRKYTEVQAKKTSGAKGHY
FT                   RKVREKRNKM"
FT   gene            <262571..>263257
FT                   /locus_tag="KLTH0A03080g"
FT                   /old_locus_tag="KLTH-ORF16698"
FT   CDS_pept        262571..263257
FT                   /locus_tag="KLTH0A03080g"
FT                   /old_locus_tag="KLTH-ORF16698"
FT                   /product="KLTH0A03080p"
FT                   /note="weakly similar to uniprot|Q12345 Saccharomyces
FT                   cerevisiae YLR052W IES3 Subunit of the INO80 chromatin
FT                   remodeling complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21149"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBJ2"
FT                   /protein_id="CAR21149.1"
FT                   /translation="MSDESALSICEDSVREFTELLAKDTQIRYAQNAIRRYKSSEAVDV
FT                   DDERKSRHKRNIIAVDDNLKINYEMVKMTPGTFIESSVSTSKNKALKEKAGKVTKMKTN
FT                   YYKKRLYNMNEQFLAEQGTLEPVSCSDSQSPESAADAGDAGDTAGAASIADDAPLDQQA
FT                   RWLAEIHKDLLQQYNTLLQEEKKWFLKKEVLLDANAKLDLFTTRDEDQSTLQLGSKDTA
FT                   GLCMFH"
FT   gene            <263585..>265084
FT                   /locus_tag="KLTH0A03102g"
FT                   /old_locus_tag="KLTH-ORF16695"
FT   CDS_pept        263585..265084
FT                   /locus_tag="KLTH0A03102g"
FT                   /old_locus_tag="KLTH-ORF16695"
FT                   /product="KLTH0A03102p"
FT                   /note="highly similar to uniprot|P15625 Saccharomyces
FT                   cerevisiae YFL022C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21150"
FT                   /db_xref="GOA:C5DBJ3"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR040586"
FT                   /db_xref="InterPro:IPR040725"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBJ3"
FT                   /protein_id="CAR21150.1"
FT                   /translation="MSDLQLEILQKLDQLGEIQSTLEVFPNINPQVVLSSLNSLKAHGK
FT                   LEYTKQDKTYYTLSKEGEEIMGKGSHEIRLLQLVDKFTKLQIKDVATHMGADGKVGQAR
FT                   AFKNGWISKNKDNELTVSDKISSVNDVQDETKDILVQIKNGNYEGVNDKTLNDLKKRKL
FT                   VAAKKEISFHVTKGADFSTELTKLETDLTADMVASGTYKDLKFKPYNFNSEGILPESGA
FT                   LHPLNKVREEFRQIFFSMGFTEMPANQYVDTGFWNFDALYVPQKHPARDLQDTFYLKDP
FT                   IKSDLPEDKAYLENIKAVHEQGKFESIGYRYDWKPEESQKLVLRTHSTATSAYMLKKLA
FT                   EDPKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEGFFEKMGVT
FT                   GLRFKPTYNPYTEPSMEIFSWHEGLGKWVEIGNSGMFRPEMLESMGLPPNMRVLGWGLS
FT                   LERPTMIKYGVQNIRELLGHKVSLDFIETNPAARLDEDLYE"
FT   gene            complement(<265273..>265863)
FT                   /locus_tag="KLTH0A03124g"
FT                   /old_locus_tag="KLTH-ORF16693"
FT   CDS_pept        complement(265273..265863)
FT                   /locus_tag="KLTH0A03124g"
FT                   /old_locus_tag="KLTH-ORF16693"
FT                   /product="KLTH0A03124p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21151"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBJ4"
FT                   /protein_id="CAR21151.1"
FT                   /translation="MIFAHTDLDFQETSMGLARSYPSLDAGSLSEGAEQEQQPRAPIED
FT                   VLELIISGTESELDPPIFEAELLTSDMAVDGLRQDSIFSLDGDADLSLPDLQETESFDT
FT                   SLEQLPYEAFNACADQPAETPGAPARPRLSHRKSNPFYLPSKHIKNMISKDRHRQSARK
FT                   VESASRSQWGGAGEALIPDQCTKPFLERRQTIG"
FT   gene            complement(<266666..>268573)
FT                   /locus_tag="KLTH0A03146g"
FT                   /old_locus_tag="KLTH-ORF16690"
FT   CDS_pept        complement(266666..268573)
FT                   /locus_tag="KLTH0A03146g"
FT                   /old_locus_tag="KLTH-ORF16690"
FT                   /product="KLTH0A03146p"
FT                   /note="some similarities with uniprot|Q12202 Saccharomyces
FT                   cerevisiae YLR054C OSW2 Protein of unknown function
FT                   proposed to be involved in the assembly of the spore wall"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21152"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBJ5"
FT                   /protein_id="CAR21152.1"
FT                   /translation="MIILSCLSFPSLNRYCDLLSRYSGKHTIVLVDASFAAQLEKLVLD
FT                   KFYDTCACVLSVLCDVETRQLSSGSYALVNDSCKFYLGLTYARKGFNKQANKQDRLSVN
FT                   LQCVQNTFFDESSTLNAMVAQLEGTNVDTIIKLAPEESCEMALKVWEHIIPRISLHILS
FT                   IVFEQFDYDKLLENSSSRFIFEDLVRELSSICYAQCGEVSEKYLKSKSGPRNPPTSAED
FT                   WISQLDFDKVLEETKRRKRQMDRSTINEYPEFLTLSFEAYCFYHRLEFPAHILLHQPIQ
FT                   LASAYRINYSSINFLYGFYSRLLAISGFSIEGEPNKVSAPSLLFGIRTQLANQSEQTLV
FT                   SKHCLNDDKNAPGSASKSKGVKSKLRARFKKIGHGNRERTSGATYSSEDPELSDEESGS
FT                   SLDNLLAGDARDRSSTDPEDTGEAQAGRDFMFWCSEEFQDANSEPEIDDNDNSSIVDEL
FT                   IKLPNFRKRNFRKQGTQAELTLTTVPLFEQEIRSDPFAMSRYYFDAYKLGDPKTFLSLK
FT                   ERDSRPASARRFQRRYPRERAGVTGASTLPENYFRDHVDLMKRVNMGGILSVTTSRYGH
FT                   VDSSQKMLDNWNRGLGYLKTLALRESASQVGASCHVVREPPARLQLRHSRRSSFSPEVD
FT                   "
FT   gene            complement(<269073..>270239)
FT                   /locus_tag="KLTH0A03168g"
FT                   /old_locus_tag="KLTH-ORF16687"
FT   CDS_pept        complement(269073..270239)
FT                   /locus_tag="KLTH0A03168g"
FT                   /old_locus_tag="KLTH-ORF16687"
FT                   /product="KLTH0A03168p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21153"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBJ6"
FT                   /protein_id="CAR21153.1"
FT                   /translation="METDKVSSVSERLQLLMDVNHEQHDRPSGSLLTHLISTLDQETTA
FT                   PPTLAEDAPSLQEDAAERTFTASSYYTSFVPARPHADYFDFDTEYNEKAKDLYGDVEEA
FT                   EAAAGRSDTGVERRLETMEESTLEASPVGLPTDDPSDDADQNVQMILDKLDTFKREFRH
FT                   LIKRMDEASLVSRISGSATLPDMTARPRVMNTLVGEIIDTLQSFVPQPSRKRSRCDSDV
FT                   GIAEKDEESSLLDAVAKETLEHDPCYGVPNFGVVLIKSPTTVSQLWNEYTKLPSEWALP
FT                   DWFDVASQQSSGANNARRPAILLKRRTSIRDLERIYGSSWRNGDKNFSRQVNRRKKIWH
FT                   AIEEGLESGIPLEECFRLLESYVKERGKGLSWYYNGVPFKLAELRGGN"
FT   gene            complement(<270862..>273408)
FT                   /locus_tag="KLTH0A03190g"
FT                   /old_locus_tag="KLTH-ORF16685"
FT   CDS_pept        complement(270862..273408)
FT                   /locus_tag="KLTH0A03190g"
FT                   /old_locus_tag="KLTH-ORF16685"
FT                   /product="KLTH0A03190p"
FT                   /note="similar to uniprot|P43573 Saccharomyces cerevisiae
FT                   YFL023W BUD27 Protein involved in bud-site selection
FT                   nutrient signaling and gene expression controlled by the
FT                   TOR kinase diploid mutants display a random budding pattern
FT                   instead of the wild-type bipolar pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21154"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR024325"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBJ7"
FT                   /protein_id="CAR21154.1"
FT                   /translation="MSFQKKCNKAYADTQSAMDSLVDIVSKTSVNLENKLRFLKEQKQH
FT                   YSGIRRNLVDYDKDSYDDNEDGNKRGLVFGEIIISSKIYLNIGYEYFVEKSQLEAIDFI
FT                   TEKLRLIDEAAARFEGKIQEAKETLKNLKEAQKLEEDQASSDNQDSFPNPSENEDGLPF
FT                   MEIREDLDEEGNILSSSVNPTATAQPSNPRIEEISDETETVVSGKRATGDAEPSIHNAR
FT                   FDKGFDKDFEHRVRDKTLKDSTEFREKDEAKAASEPSPIVKDVDIEDLNIKGPNIKKHG
FT                   PAIEPGDIYTFDDIVAQLEKEDGIEGGDIKDEDIHYDFDSYNHKSLLNDSESEEDEDDY
FT                   DDYDESSMPSIIPGFAQRRFLDQINHLRSQKQQPQQPQEPQEPQKLQRPSQVQHVSETV
FT                   KTKSILKKDKGAKKASKKVGFAPTLDVHEIESVKRETKANTYIASPFAAQSSVEDITHA
FT                   DADEGFDADLFAQLIGAKDSNEVHEKYEKEIEQQPAKRKPKVSRFKKDRNPSAAVESTK
FT                   FATNKEVQNPINGQAVEDIMERDPEAAERVTQVTKDFSRVRLDNSGPVTGVLERDSETD
FT                   APSSPSSGLSATNIPRNSEALANKASNPGWDSKFKKNLSSLQKPVKRRPAKEKLPELPE
FT                   QEEIETTEPKGLESRPVLEKQDQPQAFPKEINAAVNNNPSEVVQNPHVDFHKLGEDLDD
FT                   MARAYLLGLYNSDVEDPGAVLEKLGDLNSYNKEVETLKGEISTFLKENPLATVDEASGA
FT                   DDDEKGPIMTDVVEKEVELPSDYDEVDVELSSEALNHSVAVEYHRLRERMIASQGTIER
FT                   SPEELQLEAIDEYGNPIRTSKFKANKLRIGTDENHG"
FT   gene            <274770..>277055
FT                   /locus_tag="KLTH0A03212g"
FT                   /old_locus_tag="KLTH-ORF16680"
FT   CDS_pept        274770..277055
FT                   /locus_tag="KLTH0A03212g"
FT                   /old_locus_tag="KLTH-ORF16680"
FT                   /product="KLTH0A03212p"
FT                   /note="similar to uniprot|P43572 Saccharomyces cerevisiae
FT                   YFL024C EPL1 Component of NuA4 which is an essential
FT                   histone H4/H2A acetyltransferase complex homologous to
FT                   Drosophila Enhancer of Polycomb"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21155"
FT                   /db_xref="GOA:C5DBJ8"
FT                   /db_xref="InterPro:IPR019542"
FT                   /db_xref="InterPro:IPR024943"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBJ8"
FT                   /protein_id="CAR21155.1"
FT                   /translation="MAAPSSQEAANTRFRHRKISVKQRLQVYKASDLRKLDKDELQQRE
FT                   LVEIETGVEKNEEKEEHLHKILQKNQLTRKELYIPTPDASQTWGEYENFYRGKFEEPVS
FT                   YIRFSATVEDCCGSCYNMDERDERFLESKVNNKLKDGEKLSETEFELMCSSLEAAIHER
FT                   QPFLSIDPENILSLEEIKPTILKRDLGDAGIKDKLAEEIGVQPQHFITQFDSAVQQDSR
FT                   PITVLFEKFGKQVYNHWKGRKIEAHGGKICPQLKSERPGDRDDNDPYVCFRRREVRQAR
FT                   KTRRVDYQNSHKLRLLHQQLLFTKKLALLVAKREKVSLDMLENDLRVFELRRDIKPIKR
FT                   SAVIRGDDDLLLDQKKRRLVSNVVTSTALESNPKKLRTKSKKANADAANSKVAVAAKPQ
FT                   SRSSQAQSQQSAQQLHSQQQALLQQQQAQQQAQQQKQQANAIAAHVYVKLPSSKIPDIL
FT                   LEDVDDILLKKERSARNYVEERMRKRRLEDGERFFNLTDDPYNPVFDISVPAGVSPTNA
FT                   PFSSIASSKFEIEKSYYVPGLDNYLEGKADDVVVLNRDGDRIDNPKYRKIERYRPFQQN
FT                   SGVHTRELPFRLRRRVGRLGLEYIDRRRPSEAFEPLKSFINLAEVEKQERENDVIDVYD
FT                   SKLDALSRLHDRWKHDSDYNDHGAKFSHEPARLNQISNDTQVIRFGTMLGTKSYEQLRD
FT                   ATFKYRQEIYNQRRIQKNSISQKHPRVNGVTPASASTPSMSSTPARTSSSSSIKRNSNT
FT                   KQHVASIN"
FT   gene            <277333..>280440
FT                   /locus_tag="KLTH0A03234g"
FT                   /old_locus_tag="KLTH-ORF16674"
FT   CDS_pept        277333..280440
FT                   /locus_tag="KLTH0A03234g"
FT                   /old_locus_tag="KLTH-ORF16674"
FT                   /product="KLTH0A03234p"
FT                   /note="similar to uniprot|P43571 Saccharomyces cerevisiae
FT                   YFL025C BST1 GPI inositol deacylase of the ER that
FT                   negatively regulates COPII vesicle formation prevents
FT                   production of vesicles with defective subunits required for
FT                   proper discrimination between resident ER proteins and
FT                   Golgi-bound cargo molecules"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21156"
FT                   /db_xref="GOA:C5DBJ9"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039529"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBJ9"
FT                   /protein_id="CAR21156.1"
FT                   /translation="MGLRRSVNALAHKGVYFAGRYLKMGEHKISNSAGSEVGGAQTKRK
FT                   RSGLKSVTGDALRNQKSSGDKVPLRIITLGFLLVLLVVAASFFKKFTGADSPKCRSIYM
FT                   YPSYARIDGFDERFTKLAKKYHLYLYREQGKDREPLENNLIQLDGVPVLFIPGNAGSFK
FT                   QARSIAAASADMYFDEPELIDNHWTKNLDFFTADFNEDFTAFHGRSLLDQAEYLNDAIK
FT                   YILSLYSANEDRTEPQPQSVLVLGHSMGGVVARVMPTLKNFVPESINSYITLSAPHTAS
FT                   PVTFDGDMLKIYESTSKFWKSQFSDNSSFFSQNVSLISITGGVLDTTLPADLTLVEDII
FT                   PYSNGFTTYTTTIPQVWTPIDHLAIVWCDQLRKVLAKLLLETVDVHSSYKSRPLKERMR
FT                   FYRKSLISGLEDYAVQDLKIDDRSESSYKPFELPDDFEEMVTGEKLILTRETAEAHRLL
FT                   NLFKIPTNKKDYQFSLLTSMAPPEVFFCQNNIVRARIDDKLEDTKFECVSAKDDFTRIP
FT                   RSTKDSLFPSDSSVGEPMSPFYLLKINGAVLSRFEFVAFSAPEGFVHDDDFLIAEMKAT
FT                   NSTRSLGDNPLTVLLKSLIKRKVRIDTSFLISTISFPNLWSSVISYRLKTTTIGENLIF
FT                   EPLIRQFIELPFETKWHVNLKQGPQDVNFHNVAPFIPSNSSNDRSLKLDFISPPGCEMT
FT                   MSLEINWALTMKMLLIRFRLTIAAFTVGLVSLVAFLQYYQYNQTGQFLAFDAALKLLLS
FT                   KYWVLILALASLLTPLYSFFCLEKLSNITKFADRTRPTMSASHSWASNTFFLGIDELFL
FT                   WWLGPVFFLMTVSSVYLLFRLITMVEAAARVAFSKVLPFRRTVEVSSIANEASSNRQFN
FT                   LRQFAGALILVLGVVFYIPYQFAFIILTVVQSLFCLKIAVSAEEGIKRNVVNYNNSVLL
FT                   LMLLLLPINAPIVMVFMRNFAIRWETPFRSHHNCLAILPIILLIESNARSRIPLRSLTN
FT                   NLVSLAILGWLLHMSLYSFIFGTRNLYWLHYLFNSLCAMLFLKTFA"
FT   gene            complement(<280633..>281961)
FT                   /locus_tag="KLTH0A03256g"
FT                   /old_locus_tag="KLTH-ORF16673"
FT   CDS_pept        complement(280633..281961)
FT                   /locus_tag="KLTH0A03256g"
FT                   /old_locus_tag="KLTH-ORF16673"
FT                   /product="KLTH0A03256p"
FT                   /note="similar to uniprot|P06842 Saccharomyces cerevisiae
FT                   YFL026W STE2 Receptor for alpha-factor pheromone seven
FT                   transmembrane-domain protein that interacts with both
FT                   pheromone and a heterotrimeric G protein to initiate the
FT                   signaling response that leads to mating between haploid a
FT                   and alpha cells"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21157"
FT                   /db_xref="GOA:C5DBK0"
FT                   /db_xref="InterPro:IPR000366"
FT                   /db_xref="InterPro:IPR027458"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBK0"
FT                   /protein_id="CAR21157.1"
FT                   /translation="MGSEFSPSTANTTMATLRSASEMLLTFESAFSNDTQVDFGQLQAL
FT                   ADTRITQGILFGTRIGTSVLTIITLYMVSKNRKTPIFISNFVSLFLVALHSALYLGYLT
FT                   TPFASLTFNLTLFPDLIPRSNLHLFAVTNVVQVLLVAAVEASLILQVRIIFHSNTLKPV
FT                   GRVLVALSSVLAAATTVLFFVSAVKSIRSVYADVLAIQDTLFFNLATIMLATSVNFMTL
FT                   LLTVKLVLAIRSRRFLGLKQFDSFHILLIMSFQTLVFPSLLLILSYALNGKKGTNTLST
FT                   LATLLVTLSLPLSSMWATSANNSPRPSSVNTRFSPCLSDNGSSKFDNHSLFSHSMNSTA
FT                   YQRHEDRAYDLYPISRSGNIDEDYGYGMEPLDKDNCRTLAVSVKSGDTSPGSSSHGELS
FT                   RLPSSDANQQTLETLERAIQAGSFTPNTVDDEAARSFWANAKP"
FT   gene            <283065..>284783
FT                   /locus_tag="KLTH0A03278g"
FT                   /old_locus_tag="KLTH-ORF16666"
FT   CDS_pept        283065..284783
FT                   /locus_tag="KLTH0A03278g"
FT                   /old_locus_tag="KLTH-ORF16666"
FT                   /product="KLTH0A03278p"
FT                   /note="highly similar to uniprot|P50276 Saccharomyces
FT                   cerevisiae YGR055W MUP1 High affinity methionine permease
FT                   integral membrane protein with 13 putative membrane-
FT                   spanning regions also involved in cysteine uptake"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21158"
FT                   /db_xref="GOA:C5DBK1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBK1"
FT                   /protein_id="CAR21158.1"
FT                   /translation="MFRSKYASQLNPFSKSEGRGPSESKAATTEFSGSDDIEHGEQFVT
FT                   ELDQGSKRLGLVSCIGLICNRMLGTGVFAVSSTIYTLCGSVGLALIMWAVGAIIALSGL
FT                   YVYMEFGTAIPRNGGEKNYLEHICEKPRFFITCMYAAYVFFLGWAASNSVNSAVMFLTA
FT                   ADVEITTWKQRGVAVAVVCFCFLVNAINVRVGLLIQNVLGIFKIVIVLFISVTGWVALG
FT                   GGLRDGVKTNNFHNAFEGTKDATAYGVVNALYNVIWSFVGYSNVNYALGEVKNPVRTLK
FT                   IAGPTSLIFLAIVYIFVNIAYFAVVPKEKLISSKLVLAADFFDIVFGGSGKKAASVIVG
FT                   LSAVGNVMSVIFSQGRIIQQLGREGVLPFSSFFATSKPFDSPLVGLLQHFIVCVVTILA
FT                   PPPGDAYNFILNLISYPMNVVNLVVSSGLLWIYWKRRQGKITWNPPIKAGVVITTFFTL
FT                   SNLYLVVAPYVPPTGDQSVYNSLPYWIHCVVTWGIFAFGAAYWVVWAYLMPKFGKYELV
FT                   DTEVIGDDGFWRKKITKHYLDDAENDGESENNIVSETISIKNTADSSKESNKAGL"
FT   gene            complement(<284917..>286008)
FT                   /locus_tag="KLTH0A03300g"
FT                   /old_locus_tag="KLTH-ORF16663"
FT   CDS_pept        complement(284917..286008)
FT                   /locus_tag="KLTH0A03300g"
FT                   /old_locus_tag="KLTH-ORF16663"
FT                   /product="KLTH0A03300p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21159"
FT                   /db_xref="GOA:C5DBK2"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBK2"
FT                   /protein_id="CAR21159.1"
FT                   /translation="MAESDGQMQQFQRYLSKARKILCIVGSGVSASSGIATYQLQKGSW
FT                   HGYTALDLATPEAFQNDPGLVWLFYSNRRYEALRAKPNEGHYALAELCRRYPSGISRRG
FT                   DSASGQHPPASVNDKKKVLVVSQNVDGLHQRAGHPPESLVELHGSVFGLRCTQFFCNYR
FT                   SRNSNDRFLTPALYRYTPRNRGANKKRTKRVSLHDGTETKKRRLDSTANGVQGQETDLE
FT                   PPSSEEESERPEMFPTLEPGDLPSCPQCHQGILRPAVVWYGESLPLDQMDEVDQFFNKG
FT                   GPVDLVLVIGTSGKVWPAMGYVERAKKSGSRVAIFNRVIEDLDQVRDSKDIWGFQGDAA
FT                   QLLPKALKPLIGERYKPRDWRRR"
FT   gene            <286223..>288904
FT                   /locus_tag="KLTH0A03322g"
FT                   /old_locus_tag="KLTH-ORF16659"
FT   CDS_pept        286223..288904
FT                   /locus_tag="KLTH0A03322g"
FT                   /old_locus_tag="KLTH-ORF16659"
FT                   /product="KLTH0A03322p"
FT                   /note="similar to uniprot|Q06488 Saccharomyces cerevisiae
FT                   YLR357W RSC2 One of 15 subunits of the 'Remodel the
FT                   Structure of Chromatin' (RSC) complex required for
FT                   expression of mid-late sporulation-specific genes contains
FT                   two essential bromodomains a bromo-adjacent homology (BAH)
FT                   domain and an AT hook"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21160"
FT                   /db_xref="GOA:C5DBK3"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR027180"
FT                   /db_xref="InterPro:IPR035700"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037382"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBK3"
FT                   /protein_id="CAR21160.1"
FT                   /translation="MSEEKKQLQKRLKPLYDEVLKIKEPNGLEIYPIFQILPPRKDYPD
FT                   YYRVIKHPMSLSTIKKRLSHHYGSANEFVRDLVQITWNARTYNTKQSDIYLYATILDDY
FT                   IKAHIIPELRKFDSKVSYPNLGPLPDEIDSASRAHKDQDVTDIPVSNEILATSNGADSG
FT                   NGADDTHEQDDDEDYNAQQQEEDEDEEYTEQKKPLPKIRIPPATQSPVPHQLPSHSMTP
FT                   TPLYQRHQQQKTHMRRGRPPVIDLPYEQRIKNVLKVLKKDINERGENITAAFDRLPDEE
FT                   REPQYYAMIANPISVDDIRKKVKQRKYKTFQLFQQDFKLAISNYQLYHRSQPAELRRAA
FT                   ELEKRFNELAQYELSRPDEDYMTDGELKYPMNQVEHNGSTYKIGDWILIHNSNDASKPT
FT                   IAQIFRLWHTSDGRRWLNACWYLRPEQTVHRVDRLFYKNEVVKSGQYRDHLVDEIVGKC
FT                   YVCHFTRFQRGDPDLEIEGPLFVCEFRYNESEKVFNKIRTWKGCLPEEIRDVEEATIPV
FT                   LGRKFFKYESPIKHLLPPNATVNDPIPMPTEGAVNAPPLVGAVYLRPKVKKDDLGEYST
FT                   SDECPRYIMRPGDPVEHGKVDIETGTIVTNTQTTTALPKGGPSTTRLASLTKSRSASGL
FT                   ASMRQSNTAVYNPPAMKSTQYFPPGQSPASGQSPLPMQQTPLPSQASISQQQANGKSGS
FT                   AGSTPAYQPPTIINSLAAQARTNNSVIGTISTDTPGAYVLPLQITKNVELLQRADYSSQ
FT                   ARRLGKDQVPKRKRTKGEVLWFKGPSVAITERLLNSKNEYTDIPLNRWFKKRRMEYEEV
FT                   DAEDNDYVNDDQEEDNQGDEDSEDEESSLAGTFPLGLRPSVSYMAFKIAQQAQHTQQAQ
FT                   QTQETQQTPQTQQTQPATIQAD"
FT   gene            <289188..>290636
FT                   /locus_tag="KLTH0A03344g"
FT                   /old_locus_tag="KLTH-ORF16655"
FT   CDS_pept        289188..290636
FT                   /locus_tag="KLTH0A03344g"
FT                   /old_locus_tag="KLTH-ORF16655"
FT                   /product="KLTH0A03344p"
FT                   /note="highly similar to uniprot|Q05911 Saccharomyces
FT                   cerevisiae YLR359W ADE13 Adenylosuccinate lyase catalyzes
FT                   two steps in the 'de novo' purine nucleotide biosynthetic
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21161"
FT                   /db_xref="GOA:C5DBK4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBK4"
FT                   /protein_id="CAR21161.1"
FT                   /translation="MSEFDKYTTPLSSRYASEEMSSIFSLRNRFSTWRKLWLNLAVAEK
FT                   ELGLSVITDEAIEEMRQHLKITDAEIGEASKQEAIVRHDVMAHVHAFGQTCPSAAGIIH
FT                   LGATSCFVTDNADLIFLRDAYDILIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLT
FT                   TLGKRVTLWIQELLWDLRNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKR
FT                   VTELLGFDTVYPVTGQTYSRKIDIDVLAPLCSFAATAHKMATDIRLLANLKEIEEPFEK
FT                   SQIGSSAMAYKRNPMRCERVCSLARHLGSLFNDAVQTASVQWFERTLDDSAIRRISLPS
FT                   AFLTTDILLSTLLNISSGLVVYPKVIERRIKSELPFMATENIIMAMVGKGASRQEVHEA
FT                   IRVLSHQAAAVVKEEGGDNDLIERIKKDNFFQPIWDELDSLLEPSTFVGRAPQQVEKFV
FT                   GGDVAQALAPFQDKITDEQVKLSV"
FT   gene            complement(<290685..>291389)
FT                   /locus_tag="KLTH0A03366g"
FT                   /old_locus_tag="KLTH-ORF16654"
FT   CDS_pept        complement(290685..291389)
FT                   /locus_tag="KLTH0A03366g"
FT                   /old_locus_tag="KLTH-ORF16654"
FT                   /product="KLTH0A03366p"
FT                   /note="similar to uniprot|P53237 Saccharomyces cerevisiae
FT                   YGR057C LST7 Protein possibly involved in a post-Golgi
FT                   secretory pathway required for the transport of nitrogen-
FT                   regulated amino acid permease Gap1p from the Golgi to the
FT                   cell surface"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21162"
FT                   /db_xref="InterPro:IPR021713"
FT                   /db_xref="InterPro:IPR037520"
FT                   /db_xref="InterPro:IPR037521"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBK5"
FT                   /protein_id="CAR21162.1"
FT                   /translation="MPNMLISLAHFCDKHGPRILLGTQFAKDGEELFLPDYPTDTYCDS
FT                   CSIHFPGSDKSSRSMRSTLHSIDYVSTNYPSVRYQLISSVIRHIFSEETMTYDGSPLTF
FT                   YDQSRGLNLVIGFKLQDNDARGDERRYGLILTIDSPDHASAMKLLSRHWEFVNYSFNKV
FT                   IQYTKQQREDELRRRQISESYGEFTPMAGSYLRGNKLKIPRNLAYLTNDDLLFVRLHKW
FT                   NTYMLDVLNMDE"
FT   gene            complement(<291551..>293413)
FT                   /locus_tag="KLTH0A03388g"
FT                   /old_locus_tag="KLTH-ORF16653"
FT   CDS_pept        complement(291551..293413)
FT                   /locus_tag="KLTH0A03388g"
FT                   /old_locus_tag="KLTH-ORF16653"
FT                   /product="KLTH0A03388p"
FT                   /note="some similarities with uniprot|P43609 Saccharomyces
FT                   cerevisiae YFR037C RSC8 One of 15 subunits of the 'Remodel
FT                   the Structure of Chromatin' (RSC) complex essential for
FT                   viability and mitotic growth homolog of SWI/SNF subunit
FT                   Swi3p but unlike Swi3p does not activate transcription of
FT                   reporters"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21163"
FT                   /db_xref="GOA:C5DBK6"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR032451"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041984"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBK6"
FT                   /protein_id="CAR21163.1"
FT                   /translation="MSEPEVPQSVEKMLPHLQQQQQQQENSKIDYEQEAAKLEEKAIRF
FT                   LAKQAHPVIVPSFASWFQFSDVHEIERRILPDFFDDSSRFKTEKAYKDVRNFMINTYRL
FT                   SPYEYLTVTAIRRNVAMDVASIVRIHNFLEQWGLINYQVDPRSKPSLLGPSFTGHFQVV
FT                   LDTPQGLKPFVPTRVITKTPPESQVTTEPEAASEQQTNAENDAATEPQGDSNSEPSVET
FT                   QGATEPQSAHPVPGLEEAETKSTTPSGAAVNANAQNKAEQGSNDDQELVTEVKSEPKSD
FT                   IKLEHKSEVKPEIEFVKPEKFPVNLSLRKNIYDSAQNFNSLQTDSQQSKQINRAYICHT
FT                   CGNDAVGVRYHNLRSRDTNLCSRCFQEGHFSAHFSSSDFLRLENNAHTKKQWSDQEVLL
FT                   LLEGIEMYEDQWDRVVEHVGGSKTLEECVEKFLTLPIEDKYIDEVIPAQPRKSGQGNAT
FT                   PEVTQAVDATVEALLNGFNDKVLKGTLPENAKHISEKYLQEAQLVVQDLVKLTLEKVDL
FT                   KFQKLNTLEETLNKERQRYTQESDKLLGERQSLSKQVTELNEELAKLNISKKLVMLSEQ
FT                   ADSGVKLVEKDVESQNKNKLVKSVDEFESVSHIDPQQYKSWSMS"
FT   gene            <293799..>296219
FT                   /locus_tag="KLTH0A03410g"
FT                   /old_locus_tag="KLTH-ORF16651"
FT   CDS_pept        293799..296219
FT                   /locus_tag="KLTH0A03410g"
FT                   /old_locus_tag="KLTH-ORF16651"
FT                   /product="KLTH0A03410p"
FT                   /note="similar to uniprot|P43610 Saccharomyces cerevisiae
FT                   YFR038W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21164"
FT                   /db_xref="GOA:C5DBK7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBK7"
FT                   /protein_id="CAR21164.1"
FT                   /translation="MVKTRNASRRSQRVDYKEKQESNLEPDTLVSSESSDDEEKGDAPI
FT                   WLSENNELGVQDVDLSSGDEEDDTELNNLIQEQESKRQEAQLKKDEEEKSEEEFDDTTV
FT                   SMKLNRLQEFVKQSQVYSRIIADTLLTRSQERQTEKEAKEPPRKRTKVTDFFRKSKKEP
FT                   VADSEEPEPVLHQQPSMLKNCQLKPYQLEGVNWLITLYENGLNGILADEMGLGKTLQSI
FT                   ALLAFITEMDTGGPFLIAAPLSTLDTWVNEFSRFAPDIKVLKYYSSQGQRQRQQLLKDF
FT                   FRKTKNEGVIVTSYEVIIRDIEQILSYQWKFLIVDEGHRIKNINCKLIRELKRINTLNR
FT                   LLITGTALQNNLSELWSLLNFIMPDIFADFEIFHKWFDFSDLELKSSSQGLNRLINDEL
FT                   EKNLISNLHTILKPFLLRRLKKVVLAKSLPPKREYIVNCPLTPIQRKFYKAALGGKLKQ
FT                   AIFKQAIKNFFTLNQDQIGCVSNKSIREFLEWRLKHGREEPETKVLRQMNELYNQHIHR
FT                   ALLHKRLQNPMIQLRQVVDSTLLFFFPFLDPEHLTLEFLLQTSGKLQILQQLVPPLVAK
FT                   KHKVLIFTQFVSMLDLIEDWCELNEIRVCRIDGSMDNEARQEHIERFNDGHDSYDAFLI
FT                   STRAGGLGINLTAADTVVLFDSDWNPQVDLQAMDRTHRIGQTKPVIVYRLCCDNTVEHV
FT                   ILTRAASKRKLEKMVIQLGNFGTLKRLAGNESSFISQGHTPANSNKELMHELSQLLMSD
FT                   ESSISGFPRSGNPELTTDELAELFDRSEKAFRIENAKKEWPHIRLFESTTAAK"
FT   gene            <296563..>297951
FT                   /locus_tag="KLTH0A03432g"
FT                   /old_locus_tag="KLTH-ORF16648"
FT   CDS_pept        296563..297951
FT                   /locus_tag="KLTH0A03432g"
FT                   /old_locus_tag="KLTH-ORF16648"
FT                   /product="KLTH0A03432p"
FT                   /note="similar to uniprot|P07278 YIL033C Saccharomyces
FT                   cerevisiae BCY1 Regulatory subunit of the cyclic AMP-
FT                   dependent protein kinase (PKA)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03432g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21165"
FT                   /db_xref="GOA:C5DBK8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003117"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBK8"
FT                   /protein_id="CAR21165.1"
FT                   /translation="MPLSSNQMEELNLFQRKVHEDQPKDLLQFAANYFNRRLEQQRFFA
FT                   RNQESLALSKGIVLFPSATRNDSVVASGSLGGRIGGLGSLGGTDDQDVLFKAPFAEQDP
FT                   HAHDPHATHENSQDGDQQNDSDAGGLFKNNFRVNQSSDKDIKKPVDPMAPDHTKSPSPQ
FT                   PTKIPRRSTLAPQPLPLNFNAQRRTSVSAETMTPDNLDDWTPENFNEKTGEQLARLEKA
FT                   IGRNFLFNKLDSESKRLVINSLEEKTVKQSQEIIKQGDEGDYFYIVEKGTVDFYVGNEK
FT                   VNTSGPGSSFGELALMYNSPRAATVVANTDCVLWALDRLTFRRILLGGSFKKRILYDEF
FT                   LKSMPVLQSLSTYDRAKLADALDTELYHPGQVIIREGDNGENFYFIEYGEAEVSKEGQG
FT                   IIAHLKQGDYFGEVALLNDLPRQATVKAIKKTKVATLGKSGFQRLLGPAVEVLKLNDPT
FT                   RVDH"
FT   gene            complement(<298086..>298532)
FT                   /locus_tag="KLTH0A03454g"
FT                   /old_locus_tag="KLTH-ORF16647"
FT   CDS_pept        complement(298086..298532)
FT                   /locus_tag="KLTH0A03454g"
FT                   /old_locus_tag="KLTH-ORF16647"
FT                   /product="KLTH0A03454p"
FT                   /note="highly similar to uniprot|P40030 Saccharomyces
FT                   cerevisiae YER044C ERG28 Endoplasmic reticulum membrane
FT                   protein may facilitate protein-protein interactions between
FT                   the Erg26p dehydrogenase and the Erg27p 3- ketoreductase
FT                   and/or tether these enzymes to the ER also interacts with
FT                   Erg6p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21166"
FT                   /db_xref="GOA:C5DBK9"
FT                   /db_xref="InterPro:IPR005352"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBK9"
FT                   /protein_id="CAR21166.1"
FT                   /translation="MLSFQQVVNFTQNTLSSMPPGYLPKWLLFISVVSVLNSIQTYISG
FT                   LELTRRVYERKPSETTSLSARTFGTWTFISCVIRLYGALFLYEEHIYQLVCISYLVALF
FT                   HFGSELLVFRTCKLGKGFMGPLVVSTTSLLWMYNQKEFYTGKGW"
FT   gene            complement(<298735..>299661)
FT                   /locus_tag="KLTH0A03476g"
FT                   /old_locus_tag="KLTH-ORF16646"
FT   CDS_pept        complement(298735..299661)
FT                   /locus_tag="KLTH0A03476g"
FT                   /old_locus_tag="KLTH-ORF16646"
FT                   /product="KLTH0A03476p"
FT                   /note="similar to uniprot|Q12458 Saccharomyces cerevisiae
FT                   YDR368W YPR1 2-methylbutyraldehyde reductase may be
FT                   involved in isoleucine catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21167"
FT                   /db_xref="GOA:C5DBL0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBL0"
FT                   /protein_id="CAR21167.1"
FT                   /translation="MSAPKPSTSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVG
FT                   YRHIDCAALYKNEDFVGRAIRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDY
FT                   VDLFLMHWPQALRTERITDGNMITVPKREDEKPDVDTEWNYIKTWHLMQDLPASGKTKA
FT                   VGVSNFSVKQLEKLLADPGSKVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGS
FT                   QKAPLLDDPVILEIAAKHKADPAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDS
FT                   ELEKINEIHKKGEKRVVDPEWFDFEED"
FT   gene            complement(<301696..>303915)
FT                   /locus_tag="KLTH0A03498g"
FT                   /old_locus_tag="KLTH-ORF16642"
FT   CDS_pept        complement(301696..303915)
FT                   /locus_tag="KLTH0A03498g"
FT                   /old_locus_tag="KLTH-ORF16642"
FT                   /product="KLTH0A03498p"
FT                   /note="weakly similar to uniprot|Q6B2M3 Saccharomyces
FT                   cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger transcription
FT                   factor that activates genes involved in multidrug
FT                   resistance paralog of Yrr1p acting on an overlapping set of
FT                   target genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21168"
FT                   /db_xref="GOA:C5DBL1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBL1"
FT                   /protein_id="CAR21168.1"
FT                   /translation="MARDIGAASIIDNDAAVRRRRRKIIKSCTFCRQRKLKCDHKRPKC
FT                   GSCLARKLPECIYLDTLNLQLTSTDLYSNKPNVALLRRIQELELELDKTYMDDASEGSE
FT                   KGLSSEAGSRTSTSGISDTVLSGEPCRNEVLNFNALRVKNGRFVYYGPTSIRATISASG
FT                   ERFVAEYSKFWDRVKSDLADWKTAHGRFPTMEHNIITAPQTSNVLESIIPDLPCYEVVG
FT                   LRINEFFDDPLHDYFRFLDKQKVLADFARCFVPGYAATPEIDGVPKQQVIMIVAPENKN
FT                   FYTIGVILMILCLNHYKTGIPVSIERFIVTLEGFTMASSMFVERAQLLLLVYVFRVYNG
FT                   MGGNGSSNLVSLVSLLTSAALRLGLHKDIDMMYGGQEHLVGSLYSLKNLWYWTLFADLC
FT                   VAFDMGVLMSVTSAHFDDSTLPTSERGRIPLLRNFLFLGRKCMQSLLNPNTAPDLHLKA
FT                   GELISFVESQFRPIRFYTNIALISQVDLFEVIILSPALAMITNFFDLMRIIDSQRDTHK
FT                   EMTVYLKNKFVKCMLVATSLMVNTIIQCYKLDKERLSAAKFIQLKHLTPWLNLCVLLLN
FT                   SFPIRVLTEMYALMLYKISLFEKGQRITVDKGQFSNFPSLDDLSVPRNSYLHFKDSFEA
FT                   FCSTFDELWTPENTGMIQILMNSHYFVIMMALERVNRKVFQLALQSRTEVEKVHNWPKL
FT                   IQNNVSDDVIKMLADEVWNNYSTGLSGLTEMPASDFLANLEMPDR"
FT   gene            <305601..>306446
FT                   /locus_tag="KLTH0A03520g"
FT                   /old_locus_tag="KLTH-ORF16640"
FT   CDS_pept        305601..306446
FT                   /locus_tag="KLTH0A03520g"
FT                   /old_locus_tag="KLTH-ORF16640"
FT                   /product="KLTH0A03520p"
FT                   /note="similar to uniprot|P13517 Saccharomyces cerevisiae
FT                   YIL034C CAP2 Beta subunit of the capping protein (CP)
FT                   heterodimer (Cap1p and Cap2p) which binds to the barbed
FT                   ends of actin filaments preventing further polymerization
FT                   localized predominantly to cortical actin patches"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21169"
FT                   /db_xref="GOA:C5DBL2"
FT                   /db_xref="InterPro:IPR001698"
FT                   /db_xref="InterPro:IPR019771"
FT                   /db_xref="InterPro:IPR037282"
FT                   /db_xref="InterPro:IPR042276"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBL2"
FT                   /protein_id="CAR21169.1"
FT                   /translation="MSPYEAALDLLRRLDPTKVEQNLNQLIKLDPDLAEDLLASVDTPL
FT                   KVKKDPNASQKEFLCCDYNRDIDSHRSPWSNNYVPALSAQELEESPFPSDAIRAVEVLA
FT                   NDSFDIYRDLYYEGGVSSVYLWDLGDDADADGAPNDFAGVVLLKKGENSRSSWDAIHVF
FT                   EVLQEGSTQSQVSYRITTTIILHLNSEKKMTLAGNLTRQTERSFALPGHLSPEQSGIWH
FT                   VSNLGSVIEEVESQMRNQLEVVYFEKTKDIYRELRDSSQEATTQNRSVHEEVVKGLQGM
FT                   "
FT   gene            <306667..>307803
FT                   /locus_tag="KLTH0A03542g"
FT                   /old_locus_tag="KLTH-ORF16638"
FT   CDS_pept        306667..307803
FT                   /locus_tag="KLTH0A03542g"
FT                   /old_locus_tag="KLTH-ORF16638"
FT                   /product="KLTH0A03542p"
FT                   /note="highly similar to uniprot|P15790 Saccharomyces
FT                   cerevisiae YIL035C CKA1 alpha subunit of protein kinase
FT                   CK2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21170"
FT                   /db_xref="GOA:C5DBL3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBL3"
FT                   /protein_id="CAR21170.1"
FT                   /translation="MKCRTWSEARVYTTANVRRGQAYWDYENTVIDWVPNNGTYEIETK
FT                   VGRGKYSEVFQGVQLSTKSKIVIKMLKPVKKKKIKREISILTNLSNETNPPTAQPFNKD
FT                   AYYENKKEEVLQFTRSEVYELAHDGHKNIIQLLDVVKDQVSRTPALIFEHVDNVDFRTL
FT                   YPTFTDLDVRFYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKRKKLRLIDWGLAEFYH
FT                   PNMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFKKEPFFHGTSNTDQL
FT                   VKIVRILGSDDFENYLNKYQITLPQEFHDIDQYIRRPWHRFVNDSNKHLSGNGDIIDLI
FT                   DNLLRYDHQERLTAREAMQHSWFAPIRRGEYNGEPDAK"
FT   gene            complement(<307859..>309100)
FT                   /locus_tag="KLTH0A03564g"
FT                   /old_locus_tag="Klth0A.mRNA.3045.m"
FT   CDS_pept        complement(join(307859..308965,309038..309100))
FT                   /locus_tag="KLTH0A03564g"
FT                   /old_locus_tag="Klth0A.mRNA.3045.m"
FT                   /product="KLTH0A03564p"
FT                   /note="weakly similar to to YER044C-A uniprot|P29467
FT                   Saccharomyces cerevisiae YER044C-A MEI4 Functions in early
FT                   recombination; mRNA is meiosis-specific and has 88 bp
FT                   intron at 5' end spliced independently of MER1[INTRON]"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21171"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBL4"
FT                   /protein_id="CAR21171.1"
FT                   /translation="MVFSNPICQTDDNPGSLDLALALSLIKQRNPRLWHKLASQGFFQE
FT                   TAGASELFPAERHVVKGSAANKADTGIESIGESFLYKFTTNNISSHIERATAFLGCNRH
FT                   TWKCLSSQISTLESFGCGLEESDIAKWVLPNYRLLKWLYAKDPPQLQKRDRALRTVNSF
FT                   QLLLISHYAFSGERNKVVHVLCQSLIYRFIKDELISFGPSKVRVLKLLRDYTDSNVVQV
FT                   ADVSLFSLSEGHLKLVKLILNIRISFQDHEVLSKTLQFLLKLLESLVVCLIKLNSSRYS
FT                   PARKPRAYEIMYKARSKLMNYQYVTKVLEACHLLSRKEATIRLKISFTFVLKLVTSVEW
FT                   LNAFDNSGAGQNELMRTLREHRTYIISSLLVLNDSRLISKFLKTRWPAQ"
FT   gene            complement(<309596..>310870)
FT                   /locus_tag="KLTH0A03586g"
FT                   /old_locus_tag="KLTH-ORF16635"
FT   CDS_pept        complement(309596..310870)
FT                   /locus_tag="KLTH0A03586g"
FT                   /old_locus_tag="KLTH-ORF16635"
FT                   /product="KLTH0A03586p"
FT                   /note="some similarities with uniprot|P40535 Saccharomyces
FT                   cerevisiae YIL036W CST6 Basic leucine zipper (bZIP)
FT                   transcription factor of the ATF/CREB family activates
FT                   transcription of genes involved in utilization of non-
FT                   optimal carbon sources"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21172"
FT                   /db_xref="GOA:C5DBL5"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBL5"
FT                   /protein_id="CAR21172.1"
FT                   /translation="MERVHIKTEESRAGLPPAHAQGVLVGGAMNHGQVGANYGAPAGGG
FT                   MGFGGLGSPGTLGMHGASGTPGAAETGNLREAGGVFPHLSKYQLNNSGGMADSSLQECL
FT                   SPFFQPFGVDVSHFPLTNPPIFQSSLTNFSDHPRRRRISISNGQISQLGDATHTFDDLY
FT                   YTQPPPMPIRHERQDAQPHIGESKSVPPQGAKAAPAPVQVQGAPTAQHFLPQPAAADVV
FT                   PGQQHGQLQVPPQHAQHPQHPQHTQPVQHAQQPMDGPHQHAPVPDELYSKDSAFSSSFS
FT                   TPTDASLLVPENSRPPVQALPKEYQVRPRTTYEDGPGTPEWKRARLLERNRIAASKCRQ
FT                   RKKIAQQQLQKDVSQLTQENRFMRKKLDYYEKLVNKFKKFTEIHMASCGGSEQLSVIED
FT                   LLKIDHNIDDKQGGSSQSTEEEARL"
FT   gene            <311369..>312109
FT                   /locus_tag="KLTH0A03608g"
FT                   /old_locus_tag="KLTH-ORF16628"
FT   CDS_pept        311369..312109
FT                   /locus_tag="KLTH0A03608g"
FT                   /old_locus_tag="KLTH-ORF16628"
FT                   /product="KLTH0A03608p"
FT                   /note="similar to uniprot|P40031 Saccharomyces cerevisiae
FT                   YER046W SPO73 Meiosis-specific protein of unknown function
FT                   required for spore wall formation during sporulation
FT                   dispensible for both nuclear divisions during meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21173"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBL6"
FT                   /protein_id="CAR21173.1"
FT                   /translation="MLFGTQDIIVEHQRGAMVLGYPVFSPNLLIRGIDPPQFQLVGEDG
FT                   HTVEKGEIKAGGGMYPFDLGTPLKGFKWFVSMDHGNRYDTDDQGWCYSWRFRSRRWKAH
FT                   GGFVRKRFWVRLPINGREMTPAEPEVCAGSVRPGEHASSGADEPAYSVAGPVVAAQTRS
FT                   EELFEALLEELHKPSLDRQKADLALRYIAELPEEERRRAASPGSELMERVPCAFQFEES
FT                   RLKFLQVQVPALLDSVSGRNTILT"
FT   gene            <312223..>314028
FT                   /locus_tag="KLTH0A03630g"
FT                   /old_locus_tag="KLTH-ORF16625"
FT   CDS_pept        312223..314028
FT                   /locus_tag="KLTH0A03630g"
FT                   /old_locus_tag="KLTH-ORF16625"
FT                   /product="KLTH0A03630p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21174"
FT                   /db_xref="GOA:C5DBL7"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBL7"
FT                   /protein_id="CAR21174.1"
FT                   /translation="MHGPLELFPSLRQRLLSCMFKPQIFAPHAVFWFSTWMLYFLFQDE
FT                   TASLSSTASLAAAGATLVTTTATATATMTATTTKTIAYTSSVETEAAGANITSAVETFL
FT                   SLKANDSARQVATYIEGFNENCKLKLRLWNASLETQLGFWEREYESLKAYNNTIFSNLL
FT                   EQAQTINSSVDYLSNSGFLVASDSQSSVLRGLSLNTSFLQSVFGNVSSNLGKIRNLTLP
FT                   AAPTATASALSASEILDSITSNKTTSNFTSMLGVLGSDKKIRTTLLVKRDSASDTSGKY
FT                   KQKAIRISSALAATYVAATFAFVCLEYVTYKIEVRGAQDTLQHQLECIDELYKGETVIS
FT                   VARIRAHESFQQLLICYNDFAKHPVTYTFTEMALELLRRPLSKTWSPVAVAKFVKAYNW
FT                   WLTTNGLHVFCLFLAAVVEGQILRAFLDVSHSTHPTSLYPRSKFSEAALSTKTLGSISS
FT                   SCALFESTVNAEINSVVHERLWNASRGNVTQINSLLDEYFSNVNATLKDQVPAIDMNMS
FT                   YWSSELNSEQTFNFTSFSETLAHEIYEVVAPSENLETKRLVRRSEAAQSQAMGKTILAR
FT                   YEKGCLCLLGSVVFYLLCGFLAAAV"
FT   gene            <314336..>316654
FT                   /locus_tag="KLTH0A03652g"
FT                   /old_locus_tag="KLTH-ORF16623"
FT   CDS_pept        314336..316654
FT                   /locus_tag="KLTH0A03652g"
FT                   /old_locus_tag="KLTH-ORF16623"
FT                   /product="KLTH0A03652p"
FT                   /note="some similarities with uniprot|P06102 Saccharomyces
FT                   cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
FT                   which is a global transcriptional regulator with roles in
FT                   transcription initiation and elongation and in mRNA
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21175"
FT                   /db_xref="GOA:C5DBL8"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBL8"
FT                   /protein_id="CAR21175.1"
FT                   /translation="MAHRKLQQEVDRVFKKISEGLEIFDTYYERHENCTNNPSQKDKLE
FT                   CDLKREVKKLQRLREQIKSWQSSPDIKDKDSLLEHRRSVEVAMEKYKAVEKASKEKAYS
FT                   NNSLKRSDNLDPKERERQEITDYLSQSIEELERQYDSAQVEVDKLILLNKKKKTATTAN
FT                   EEKKNQLKDLQGRYRWHLQQMELALRLVANQELDPEDVKRVKDDINYFIESNQEPDFVE
FT                   DETIYDGLDLTSNEAIAHEVAAAFAAQRSEELEEDMVKEGAKLSKKEQRKLEREAKKAA
FT                   KASAKTGSGTETLPESAGIVIPQKNEPRQIDSVSESASVSASRSPSPDVSSAGTSIPNT
FT                   ANSKSTIQPSSSAGPVNLMGKLPGSQIKQQTISREATPELQGHTHIHQSLNGITTTSTL
FT                   KPATVPARPVGDLRWAAAASQAAEKEKKAEHLNHQAAKSQSTSSSVNNSATTSAASTPI
FT                   VTKQALTPVGQKRILSNSQMLTATVPSSVGIQVSNNTLPSQKTVNSQDAKAGEPAVEEV
FT                   IDDTYDSDYSLDDFDESSDDEIIDDEESATKSQIRENLRETLSDDLELLVLPGGVQDFI
FT                   MSSLLSRNGLNRSNGSCSKLRTLRDACRVSRLDNIPRSVNPPSPLDAFRSTSVWDVTRC
FT                   SLRDEIGEFGGDKPAERAHLLEKFRGLETFFLFYCFYYSITPLEQEIAYTLLGERNWKV
FT                   SKTGENWFSRHSLPKFSNELCEVADFKIFNLDDWTVTDKLNFKLDYSILRDPPSTEAEP
FT                   SLVDDANESGAWTKSTVVQ"
FT   gene            complement(<316868..>317992)
FT                   /locus_tag="KLTH0A03674g"
FT   CDS_pept        complement(316868..317992)
FT                   /locus_tag="KLTH0A03674g"
FT                   /product="KLTH0A03674p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21176"
FT                   /db_xref="GOA:C5DBL9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBL9"
FT                   /protein_id="CAR21176.1"
FT                   /translation="MPVKVTKLEGKPLGAVITLPEGCTDPSELSPEDFDTVYKALHEHL
FT                   VIVIPGMEDLPPKSQWKLTTMFDPTCDQSGKSYGHGKEFRHDKSVLRRDGTSIPDQPQV
FT                   QVLGQGEWPAGHYGLGDISLRHPTHFDFHKKPLTQEQAFEQDMTRFYRWHIDSALYGLS
FT                   PPVATTLLGIHVPPHSRKQKVVYEDNGDVLELTQGATAFVSGAKAFEMLSPEDQERALK
FT                   TTVVYAPHPYIFISSARATPDGLTMVSEGKETPFDELPPWEESKIKKLPLVWTNPITKK
FT                   HHLQVHGCCIHKLELPDGTVLELDDARKEVYRMMRPAIAPENVYAHDWNKGDLAIFFNR
FT                   GVWHSVTGQFSEGERRLMHQCNIASGQDPQTLTA"
FT   gene            complement(<318721..>321066)
FT                   /locus_tag="KLTH0A03696g"
FT                   /old_locus_tag="KLTH-ORF16618"
FT   CDS_pept        complement(318721..321066)
FT                   /locus_tag="KLTH0A03696g"
FT                   /old_locus_tag="KLTH-ORF16618"
FT                   /product="KLTH0A03696p"
FT                   /note="similar to uniprot|P39955 Saccharomyces cerevisiae
FT                   YER047C SAP1 Putative ATPase of the AAA family interacts
FT                   with the Sin1p transcriptional repressor in the two-hybrid
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21177"
FT                   /db_xref="GOA:C5DBM0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBM0"
FT                   /protein_id="CAR21177.1"
FT                   /translation="MDASKEGGLLTRFARMRKKPQQPLTDLTELYSQIANESIYYLKLE
FT                   EKHEYKKAVLGWKALNTHVLYELTQIEYHYPNTGAYTRDEISIQNGVRELYHRSLSHLE
FT                   RVSKLCQEDEKSHEHYKPHSSSLPGRPRPPTANSRSMLKTLREPGRLKYNRNHPSSAPN
FT                   ITSPTSRSNSNVNFTTSKPLGHDNVFQGFDEDHNLIEFSDDEPAAKLEEDAKSDTKSDI
FT                   TFDFDVHDYFDDYLDMDQEELKRLETLNNLEGVQKSVGNMSIESSALDPKIKEKPSVTK
FT                   SAQTSATVPKEKVMHKTTKKIVPKAAPKAASRPGVSTQTTRSRVPAAKPKTRPTVKAAQ
FT                   STPVLRSRVASPPPKSSALINKRVVRKNTPAAAKTSESLPSRTPGKPPPSKKGGTVAAK
FT                   NASNGTKKQPAKTATPTSSINSNSSASRKRLLKSPTPPPVAPTESAPKESEVSPDDEKI
FT                   LKEALEDELIDQMRGIDKTAAKQIFSEIVVHGDEVHWDDIAGLESAKSSLKEAVVYPFL
FT                   RPDLFRGLREPVRGMLLFGPPGTGKTMLARAVATESNSTFFSISASSLTSKYLGESEKL
FT                   VRALFAIAKKLSPSIVFVDEIDSIMGSRNNDGENESSRRIKNEFLIQWSSLSNAAAGNK
FT                   EGSEDEEDERVLVLAATNLPWSIDEAARRRFVRRQYIPLPEPETRKKQMNKLLAHQTHT
FT                   LTEEDFEELLALTDGYSGSDITSLAKDAAMGPLRELGDQLLFTPRDQIRPITLQDVKNS
FT                   LEYIKPSVSKEGLTEYEDWAKKFGSSGA"
FT   gene            complement(<321327..>322751)
FT                   /locus_tag="KLTH0A03718g"
FT                   /old_locus_tag="KLTH-ORF16614"
FT   CDS_pept        complement(321327..322751)
FT                   /locus_tag="KLTH0A03718g"
FT                   /old_locus_tag="KLTH-ORF16614"
FT                   /product="KLTH0A03718p"
FT                   /note="similar to uniprot|P40533 Saccharomyces cerevisiae
FT                   YIL039W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21178"
FT                   /db_xref="GOA:C5DBM1"
FT                   /db_xref="InterPro:IPR033307"
FT                   /db_xref="InterPro:IPR033308"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBM1"
FT                   /protein_id="CAR21178.1"
FT                   /translation="MIRPLLKKFTGFTLVLAIVSNIYIFTYPSLFPERCSWRCASQPSV
FT                   VGATDSMHVGEKVLYYSKRYVNDLMRQWKKSHEETQSSPADVHLMAFGDPQIKGIWRNT
FT                   PYVTRLDIFGNDFYLGHIFSTMRNRLNPTHVAVMGDLFSSQWIGDSEFFNRTMRYTKRI
FT                   FKRDTTSLENIRNDSHDENGLYKNYWVQFADEFKRRLTEEPKTLGFGYENVHTWDPEHE
FT                   DYLFINLTGNHDIGYSGDATFQHMSRFHQLFGKDNYWIEYDRDTDHPWRIVVLDSMLLE
FT                   GPPLQQEFVNATWEFLLQLFEQRFEGSTVLLTHVPFYKKEGLCTDGELFRYYPDDYPRE
FT                   PYKQNLLRSQNHLSEDVTKRVLNLIFDNGKPGIILTGHDHEGCETVYNKDSKTGDWNAA
FT                   KTMQSPDFHVREVTVRSMMGEFNGNTGLVTGHFNHETKTWEWSFSLCPFSIQHVWWFTK
FT                   VVTILSGFLLSALLVT"
FT   gene            complement(<322936..>324123)
FT                   /locus_tag="KLTH0A03740g"
FT                   /old_locus_tag="KLTH-ORF16613"
FT   CDS_pept        complement(322936..324123)
FT                   /locus_tag="KLTH0A03740g"
FT                   /old_locus_tag="KLTH-ORF16613"
FT                   /product="KLTH0A03740p"
FT                   /note="similar to uniprot|P39101 YER048C Saccharomyces
FT                   cerevisiae CAJ1 Nuclear type II J heat shock protein of the
FT                   E. coli dnaJ family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21179"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR026894"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBM2"
FT                   /protein_id="CAR21179.1"
FT                   /translation="MVKDTEYYDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPEAQ
FT                   AKFQAIGQAYQVLSDPELRSRYDEFGKEDAVPQQGFEDAAEFFSTIFGGDAFQDWIGDF
FT                   AFLKNLTKGAEIMGEDGEEAGTAAENSEDPSKDVVQHDGKTAKPKSSDNKLTKEQRAKL
FT                   VEMENERRAEKKKQVEDLVRKLETRIEQYVAAVQNKHLDEFDAKLNQEIEDLKLESFGL
FT                   ELLQLIAKVYKTKANNFLASQKTYGFSKLFTGVRDKTKTAKSAWGILSSAMDAQSAMKE
FT                   LEKLDVETMDEYERAEVEKLITGKVLGTAWVMSKFEAQGKLKDVCDKILGDKNVPSKQR
FT                   VVKAKALLYMANKFASAQRSPDEAEDARVFEELIFDAQGKKKKADHKRKDSTVKA"
FT   gene            complement(<324351..>324800)
FT                   /locus_tag="KLTH0A03762g"
FT                   /old_locus_tag="KLTH-ORF16611"
FT   CDS_pept        complement(324351..324800)
FT                   /locus_tag="KLTH0A03762g"
FT                   /old_locus_tag="KLTH-ORF16611"
FT                   /product="KLTH0A03762p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21180"
FT                   /db_xref="GOA:C5DBM3"
FT                   /db_xref="InterPro:IPR024316"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBM3"
FT                   /protein_id="CAR21180.1"
FT                   /translation="MEPKYEQVQAAISWFASYVLRTLAWILPLTYRFAQSHPTITNILG
FT                   YMLSAYILWKVVCHLWAIIKKLLLVAAVLFSVLLWYRGLHQVLSVDAPILLEYLRNDSY
FT                   LRDRWSQAVRAMNPTYLGIYSPFLLGQHLQELRNRSLRFLASASN"
FT   gene            <324954..>325025
FT                   /locus_tag="KLTH0A03784r"
FT                   /old_locus_tag="Klth0A.tGln.CTG.4"
FT   tRNA            324954..325025
FT                   /locus_tag="KLTH0A03784r"
FT                   /old_locus_tag="Klth0A.tGln.CTG.4"
FT                   /note="tRNA-Gln (CTG) cove score=70.60"
FT   gene            complement(<325271..>325342)
FT                   /locus_tag="KLTH0A03806r"
FT                   /old_locus_tag="Klth0A.tGln.CTG.10"
FT   tRNA            complement(325271..325342)
FT                   /locus_tag="KLTH0A03806r"
FT                   /old_locus_tag="Klth0A.tGln.CTG.10"
FT                   /note="tRNA-Gln (CTG) cove score=70.60"
FT   gene            <325659..>325730
FT                   /locus_tag="KLTH0A03828r"
FT                   /old_locus_tag="Klth0A.tGln.TTG.5"
FT   tRNA            325659..325730
FT                   /locus_tag="KLTH0A03828r"
FT                   /old_locus_tag="Klth0A.tGln.TTG.5"
FT                   /note="tRNA-Gln (TTG) cove score=68.39"
FT   gene            <325998..>326291
FT                   /locus_tag="KLTH0A03850g"
FT   CDS_pept        325998..326291
FT                   /locus_tag="KLTH0A03850g"
FT                   /product="KLTH0A03850p"
FT                   /note="similar to uniprot|Q6Q560 Saccharomyces cerevisiae
FT                   YER048W-A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21181"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBM4"
FT                   /protein_id="CAR21181.1"
FT                   /translation="MSASPGPSRAQVLALYKQFIKNANGFNNYNYREYFLRKARTTFRK
FT                   NRALEDPATISAAWDTALKDLGVLKRQSVISQMYTFDKQVVEPLDPKHHSRG"
FT   gene            <326673..>328547
FT                   /locus_tag="KLTH0A03872g"
FT                   /old_locus_tag="KLTH-ORF16606"
FT   CDS_pept        326673..328547
FT                   /locus_tag="KLTH0A03872g"
FT                   /old_locus_tag="KLTH-ORF16606"
FT                   /product="KLTH0A03872p"
FT                   /note="similar to uniprot|P40032 Saccharomyces cerevisiae
FT                   YER049W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21182"
FT                   /db_xref="GOA:C5DBM5"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR019601"
FT                   /db_xref="InterPro:IPR039558"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBM5"
FT                   /protein_id="CAR21182.1"
FT                   /translation="MKRNSAPSGDQQPKKQPTNEVGKVKSLFNAKIWDPKFQKDLRQEI
FT                   HDSKPYNWGTIRDLVDDDLLRAVRKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWED
FT                   LSRLPNLCKLREILYSEVYRDVISYVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGS
FT                   RRVSFILYLPDPNTRWKDHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGF
FT                   SFHDVEEVRVNRHRLSIQGWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYE
FT                   FPKGERDVLPPHQIKHFENLLHNQPANQEAENEATEQPLPDMRFLTKEEMKFLSSFVSP
FT                   EYLTPEGISRLQTQFLEKSHLQIEDFLNDERSDLLKKLIKRDEFEKDCPYESVNVERPW
FT                   KTAMPPHKWRYLYIDGKSHENFRNEQDILDNLNNEERPNYVLLKQTLDKSKHDTETELI
FT                   TVAEFLQSTAFKKYLALVTLLSPISEQVLIRRFRPGKDFTLATQLNKNALLKDVEGLVD
FT                   AVLEGTLCLTPSNGWESGEVGGYELYMDNQEESENMDKDIEDAAVYKSDDTGDAVLINK
FT                   PPSWNSLNLVLRDESVLQFIKYVSWSAKSSRWDITAQWDVKAVDGDDK"
FT   gene            complement(<328648..>329619)
FT                   /locus_tag="KLTH0A03894g"
FT                   /old_locus_tag="KLTH-ORF16602"
FT   CDS_pept        complement(328648..329619)
FT                   /locus_tag="KLTH0A03894g"
FT                   /old_locus_tag="KLTH-ORF16602"
FT                   /product="KLTH0A03894p"
FT                   /note="similar to uniprot|P40531 Saccharomyces cerevisiae
FT                   YIL041W GVP36 Golgi-vesicle protein of unknown function
FT                   green fluorescent protein (GFP)-fusion protein localizes to
FT                   the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21183"
FT                   /db_xref="InterPro:IPR018859"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBM6"
FT                   /protein_id="CAR21183.1"
FT                   /translation="MSFNNFADSVNKKLQELSSQVSQRAQDAQLDKKFRDLSSAVSQRT
FT                   QDLTTQLPSFAQSTQRLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVY
FT                   ENESYDYPNNVRDSVNEFSSVVAGKLHDLSRATSTNEAQSVLIAPGPHKDPKTLNYALS
FT                   KVALTSSEYLNKSVGGDDSEVSNALLKYSDVQAKVAQARLQQDTLIQTRFNKKLRDILA
FT                   NDLNEAQKARKNVEHKRLQYDIARSNLANAKPEKEASLRVQMESLEDEFAQATDDAVVV
FT                   MQKVAGSSELLKELRELVAAQADYHKQSYELLSEFLPQLESA"
FT   gene            <329926..>331167
FT                   /locus_tag="KLTH0A03916g"
FT                   /old_locus_tag="KLTH-ORF16601"
FT   CDS_pept        329926..331167
FT                   /locus_tag="KLTH0A03916g"
FT                   /old_locus_tag="KLTH-ORF16601"
FT                   /product="KLTH0A03916p"
FT                   /note="similar to uniprot|P40530 Saccharomyces cerevisiae
FT                   YIL042C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21184"
FT                   /db_xref="GOA:C5DBM7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="InterPro:IPR036784"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBM7"
FT                   /protein_id="CAR21184.1"
FT                   /translation="MFARHSQLAGRGLKQLAITVKLPRLIFHSCATRQSYSTKTSMREK
FT                   LKEVGFEELYRIRSNTQLLIQDFAKKPIPPLSYEFLTQYKVPLTENQKYTLTIQTVNLL
FT                   LMYTCRRLVAIQRLPYIAVLNPNIEQTNRLYLRTLESLLSLNYPYGLHDQGVMTKKLTE
FT                   FLDDHQDTLVTLSRGFQEIMDFFPKEAVFDFLNLHLRDRIAMKLLATHYLALVSQKSNE
FT                   EPVIGVLHKNLKISELVRRVEEFVGDLCFVKYDHQLPIEILEGEDVTFPCIPTDLEYVL
FT                   TEILKNSSRAHIENSVPENNTAEKPIEVTIVRNDNDLKIRIRDFGGGIPPDVEDRMFDY
FT                   SYSTVNSDAKDSGMSAYVIPGEDVCNVSGMGFGLPMCKAYMEMFGGSVDIQSLWGWGTD
FT                   AYICLKGPSPNLLK"
FT   gene            complement(<331257..>331772)
FT                   /locus_tag="KLTH0A03938g"
FT                   /old_locus_tag="KLTH-ORF16599"
FT   CDS_pept        complement(331257..331772)
FT                   /locus_tag="KLTH0A03938g"
FT                   /old_locus_tag="KLTH-ORF16599"
FT                   /product="KLTH0A03938p"
FT                   /note="weakly similar to uniprot|P40033 Saccharomyces
FT                   cerevisiae YER050C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21185"
FT                   /db_xref="GOA:C5DBM8"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBM8"
FT                   /protein_id="CAR21185.1"
FT                   /translation="MLSLRTSWHVSIPKRAFTSGIPKQNLSFKIKLTPNEKSQINVKAR
FT                   DPGSASSQPKRIDPRLVKKFQSGTTYDPFDFSLARLHLDKKFSSKNSSNDLFDKNGVDP
FT                   LDLYTNPEFLSQFVTSSGKILHRDVTGLSAKNQRRLSKAIRRCQAIGLMSKTHRDVSYL
FT                   PSRIMGKI"
FT   gene            <332436..>333842
FT                   /locus_tag="KLTH0A03960g"
FT                   /old_locus_tag="KLTH-ORF16597"
FT   CDS_pept        332436..333842
FT                   /locus_tag="KLTH0A03960g"
FT                   /old_locus_tag="KLTH-ORF16597"
FT                   /product="KLTH0A03960p"
FT                   /note="similar to uniprot|P40034 Saccharomyces cerevisiae
FT                   YER051W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03960g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21186"
FT                   /db_xref="GOA:C5DBM9"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBM9"
FT                   /protein_id="CAR21186.1"
FT                   /translation="MTKDVCSYCSSDGADGAVWVQCEVCDQWVHVTCIPIKYLTNEMRE
FT                   PLDSYPKLARQIKRFSCSAHGSPVLEVKSTSKKRKIEPTAPAKVGKRQGLRKKKQVDYI
FT                   SLNEGDDKRLKDEHPHMHAFLACFSKWENKTNVIESSRLERDFNAITIPMKVQDPENSG
FT                   MRIPEYSEGRAFTVDTVTKFLGADYPVDVMDVQSQQNSTWSMSQWNQYFTETAADARDR
FT                   IRNVISLEVSHVDQFKTGLRRPRVVESHDLVDLLWEEVKDDIPRPKVTKYVLMSVGNAY
FT                   TDFHLDFAGTSVYYKVIFGSKKFILFPPTPHNLKAYESWCGNDHQNLIFLGDQLEQGVA
FT                   MELRAGDLFMIPSGFIHAVFTPQDSLVVGGNFLTLRDLATQLVVTEIEKLTKVPKKFTF
FT                   PQFEAVMGKTAELTLQKSGTDEDLALSIEKEEALLEYIKTPTFKYKPVNFSTKRELISQ
FT                   FQKHIEARSD"
FT   gene            <334027..>334890
FT                   /locus_tag="KLTH0A03982g"
FT                   /old_locus_tag="KLTH-ORF16595"
FT   CDS_pept        334027..334890
FT                   /locus_tag="KLTH0A03982g"
FT                   /old_locus_tag="KLTH-ORF16595"
FT                   /product="KLTH0A03982p"
FT                   /note="similar to uniprot|P38626 Saccharomyces cerevisiae
FT                   YIL043C CBR1 cytochrome b reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21187"
FT                   /db_xref="GOA:C5DBN0"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBN0"
FT                   /protein_id="CAR21187.1"
FT                   /translation="MDSLPFDSKTLLIGGFVAFFVITLASRFLGSKKAIPVLIKDQYQE
FT                   FPLVSKTVLTHNTAVYRFGLPKQSDVLGLPIGQHISIKGNLPDGKEIMRSYTPTSLDSD
FT                   SVGFFELLIKSYDQGNVSKMIGELQIGDKIKVRGPKGFYTYTPNMNSEIGMIAGGTGIA
FT                   PMYQIIKAIHSDPKDRTKVSIVYGSQTEDDILLKKELDAIVESNPEQFKVHYLLDKPAR
FT                   DTWTGGVGYVTPDVMKSYLPAPGPGAQLLVCGPPGMVSSVKKNAVALGFEKAKPVSKMG
FT                   DQVFVF"
FT   gene            complement(<335054..>336622)
FT                   /locus_tag="KLTH0A04004g"
FT                   /old_locus_tag="KLTH-ORF16594"
FT   CDS_pept        complement(335054..336622)
FT                   /locus_tag="KLTH0A04004g"
FT                   /old_locus_tag="KLTH-ORF16594"
FT                   /product="KLTH0A04004p"
FT                   /note="highly similar to uniprot|P10869 Saccharomyces
FT                   cerevisiae YER052C HOM3 Aspartate kinase (L-aspartate 4-P-
FT                   transferase) cytoplasmic enzyme that catalyzes the first
FT                   step in the common pathway for methionine and threonine
FT                   biosynthesis expression regulated by Gcn4p and the general
FT                   control of amino acid synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21188"
FT                   /db_xref="GOA:C5DBN1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBN1"
FT                   /protein_id="CAR21188.1"
FT                   /translation="MALQTNWIVQKFGGTSVGKFPEQIVDEIVKVYTTQFKNNVAVVCS
FT                   ARSSDTKAEGTTSRLLRACDLVCNSDPSFAEVLQKVRDDHISNAKQRISNPELQKKLIQ
FT                   DTIAELDLVEKYLNASQVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEHGVPAQYVDLS
FT                   SVIPHDYECRQGTLDTSFYTFLVMAFKEKLQPVLDLHAKGEPVVPVITGFFGLVPMGLL
FT                   NGVGRGYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELT
FT                   YYGSEVIHPFTMEQVIRAKIPIRIKNVQNPRGDGTVIYPDNVAKKGESTPPHPPVTLSN
FT                   SFFEQRRRGATAITSKSDIYVVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVH
FT                   VSMALPVPDNDSAKALKKAVEELKKLGSVELTKKLVIISLVGKQMKQFIGIAGTMFTTL
FT                   AEQGINIEMISQGANEINISCVIDEDNAIKALQSIHSKLLDLNTEVELGKAVNEKLEQI
FT                   KRLAL"
FT   gene            complement(<337200..>337901)
FT                   /locus_tag="KLTH0A04026g"
FT                   /old_locus_tag="KLTH-ORF16592"
FT   CDS_pept        complement(337200..337901)
FT                   /locus_tag="KLTH0A04026g"
FT                   /old_locus_tag="KLTH-ORF16592"
FT                   /product="KLTH0A04026p"
FT                   /note="weakly similar to uniprot|P40312 Saccharomyces
FT                   cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
FT                   sterol and lipid biosynthesis pathways"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21189"
FT                   /db_xref="GOA:C5DBN2"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBN2"
FT                   /protein_id="CAR21189.1"
FT                   /translation="MPLESQKKVRFCLEKEEQDLGAAEHTVLEQPPVISREELATHTSA
FT                   EDCWLAIHGAVYDVSRYLTQHPGGAQVMLKLAGKDATAQFDDVGHSMESLMFDLGSGAC
FT                   VGVLKARPVTTALSTPQKQQQASEFAPEHSSYWEQLWTWVKHVPETPLGFRNLKWATGE
FT                   LRSRNPSVYKGDAEVRRELNALAIAVVMGVCIIMLVYVKLRCPSMMEHVVLGALPEEMA
FT                   GENFDIPSWSL"
FT   gene            <339253..>340128
FT                   /locus_tag="KLTH0A04048g"
FT                   /old_locus_tag="KLTH-ORF16590"
FT   CDS_pept        339253..340128
FT                   /locus_tag="KLTH0A04048g"
FT                   /old_locus_tag="KLTH-ORF16590"
FT                   /product="KLTH0A04048p"
FT                   /note="similar to uniprot|P40529 Saccharomyces cerevisiae
FT                   YIL044C AGE2 ADP-ribosylation factor (ARF) GTPase
FT                   activating protein (GAP) effector ARF GAP with effector
FT                   function(s)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21190"
FT                   /db_xref="GOA:C5DBN3"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBN3"
FT                   /protein_id="CAR21190.1"
FT                   /translation="MSNFLWKLQKSGSRIGPMSSPAIKKALAALLRDPNNSTCADCKTA
FT                   GHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWQEEHMRKVVEFGNNAAANA
FT                   VYECKLSGNHTPEASKIADFIRNKYELKKWIGNAAEVSAPPSRPKTVEKKPQVAQQAHG
FT                   SQTSLVSQTSSAPSRSATSSQVDLNLASPSVASRTTLNAAAREPSGRPDLKKSILSLYS
FT                   RPRTSTASVASGASNASFSSSTGTPSIASNSTPAAGYPLPGASFSLPAQTNTTSSASLE
FT                   DNDLFKNVWS"
FT   gene            complement(<340333..>341373)
FT                   /locus_tag="KLTH0A04070g"
FT                   /old_locus_tag="KLTH-ORF16585"
FT   CDS_pept        complement(340333..341373)
FT                   /locus_tag="KLTH0A04070g"
FT                   /old_locus_tag="KLTH-ORF16585"
FT                   /product="KLTH0A04070p"
FT                   /note="similar to uniprot|P40035 Saccharomyces cerevisiae
FT                   YER053C PIC2 Mitochondrial phosphate carrier imports
FT                   inorganic phosphate into mitochondria functionally
FT                   redundant with Mir1p but less abundant than Mir1p under
FT                   normal conditions expression is induced at high
FT                   temperature"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21191"
FT                   /db_xref="GOA:C5DBN4"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBN4"
FT                   /protein_id="CAR21191.1"
FT                   /translation="MVRSQLRDYISERPRQLPGRLPVHPLEPRSRPRPHSALMSQNSSI
FT                   FNSPKLYSPDYYAACTIGGLVACGPTHSAVTPLDLVKCRRQVDSSLYKSNLEGWRQIIK
FT                   TEGGVGKIFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHQYRTGIFLAASA
FT                   SAEFIADLFLCPWEAIKVRQQTAVPPPFARNVFEAYSKMVGAEGFASLYKGITPLWCRQ
FT                   IPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQIGVSFAGGYLAGILCAVVSHPADVM
FT                   VSKVNNERKKGESMMEATSRIYAKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKATV
FT                   GLPTTG"
FT   gene            complement(<342925..>344223)
FT                   /locus_tag="KLTH0A04092g"
FT                   /old_locus_tag="KLTH-ORF16577"
FT   CDS_pept        complement(342925..344223)
FT                   /locus_tag="KLTH0A04092g"
FT                   /old_locus_tag="KLTH-ORF16577"
FT                   /product="KLTH0A04092p"
FT                   /note="weakly similar to uniprot|P40036 Saccharomyces
FT                   cerevisiae YER054C GIP2 Putative regulatory subunit of the
FT                   protein phosphatase Glc7p proposed to be involved in
FT                   glycogen metabolism contains a conserved motif (GVNK motif)
FT                   that is also found in Gac1p Pig1p and Pig2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21192"
FT                   /db_xref="InterPro:IPR005036"
FT                   /db_xref="InterPro:IPR038175"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBN5"
FT                   /protein_id="CAR21192.1"
FT                   /translation="MYIRRPPSDTNGDVMNRSLAFLHKPQRVSQPKPFAEESLRRNTDL
FT                   NRGKVQVNEMHDDYFSSQTPASADGSVAGDVSSQLRVNPYFPANENYYYNSSGDGDDAD
FT                   NEPPPLVRKKSGEVVRSNLKLAQRSRSLPATPSGREPDKRIGAPPPGPQRSKSVHFDQR
FT                   DVVKFKYFWQEDSPLDVASQDVLEGPLDEDPHTLTLQADAAVRSDGSDAEPRDLTMTMS
FT                   NLQIEKRMSSGLRRSKRYQRLRSKGAEKDGATKPGLYRENFATLSDDDQSSLKSNIFLN
FT                   IAHNSYCFLQDLSLIADQHYLVGHVLVKNIFYDKEVVVRYTRDHWRTVHEVECVWESSG
FT                   DDVLPGMGMDRFKLVIDLATLGDDGGAAPRAPRAGPAAAFALVKLEFCIRYTTRSSHER
FT                   VEHWDNNGGRNYVVDVVCAAQRMGFTDPFGPPH"
FT   gene            complement(<344618..>346594)
FT                   /locus_tag="KLTH0A04114g"
FT                   /old_locus_tag="KLTH-ORF16573"
FT   CDS_pept        complement(344618..346594)
FT                   /locus_tag="KLTH0A04114g"
FT                   /old_locus_tag="KLTH-ORF16573"
FT                   /product="KLTH0A04114p"
FT                   /note="similar to uniprot|P39014 Saccharomyces cerevisiae
FT                   YIL046W MET30 F-box protein containing five copies of the
FT                   WD40 motif controls cell cycle function sulfur metabolism
FT                   and methionine biosynthesis as part of the ubiquitin ligase
FT                   complex interacts with and regulates Met4p localizes within
FT                   the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21193"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBN6"
FT                   /protein_id="CAR21193.1"
FT                   /translation="MSQSNHSASNKTTITVEDKHIGTCIKGIKKLESLPWRRRRKLTVM
FT                   LEEFPNQMGALIKPEVRSTQSTNMHAKEEAPDAANSSVVASGRLNGKRGLEEYEEDQPS
FT                   TAEVSSEASAQNVNKRRRGLPQYNFLRFCYRHNPDIQQSPTHTACRKQDQQRHSLLQRK
FT                   IEKLEPEEQRQVQNVLSTFTSCNDKMRKLLLEGMLTNCCFPQLSFVASEVQNMIKIDFI
FT                   STLPEEVSLKILGYLDCESLCNAARVCRRWKQLADDDKVWYHMCQQHIDRKCPNCGWGL
FT                   PLLHMKRARFIDSTEQKSDPKDACATAAASGGHRKTRPWKVIYRERFKVESNWRKGAAH
FT                   IQDFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKTLYFDDQ
FT                   KLITGSLDRTIRVWNYVTGACVSTYRGHSDSVLSVDSYKKIIVSGSADKTVKMWHVESR
FT                   TCYTLRGHSEWVGCVKLHPKSFTCFSGSDDTTIRMWDIRSNTCLKVFRGHVGQVQKVLP
FT                   LNILDTENLVTDPASEAQRNDEPAANDPSEGQLAPLDDSLPYPSHLLSCSLDNTIKLWD
FT                   VRTGKCVRTHFGHLEGIWDIAADNFRIISGAHDKTVKVWDLQSGKCIHTFDSHHAPITC
FT                   VGIGDSEFVSGDELGCVKLHRFD"
FT   gene            complement(<347041..>348000)
FT                   /locus_tag="KLTH0A04136g"
FT                   /old_locus_tag="Klth0A.mRNA.3024.m"
FT   CDS_pept        complement(join(347041..347882,347949..348000))
FT                   /locus_tag="KLTH0A04136g"
FT                   /old_locus_tag="Klth0A.mRNA.3024.m"
FT                   /product="KLTH0A04136p"
FT                   /note="highly similar to uniprot|P00498 Saccharomyces
FT                   cerevisiae YER055C HIS1 ATP phosphoribosyltransferase a
FT                   hexameric enzyme catalyzes the first step in histidine
FT                   biosynthesis mutations cause histidine auxotrophy and
FT                   sensitivity to Cu Co and Ni salts transcription is
FT                   regulated by general amino acid control"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21194"
FT                   /db_xref="GOA:C5DBN7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBN7"
FT                   /protein_id="CAR21194.1"
FT                   /translation="MDLVNHLNDRLLFAIPKKGRLYEKAVSILKGSDIRFHRSQRLDIA
FT                   LSTNMPIALIFLPAADIPMFVGEGKCDLGITGVDQVKESQVDVLLPMDLQFGACKLQVQ
FT                   VPEAGPYQKPEQLIGKTIVSSFTQLTKEYFAELEGVPIDQITTKIRYVGGSVEASCALG
FT                   IADAIVDLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDTELLQTIKSRIEGVMTA
FT                   QKYVSCNYNVPVSCLPQVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKK
FT                   NGAADIMVFEISNCRV"
FT   gene            <348896..>351466
FT                   /locus_tag="KLTH0A04158g"
FT                   /old_locus_tag="KLTH-ORF16561"
FT   CDS_pept        348896..351466
FT                   /locus_tag="KLTH0A04158g"
FT                   /old_locus_tag="KLTH-ORF16561"
FT                   /product="KLTH0A04158p"
FT                   /note="similar to uniprot|P40528 Saccharomyces cerevisiae
FT                   YIL047C SYG1 Protein for which truncation and
FT                   overexpression can suppress lethality of G-alpha protein
FT                   deficiency plasma membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04158g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21195"
FT                   /db_xref="GOA:C5DBN8"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="InterPro:IPR033507"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBN8"
FT                   /protein_id="CAR21195.1"
FT                   /translation="MKFAEHLRESAVPEWIDKYIDYKKGKKKIKACRNTIAASEVLVNN
FT                   VSTTNSVAMYRDSSSSSRYNSQNVYSPVQRRFVQEFIDKWVIDQELEKCNDFYLWEFKR
FT                   CSRRFAILREQIERFEAHRTQLTVTESDPKYYGAVDRDERVVPAKSRKRSSWATRTFRT
FT                   LQDLELIPSLPSLKPFKQLFLNEPDTNSLSVGYGDTFAPSSLTTNQIQHRLSDALIEFY
FT                   LLVQLIKNYRDINVTGFRKIVKKFDKSCGTRELFSFIEYAKSSYPLFQHAEANARMVAQ
FT                   QIHDSVATRTSAASSNDPNFEDPLVVWEHEVTTWYTDVLSSSAKDRKRKIERIKNLSLE
FT                   YSLNEQKVHRFNKSILQVFVGGVLMGGSLTLVAYTLWVGFKAPSSSKIHHILLPLWGGW
FT                   YMVFLITFLFLLNCFIWHRSNVNYRFIMFGEMHSRRGAVLFNNDFSTTQIPILFYFASV
FT                   LAFPMTLLGALSFYENALDPFAIIWIVLVSVLFFLPLFGKTPYLNLPYWNKLTKSVRWI
FT                   LVSFVRLIFSGFYPVQFGDFFLGDIFCSLTYSLADIAMFFCIYSPTPNGMCGSSHSKAM
FT                   GAMTCLPNFWRFMQCLRRFSDSGDWFPHLVNGVKYSMSVLYYASLCAYRIGHTRNRRNV
FT                   FIIFATLNATCTAIWDIIMDWSLLQPGSKNWLLRDDLYLAGRKNWKTGAYSRKRKSVYY
FT                   LAMVWDVSMRFQWIVYAIAPDTIQQSAITSLVLAVLEVGRRFVWIIFRVENEHVANVHL
FT                   FKVSGEATLPFPSTVEGDVETEGSIASNHYAMSEVSYPAMPSPTPMYRGESLQKSTGSN
FT                   GLLRTLSSSIPWAHAQDFQRPRGFSIVDHSHESDASESEAESML"
FT   gene            complement(<351562..>354954)
FT                   /locus_tag="KLTH0A04180g"
FT                   /old_locus_tag="KLTH-ORF16560"
FT   CDS_pept        complement(351562..354954)
FT                   /locus_tag="KLTH0A04180g"
FT                   /old_locus_tag="KLTH-ORF16560"
FT                   /product="KLTH0A04180p"
FT                   /note="highly similar to uniprot|P40527 Saccharomyces
FT                   cerevisiae YIL048W NEO1 Protein involved in the retrograde
FT                   transport from the Golgi complex to the ER and the
FT                   endosomal membrane traffic putative aminophospholipid
FT                   translocase member of the highly conserved Drs2 family of
FT                   P-type ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04180g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21196"
FT                   /db_xref="GOA:C5DBN9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBN9"
FT                   /protein_id="CAR21196.1"
FT                   /translation="MSFTPPPGSNKEPAAPANRHNSFDLLDPQFEDSLDAALESLQIHS
FT                   EGAPTGEDFEMKSIASNDNHNAGLHSDTQPLINDGLGPNDSWSRGSRNSHSAEHRQPFW
FT                   SRITGIVRSSSTPRSSKYKSTGKSIQLTDQQLEREIHPGTTPIYDKYKYAANAVSNAKY
FT                   NPVTFIPVILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLIVTMSKEAL
FT                   DDIQRRRRDSEANNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLILLQSSEPSG
FT                   EIFIKTDQLDGETDWKLRIASPLTQHLSQEDLLHKINITASVPEKSIHNFLGKLTFNDS
FT                   QSQPLSVDNTMWANTVFASTGTAVACVVYTGSDTRQAMNTTMSSVKTGLLELEINSLSK
FT                   ILCVCVFILSVALVAFAGFNNSDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYQIE
FT                   HDATIPDTIVRTSTIPEDLGRIEYLLTDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVT
FT                   DYVRGMTSGADSTVLPSASKKDLPSRVRDLVLALALCHQVTPTFEDGELTYQAASPDEI
FT                   AIVKFTESVGLTLFKRDRHSITLLHDQSGSYFDFDIVQVFPFNSDNKRMGIIIFDKQKQ
FT                   EHWFFQKGADVVMSKIVQTNDWLEEETGNLAREGLRTLVIGRKKLSQKVFDNFTKEYKD
FT                   ASLTMLNREALMSNVVKKHLEHNLEILGLTGVEDKLQHDAKSSIELLRNAGIKIWMLTG
FT                   DKVETARCVSISAKLVSRGQYVHTVTKIGKPEGALGQLELLKINQNSCLLIDGESLATY
FT                   LEYYRQEFFEIVVHLPAVIACRCTPQQKADVATFIREATGKRVCCIGDGGNDVSMIQAA
FT                   DVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISV
FT                   CQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELT
FT                   AGKSLSYKTFFVWVALSVFQGCVIQGFSQAFTSLDQLDFKRLVALSFTVLIINELIMVA
FT                   IEIYTWNKTMIICEILTFLVFVGSIPLLGDYFDLHFMTQPNFYAKLALILGLSVVPVWT
FT                   AKALHRKLNPPSYAKVQQFYFNA"
FT   gene            complement(<355181..>355970)
FT                   /locus_tag="KLTH0A04202g"
FT                   /old_locus_tag="Klth0A.mRNA.3001.m"
FT   CDS_pept        complement(join(355181..355515,355934..355970))
FT                   /locus_tag="KLTH0A04202g"
FT                   /old_locus_tag="Klth0A.mRNA.3001.m"
FT                   /product="KLTH0A04202p"
FT                   /note="highly similar to uniprot|P40525 Saccharomyces
FT                   cerevisiae YIL052C RPL34B Protein component of the large
FT                   (60S) ribosomal subunit, nearly identical to Rpl34Ap and
FT                   has similarity to rat L34 ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04202g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21197"
FT                   /db_xref="GOA:C5DBP0"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="InterPro:IPR038562"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBP0"
FT                   /protein_id="CAR21197.1"
FT                   /translation="MAQRVTFRRRNPYNTRSNKIKVVKTPGGVLRAQHTKKLATRPKCG
FT                   DTGVPLQGVSTMRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFLIEEQKIVKKV
FT                   VKEQAESAKTTGKKKSRKN"
FT   gene            complement(<356660..>357085)
FT                   /locus_tag="KLTH0A04224g"
FT                   /old_locus_tag="KLTH-ORF16553"
FT   CDS_pept        complement(356660..357085)
FT                   /locus_tag="KLTH0A04224g"
FT                   /old_locus_tag="KLTH-ORF16553"
FT                   /product="KLTH0A04224p"
FT                   /note="highly similar to uniprot|P40185 Saccharomyces
FT                   cerevisiae YIL051C MMF1 Mitochondrial protein involved in
FT                   maintenance of the mitochondrial genome and similar to
FT                   YER057C uniprot|P40037 Saccharomyces cerevisiae YER057C
FT                   HMF1 Member of the p14.5 protein family with similarity to
FT                   Mmf1p, functionally complements Mmf1p function when
FT                   targeted to mitochondria; heat shock inducible; high-
FT                   dosage growth inhibitor; forms a homotrimer in vitro"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21198"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBP1"
FT                   /protein_id="CAR21198.1"
FT                   /translation="MFLRNAARQTFRTMSTLTPVRTQLSPPPAASYSQAMKVNNMVFVS
FT                   GQIPYTAENKRVEGTMTDKAEQVIQNVKNILEEANSALNKIVKVNIFLADINDFAEFNG
FT                   VYGKYFNEHKPARSCVAVKDLPLNVDLEMEVVAVEKE"
FT   gene            <357173..>357541
FT                   /locus_tag="KLTH0A04246g"
FT   CDS_pept        357173..357541
FT                   /locus_tag="KLTH0A04246g"
FT                   /product="KLTH0A04246p"
FT                   /note="similar to uniprot|Q02771 Saccharomyces cerevisiae
FT                   YER058W PET117 Protein required for assembly of cytochrome
FT                   c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21199"
FT                   /db_xref="InterPro:IPR031568"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBP2"
FT                   /protein_id="CAR21199.1"
FT                   /translation="MKSQYIRRTNIFRHTMSTASKITLALSCAVTAATVVGVHYVQELE
FT                   RETLHQGPIKDAKRMAERKAEQSAGAGAVSAESERKQHFNRSEHELQQELRKKYEAMQP
FT                   LSGEVLTKDGERAARDEK"
FT   gene            <358035..>359777
FT                   /locus_tag="KLTH0A04268g"
FT                   /old_locus_tag="KLTH-ORF16548"
FT   CDS_pept        358035..359777
FT                   /locus_tag="KLTH0A04268g"
FT                   /old_locus_tag="KLTH-ORF16548"
FT                   /product="KLTH0A04268p"
FT                   /note="similar to uniprot|P40186 Saccharomyces cerevisiae
FT                   YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms a
FT                   functional kinase complex with Pho85p which phosphorylates
FT                   Mmr1p and is regulated by Pho81p involved in glycogen
FT                   metabolism expression is cell-cycle regulated"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21200"
FT                   /db_xref="GOA:C5DBP3"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBP3"
FT                   /protein_id="CAR21200.1"
FT                   /translation="MYEEAPTQSAPNFTKGERAPAVTTSDFEAPKHPKTYRSVKYPYRN
FT                   ITFLEEIPEFHTHTHTHMPPRPSFLEQVSENTPKTKARPMLIPRRVSTVHTEGPTSVTE
FT                   ETISSSHSSESLMNGEDSPASRQTVGIAGGGVAVGPHGARLADSPAAGVASVRSDSVAS
FT                   RMRPMLQRMGSSYSRGSFVGKNGSFISTSLSDDGGSGGGSNTGETPGLFEAVCDSSDLE
FT                   RDHDHDYDHEHDHDHEHNDEHNHARAQSRGHGHCHDHDHTHGQTTPEDRETTLPSSVPR
FT                   GSAPIDISTAPMAKTLSSKYFQESVHDDDYLQNFTPFHNTPTSVSNSYSTNATGSDLMA
FT                   RRLAHPPAADPEPRLSDDPALVYIAEFPTDKLLSMLTALLDKIVRSNDQLSRDRPFDED
FT                   QFLARAADATATASASADAPAAGCAGHDLAAEILSFRGKHVPAITLHQYFQRIQKYCPT
FT                   TNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRY
FT                   ARVGGISLKELNHLELQFLVLCDFELIISVEELQKYSNLLRDFWHREMGDAPEAETAAP
FT                   EHVL"
FT   gene            <361064..>362614
FT                   /locus_tag="KLTH0A04290g"
FT                   /old_locus_tag="KLTH-ORF16534"
FT   CDS_pept        361064..362614
FT                   /locus_tag="KLTH0A04290g"
FT                   /old_locus_tag="KLTH-ORF16534"
FT                   /product="KLTH0A04290p"
FT                   /note="similar to uniprot|P17064 Saccharomyces cerevisiae
FT                   YER056C FCY2 Purine-cytosine permease mediates purine
FT                   (adenine guanine and hypoxanthine) and cytosine
FT                   accumulation and similar to uniprot|P40039 Saccharomyces
FT                   cerevisiae YER060W FCY21 Putative purine-cytosine permease"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04290g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21201"
FT                   /db_xref="GOA:C5DBP4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBP4"
FT                   /protein_id="CAR21201.1"
FT                   /translation="MSTGKEEYEIQDVEKQSRSRLELSDDDSQPIVETSEHTRLSFVDR
FT                   MAAKLRAETKGIEPITDEEKDDNSILNAASMWFSANMVIAAFALGVLGPCIFGLNFFGC
FT                   LLAVLIFATLGILPVAFFSVFGAELGLRQMVLSRYLLGNATARIFALINVIACVGWGAV
FT                   NTIASAQLLHMVNPGGARCPPWAGCIIIVVSTIIVTFFGYRVIHAYEKFSWIPNFAVFL
FT                   VIIARLKIDGSFTVGPWVSGTAGAASVLSFGGVIFGFASGWTTYAADYTVYMPRSTNKP
FT                   KVFFFVLVGLMFPLCFAILLGSACAMATFNNKSYASYYADEGTGGLIFAILVDKSLHGF
FT                   GQFCCVLLAMSTVANNIPNMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYY
FT                   KFESFMTNFMDAIAYYLAIYIGISITEHFVFRKGKFSNYNVDDWDSWARLPLGIAGCCA
FT                   LFVGAVGVAVGMEQTYWTGEIARKIGTFGADIGLELGFGFSVIVYLALRPLELKFIGR"
FT   gene            <362792..>363535
FT                   /locus_tag="KLTH0A04312g"
FT                   /old_locus_tag="KLTH-ORF16529"
FT   CDS_pept        362792..363535
FT                   /locus_tag="KLTH0A04312g"
FT                   /old_locus_tag="KLTH-ORF16529"
FT                   /product="KLTH0A04312p"
FT                   /note="similar to uniprot|P40526 Saccharomyces cerevisiae
FT                   YIL049W DFG10 Protein of unknown function involved in
FT                   filamentous growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21202"
FT                   /db_xref="GOA:C5DBP5"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR039698"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBP5"
FT                   /protein_id="CAR21202.1"
FT                   /translation="MDLNPRSLFELAFYSSFLLAITSVLLAKWRLPTLLKYGKTLQGVP
FT                   SKGGILGSLQSLTVPKKWFGHFYVYSTALALLNVCFLRGFASLLVLTHSARRLYETRCV
FT                   SKFGKDSRIHLSHYLVGLWFYTAVNCAVFVDRTRTRSPLARLVAVIVFVLSSLDQYRNH
FT                   LHLSKLVKYTLPTYGLFQLVSSPHYFDEILIYLSLAIYTSSLKMFLCLVWVIVNLSTSA
FT                   LETRSWYAKKFPRAAPSFAIIPYLL"
FT   gene            complement(<363572..>364846)
FT                   /locus_tag="KLTH0A04334g"
FT                   /old_locus_tag="KLTH-ORF16525"
FT   CDS_pept        complement(363572..364846)
FT                   /locus_tag="KLTH0A04334g"
FT                   /old_locus_tag="KLTH-ORF16525"
FT                   /product="KLTH0A04334p"
FT                   /note="similar to uniprot|P39525 Saccharomyces cerevisiae
FT                   YER061C CEM1 homology with beta-keto-acyl synthases Protein
FT                   homologous to beta-keto-acyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21203"
FT                   /db_xref="GOA:C5DBP6"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBP6"
FT                   /protein_id="CAR21203.1"
FT                   /translation="MSTRVVVTGLGALTPLGKTVAESWAALLAGKSGIRPIGELANAES
FT                   YERHCPPSLAVADVKEFDPHAYGNLFTSQDLRRMSQFTQFAVVAAQEALRDANLIETLQ
FT                   KGRNDRVGCVIGSGIASVHDMYDSIVEFDRGKRLSPSFVPKILSNMACGNVSIKFQLRG
FT                   VSHCVSTACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLALAGFLRAKSITPSGI
FT                   SRPFDKERNGFVLGEGAGLLVLESLKHAQDRGARIYAEVEGYGLTSDAHHITSPSENGD
FT                   GARRAMEMALNNQTRSQVDYVNAHATSTVLGDRAEAQAISNILSGDGKDAIKVSSNKGA
FT                   IGHLLGAAGAVESIFTIKSLQDGVVPHTLNLHSVGGASGDEAENFERLDLVRGAPAKHD
FT                   IRRALNNSFGFGGINSSIVFRRWEV"
FT   gene            complement(<365149..>365898)
FT                   /locus_tag="KLTH0A04356g"
FT                   /old_locus_tag="KLTH-ORF16523"
FT   CDS_pept        complement(365149..365898)
FT                   /locus_tag="KLTH0A04356g"
FT                   /old_locus_tag="KLTH-ORF16523"
FT                   /product="KLTH0A04356p"
FT                   /note="similar to uniprot|P40106 Saccharomyces cerevisiae
FT                   HOR2 and to YIL053W uniprot|P41277 Saccharomyces cerevisiae
FT                   RHR2, two redundant DL-glycerol-3-phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21204"
FT                   /db_xref="GOA:C5DBP7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBP7"
FT                   /protein_id="CAR21204.1"
FT                   /translation="MSSSKPISLKVNAALFDVDGTIIISQPATNAFWRDFAKDKPYFIV
FT                   DEVLKVSHGCRTFDTISRFAPDFADEAKIVEMETQIPAKYGEHSIEVPGAVNLCHALNT
FT                   LPKEKWAVATSGTRGLAVQWFKLLGITMPTYFITANDVKQGKPHPEPYLKGRNGLGYPV
FT                   NEKEPSKSKAIVFEDAPAGIAAGKAAGCKVIGIATTFDLDYLKKHDCDIIVEDLSTVRI
FT                   GSYDAETDEVEFIFSDYLYAKDDVLTW"
FT   gene            complement(<366491..>367240)
FT                   /locus_tag="KLTH0A04378g"
FT                   /old_locus_tag="KLTH-ORF16518"
FT   CDS_pept        complement(366491..367240)
FT                   /locus_tag="KLTH0A04378g"
FT                   /old_locus_tag="KLTH-ORF16518"
FT                   /product="KLTH0A04378p"
FT                   /note="highly similar to uniprot|P40106 Saccharomyces
FT                   cerevisiae HOR2 and to YIL053W uniprot|P41277 Saccharomyces
FT                   cerevisiae RHR2, two redundant DL-glycerol-3- phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21205"
FT                   /db_xref="GOA:C5DBP8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBP8"
FT                   /protein_id="CAR21205.1"
FT                   /translation="MPLSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDA
FT                   EHVIHESHGWRTYDAIAKFAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCNDLNA
FT                   LPKEKWAVATSGTRPMASKWFEHLGIAKPKYFITANDVKQGKPFPEPYIKGRDGLGFPI
FT                   NEKDPSKSKVIVFEDAPAGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRV
FT                   GGYDPKTDEVEFIFDDYLYAKDDLLQW"
FT   gene            <368443..>369036
FT                   /locus_tag="KLTH0A04400g"
FT                   /old_locus_tag="KLTH-ORF16509"
FT   CDS_pept        368443..369036
FT                   /locus_tag="KLTH0A04400g"
FT                   /old_locus_tag="KLTH-ORF16509"
FT                   /product="KLTH0A04400p"
FT                   /note="some similarities with uniprot|P40040 Saccharomyces
FT                   cerevisiae YER063W THO1 Suppressor of the Transcriptional
FT                   (T) defect of Hpr1 (H) by Overexpression (O); (putative)
FT                   involved in transcription"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21206"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="InterPro:IPR040746"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBP9"
FT                   /protein_id="CAR21206.1"
FT                   /translation="MAPMAAYAKRTVPELRKELESRQLSHDGNKPDLIARLEAHDAAQA
FT                   AVEPPTAATAQEEPAPEPEAQPETQPEAQPAPESAPEPAPESAPAQPAQEHQASPAPRK
FT                   PSPEEAKALALADLELKLRRAKKFADDQSTIDSLQRQIARVHKFGVDPTTQLARDLGLG
FT                   SGPASAAPKSANRPRSRRRKANPQSKSTKHARSN"
FT   gene            <369616..>370812
FT                   /locus_tag="KLTH0A04422g"
FT                   /old_locus_tag="KLTH-ORF16504"
FT   CDS_pept        369616..370812
FT                   /locus_tag="KLTH0A04422g"
FT                   /old_locus_tag="KLTH-ORF16504"
FT                   /product="KLTH0A04422p"
FT                   /note="some similarities with uniprot|P40523 Saccharomyces
FT                   cerevisiae YIL055C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21207"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBQ0"
FT                   /protein_id="CAR21207.1"
FT                   /translation="MEQPETRVAYIRIDNLPPGKTWRQVKYLVGGMIHHTSILQVKMLP
FT                   PVQSIVPPFIPFQSSIVSLKRSDAQLSRLLMELNGYTWEYYPLVAYAVPPLHVPSNAGY
FT                   GEGLGLGFGLGSGSAGGSAGTGGSRSGSDVPGSPRAPGSAPVPPMMMPFQPMPAMYFPP
FT                   LAQEPYARHVQSHGKKMRQVFSEESFRKQMSARGMWQLLLEGFPPCLHWDVNGADGAGL
FT                   QQSPLLGPPPAVHVKTAHPEHFGKLKWTVLKDFIKLKCHKLLEMDNMGATTNTREFYVG
FT                   VYEDCEVRTDVEVPEQDAGQEPNGVEASDESPEESTSETATTASAKGSAENELEKATQS
FT                   ISRLSLGPSHRVVSATIYKAIVGFHSRELCDMCRESLQGQEYSLGYKLKVTELPLLEW"
FT   gene            complement(<371219..>373240)
FT                   /locus_tag="KLTH0A04444g"
FT                   /old_locus_tag="KLTH-ORF16501"
FT   CDS_pept        complement(371219..373240)
FT                   /locus_tag="KLTH0A04444g"
FT                   /old_locus_tag="KLTH-ORF16501"
FT                   /product="KLTH0A04444p"
FT                   /note="similar to uniprot|P40522 Saccharomyces cerevisiae
FT                   YIL056W Hypothetical ORF and to uniprot|P40041
FT                   Saccharomyces cerevisiae YER064C Non-essential nuclear
FT                   protein; null mutation has global effects on transcription"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21208"
FT                   /db_xref="InterPro:IPR007147"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBQ1"
FT                   /protein_id="CAR21208.1"
FT                   /translation="MIKPPRVQKPSSSGTTHKIRKQLNFTDERRWKQFSSRRLELIEKF
FT                   GLGERKASEQDKSIRQIATILRTEFGYPLSSSSEFEKLVTAAVQSVRRNRKRSSKSKPS
FT                   NPQAQESVLEPFPVMTTTRESSGTDNLFFDRDGDQFARADRYTSGSNSSSSPPESSLTS
FT                   FISHNQTLPTLFSHSGQRSGPTKNASTLGAVPHALPHLQPKPLSSSNKPVGDCENPGSS
FT                   IVTAHTQNYDEVIKAVIADMVQNRVALHVQSRNDEVTPNLADFALSSNDGNLLNIAFQS
FT                   HVAPSNPHTTAYPKARNPSGNDSNESKIPFFLREKILLHVQRSRACLEVSTAQGSLELY
FT                   TNLSILGETSVKASVAFVMERFFSNLSSSSMEYVTSKLCSDQELALISVRIFGPATERH
FT                   FDQLPHGAQLKLFYIVIGGIIKDFGFDPCIYPLSEIMHDVILRQFPLGHHPKGDFKRAA
FT                   VMSTVSMAPAAANKDVYRVVLLKFKDKEQRFTFHLLSNGPPTIAEIIANSRSLFHIVSQ
FT                   TKSLYLIHNNRVINDDMELARVFNRFTSEEIVIELRDVKPEPLDGLAMLSTVSASEFSD
FT                   PGSQKALPNRQNGASTTPTAYYPAASPLGPDCHSKESGDSENMPSTSTIQSDRDKVASE
FT                   GSGAKEQAENEQKTGSEVGQNPETSASAPPRRRFQPLL"
FT   gene            complement(<374411..>376081)
FT                   /locus_tag="KLTH0A04466g"
FT                   /old_locus_tag="KLTH-ORF16497"
FT   CDS_pept        complement(374411..376081)
FT                   /locus_tag="KLTH0A04466g"
FT                   /old_locus_tag="KLTH-ORF16497"
FT                   /product="KLTH0A04466p"
FT                   /note="highly similar to uniprot|P28240 Saccharomyces
FT                   cerevisiae YER065C ICL1 Isocitrate lyase catalyzes the
FT                   formation of succinate and glyoxylate from isocitrate a key
FT                   reaction of the glyoxylate cycle expression of ICL1 is
FT                   induced by growth on ethanol and repressed by growth on
FT                   glucose"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21209"
FT                   /db_xref="GOA:C5DBQ2"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBQ2"
FT                   /protein_id="CAR21209.1"
FT                   /translation="MTVPTTQNLDSFESLQRQLEQQTAEIEKWWSQPRWKHTKRIYSAR
FT                   EIAARRGTMPMAPHASSTMAQKLYKLLEEHHENRTVARTFGALDPVHVTQMAKYLDTVY
FT                   VSGWQCSSTASTSNEPGPDLADYPMDTVPNKVDHLFKAQLFHDRKQWEDRSRCKSQAEL
FT                   DKLGPATDYLRPIVADADAGHGGVTAVFKLTKMFIEKGAAGIHMEDQTSTNKKCGHMAG
FT                   RCVIPVQEHISRLVTIRMCADIMHSDLVLVARTDSEEATLLSSTIDPRDHYFIVGATNP
FT                   DVEVSLAETLEAAIMKGVSAADLVATEERWCAKAGLKLFHEAFADEVRKHETSNQEQII
FT                   KEFNETVGPLAGFSLREMQAVAKKLLGKPLHFDWDLPRAREGLYRYRGGTQSSIMRARA
FT                   FAPYADLVWMECNSPDYEQAKAFAEGVKAKFPDQWLAYNLSPSFNWTKTMDAKQLRTFI
FT                   DRLGDLGYIWQFITLAGLHTSALAVNAFSKDFAERGMQSYAETVQQKEIDQGVDILKHQ
FT                   KWSGAEYIDSLLKLAHGGTSATAAMGLGVTEDQFHENGV"
FT   gene            complement(<376580..>376661)
FT                   /locus_tag="KLTH0A04488r"
FT                   /old_locus_tag="Klth0A.tSer.TGA.9"
FT   tRNA            complement(376580..376661)
FT                   /locus_tag="KLTH0A04488r"
FT                   /old_locus_tag="Klth0A.tSer.TGA.9"
FT                   /note="tRNA-Ser (TGA) cove score=84.16"
FT   gene            <376970..>377461
FT                   /locus_tag="KLTH0A04510g"
FT                   /old_locus_tag="KLTH-ORF16494"
FT   CDS_pept        376970..377461
FT                   /locus_tag="KLTH0A04510g"
FT                   /old_locus_tag="KLTH-ORF16494"
FT                   /product="KLTH0A04510p"
FT                   /note="similar to uniprot|P40188 Saccharomyces cerevisiae
FT                   YIL057C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21210"
FT                   /db_xref="GOA:C5DBQ3"
FT                   /db_xref="InterPro:IPR022554"
FT                   /db_xref="InterPro:IPR038235"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DBQ3"
FT                   /protein_id="CAR21210.1"
FT                   /translation="MTKKDKKPKISTIVTKEGDTVKVFEDLDTFETFIKNETEDEEFDH
FT                   VNCHLKYYPPFVLHESHEDPEKIKETVNSHNRKFVRHLHQHVEKHLLKDIRERLQLPQL
FT                   KFNDKSKEETPDHIVWRYNQRANFHERDFDIHVTVECHHDSALVDVDYLTVPVPAVAAA
FT                   "
FT   gene            <378016..>379851
FT                   /locus_tag="KLTH0A04532g"
FT                   /old_locus_tag="KLTH-ORF16490"
FT   CDS_pept        378016..379851
FT                   /locus_tag="KLTH0A04532g"
FT                   /old_locus_tag="KLTH-ORF16490"
FT                   /product="KLTH0A04532p"
FT                   /note="similar to uniprot|P34909 Saccharomyces cerevisiae
FT                   YER068W MOT2 Component of the CCR4-NOT transcription
FT                   regulatory complex which represses transcription at least
FT                   in part by inhibiting functional TBP-DNA interactions and
FT                   also aids in transcription elongation interacts with C-
FT                   terminal region of Not1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21211"
FT                   /db_xref="GOA:C5DBQ4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR034261"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039515"
FT                   /db_xref="InterPro:IPR039780"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBQ4"
FT                   /protein_id="CAR21211.1"
FT                   /translation="MNKTTTAANMHAIQNALANYDTSFLSDDEEDYCPLCIETLDITDK
FT                   NFKPCPCGYQICQFCYNNIRQNPELNGRCPACRRKYDDESVEYIVLTPEEMKLEQAKQV
FT                   RKEKERKLRDKERKENEFANRKHLAGMRVIQKNLVYVVGLNPPVPYEDVAALLKSDRYF
FT                   GQYGKINKIVVNKKTAHNDHHSGPASGSHGHHTGYGIYVTFAKKDDAARCIAAVDGTYL
FT                   DGRIVKAAYGTTKYCSSYLRGQSCPNPNCMFLHEPGEEADSFNRRELTNKQHDHSAFKQ
FT                   LGGSSSSLPSNKAAASAIVPPSASPAPSPLPIKTHLNSSHNQEEISSSSSTSAAHTPVL
FT                   TPALVPSGSNPWGVNSAAAPSFSSAAAKTTTSSAFPTLGEATLAQSMAALSTKDSGAGT
FT                   AHSSTKSNKKNLEKKYIDPYDPLSSAVRFIDDTIKFLSEYRNCHFKLRSNVIDEETYKS
FT                   YPSLFSFENVPVSKTSDNTLSRKLVDMLAIKPVDHSASVLPYLQATPQADPLVLHQLQQ
FT                   QQQQQQLLLAKQQQQLQQQVQTHQQTQQPTPPGMTPQLLHAQLQQQRAVNTPPPPGIFS
FT                   PSNPPTSANQVPVTGSNSSDLLNQLINGKRISTSS"
FT   gene            <380152..>380988
FT                   /locus_tag="KLTH0A04554g"
FT                   /old_locus_tag="KLTH-ORF16486"
FT   CDS_pept        380152..380988
FT                   /locus_tag="KLTH0A04554g"
FT                   /old_locus_tag="KLTH-ORF16486"
FT                   /product="KLTH0A04554p"
FT                   /note="weakly similar to uniprot|Q00916 Saccharomyces
FT                   cerevisiae YIL061C SNP1 U1snRNP 70K protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21212"
FT                   /db_xref="GOA:C5DBQ5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR040252"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBQ5"
FT                   /protein_id="CAR21212.1"
FT                   /translation="MIKFPQNVSKLFRPGPPLQYKKPVDYPVEERKTANKIQSLSGYLG
FT                   ALDTYRSEHPEGSENGHLDAYNAAENARQVEAKALNAKLAIWNPDEDPNIADSDPYRTI
FT                   FVGRLPFAVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKDEISARSACREI
FT                   GVHRGVQIGGRPVIVDIERGRTVKYFTPRRLGGGLGGRGYMKRDKLAKLASAVAKDEPK
FT                   TTPRGPPPSSFPSGPRSRFNAYSGAPARAAPPPERAPAYRSRQNRTSRFQGFRPDY"
FT   gene            <381267..>383840
FT                   /locus_tag="KLTH0A04576g"
FT                   /old_locus_tag="KLTH-ORF16484"
FT   CDS_pept        381267..383840
FT                   /locus_tag="KLTH0A04576g"
FT                   /old_locus_tag="KLTH-ORF16484"
FT                   /product="KLTH0A04576p"
FT                   /note="highly similar to uniprot|Q01217 Saccharomyces
FT                   cerevisiae YER069W ARG5 6 Bifunctional enzyme with
FT                   acetylglutamate kinase and N-acetyl-gamma-glutamyl-
FT                   phosphate reductase activities catalyzes the second and
FT                   third steps in the biosynthesis of the arginine precursor
FT                   ornithine forms a complex with Arg2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21213"
FT                   /db_xref="GOA:C5DBQ6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011241"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBQ6"
FT                   /protein_id="CAR21213.1"
FT                   /translation="MSARLLVSTKSLKSGRLQGLASLLSKVNCAHSVPYAQKRVGYSKR
FT                   HVASVSGVGTTGTRSTVVQLLNNIGSKREVEQYLKYFTSVSQQQFAVIKVGGAIISDNL
FT                   QELASCLAFLYHVGLYPIILHGTGPQVNGRLEAQGVEPDYIDGIRITDERTMSVVRQCF
FT                   LEQNLKLVTALEQLGVRARPITSGVFTAEYLDKDKYKLVGDITGVCKDPIEASIKAGAL
FT                   PILTSLAETPSGQTLNVNADIAAGELARIFEPLKIVYLNEKGGIVNGETQEKVSVINLD
FT                   EEYDELMKQSWVKYGTKLKIKEIKELLDYLPRSSSVAIINVQDLQKELFTDSGAGTMIR
FT                   RGYKLVKRSSLSEFPTPDALREALQRDPDIASGAQSSATYLRDLQSSEFTTYSDEPLEV
FT                   LAIVKKDTLVPKLDKFLCSKVGWLNNVTDNVFSSLKRDFPALQWVVREDDENIGWHFSK
FT                   CDGSYLKNGKVLFWYGVKDLNTASQLIKDFVGTASAAPTGSTSGVFASGQATRAFSTAR
FT                   SYSTRSEPKTEGTNTKKGRVALIGARGYTGQNLISLLDNHPYLELAHVSSRELNGTKLK
FT                   GYNKAEITYENLQLEDLKRLESKGNVDMWVMALPNGVCKPFVEAIESVKGKSKIIDLGA
FT                   DYRFVPETEWAYGLPELNNREKIAAAKKIANPGCYATGAQVAIAPLTEFITGLPTVFGV
FT                   SGYSGAGTKPSPKNDPAFLNNNLIPYALTNHIHEREISTRLGLEVAFVPHVAQWFQGIS
FT                   HTISIPIKKGSLTSQDIRSMYEKFYENERLVNVAKDIPLMKSISGTHGVLVGGFKVNDA
FT                   QDRVVVCAAIDNLLKGAATQCLQNINLALGYGEYDGIPQDKIAQD"
FT   gene            <384126..>384587
FT                   /locus_tag="KLTH0A04598g"
FT                   /old_locus_tag="KLTH-ORF16478"
FT   CDS_pept        384126..384587
FT                   /locus_tag="KLTH0A04598g"
FT                   /old_locus_tag="KLTH-ORF16478"
FT                   /product="KLTH0A04598p"
FT                   /note="highly similar to uniprot|P40518 Saccharomyces
FT                   cerevisiae YIL062C ARC15 Subunit of the ARP2/3 complex
FT                   which is required for the motility and integrity of
FT                   cortical actin patches"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21214"
FT                   /db_xref="GOA:C5DBQ7"
FT                   /db_xref="InterPro:IPR006789"
FT                   /db_xref="InterPro:IPR036743"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBQ7"
FT                   /protein_id="CAR21214.1"
FT                   /translation="MEDWRRIDIDAFDPDSGRLTAEDLKPPYASSVSLQELEPKISQLR
FT                   SAATSGDFLNALQILTTDPPYSADETTKNQYFHAVLGVLTQVRQADITNLVKQLSPKQT
FT                   DVLVKYLYKGMSVPEGQKQGGMLLSWFEKVTQLSGVGPVVRYLSDRNTV"
FT   gene            <384810..>385973
FT                   /locus_tag="KLTH0A04620g"
FT                   /old_locus_tag="KLTH-ORF16477"
FT   CDS_pept        384810..385973
FT                   /locus_tag="KLTH0A04620g"
FT                   /old_locus_tag="KLTH-ORF16477"
FT                   /product="KLTH0A04620p"
FT                   /note="some similarities with uniprot|P40517 Saccharomyces
FT                   cerevisiae YIL063C YRB2 Ran-GTPase-binding protein involved
FT                   in nuclear export nuclear protein interacts with Gsp1p and
FT                   Crm1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21215"
FT                   /db_xref="GOA:C5DBQ8"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBQ8"
FT                   /protein_id="CAR21215.1"
FT                   /translation="MSEASDSSNLNQKELIKDTEANTSEPIGIKRSRSQEANNAEEPAK
FT                   RLKSEESEESKENLNEHTAQEKKDDGKRSEPATSEKGPANESGSNNKEAKSDEGHKQSS
FT                   SDDDKKPGPAKECEADKDKKDVQKTTKEGEDNATEESQKASPKPSAKPKFAFGASSGFS
FT                   AGFGLAKTPTPKSNTPESIISPKEGSSESKAPTKPTAFGSGFAFGAGFYALNKDKKSGS
FT                   KVFASEEEKAKSASPVPGNPNTDDTKENTSSTDSEGVVKLQKQDVKSGEESEESIFQVN
FT                   AKLYQLTSLKEGWKERGVGALHVNKNPHNGKARIVMRSRGILKVILNVLLVKGVVIHKG
FT                   FPASLQGEKFIRIVTVDHDKAPLQYAVRMGKAEAADELYETIKKLIP"
FT   gene            complement(<386066..>386755)
FT                   /locus_tag="KLTH0A04642g"
FT                   /old_locus_tag="KLTH-ORF16474"
FT   CDS_pept        complement(386066..386755)
FT                   /locus_tag="KLTH0A04642g"
FT                   /old_locus_tag="KLTH-ORF16474"
FT                   /product="KLTH0A04642p"
FT                   /note="similar to uniprot|P40516 Saccharomyces cerevisiae
FT                   YIL064W Putative S-adenosylmethionine-dependent
FT                   methyltransferase of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21216"
FT                   /db_xref="GOA:C5DBQ9"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026635"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBQ9"
FT                   /protein_id="CAR21216.1"
FT                   /translation="MEDTSKLNTSKLGTKEYWDDFYALENSNFKENPGDTGECWFADND
FT                   AEEKMIEFLMDNLDQQNIHRDCSMIDLGTGNGHLLFQLHEEGFNGPMMGVDYSEKSVQF
FT                   AREISESQFPGYENIKFEAADIFDPNWECSAYDVVLDKGTLDAIALSGIKLDGDRSVVD
FT                   VYPKVVEKLLKKDSVFLITSCNFTQEELIRIVESDSLKVWKTIDYPVFEFGGVKGTTIC
FT                   SIAFVKR"
FT   gene            <386899..>387363
FT                   /locus_tag="KLTH0A04664g"
FT                   /old_locus_tag="KLTH-ORF16472"
FT   CDS_pept        386899..387363
FT                   /locus_tag="KLTH0A04664g"
FT                   /old_locus_tag="KLTH-ORF16472"
FT                   /product="KLTH0A04664p"
FT                   /note="similar to uniprot|P40515 Saccharomyces cerevisiae
FT                   YIL065C FIS1 Mitochondrial outer membrane protein involved
FT                   in membrane fission required for localization of Dnm1p and
FT                   Mdv1p during mitochondrial division"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21217"
FT                   /db_xref="GOA:C5DBR0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016543"
FT                   /db_xref="InterPro:IPR028058"
FT                   /db_xref="InterPro:IPR028061"
FT                   /db_xref="InterPro:IPR033745"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBR0"
FT                   /protein_id="CAR21217.1"
FT                   /translation="MGKISFLPTLEDAYGSLSPDQLEILRQQVLSEGGELASIQSRFNY
FT                   AWGLIKSTEQDDQRLGVKLLTDIYKESSMRRRECLYYLTIGCYKLGEFSTAKRYSDALC
FT                   SHEPDNKQARTLQSMVENKIQRESFKGIAIASGCVAVAATVAGMLFRKKR"
FT   gene            <388330..>390969
FT                   /locus_tag="KLTH0A04686g"
FT                   /old_locus_tag="KLTH-ORF16471"
FT   CDS_pept        388330..390969
FT                   /locus_tag="KLTH0A04686g"
FT                   /old_locus_tag="KLTH-ORF16471"
FT                   /product="KLTH0A04686p"
FT                   /note="highly similar to uniprot|P21524 Saccharomyces
FT                   cerevisiae YER070W RNR1 Ribonucleotide-diphosphate
FT                   reductase (RNR) and to YIL066C uniprot|P21672 Saccharomyces
FT                   cerevisiae YIL066C RNR3 Ribonucleotide- diphosphate
FT                   reductase (RNR), large subunit; the RNR complex catalyzes
FT                   the rate-limiting step in dNTP synthesis and is regulated
FT                   by DNA replication and DNA damage checkpoint pathways via
FT                   localization of the small subunits"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21218"
FT                   /db_xref="GOA:C5DBR1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBR1"
FT                   /protein_id="CAR21218.1"
FT                   /translation="MFVYKRDGRREPVKFDKITARVSRLCYGLDPNHVDAVKITQRIIS
FT                   GVYEGVTTVELDNLAAETCAYMTTIHPDYATLAARIAISNLHKQTTKQFSQVVSDLFHY
FT                   VNPKNGIHSPMISQEVFDIIQKHKDELNSAIVYDRDFQYNYFGFKTLERSYLLRINGEV
FT                   AERPQHLIMRVAVGIHGDNIPKVIETYNLMSLKYFTHASPTLFNAGTPHPQMSSCFLVA
FT                   MKDDSIEGIYDTLKECAMISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGLIPMIRVFNN
FT                   TARYVDQGGNKRPGAFALYLEPWHSDIFDFVDIRKNHGKEEIRARDLFPALWVPDLFMK
FT                   RVQENGDWTLFSPSEAPGLSDVYGDEFEALYERYVQEGRGRKTIKAQKLWYAILEAQTE
FT                   TGTPFMLYKDACNRKSNQKNLGVIKSSNLCCEIVEYSAPDETAVCNLASLSLPAFIETS
FT                   EDGQTQWYNFDKLHEIAKVVTHNLNQVIDRNYYPVESARNSNMRHRPVALGVQGLADAF
FT                   MILRIPFDSQEAKELNIQIFETIYHAALERSNELAVEHGPYETFEGSPASQGILQFDMW
FT                   DKKPTDLWDWETLKAKIVKTGLRNSLLLAPMPTASTSQILGNNECFEPYTSNMYSRRVL
FT                   SGEFQIVNPYLLRDLVDLGIWNDAMKSHIISDNGSIQNLPNIPQKLKDLYKTVWELSQK
FT                   TIIEMAADRACYIDQSQSLNVHIRAPTMGKLTSMHFYGWKKGLKTGMYYLRTQAASAAI
FT                   QFTIDKSVASMAGDKEADLQNLHRPLYVPRKMNFSEGAAKDKGIEALRETRESSPSPSV
FT                   DSSLANSVASLKIEEAKPVTPPATTTDVAAEAKSEATQPENEEFDIYNSKVIACAIDNP
FT                   GACEMCSG"
FT   gene            <391244..>393286
FT                   /locus_tag="KLTH0A04708g"
FT                   /old_locus_tag="KLTH-ORF16465"
FT   CDS_pept        391244..393286
FT                   /locus_tag="KLTH0A04708g"
FT                   /old_locus_tag="KLTH-ORF16465"
FT                   /product="KLTH0A04708p"
FT                   /note="similar to uniprot|P40514 Saccharomyces cerevisiae
FT                   YIL067C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21219"
FT                   /db_xref="GOA:C5DBR2"
FT                   /db_xref="InterPro:IPR004043"
FT                   /db_xref="InterPro:IPR036609"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBR2"
FT                   /protein_id="CAR21219.1"
FT                   /translation="MDRQGIGLTDSEEHTRQGNARECCPRDEILSSSGTAIDGSSADVY
FT                   EMHSMEDIDNQGHSKDSNEREEWVYLEDSNIVTRFFKRLWNGPRVAKDMRPTFPDRWEF
FT                   TRRIDSFPEAVFRKRFPRLSVRLCILVVYCCLWSAIIFAFMHYYFGSPPTYYRSNGEKV
FT                   PIKTISCSSTLFWKGKNNKCGLGAAACKPFDNEEVYVRCPALCDRGGWTYSAINVGDRR
FT                   VKHTGFEIGGGELHEGELLSYPYRADSFACGAAVHAGVVSPFVGGCARVSMEGAQSSFE
FT                   SKKGRYGTDPSVKFDSFFPSSFSFRQLIEGYSSRCYDPRIPVLIINIVLGLPIFYLYEG
FT                   IYGYWIITIVGYWTLVLFLDPPIIVDPYSPETAFELLSVGFQRLLPLGFVLYVLWKCSV
FT                   KRTLTDGSPLVKVLCWFPTFWLGVMNVVTFDRLPVDRLIISDLKEQAGAMTAVGSIITL
FT                   IVVCAVIQAYSLWKSGRFRKYLVIYCLFISALATLGMLPGLSLRIHHYILGILLVPGCA
FT                   TRGASAYLFQGILIGLVLSGVSRWDFASIVETKVALLRGEAGGSWKPPTMNYNEEHPTK
FT                   ISWQVENSTTQSFDVLDAYSLLINDIEQYVGQNTTIDLEKIIQEDGFLSEYVNSTVSSK
FT                   GSVKLYLRVARASLKAPRKSHGDYTNAAVLEWPQGIYHGPLPGVS"
FT   gene            <393425..>395821
FT                   /locus_tag="KLTH0A04730g"
FT                   /old_locus_tag="KLTH-ORF16463"
FT   CDS_pept        393425..395821
FT                   /locus_tag="KLTH0A04730g"
FT                   /old_locus_tag="KLTH-ORF16463"
FT                   /product="KLTH0A04730p"
FT                   /note="similar to uniprot|P32844 Saccharomyces cerevisiae
FT                   YIL068C SEC6 Essential 88kDa subunit of the exocyst complex
FT                   (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and Exo84p)
FT                   which has the essential function of mediating polarized
FT                   targeting of secretory vesicles to active sites of
FT                   exocytosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04730g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21220"
FT                   /db_xref="GOA:C5DBR3"
FT                   /db_xref="InterPro:IPR010326"
FT                   /db_xref="InterPro:IPR042532"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBR3"
FT                   /protein_id="CAR21220.1"
FT                   /translation="MADYALQRVSELIKDEPSIDRIRELVNQITKEKSTIDYQLNKDSK
FT                   KSLNDVTSSLDRMHLARKNVRMLKDRLREVSTLSQENQSSIERYEVINEATAIHELIEK
FT                   TTSMYNKIIGFNDLLTRLSEMMDNELAQDALQSGIPNLLQIHYLLTMARDFHDQSLILA
FT                   QTSTEDVQRTMQRVFQRLPELIQKFDRLLESLIFDIVEAVRTENQSLLIRLFKIIDLED
FT                   REDIKIEATRRIIESKEREQDARKIRKLPSTYGITGSRDEAPVTQYPSPAALAQEITNG
FT                   TIQTRLQPRGYKKFLFDKIKSSIQDVFQEVRREYSGEKRFEVLNNLDWVFNELLVVKDH
FT                   VSNLCPAHWQLFDKFYELYYHELNKLITELVNAEPETLIILDILDFDKTFQSTLRKDFG
FT                   FSKDQAKSVIGEKEKETLLSDYLNLIVTKSNEWFGNLESAEMKIFVERTTPPHTDSEGL
FT                   LFLDGTKTCFQMFSQQVEVAAGSGQAKILVGVVDKLCELLAARQKNWMDIISVEVKKSV
FT                   EYNHKVEEDPESVTPEEESSGGLVEYLIAVANDQMKAADYAVAISQKYGSIVSKVHEKS
FT                   ITNNIERTLDGFAEVAKCSSTGLIKLMFDDLRKPYTQVFGKNWYTGNQAQQIADTLYEY
FT                   LGDIRAQMNPFVYSTLAESVIEETILKFVECLKYEHSFKSKHNKFLECMKRDFEVFYKL
FT                   FVQFVPEEEREIIDDKFKLMEFFMDFSCGPVNGIIEVWTQCLEMYWDCPASFLSAILKC
FT                   RKDVDSSTLKSTVATAQRIASSPQRANQLRAVDLQPTFISRFKIA"
FT   gene            complement(<395850..>396281)
FT                   /locus_tag="KLTH0A04752g"
FT                   /old_locus_tag="KLTH-ORF16459"
FT   CDS_pept        complement(395850..396281)
FT                   /locus_tag="KLTH0A04752g"
FT                   /old_locus_tag="KLTH-ORF16459"
FT                   /product="KLTH0A04752p"
FT                   /note="weakly similar to uniprot|P40045 Saccharomyces
FT                   cerevisiae YER071C Protein of unknown"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21221"
FT                   /db_xref="GOA:C5DBR4"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DBR4"
FT                   /protein_id="CAR21221.1"
FT                   /translation="MLTTCSLKPLIQQSQLSPEQLKESFLSSFMPALEVNSVPSSSEFP
FT                   VAPEKLASIIETSARDASSDDLGACTESILVELSKASSAHKFVVSLTKVAFSDSEDFNL
FT                   SIDSSIGGSWNKTKDGGYSHSVETEAGARLLATVVWVSK"
FT   gene            <397090..>397461
FT                   /locus_tag="KLTH0A04774g"
FT                   /old_locus_tag="KLTH-ORF16454"
FT   CDS_pept        397090..397461
FT                   /locus_tag="KLTH0A04774g"
FT                   /old_locus_tag="KLTH-ORF16454"
FT                   /product="KLTH0A04774p"
FT                   /note="highly similar to uniprot|P40046 Saccharomyces
FT                   cerevisiae YER072W VTC1 Protein involved in vacuolar
FT                   maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21222"
FT                   /db_xref="GOA:C5DBR5"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBR5"
FT                   /protein_id="CAR21222.1"
FT                   /translation="MSSAPLLQKAPGKKIALPTRVEPKVFFANERTFLSWLNFTVMLGG
FT                   LGIGLLNFGDKVGRISAGLFTLVAMATMVYALVTYHWRASAIRRRGSGPYDDRLGPTLL
FT                   CFFLLIAVVVNFLLRMKYQ"
FT   gene            <398632..>400185
FT                   /locus_tag="KLTH0A04796g"
FT                   /old_locus_tag="KLTH-ORF16452"
FT   CDS_pept        398632..400185
FT                   /locus_tag="KLTH0A04796g"
FT                   /old_locus_tag="KLTH-ORF16452"
FT                   /product="KLTH0A04796p"
FT                   /note="highly similar to uniprot|P40047 Saccharomyces
FT                   cerevisiae YER073W ALD5 Mitochondrial aldehyde
FT                   dehydrogenase that is activated by K and utilizes NADP as
FT                   the preferred coenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21223"
FT                   /db_xref="GOA:C5DBR6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBR6"
FT                   /protein_id="CAR21223.1"
FT                   /translation="MLVSRTFSRSVASRLVLRSYSQLPLRVPITLPSGVTYDQPTGLFI
FT                   NGEFVPSRQHKTFEVLNPSTEQEIAHVYEAREDDVDVAVAAAKAAFENKWGTADPEFRS
FT                   RCLYKLADLVDKHAEVLAGIESLDNGKSLLCSRGDVDLVAKYLRSCAGWADKIFGRTID
FT                   TGSTHFSYTRREPLGVCAQIIPWNFPLLMWSWKLGPALATGNTVVLKPAEATPLSALYA
FT                   CQLVQEAGIPAGVVNILPGFGKLLGDRLCTHKDVKKIAFTGSTATGRHIMRSAANTIKK
FT                   VTLELGGKSPNIVFGDADLDKAVRTIAFGIFYNSGEVCCAGSRVYVQDTVYEEVLEKFK
FT                   NYAESLKVGDPFQEGVFQGAQTSQMQIDKILDYVQIGTGEGARVVAGGERLGDKGYFIK
FT                   PTIFADVTEDMRIVKEEIFGPVVTVSKFSTVDEVIEMANDSEYGLAAGIHTKDINKAMD
FT                   VSNRVKAGTVWINTYNSFHQSVPFGGFGQSGIGREMGAEALDNYTQVKAVRMAIDPAER
FT                   "
FT   gene            <400870..>401682
FT                   /locus_tag="KLTH0A04818g"
FT                   /old_locus_tag="Klth0A.mRNA.204.p"
FT   CDS_pept        join(400870..400872,401278..401682)
FT                   /locus_tag="KLTH0A04818g"
FT                   /old_locus_tag="Klth0A.mRNA.204.p"
FT                   /product="KLTH0A04818p"
FT                   /note="highly similar to uniprot|P26782 Saccharomyces
FT                   cerevisiae YIL069C RPS24B and highly similar to
FT                   uniprot|P26782 Saccharomyces cerevisiae YER074W RPS24A
FT                   proteins component of the small (40S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21224"
FT                   /db_xref="GOA:C5DBR7"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBR7"
FT                   /protein_id="CAR21224.1"
FT                   /translation="MSDAITIRTRKVITNPLLARKQFVVDVLHPNRANVAKDELREKLA
FT                   EAYKAEKDAVSVFGFRTQFGGGKSVGFGLIYNSVADAKKFEPTYRLVRYGLAEKVEKAS
FT                   RQQRKQKKNRDKKVFGTGKRLAKKVARRNAD"
FT   gene            <402770..>403160
FT                   /locus_tag="KLTH0A04840g"
FT                   /old_locus_tag="Klth0A.mRNA.733.p"
FT   CDS_pept        join(402770..402860,402930..403037,403105..403160)
FT                   /locus_tag="KLTH0A04840g"
FT                   /old_locus_tag="Klth0A.mRNA.733.p"
FT                   /product="KLTH0A04840p"
FT                   /note="highly similar to uniprot|Q3E834 Saccharomyces
FT                   cerevisiae YER074W-A YOS1 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21225"
FT                   /db_xref="GOA:C5DBR8"
FT                   /db_xref="InterPro:IPR013880"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBR8"
FT                   /protein_id="CAR21225.1"
FT                   /translation="MIFGLGRLFYVILLLINAVAVLSEERFLSRIGLGSSASQAPAFGQ
FT                   QENSTRSKVVQLIGAIQTLLRIPLIGINILVIVYELLLG"
FT   gene            complement(<403388..>406003)
FT                   /locus_tag="KLTH0A04862g"
FT                   /old_locus_tag="KLTH-ORF16442"
FT   CDS_pept        complement(403388..406003)
FT                   /locus_tag="KLTH0A04862g"
FT                   /old_locus_tag="KLTH-ORF16442"
FT                   /product="KLTH0A04862p"
FT                   /note="some similarities with uniprot|P40048 Saccharomyces
FT                   cerevisiae YER075C PTP3 Phosphotyrosine-specific protein
FT                   phosphatase involved in the inactivation of mitogen-
FT                   activated protein kinase (MAPK) during osmolarity sensing
FT                   dephosporylates Hog1p MAPK and regulates its localization
FT                   localized to the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21226"
FT                   /db_xref="GOA:C5DBR9"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBR9"
FT                   /protein_id="CAR21226.1"
FT                   /translation="MESRWSSDQAELEAGCAAVSDASSVVSSSSTLVGEPGSKVAAFPP
FT                   ARPHRRAISALAIGRTMPGPAGALGPVGAIGSARPVGSPSSVNSAGSAGSQSPQTLPFL
FT                   MRSNSNPSLPSFKAKEMRLPLPEGAQSMAAVELVSLLDSEPAEKLLVLDVRPFVDFCRA
FT                   TIQNALHVCLPSTLLRRKTFTLERLVDNLPEDVRQIVKPRVMDPEDCSDLKIVIFDNTA
FT                   QQIDSGFSVGCHGMASKFVQSPKWATVEARPSVYILESGFAGFKEFAPDCVKAPVVTLS
FT                   SPINSNSSPTDLSGAPNMMPKPKFSNHSVANGSPSSIPESPLSSSSPVSGLLKFQLPAS
FT                   NGLPPPFKIARNEEVLNLESYLSAVDLGEKQRSLGGSISSLENLDLSSPPSNTAFKFPT
FT                   DPSSINQINLASGNGIVHADKLNFQKSFIQLHILYDRNMINSVVPRWFQDLAHEPKLEM
FT                   ISQFQKIDLLEKKRLSHCLSNACQPSRAQTASYAAANSCDTADLEHSNGFCPSRWLDEY
FT                   DSDEEDQNICVSSGVELGTKNRYKDIFPYEHTRVVLKKTMPVYQHHYANEIFDTYINAN
FT                   YLTNPFVRLQTPPESDCLNVRYIATQAPLEATIHDFYTCILNNNVPLVLSLTDEFENGV
FT                   EKCYKFWAEGNYDGIRIKLLQEHDLELPDVGPGVGPVTLRRIQIIYNENQTFETLQIQI
FT                   KDWPDLGVMVNPRQILEMICLKNIVICQMFERRAYSHDHFPTILVHCSAGCGRTGTLCT
FT                   LDTVLSNMSKFDSLKEEWIGRRDATEYNPWSPRSAACLNSKLFDPVIITINKFRKQRIS
FT                   MVQNVNQYLFIYDCLLSFFDMRLKEKAFLAHTSNPFRKTGKGLEIIESFLGSKTREAGL
FT                   "
FT   gene            <406887..>407675
FT                   /locus_tag="KLTH0A04884g"
FT                   /old_locus_tag="KLTH-ORF16438"
FT   CDS_pept        406887..407675
FT                   /locus_tag="KLTH0A04884g"
FT                   /old_locus_tag="KLTH-ORF16438"
FT                   /product="KLTH0A04884p"
FT                   /note="similar to uniprot|P40513 Saccharomyces cerevisiae
FT                   YIL070C MAM33 Acidic protein of the mitochondrial matrix
FT                   involved in oxidative phosphorylation related to the human
FT                   complement receptor gC1q-R"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21227"
FT                   /db_xref="GOA:C5DBS0"
FT                   /db_xref="InterPro:IPR003428"
FT                   /db_xref="InterPro:IPR036561"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBS0"
FT                   /protein_id="CAR21227.1"
FT                   /translation="MFSRVLVRSAAVAARSARTARCAPMLRSVNLQAASLRPLHFSAVR
FT                   LNKQCQKVAQVLESEVALEVEEDVQDLPESLQSFFDKTGFSAVASPGKNMAEITSKTAR
FT                   GETVHVFFDVAQVSNLPLESAELDGEAAAPSEEEEFDGMADNFANVNVVVVKDSDQSAV
FT                   SFELLMNLQEGTFFVDSATPYSSAKAALDETAESEVSRELVYHGPPFSNLDEELQESLE
FT                   AYLESRGINEELATFIGTYSEFKENKEYINWLKNMKTFFN"
FT   gene            complement(<407728..>409641)
FT                   /locus_tag="KLTH0A04906g"
FT                   /old_locus_tag="KLTH-ORF16434"
FT   CDS_pept        complement(407728..409641)
FT                   /locus_tag="KLTH0A04906g"
FT                   /old_locus_tag="KLTH-ORF16434"
FT                   /product="KLTH0A04906p"
FT                   /note="similar to uniprot|P40050 Saccharomyces cerevisiae
FT                   YER077C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04906g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21228"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBS1"
FT                   /protein_id="CAR21228.1"
FT                   /translation="MVRKATIVNLTTFLRGLHVQVPNCASQLRDRITHFERNHEVLRKS
FT                   RSQLKRIEERRRLDLKNLNKTPYSQQHARHVLKRKYEVPSEDLDSTKLGPTSESDLRFL
FT                   KLTHDKRLLYTILGVTGEQLRDSKLIAADVSKFLSRNQLEKAVFLARLAKSRGVVGMNK
FT                   VIEHFCQVKQDAGSAIDMYNWRKKWDIPPNEFTHTILFDGLANVKQPLSEKQSQRVLKI
FT                   AKLLLEREEMNIAGFNASLSALANSVNVEYAFELFDARKKQISPDAITYTILLRALSLT
FT                   QDDKLCMARLDAVMASVPRKFLDGRVVYEYCHVLHNRKDSMLSKMAIKALANFFDINIP
FT                   LEKISFPAGVNLPSLQFWDVKQRFDSNKFVADLFFQNCERNKLYELAWETYKAWNSENP
FT                   RLLELPVHERMIRIVTAAFPTKCAEMATEVFKNVNLRHRSGKNGMLLVYRAFERQAGKK
FT                   FINDSESNVDKLLTQLFDFSIELEGKHWKELGTRVLNWKAWMFCWNVVNKANERRKISN
FT                   ERAKWILDQYLRTILTGQTNRAGIQHEDHAGLRHVGLESVRFLSSFADHFKIKGESELN
FT                   DFVSEHDRQFFLYRRLLLRFKDRILEQVKILEGRPGSAESVEESIKQTAEKLLATKLPD
FT                   QA"
FT   gene            <409825..>411081
FT                   /locus_tag="KLTH0A04928g"
FT                   /old_locus_tag="KLTH-ORF16431"
FT   CDS_pept        409825..411081
FT                   /locus_tag="KLTH0A04928g"
FT                   /old_locus_tag="KLTH-ORF16431"
FT                   /product="KLTH0A04928p"
FT                   /note="similar to uniprot|P40512 Saccharomyces cerevisiae
FT                   YIL071C PCI8 Possible shared subunit of Cop9 signalosome
FT                   (CSN) and eIF3 binds eIF3b subunit Prt1p has possible dual
FT                   functions in transcriptional and translational control
FT                   contains a PCI (Proteasome-COP9 signalosome (CSN)-eIF3)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21229"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBS2"
FT                   /protein_id="CAR21229.1"
FT                   /translation="MDLLNGFYGPVLVERAAFAAQDEFLSPEIKSVWCSAAFEYLGLLQ
FT                   FNGSPHIGTISKFVEGNQGNLIPNASTAKVQVNYNVCRKVVAHEFSDAIALQEADSNVP
FT                   FLEKLYGIVRLLILGEKWKSLDEIDHRLDAYLKSKEGCLSEAEKHLTLAVRLLICGALY
FT                   LQGRYFDCIKYFVTAIQKDGAIFDMLLLSDSEAFFTTEEIITMITLSVIVSVPLDNYEE
FT                   FAQLEELKPLFVIAPTLSSCLSLLIDTSYNSFLKLWNESFDQKCSSSYFLCGRWKEVQA
FT                   TMRYKIYFFYLRISNRVEIRYLSETLGIDFETVRTEINSLIDDLTLNFSINDQLIYYRN
FT                   RYEMSDIVKNLSSSKTILDERIEKLKNQNDLVRYQVQQSIIENNARLREQNRDLDACND
FT                   ESNENLQNFVSNSEPDLGD"
FT   gene            complement(<411162..>412727)
FT                   /locus_tag="KLTH0A04950g"
FT                   /old_locus_tag="KLTH-ORF16430"
FT   CDS_pept        complement(411162..412727)
FT                   /locus_tag="KLTH0A04950g"
FT                   /old_locus_tag="KLTH-ORF16430"
FT                   /product="KLTH0A04950p"
FT                   /note="similar to uniprot|P40051 Saccharomyces cerevisiae
FT                   YER078C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21230"
FT                   /db_xref="GOA:C5DBS3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBS3"
FT                   /protein_id="CAR21230.1"
FT                   /translation="MFRASKLSSFQVLFIAKVPRRYISGSKPFSNNARYLNRQCPQFSA
FT                   GQPLFETRPNLLKPGEITPGITALEYFERRVKLATRLPAKSCAIIAGSQVKYASGPVFY
FT                   PFQQNNDLFYLTGWNEPDSVMILEKPTDDIDDVLFHLIVPPKDAFSEQWEGERTGTEGA
FT                   CEVFNADESTDTRQLSIYISRIIKRNEFIYFDRPQDKIDSSAEAFFRSFFSVSHSPVAS
FT                   DTITSVIKSSGKKHVRKLKRIIADMRSIKSPAEIRVMRRAGQISGRAYNQAYAQRFRNE
FT                   RTLHSFLDYKFVSGGCDKSAYIPVVAAGANSLCIHYTRNDDVMYNDEMVLVDAAGSLGG
FT                   YCSDISRTWPVSGKFSPAQRDLYEAVLSVQRRCIDLCKASNLYSLNDIHEKSVSFFKEE
FT                   LANVGLSNLQNSSIAKIYPHYIGHNLGLDVHDVPEVSRHEPLQAGQVITIEPGIYFPDD
FT                   PSYPAYFKNIGIRIEDDIAIGLDSHINLTAEAAKEVVDIESIAQNGVTTKIEEDVVAPL
FT                   KYVD"
FT   gene            complement(<412916..>414785)
FT                   /locus_tag="KLTH0A04972g"
FT                   /old_locus_tag="KLTH.mRNA.122AT.m"
FT   CDS_pept        complement(join(412916..414017,414073..414785))
FT                   /locus_tag="KLTH0A04972g"
FT                   /old_locus_tag="KLTH.mRNA.122AT.m"
FT                   /product="KLTH0A04972p"
FT                   /note="similar to uniprot|P20050 Saccharomyces cerevisiae
FT                   YIL072W HOP1 Meiosis-specific DNA binding protein that
FT                   displays Red1p dependent localization to the unsynapsed
FT                   axial-lateral elements of the synaptonemal complex required
FT                   for homologous chromosome synapsis and chiasma formation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21231"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBS4"
FT                   /protein_id="CAR21231.1"
FT                   /translation="MSTAQQTKPKTVVSTTTGITCEQSQKLVQTMLTMSFGCLSFLRGL
FT                   FPDDNFIDQRFVPEKVIKNYNKDRNEAPANSIKIKTLVRGKTPEADLFLDWLEKGVFQS
FT                   IKVKYLKALSLGVFTHEEAPSDLLENYLFSFSYGDDGQVSMGVNGEEGEVSLLDSRRVV
FT                   QQLMRRFIIITQSLEPLPEKRFLTMRLLFNENAPPEYQPQYFRDATYDKPSIIKIPKSA
FT                   DLDTYSVGSIDTKFHEVSLKVLSVVESTNDASPVPTRDIDPFSLVEPVDAIEETNLSFS
FT                   QVAFETPRRPLSQTTKYLKNYLTAPSAEVANTQHLNEHDTYDCQCAIPCPQSTSKSICC
FT                   TQCKRKVHRICYGNYRRTSINKCISCLMKGKSFNCRTWSFKTFMMLRRIYRFMIKKPDF
FT                   PSTLSEFYEILAGTDTDPEIKRCINVSISILFYDEVFVLEKERRPQTSSKNQFLKSSNY
FT                   ITIDQSGIVVKNLGELPLNTKPVWSFIFNSAKAQAAYTTALFETPEQVSASLESISAAI
FT                   KKVEQLSRTHQCTNERAIGSSFDFNSLRIDDDTQDSLGPLKRKHPNLRDFLDNGKNSQL
FT                   DDTLDMHSYKPQKIRKISASKKTLKSVW"
FT   gene            <416070..>416657
FT                   /locus_tag="KLTH0A04994g"
FT                   /old_locus_tag="KLTH-ORF16425"
FT   CDS_pept        416070..416657
FT                   /locus_tag="KLTH0A04994g"
FT                   /old_locus_tag="KLTH-ORF16425"
FT                   /product="KLTH0A04994p"
FT                   /note="some similarities with uniprot|P40052 Saccharomyces
FT                   cerevisiae YER079W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21232"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBS5"
FT                   /protein_id="CAR21232.1"
FT                   /translation="MEDSSIFSQSSKDVSSAISLYNMPTGEDASIRGLLDYDPSEEAQS
FT                   SGISRPLSRSSVTSSLSMVATKDGVEGRRVHRYGIPQYSLNLLDAMSQPPPLKGKVHTR
FT                   QNAQSHHLSPQENKEDSETQLYQDLMHSPPITLKEKMQLFRDNSESSHLDYSEESYQEG
FT                   STSLSGKDQLHSLHSYKKDIASERDDSDDYSQ"
FT   gene            <417016..>418875
FT                   /locus_tag="KLTH0A05016g"
FT                   /old_locus_tag="KLTH-ORF16423"
FT   CDS_pept        417016..418875
FT                   /locus_tag="KLTH0A05016g"
FT                   /old_locus_tag="KLTH-ORF16423"
FT                   /product="KLTH0A05016p"
FT                   /note="similar to uniprot|P40053 Saccharomyces cerevisiae
FT                   YER080W FMP29 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05016g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21233"
FT                   /db_xref="GOA:C5DBS6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DBS6"
FT                   /protein_id="CAR21233.1"
FT                   /translation="MLRYNLRIPVQAKKAMGSLAPLRPMKSRFGLRCISDKPNEVFTKL
FT                   SDDNDPQRDAFFKYSWGSWLANDRQEKEKRTTKFSIEGLTDVINDLHAQSKEKAKSEAS
FT                   EGNIPPPSYNPNLTVSLSHNLSALTLGSLNPNETLRVTAMASIHEGKHHRIYKVDTNAD
FT                   KSFILRIPYATNSEAAISYRLKSEVATMDFADLKLGLKVPKVYCFGANALNPIRQPFIL
FT                   EEHIEGRLLMRDWNPLEDDASDKKAHISKLNKVIDPLSQFQSKLLSVEFNQFGSLYFAK
FT                   DYPDSEGPAYEGEKNESLKNRWSVGPSVERCFWRQKSALPLDKLMQFVGPWSKSKPMDI
FT                   VKSLGLLEAENAKSRLALQQTDASPAPIEESILREQVRTFENLAEISSSLFNTKSHVIP
FT                   NIDSLLKPRLYHPDLDPMNVLLDEKDNSAPYLLDFENTSIKPFILQNSPQFVAYDGPKI
FT                   YNLEEDVEGYKDLSEAEKVQYQFMYKRTRNQHLWESALNKNFNKLISAVAPPVKLLRSP
FT                   YVACVERKNDMEYLLVDESLIQLREVWEVFAKNKLVSEKKFPLEYTEEQLQKHSTDLNA
FT                   FHEQLIKSPFAATQGWIPQDMFENLVKAGILIKDKNGDYTIKQ"
FT   gene            <419566..>420978
FT                   /locus_tag="KLTH0A05038g"
FT                   /old_locus_tag="KLTH-ORF16418"
FT   CDS_pept        419566..420978
FT                   /locus_tag="KLTH0A05038g"
FT                   /old_locus_tag="KLTH-ORF16418"
FT                   /product="KLTH0A05038p"
FT                   /note="highly similar to uniprot|P40510 and to YER081W
FT                   uniprot|P40054 Saccharomyces cerevisiae SER3 3-
FT                   phosphoglycerate dehydrogenase, catalyze the first step in
FT                   serine and glycine biosynthesis; isozyme of Ser33p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21234"
FT                   /db_xref="GOA:C5DBS7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029015"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBS7"
FT                   /protein_id="CAR21234.1"
FT                   /translation="MASPQQINNLQNSFQSAVNLGGSPGIVSTSPTQSFMSSVPRRVSA
FT                   SRQTKALKPFSTGDIKILLLENVNQTAVEIFNGQGYQVEFHKSSLSEDELIEKIRDVHA
FT                   VGIRSKTRLTEKVLKHAKNLVVIGCFCIGTNQVDLDYAAKIGVAVFNSPFSNSRSVAEL
FT                   IMAEVISLARQLGDRSIEMHTGTWNKVASKCWEVRGKTLGIIGYGHIGSQLSVLAEAFG
FT                   MQVLYYDIVTIMALGTAKQVSTLDKLLSESDFVTCHVPATEDTKNLLSAPQFAAMKDGS
FT                   YVLNASRGTVIDIPSLIQAIKAGKIAGTALDVYPHEPAKNGAGAFNDELNSWISELVSL
FT                   PNVILTPHIGGSTEEAQSAIGIEVATNLSKYINEGASVGSVNFPEVSLRGLDLDQENVV
FT                   RVLYIHHNVPGVLKTVNNILSNHNIEKQFSDSSGDIAYLMADISSVNQSDIKDIYDQLN
FT                   ATEYKISIRLLY"
FT   gene            <421308..>424139
FT                   /locus_tag="KLTH0A05060g"
FT                   /old_locus_tag="KLTH-ORF16416"
FT   CDS_pept        421308..424139
FT                   /locus_tag="KLTH0A05060g"
FT                   /old_locus_tag="KLTH-ORF16416"
FT                   /product="KLTH0A05060p"
FT                   /note="highly similar to uniprot|P32565 Saccharomyces
FT                   cerevisiae YIL075C RPN2 Subunit of the 26S proteasome
FT                   substrate of the N-acetyltransferase Nat1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21235"
FT                   /db_xref="GOA:C5DBS8"
FT                   /db_xref="InterPro:IPR002015"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016642"
FT                   /db_xref="InterPro:IPR035266"
FT                   /db_xref="InterPro:IPR040623"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBS8"
FT                   /protein_id="CAR21235.1"
FT                   /translation="MSVVTAAPLLALLNENDNVAKSYALEAINEVVDQLWSEISNEITQ
FT                   IEALYDDNSFQDRKLAALVASKVYYNLGEYESAVKFALAADNYFNLDEKSQFVETIVSQ
FT                   SIDMYIKSSAKNYESSGSEVKIDPQLSSVFERMLEKCVECGDFKLALGIALESYRLDVV
FT                   ERILKARVEQDSDANALKLITYVLTAASTTVTSTPFRTSILHSLFNILMSTKSPEYFTV
FT                   SKIIVNLNDLNLALGLFKKLAQEEAAEISYQIAYDLVSSATQGLLEGLHSSLAAEGADE
FT                   KLLDILSGIPTCDYNNTFLFRNKNIDMGLLNKSKSSMDGKFSLFHTAVSVANGFMHAGT
FT                   TDDSFIRSNLPWLGKAQNWAKFTATASLGVIHKGNLSDGKKIMEPYLPGSRAASRYIKG
FT                   GSLYGLGLIYAGYGREIIDYMKSHVIENSSSVGDEDVDVLLHGASLGIGLAGMGSANSE
FT                   LYEALKEVLYNDSANSGEASALGMGLIMLGSGDENAVQDMFTYAQETQHGNITRGLAVG
FT                   LAVINYGRKELADSLIEKMLLHENALLRYGGAYTIALAYAGTGDNKAIKKLLHIAVSDS
FT                   DDDVRRAAVIALGFVLIRDYTTVPRIVELLAESHNAHVRCGTAFALGISCVGRGLQAAV
FT                   DVLMPLTKDPVDFVRQAAMIALSLILMQQTEKTNSKVKDINDLFLNVVSNKHQEGLAKF
FT                   GACVAQGIMNAGGRNVTIQLENVDMGTLDTKAVIGLAMFSQFWYWFPLAHFLSLSFTPT
FT                   SIIAVRGQDLSIPAFKFNCHTRPDVFEYPPMYEENTDKNVEKVATAVLSTTAKAKARAK
FT                   KTKKDGKDTVEEKPRRESKSELKPETKEEEKKLEPDQKDDAPFKIKYTNKPYQIENASR
FT                   VVPQQLKYIAFSKEDRFVPVRKFKGSNGVIVVFDKTPDEPAELIKTTKQKKDVDAPLPT
FT                   PFKVEDELEFSKL"
FT   gene            complement(<424327..>425985)
FT                   /locus_tag="KLTH0A05082g"
FT                   /old_locus_tag="KLTH-ORF16414"
FT   CDS_pept        complement(424327..425985)
FT                   /locus_tag="KLTH0A05082g"
FT                   /old_locus_tag="KLTH-ORF16414"
FT                   /product="KLTH0A05082p"
FT                   /note="highly similar to uniprot|P40055 Saccharomyces
FT                   cerevisiae YER082C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21236"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012952"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040315"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBS9"
FT                   /protein_id="CAR21236.1"
FT                   /translation="MAKSSKPATGSHGVRDNAGKFDRDASVSKRTNGYKTKDKKLRAGL
FT                   KRIDDQYKDAVSSAAATEYLLPESSGFLEAEDEMEKTFRVKQDEIKSAVDVTTANKALD
FT                   LKLTNFGPYSVNYSRNGTHLLVCGKKGHVASMDWRKGELRAELNLNETCQSAIYLQNEQ
FT                   YFAVAQKKYTFVYDHEGVELHRLKQHIEVKHMEFLPYHYLLATAGQTGWLKYQDVTTGQ
FT                   LQAELRTKLGPTSAMAQNPWNAIIHLGHSNGTVTLWAPNMPTPLARLLSARGPITSIAI
FT                   DRQGYYMATTGADKSLKLWDIRNFRELHTIENLPTPGSNLAISDTGLLALSRGPHVTLW
FT                   KDAFRSNKSSRPCFGSSGLPDRNTPYMSSMFPGNKVNNMQFVPFEDLLGVGHGTGVRNL
FT                   IIPGAGEANYDALEVNPFETAKQRQEQEVRTLLNKLPADSIALDPTVIGTVDKRASATR
FT                   LNAKDLAEITNAKALESKTNKDIPQVMPSVKGKNSGLRSFLRKKTQNVIDERKLRVNAQ
FT                   LEKEKAARQRKEMVKRGEIEEGHQDLVNEALSRFG"
FT   gene            <426808..>428127
FT                   /locus_tag="KLTH0A05104g"
FT                   /old_locus_tag="KLTH-ORF16411"
FT   CDS_pept        426808..428127
FT                   /locus_tag="KLTH0A05104g"
FT                   /old_locus_tag="KLTH-ORF16411"
FT                   /product="KLTH0A05104p"
FT                   /note="weakly similar to uniprot|P28272 Saccharomyces
FT                   cerevisiae YKL216W URA1 The enzyme catalyzes the conversion
FT                   of dihydroorotic acid to orotic acid"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21237"
FT                   /db_xref="GOA:C5DBT0"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBT0"
FT                   /protein_id="CAR21237.1"
FT                   /translation="MFVRPTLRGLSKTPNYFLKNSKLPLKSGFNGGKFILYTAGAIGGG
FT                   FAGLYLLNSRSAIHEYLFCPLIRLVTPDAETGHQLGVFFLKWGLAPKLLFDKDDEVLKV
FT                   NVFGTILTNPVGCAAGLDKDGEAIDGILQSGFSYHEIGSITPLPQPGNPRSRFFRLPQD
FT                   EAVINRYGFNSTGKDSVQGTLVERASKYVKSYFKDADVGKMSLYKNKLLAINLGKNKNG
FT                   DEVQDYLKGVETFQSLADVLVINVSSPNTPGLRDLQNESKLADLLQKVVDKRNSLVDAG
FT                   NQLGAKAHKPPVLVKIAPDLTEPELLSIAEAAKKSKVDGIIVSNTTIQRPNSLITQDPE
FT                   VKFQTGGLSGKPLKQYSLKALRTIYKYTKDSDLVLIGCGGISSAQDALEYARAGATFVQ
FT                   LYTSFAYKGPGVVSKIKDGLTEELKREGKTWMQIIGEDSK"
FT   gene            complement(<428186..>429157)
FT                   /locus_tag="KLTH0A05126g"
FT                   /old_locus_tag="KLTH-ORF16409"
FT   CDS_pept        complement(428186..429157)
FT                   /locus_tag="KLTH0A05126g"
FT                   /old_locus_tag="KLTH-ORF16409"
FT                   /product="KLTH0A05126p"
FT                   /note="similar to uniprot|P40056 Saccharomyces cerevisiae
FT                   YER083C RMD7 Required for Meiotic nuclear Division
FT                   functions in DNA replication and damage response Protein
FT                   involved in cell wall function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21238"
FT                   /db_xref="GOA:C5DBT1"
FT                   /db_xref="InterPro:IPR014802"
FT                   /db_xref="InterPro:IPR028143"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DBT1"
FT                   /protein_id="CAR21238.1"
FT                   /translation="MSPKLEVVSRNNTQNLAMSEISDAEKRRILREKRQQKFNKGGASS
FT                   RLAKITGQTENSFLSTESPLDSRESTYPAQETKAPAGNEDSTKQMDELLAKATSKTTSK
FT                   ASSPPGSAEQQNGNPELDLFAQIAKLQQNANNETVSTDPSGTPDIFAQLMASMQQDEAK
FT                   GGSPGATAQQPIDPAIVEAHNIAVNKLKSYTILVKWLFFLLPYLYYITHSARDPFQHNA
FT                   VNYVLDRSNFFTVFTTFEIVALSVYYQLLMSAEKSHNVNTLDNNSKILKLVSMVPPGLV
FT                   PIPNLRGKVAQALQYWDVVSMYLTDLCFAIVLAGLFQYYHSM"
FT   gene            complement(<429228..>430112)
FT                   /locus_tag="KLTH0A05148g"
FT                   /old_locus_tag="KLTH-ORF16407"
FT   CDS_pept        complement(429228..430112)
FT                   /locus_tag="KLTH0A05148g"
FT                   /old_locus_tag="KLTH-ORF16407"
FT                   /product="KLTH0A05148p"
FT                   /note="similar to uniprot|P40509 Saccharomyces cerevisiae
FT                   YIL076W SEC28 Part of a heptameric protein complex that
FT                   regulates retrograde Golgi-to-ER protein traffic in
FT                   eukaryotic cells coatomer forms the COP I vesicle coat
FT                   whose functions are essential epsilon-COP coatomer subunit
FT                   Sec28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21239"
FT                   /db_xref="GOA:C5DBT2"
FT                   /db_xref="InterPro:IPR006822"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBT2"
FT                   /protein_id="CAR21239.1"
FT                   /translation="MDLFTVKQQYYSGNYKQALQEIEKVASSDQDAVVFYRAKSLIALG
FT                   EYEKESSQSGIATAFNTYADIVAGSGSLQDLESAVSSSKSAFSLNLLASAQAIQGQNED
FT                   AVKTCLEGLDSNETQGLAELVLLAVQIAVSDSSNRSESTASSILQNFLAAHEEYANEDE
FT                   IIINLAESCVNFVAGREITGSNFYFYEELCQTLPSWKSQLGLMSLHLQQSHLPEAQAIV
FT                   DLLESEYYQNQQESARLYTPQLLANKITLTAMQGGRVDELRSQLLELQPEHPLCQNYKI
FT                   NNAKFDEVVAKYA"
FT   gene            <430306..>431283
FT                   /locus_tag="KLTH0A05170g"
FT                   /old_locus_tag="KLTH-ORF16403"
FT   CDS_pept        430306..431283
FT                   /locus_tag="KLTH0A05170g"
FT                   /old_locus_tag="KLTH-ORF16403"
FT                   /product="KLTH0A05170p"
FT                   /note="similar to uniprot|P40508 Saccharomyces cerevisiae
FT                   YIL077C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21240"
FT                   /db_xref="GOA:C5DBT3"
FT                   /db_xref="InterPro:IPR012470"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBT3"
FT                   /protein_id="CAR21240.1"
FT                   /translation="MDDNRKSDGQGERKTALMESPWFKEAYNSALKFYEKDSALDSKDR
FT                   LELSRTFVSIARAELWGGWAAFALVFGAPFGYRLYKTGAVRGVKVPRNFVLGLFAMFTT
FT                   TQACGRYAFNSKLAQLQNDGNFTPRGSFGDDDDQSRPETNQQRQYEMMKLVGYGMAPKW
FT                   GNYFYTTFHNPEKRLPNPKVKLQEMKEGKTSNISPILNQRDPLGLYTGPGSEKKRGIPQ
FT                   GNGEQSGATSSTSDKDGVETGTTTGSSWDRLRQENGITTKSPGGRWSQIRKAPSDGSDI
FT                   FGSSQPSQSSQFSEQPTDDSQGAEGAQEDFDALLEKERRGEDTV"
FT   gene            complement(<431378..>433600)
FT                   /locus_tag="KLTH0A05192g"
FT                   /old_locus_tag="KLTH-ORF16400"
FT   CDS_pept        complement(431378..433600)
FT                   /locus_tag="KLTH0A05192g"
FT                   /old_locus_tag="KLTH-ORF16400"
FT                   /product="KLTH0A05192p"
FT                   /note="highly similar to uniprot|P04801 Saccharomyces
FT                   cerevisiae YIL078W THS1 Threonyl-tRNA synthetase
FT                   cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21241"
FT                   /db_xref="GOA:C5DBT4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBT4"
FT                   /protein_id="CAR21241.1"
FT                   /translation="MSVKEAVNRVEEKVKDLVLDNKDNKSSEKGNGKSKNKQDSKQSSL
FT                   YLDPEPDFIDERNQLFDKLLKEYQEKVEQMPRVPIKVVLKDGSEKEATAWETTPMDIAK
FT                   QIAKSFPDKQCISKANGQLWDLERPLEGKEGDEVKLEFFDFDSDEGKRVFWHSSAHVLG
FT                   EACECNLGAHICLGPPTEDGFFYEFAVKNAPNAPADAPERTVSQNDFPALESVSKNVIK
FT                   EKQKFERLVMSKEDLLKMFHYSKFKTYLVSTKVPDGGSTTVYRCGKLIDLCVGPHIPHT
FT                   GRIKAFKLLKNSSCYFLGDSNNDSLQRIYGISFPDKKLMDAHLKFLAEASMRDHRKIGR
FT                   EQELFYFNEMSPGSCFWLPHGTRIYNNLVDLMRAEYRKRGFDEVITPNMYNSKLWETSG
FT                   HWGNYKENMFTFEVEKETFGLKPMNCPGHCILFKSRERSYKELPWRVADFGVIHRNEFS
FT                   GALTGLTRVRRFQQDDAHIFCAQNQIEQEIENCFSFLQYVYGVFGFEFKMELSTRPEKF
FT                   VGEIETWNNAEAKLESALRKWGGNWELNPGDGAFYGPKIDIKISDALRRWHQCATIQLD
FT                   FQLPNRFELEFKSKDNQENENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQ
FT                   VLVVPVGVKYQEYAQEVRDKLCEQDFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQE
FT                   MTEKSVNIRNRDVIEQQGKNATIAFETVLQQLKKLKEEKRLDNVLN"
FT   gene            <434058..>435248
FT                   /locus_tag="KLTH0A05214g"
FT                   /old_locus_tag="KLTH-ORF16397"
FT   CDS_pept        434058..435248
FT                   /locus_tag="KLTH0A05214g"
FT                   /old_locus_tag="KLTH-ORF16397"
FT                   /product="KLTH0A05214p"
FT                   /note="similar to uniprot|P40507 Saccharomyces cerevisiae
FT                   YIL079C AIR1 and similar to uniprot|Q12476 Saccharomyces
FT                   cerevisiae YDL175C AIR2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05214g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21242"
FT                   /db_xref="GOA:C5DBT5"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR016713"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBT5"
FT                   /protein_id="CAR21242.1"
FT                   /translation="MSLKNPSSSQTHDNNRNAYQENRMASLLSEYESHDTLSFVKSTTP
FT                   TPGASEGILAPSIDEVDSNPEDLRYLRGKGRYFGVDDPSDPSLDAEPKCNNCSQRGHLK
FT                   RNCPHVICAYCGIMDDHYTQQCPKAIKCANCGEEGHYRSQCPRQARRIYCTECNSKNHA
FT                   RERCPSIWRSYYLRERTFHRTLHIERVFCYNCGHQGHFGDDCSMRRSSKVPNEDGSAFS
FT                   GENLPQELKAEYSRNLKESRLRFTQEFTFDRRQRLAAPLGEGLVGKREDTASSRRNSER
FT                   KKRNKPDFGARPSQGFPKPARNVSEPFKRNPPGRRPQKSFRASSQGNRGGRGSSPGASN
FT                   SSWGDFEPLRGSRAHNKPSQRSSKFSQRSNKSSQRSAKPSSPRNAFPFKKRKKGPG"
FT   gene            <435817..>436212
FT                   /locus_tag="KLTH0A05236g"
FT                   /old_locus_tag="KLTH-ORF16394"
FT   CDS_pept        435817..436212
FT                   /locus_tag="KLTH0A05236g"
FT                   /old_locus_tag="KLTH-ORF16394"
FT                   /product="KLTH0A05236p"
FT                   /note="similar to uniprot|Q07549 Saccharomyces cerevisiae
FT                   YDL123W SNA4 Protein of unknown function localized to the
FT                   vacuolar outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21243"
FT                   /db_xref="GOA:C5DBT6"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBT6"
FT                   /protein_id="CAR21243.1"
FT                   /translation="MCFYCHCFTVSDLILYIVGFFIPPVAVLLRSGCCSSDLLLNILLT
FT                   MLGVVPGMLHAFYYITMTSPLRREENRYYYQSGWDDGRRSRHQGSPGASEREHVVREEP
FT                   SAVTPLMPNTGVGKPASGAPPPYTESV"
FT   gene            <436670..>437155
FT                   /locus_tag="KLTH0A05258g"
FT                   /old_locus_tag="KLTH-ORF16392"
FT   CDS_pept        436670..437155
FT                   /locus_tag="KLTH0A05258g"
FT                   /old_locus_tag="KLTH-ORF16392"
FT                   /product="KLTH0A05258p"
FT                   /note="similar to uniprot|Q12257 Saccharomyces cerevisiae
FT                   YDL177C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21244"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBT7"
FT                   /protein_id="CAR21244.1"
FT                   /translation="MSMSKTVFRRAFAAMRSWNESELVIDRKSKFQGRCVKINNQDEIP
FT                   GILQELVDTNKAVSKASHPHMYAWRTGEVAHEEVSTGKRGKKGVKTETTVRGLQQGFHD
FT                   GGEAGAGQRLLTLLERSGLVNILVIVTRWYGGTPLGSARFRMIAAAAAESLKAAEGK"
FT   gene            complement(<437543..>439168)
FT                   /locus_tag="KLTH0A05280g"
FT                   /old_locus_tag="KLTH-ORF16389"
FT   CDS_pept        complement(437543..439168)
FT                   /locus_tag="KLTH0A05280g"
FT                   /old_locus_tag="KLTH-ORF16389"
FT                   /product="KLTH0A05280p"
FT                   /note="highly similar to uniprot|P46681 Saccharomyces
FT                   cerevisiae YDL178W DLD2 D-lactate dehydrogenase located in
FT                   the mitochondrial matrix"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21245"
FT                   /db_xref="GOA:C5DBT8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBT8"
FT                   /protein_id="CAR21245.1"
FT                   /translation="MLRSTVRKPLQLASRVKLSTASWSASRRAVPLQAGRVWWPKVQEY
FT                   STKIQPKLTAESYPDVHRFSGFKKLADEDLSFFRSILSDSEILQAKADEDLALFNEDWM
FT                   RKYKGQSQLVLRPKSVNQVSQILKYCNEQKLAVVPQGGNTGLVGGSVPVFDEIVLSLTQ
FT                   LNKIRDFDPVSGILKCDAGVILENADSFLAEHGYIFPMDLGAKGSCHVGGIVATNAGGL
FT                   RLLRYGSLHGTVLGLEVVLPNGEILDSMNALRKDNTGYDLKQMFIGSEGTIGVITGVSI
FT                   LTPPRPKAFNVSFLGVESYEAVQKTFVQAKQELSEILSAFEFMDLNSQRLTKEHLKDVP
FT                   HPLEEEYPFYILIETSGSNKEHDDVKLETFLEKAMEDGTVLDGVVAQDETELRNLWQWR
FT                   EMIPESSQAGGGVYKYDVSLPLKDLYSLVEAANAKLTEKGLLSVEDTSKPVISAIGYGH
FT                   VGDGNLHLNVAVREYSKDVEKALEPFVYEHVSSKNGSISAEHGLGFQKKNYIGYSKNDQ
FT                   EIKMIKQLKNLYDPNAILNPYKYV"
FT   gene            <440041..>440568
FT                   /locus_tag="KLTH0A05302g"
FT                   /old_locus_tag="Klth0A.mRNA.gf.413.p"
FT   CDS_pept        join(440041..440095,440159..440568)
FT                   /locus_tag="KLTH0A05302g"
FT                   /old_locus_tag="Klth0A.mRNA.gf.413.p"
FT                   /product="KLTH0A05302p"
FT                   /note="similar to uniprot|Q04344 Saccharomyces cerevisiae
FT                   YDL125C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21246"
FT                   /db_xref="GOA:C5DBT9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBT9"
FT                   /protein_id="CAR21246.1"
FT                   /translation="MSAPVAHDAACIFCKIIKATTGEIPSFKLIETKYSFSFLDIQPTA
FT                   EAHALVIPKFHGAKLHNVPDEYLADILPVTKKLAQATGLAIDSPEGVGYNVLQNNGRIA
FT                   HQIVDHVHFHLIPKRDEKTGLVVGWPSLETDFEKLGQLHKELLAKIEAHQ"
FT   gene            <442339..>444837
FT                   /locus_tag="KLTH0A05324g"
FT                   /old_locus_tag="KLTH-ORF16378"
FT   CDS_pept        442339..444837
FT                   /locus_tag="KLTH0A05324g"
FT                   /old_locus_tag="KLTH-ORF16378"
FT                   /product="KLTH0A05324p"
FT                   /note="highly similar to uniprot|P25694 Saccharomyces
FT                   cerevisiae YDL126C CDC48 ATPase in ER nuclear membrane and
FT                   cytosol with homology to mammalian p97 in a complex with
FT                   Npl4p and Ufd1p participates in retrotranslocation of
FT                   ubiquitinated proteins from the ER into the cytosol for
FT                   degradation by the proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21247"
FT                   /db_xref="GOA:C5DBU0"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBU0"
FT                   /protein_id="CAR21247.1"
FT                   /translation="MADDKKSLLDASGVEKREEDATATAILRRKKKDNMLMVDDAVNDD
FT                   NSVIAINSNTMDLLQLFRGDTVLVKGKKRKDTVLIVLIDDELENGVCRVNRVVRNNLRI
FT                   RLGDLVTIHACPDIKYASRISVLPIADTVEGLTGSLFDVYLKPYFVEAYRPVRKGDHFV
FT                   VRGGMRQVEFKVVDVEPEEYAVVAQDTVIHSEGEPINREDEENNINEVGYDDIGGCRKQ
FT                   MAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVANETGAFFFLING
FT                   PEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLT
FT                   LMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMK
FT                   LADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREKMDMIDLDEDEIDAEVLDSLGVT
FT                   MDNFKFALGNSNPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFG
FT                   LSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKA
FT                   RAAAPTVVFLDELDSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNR
FT                   PDQIDPAILRPGRLDQLIYVPLPDEMARLSILNAQLRNTPLEPGLELSTIAKATQGFSG
FT                   ADLSYIVQRAAKFAIKDSIEAQRRALAEQQSRVKTEDVEMGDGAEAAEPAAADEEIEDA
FT                   VPYITKEHFSEAMKTAKRSVSDAELRRYEAYSQQMKASRGQYSNFSFDDSPSANQPAGT
FT                   NERSGAAFGEGAEEDDDLYS"
FT   gene            complement(<445174..>446079)
FT                   /locus_tag="KLTH0A05346g"
FT                   /old_locus_tag="KLTH-ORF16372"
FT   CDS_pept        complement(445174..446079)
FT                   /locus_tag="KLTH0A05346g"
FT                   /old_locus_tag="KLTH-ORF16372"
FT                   /product="KLTH0A05346p"
FT                   /note="similar to uniprot|P25693 Saccharomyces cerevisiae
FT                   YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
FT                   dependent kinase (Cdk) to contribute to entry into the
FT                   mitotic cell cycle essential for cell morphogenesis
FT                   localizes to sites of polarized cell growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21248"
FT                   /db_xref="GOA:C5DBU1"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBU1"
FT                   /protein_id="CAR21248.1"
FT                   /translation="MSDLEALLQFNKRRVSMEMIEFLASTSNSVIQVRTGESSAKVVSL
FT                   VDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPANVHGMETTRHRVFLGCLIIAAKNLN
FT                   DSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNLRISTQDLVTCLSPFLTPIKDQL
FT                   VSQKEDYLFFNSPVPSRSRLAAYHDSHSRSSSAMSIPSLVSSATMSTISTGGSRRTPLL
FT                   PHSNSSNIHRIDENSYTYQSTKPVPGYAAPSLAKRSPSRPEKSHLARPIIMKTGLPGST
FT                   QSVSSQNKFGIKSNWASIFK"
FT   gene            complement(<446807..>448030)
FT                   /locus_tag="KLTH0A05368g"
FT                   /old_locus_tag="KLTH-ORF16370"
FT   CDS_pept        complement(446807..448030)
FT                   /locus_tag="KLTH0A05368g"
FT                   /old_locus_tag="KLTH-ORF16370"
FT                   /product="KLTH0A05368p"
FT                   /note="similar to uniprot|O13581 Saccharomyces cerevisiae
FT                   YDL128W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21249"
FT                   /db_xref="GOA:C5DBU2"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBU2"
FT                   /protein_id="CAR21249.1"
FT                   /translation="MDTNTPLLPQSARTQKRSALQAVWRDIKIVFRSSPVNYLAVFVPL
FT                   GLFFGYSHFSDTWVFLLNFIAIIPLAAMLAYATEELADKAGSTLGGLLNATLGNAVELI
FT                   VSIIALSKGQVTIVQASMLGSILSNLLLVVGFCFVAGGYNREFQRFNQTAAQTMSSLLA
FT                   ISCASLLIPAAFRLSLPDNNKRQDLLINEKLLELSRGTSIVLLIVYVLFLWFQLKTHHH
FT                   LFEQREVETDRTVDQHTKGSKLSIKSSLAFLAGTTVLVSLCADFLVGSIDNVVASSGLS
FT                   KTFIGLIIIPIVGNAAEHVTAVIVARKDKMDLALGVAIGSSLQISLFVTPFMVLVGWAI
FT                   GVPMSLSFSPFETTTLFIAVFLSNYLLQDGESHWLEGAMSIVTYVLIAMAFYYLPDENT
FT                   MGSLIFST"
FT   gene            complement(<448483..>449877)
FT                   /locus_tag="KLTH0A05390g"
FT                   /old_locus_tag="KLTH-ORF16366"
FT   CDS_pept        complement(448483..449877)
FT                   /locus_tag="KLTH0A05390g"
FT                   /old_locus_tag="KLTH-ORF16366"
FT                   /product="KLTH0A05390p"
FT                   /note="weakly similar to uniprot|Q12301 Saccharomyces
FT                   cerevisiae YDL180W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21250"
FT                   /db_xref="GOA:C5DBU3"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBU3"
FT                   /protein_id="CAR21250.1"
FT                   /translation="MARISYVSPYFMPLVCSSKPWVSAIVFLNLVVLFVAAFSLSQLLI
FT                   SQYDDDAMFRPVGQDYFRTSLLGFFSPLALYFVRDFVLMVSPRFVLFNLFVDFPLNDWL
FT                   YLLIIFCLAYPQAQETHARSSLDDTFWHIIPRQSCIFGISWALSEFMVCLVENFYSYEE
FT                   VPSPESAKRQLESKMMQDEQDLARSNITLSKCIDVKRRTSHISENVYCHENSQPPQGAQ
FT                   SPNSAAAEGASADTVFVSFSDSSISLLRDPEQGPHPRSRNDRKRPGLYGGTVTYFPEVV
FT                   SIRKFLKDILVLNLLVADSILLAVGHALLISMYFIYVPGHNRLFTSAVIYFGSRPFGFF
FT                   VLSLVLPLSVFSFIASVFLFLWSDEDGEDYKNTRKLTSSDLHAHTSNPQSLQYITSNQL
FT                   FVVNSIYTQDISGSEGDNELGILRFFRALMTTWRSLASHQSFPIAGITVWAFAIFVGGI
FT                   VATIEQ"
FT   gene            complement(<450284..>450985)
FT                   /locus_tag="KLTH0A05412g"
FT                   /old_locus_tag="KLTH-ORF16361"
FT   CDS_pept        complement(450284..450985)
FT                   /locus_tag="KLTH0A05412g"
FT                   /old_locus_tag="KLTH-ORF16361"
FT                   /product="KLTH0A05412p"
FT                   /note="weakly similar to uniprot|Q07555 Saccharomyces
FT                   cerevisiae YDL129W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21251"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBU4"
FT                   /protein_id="CAR21251.1"
FT                   /translation="MPGTAGATAERTAHQDKPTLQVLTPEEPRASKDSPGSLGLHGSSP
FT                   ASRSPLESPSVQSTRELEVALAETIQELEAQAGDDRYAAGAALDIPRLLSVLNQSLTAI
FT                   SHWSLQARLAQLENRSAWDSRLAVENSLIKKEVEFFRNRCLSESHRSPRLVHAPSAPAS
FT                   PSRGAPARVSKPARSNPSKKALSQQQDTQQQAQQPLLRLVENHKPHPRMRRSSDNPSAS
FT                   DFVRVFHLEKL"
FT   gene            complement(<451664..>452146)
FT                   /locus_tag="KLTH0A05434g"
FT                   /old_locus_tag="Klth0A.mRNA.2942.m"
FT   CDS_pept        complement(join(451664..451870,452033..452146))
FT                   /locus_tag="KLTH0A05434g"
FT                   /old_locus_tag="Klth0A.mRNA.2942.m"
FT                   /product="KLTH0A05434p"
FT                   /note="highly similar to uniprot|P10622 Saccharomyces
FT                   cerevisiae YDL130W RPP1B Ribosomal protein P1 beta, a
FT                   component of the ribosomal stalk, which is involved in the
FT                   interaction between translational elongation factors and
FT                   the ribosome; accumulation of P1 in the cytoplasm is
FT                   regulated by phosphorylation and interaction with the P2
FT                   stalk component"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21252"
FT                   /db_xref="GOA:C5DBU5"
FT                   /db_xref="InterPro:IPR001859"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBU5"
FT                   /protein_id="CAR21252.1"
FT                   /translation="MSDAVISYASLILADAGLDITADSLTTLTKAAGASIDNIWAETFA
FT                   KALEGKDLKEILSGFHAAGSAAPAAGSASAAAAGGDAAAEEAAPEEAAEESDDDMGFGL
FT                   FD"
FT   gene            <453736..>454107
FT                   /locus_tag="KLTH0A05456g"
FT                   /old_locus_tag="KLTH-ORF16345"
FT   CDS_pept        453736..454107
FT                   /locus_tag="KLTH0A05456g"
FT                   /old_locus_tag="KLTH-ORF16345"
FT                   /product="KLTH0A05456p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21253"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBU6"
FT                   /protein_id="CAR21253.1"
FT                   /translation="MSYNTQDFLEDGDVFSFSLAQGAPASLLPSTPLSGASDLISGDDD
FT                   LLLQSPFLDAMSRDDDEDHAGDELFALENEPQLLPSYDMTHITAKAPVPSAFECVPAPD
FT                   DDEFADAAQHNYRLWLAGV"
FT   gene            <454908..>458162
FT                   /locus_tag="KLTH0A05478g"
FT                   /old_locus_tag="KLTH-ORF16338"
FT   CDS_pept        454908..458162
FT                   /locus_tag="KLTH0A05478g"
FT                   /old_locus_tag="KLTH-ORF16338"
FT                   /product="KLTH0A05478p"
FT                   /note="similar to uniprot|Q04336 Saccharomyces cerevisiae
FT                   YMR196W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21254"
FT                   /db_xref="GOA:C5DBU7"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR031335"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBU7"
FT                   /protein_id="CAR21254.1"
FT                   /translation="MSQVYKSELKDEFVDATLEERRLHENKTRKKYWLKWGPYLSERAW
FT                   ATVREDYSDSGDAWTHFPFEHAASRVFRWGEDGIFGVSDNRQLVCLNLAMWNGHDQIIK
FT                   ERMFGVTGPQGNHGEDVKELYYYIDSTPTHSYMKALYKYPFAKAYPYEELVAKNGERGY
FT                   QDREFEVYEIDGLYSSEEHGDTPYFDVVFEMAKGDDNPNDLNFRVTAYNRSDKRAGELY
FT                   LMPQVFFRNTWGWCRQTATKPELKKGGSNYIDVQCEKYGKRTAIFAPSPGGFDDEDTET
FT                   QDVEPQLLFTENESNLEKLFDSGPNPAPYAKDAFQEYVVEQNGEAVNPENKGTKSCAVY
FT                   HFPKIPPGEYVTIRYKFTDVQLAQYEDELVIDEEEFDSIFDRREEEADNFYWKITPLHI
FT                   SDELRNVQRQAFAGLMWSKQFYHFIQDQWYNGDPNVKPRPPPNRANGRNKDWKHMYTDD
FT                   ILSLPDKWEYPFFASWDTAFHCIPLSMVDPEFAKHQLDIMTREWYMHPNGQMPAYEWNF
FT                   SDVNPPVHAWAVYRVFKIERNMYKREDRVFLERVFQKLLLNFTWWVNRKDSNGQNVFEG
FT                   GFLGLDNIGVFNRSEPLPTGGTLEQADSTGWMAFFSLQMLNIALELAKENPVYEDIASK
FT                   FFEHFILISDAMSFRYTKNTESEEFQEEIKESLWNEEDQFYYDAISWGGPFKQQLPIRS
FT                   LVGLIPLYACMTLEPQILDKFPSFKKRVDWFINNKSEIFDRNIASMKYRGVGERLLLSL
FT                   VNKDRLEAILRRMLDETEFLSDYGIRSLSKYHEEHPFVMDVNGNKYEVKYLSGESDSGM
FT                   FGGNSNWRGPIWFPVNFLLIESLQRFFLYYGPEFKVECPVGSGVFLNLAEVAEELEHRL
FT                   IHVFMPDENGNRACYEGDNSEMLSQDEYFRDLVPFYEYFDGDTGRGLGASHQCGWTALV
FT                   AKWIHDAGVSCIRLPRSSRGSRSASISSKASSPVRPVMPGRMARRKSAKSLVNLTGTLL
FT                   DLTEEEKRIYQLGSVPHTQVRSTSNAGTAADKDERKGASQEQSARYEADSDFKAPTSHS
FT                   SEAKVIEDLKKKMDSFNLTDDANERADEEELLNENK"
FT   gene            complement(<458289..>458951)
FT                   /locus_tag="KLTH0A05500g"
FT                   /old_locus_tag="KLTH-ORF16334"
FT   CDS_pept        complement(458289..458951)
FT                   /locus_tag="KLTH0A05500g"
FT                   /old_locus_tag="KLTH-ORF16334"
FT                   /product="KLTH0A05500p"
FT                   /note="similar to uniprot|Q04338 Saccharomyces cerevisiae
FT                   YMR197C VTI1 Involved in cis-Golgi membrane traffic Vti1p
FT                   is a v-SNARE that interacts with two t-SNARES Sed5p and
FT                   Pep12p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21255"
FT                   /db_xref="GOA:C5DBU8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR007705"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR027027"
FT                   /db_xref="InterPro:IPR038407"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBU8"
FT                   /protein_id="CAR21255.1"
FT                   /translation="MASLLSNYEAEFKTTLEQAKTLLSVAPSQPVSQRNGTLKEVEQQQ
FT                   DELLDLVDQMEIEVNNGALDNAARSSFKAKLREYKKHVQSDVKSPLQQLMDSRNRDLLF
FT                   QGRAGEGEPGESDDQRQQLLSNHAILSRTGDKLRDATRIAVDTEGVGSQIMMDLRSQRE
FT                   TLENARQTLFQADSYVDKSIRTLKTMSRRLVANKFISYAIIAVLILLILLVLFSKFK"
FT   gene            <459409..>459897
FT                   /locus_tag="KLTH0A05522g"
FT                   /old_locus_tag="KLTH-ORF16332"
FT   CDS_pept        459409..459897
FT                   /locus_tag="KLTH0A05522g"
FT                   /old_locus_tag="KLTH-ORF16332"
FT                   /product="KLTH0A05522p"
FT                   /note="similar to uniprot|Q12184 Saccharomyces cerevisiae
FT                   YPL252C YAH1 Iron-sulfur protein of the mitochondrial
FT                   matrix homologous to human adrenodoxin involved in heme a
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21256"
FT                   /db_xref="GOA:C5DBU9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBU9"
FT                   /protein_id="CAR21256.1"
FT                   /translation="MFRIAGLSKSLLRGPLAVGRANIMVPKYAGFAQSALRFHGHVHKP
FT                   KPGEELHVTFILKDGSQRQYEVSAGDTLLDIAQANNLEMEGACGGSCACSTCHVIVDPD
FT                   YYDALEEPDDDENDMLDLAYGLTETSRLGCQIKMSKDIDGIRVALPAMTRNVSNTDFD"
FT   gene            <460303..>462198
FT                   /locus_tag="KLTH0A05544g"
FT                   /old_locus_tag="KLTH-ORF16331"
FT   CDS_pept        460303..462198
FT                   /locus_tag="KLTH0A05544g"
FT                   /old_locus_tag="KLTH-ORF16331"
FT                   /product="KLTH0A05544p"
FT                   /note="weakly similar to uniprot|Q01649 Saccharomyces
FT                   cerevisiae YMR198W CIK1 is important for proper
FT                   organiziation of microtubule arrays and establishment of a
FT                   spindle is essential for karyogamy and expression is
FT                   regulated by KAR4 and mating spindle pole body associated
FT                   protein and to uniprot|Q12045 YPL253C VIK1 Protein that
FT                   forms a complex with Kar3p at the spindle pole body,
FT                   possible regulator of Kar3p function in microtubule-
FT                   mediated processes; required for sister chromatid cohesion"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21257"
FT                   /db_xref="GOA:C5DBV0"
FT                   /db_xref="InterPro:IPR031852"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBV0"
FT                   /protein_id="CAR21257.1"
FT                   /translation="MTHTKIPQMSQTRIPGHKRAMSSPPGSATKRLHILEDVTNTNSIA
FT                   RLPGTKMSVAVDSNTRLMNKYYYGDPKVIEAVKVRERKIARDIQHFRKSIAEIDAETKL
FT                   IQETNLPNLDYDMSKKNTLCNELRKELVQLTTSLDEKNGECELMESNWELTVKHLQLEH
FT                   EVNLQKARNEIDQALCEARERWEEKLREMENFRPDSGIIEEIEELKEERLQEEKKLNAL
FT                   EASNKRACTMRDQELDIEFQKFLLEKQKPSEELREKCQVQREKNKQLTEEILCFENQLE
FT                   ESTRDCARLYEAITRIEKLIKACLEEREELLERRTKVEASFRETELTTQKVQTEASAVE
FT                   SKYNAQFDKMEKEQLRRRKMENSIDEMRAKVRCFAYIGDKVPPSCEIDYPAKKISMIGT
FT                   NSGQSSVFSRIIPRKLIPEKDLIGQECQAYLDMCTAKGLNCNIISLPTDRQQHLRECFL
FT                   QYFVNSNTHKLSVQYVALSEKMPSSDLLVDPEDSKGDELQLTIKEDAIEMSSRSVELES
FT                   PQDITDAFSGLELHSRVGDISVMKLKVYNKSEDYFDAYFLEINDDQTIKNISNLSNKNR
FT                   FVKTPITIILQTLLLKTKSLILCNLFDGRTSDPCLVLESVHQIGRLDVPRKLNER"
FT   gene            complement(<462287..>463582)
FT                   /locus_tag="KLTH0A05566g"
FT                   /old_locus_tag="KLTH-ORF16329"
FT   CDS_pept        complement(462287..463582)
FT                   /locus_tag="KLTH0A05566g"
FT                   /old_locus_tag="KLTH-ORF16329"
FT                   /product="KLTH0A05566p"
FT                   /note="similar to uniprot|Q12060 Saccharomyces cerevisiae
FT                   YPL254W HFI1 Adaptor protein required for structural
FT                   integrity of the SAGA complex a histone acetyltransferase-
FT                   coactivator complex that is involved in global regulation
FT                   of gene expression through acetylation and transcription
FT                   functions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21258"
FT                   /db_xref="GOA:C5DBV1"
FT                   /db_xref="InterPro:IPR024738"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBV1"
FT                   /protein_id="CAR21258.1"
FT                   /translation="MSVVQPQNTPVSPGSVHKQTGVTVSAHGQKPGGALTGTPTGTTVP
FT                   GNQTNRLNIEKMVESLTAALGKESWSKYAQIISLFVLGKLSRKELVNELDLLFSPQQEN
FT                   QGQLMQGSNMSHGTLIRMHNQLLLAILTNSVRGSPLGESTEGSWGFNNGTTHSSKKRSN
FT                   KHNSQIDTYKKIVMSLPAEDRSRLKTITKEAGKRGFVLCSVLQARLNNIPKIPIVTNPE
FT                   TLKRIKASNLKTPLEWSQEIVNGFSAPLATESYSLPDNDSLYLRMISIAREHGLVGAVD
FT                   GRCVEIMTLALENYLKNVVESAIDTVRYREKYHSDYYDLNEEGFYQGVAGTDEEVACEG
FT                   NELTRDLRSITNEEMAQTLSVFPNLVAPTGAYLNLSMCGLLNDDELVTMASTIDDLPEF
FT                   QEDKPNFTPVDDKNVGSREELNWLIKDILTKE"
FT   gene            complement(<463948..>465078)
FT                   /locus_tag="KLTH0A05588g"
FT                   /old_locus_tag="KLTH-ORF16326"
FT   CDS_pept        complement(463948..465078)
FT                   /locus_tag="KLTH0A05588g"
FT                   /old_locus_tag="KLTH-ORF16326"
FT                   /product="KLTH0A05588p"
FT                   /note="weakly similar to uniprot|Q12365 Saccharomyces
FT                   cerevisiae YPL255W BBP1 Protein required for the spindle
FT                   pole body (SPB) duplication localized at the central plaque
FT                   periphery forms a complex with a nuclear envelope protein
FT                   Mps2p and SPB components Spc29p and Kar1p required for
FT                   mitotic functions of Cdc5p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21259"
FT                   /db_xref="GOA:C5DBV2"
FT                   /db_xref="InterPro:IPR029328"
FT                   /db_xref="InterPro:IPR029330"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DBV2"
FT                   /protein_id="CAR21259.1"
FT                   /translation="MIWNNDDTEHSTGGLYRWTMDALFGRQISPSRKFKEVSQDDTNYN
FT                   MKSHKDKQWDGHGFQPRTRSSSASFDRSFLQRYELLQDEEEQDIMRPVRSPARPYLSAG
FT                   HAAGQDAALANDESTDTFSNKRQRFKGKFSGPKYHDESLKFRAPAKNDPFISKLFQRES
FT                   PEHPSNLPGKFPSPFKQALGLPAGVQVQLDPEEQIPQKMFTDEYLQLLAELDQNGQKLK
FT                   QLQQGLHQKQQDHILQETSYREKYHVMRQELITELKQSKKLYDNYYRLYEKHKKMRALD
FT                   TDASRLRQRISDLEAQVVDASIEKAEEVRKLNETIFQLEFREQETQSKHERERIRYQSR
FT                   IAELESIVESRLSISNGVQNPPLRERIKPVNSSARI"
FT   gene            <465309..>466430
FT                   /locus_tag="KLTH0A05610g"
FT                   /old_locus_tag="KLTH-ORF16323"
FT   CDS_pept        465309..466430
FT                   /locus_tag="KLTH0A05610g"
FT                   /old_locus_tag="KLTH-ORF16323"
FT                   /product="KLTH0A05610p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21260"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBV3"
FT                   /protein_id="CAR21260.1"
FT                   /translation="MGILYDHEEWAVYAEGKQLLIWREGTLVNEWTVQGIQDYQFYTAE
FT                   DELVIIGNWGQGLTRLRIKEGTEELSEESALRTSFHIAQFQILPSSGVILAYDKVAGVL
FT                   HLFNSREERYQGFIKAHPAQTSFSSHGPSEFQVFVRDFDPASLVIKTYLNRYRLRGSNA
FT                   SLINTIPMEGLFIKRWVVRSACGAFFAVISTSECEQACQLKFFLQDASIPFHTETLEGH
FT                   AVSAAFVSPLKLFLILRLAQGNALCLLNLESSHTHQLLSLEAEFIRSSHEIDEAGNFTQ
FT                   PSSVPAITHLDSNLKLVNSSSNSIFFVMNSAPNILFCWSFTKNIDSHLDTWAFPAKVVS
FT                   LGELNSATVAAVCLTENPTSLSKIEISQPFSGP"
FT   gene            <467019..>468533
FT                   /locus_tag="KLTH0A05632g"
FT                   /old_locus_tag="KLTH-ORF16320"
FT   CDS_pept        467019..468533
FT                   /locus_tag="KLTH0A05632g"
FT                   /old_locus_tag="KLTH-ORF16320"
FT                   /product="KLTH0A05632p"
FT                   /note="similar to uniprot|P20437 Saccharomyces cerevisiae
FT                   YMR199W CLN1 role in cell cycle START; G(sub)1 cyclin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21261"
FT                   /db_xref="GOA:C5DBV4"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014399"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBV4"
FT                   /protein_id="CAR21261.1"
FT                   /translation="MGVSNGIPQGLIVTAKQTYYPIELSNAELLAHYEMIQDYHQEISA
FT                   NVISQSCKFKPDPKLIDQQPEMNPQQTRQQVMAVLFELSVKTRVTNGIFFHAARLYDRY
FT                   CSKRVVLREQAKLVIATCLWLAAKTWGGCNHIINNVSVPTGGRFYGPNPRARIPRLSEL
FT                   VHYCGGADVFDESMFMQMERHILDTLSWDIFEPMVNDYVLNVDENCLLQYELYKRQLEH
FT                   NKEWFHRASQSSDSDATEADEEEDEDLVDKIQLINIKKFLIDLATWQYDLLKFEMFEVA
FT                   HGIFAIINKFTGQDQGPLLLSPLPTSTNQSLLLRIFINAVVKAPKQLLQFYENSQGVNQ
FT                   FVAAVRDFHASRQKKVQIASGMDLSGRPTVCYEVPSMPSPPHPNVNYTPMRNTSAPSDV
FT                   SIFSAAESQPSPVTPVMYSFANNKTNSGSACGSVLSVNSLSNKRSRADDYDCMDEDKEN
FT                   QPHNPTFAPPPRAKFVGNSIFASGGTSATNSNRSSLVSLAISNNIV"
FT   gene            <468827..>469576
FT                   /locus_tag="KLTH0A05654g"
FT                   /old_locus_tag="KLTH-ORF16318"
FT   CDS_pept        468827..469576
FT                   /locus_tag="KLTH0A05654g"
FT                   /old_locus_tag="KLTH-ORF16318"
FT                   /product="KLTH0A05654p"
FT                   /note="similar to uniprot|Q03691 Saccharomyces cerevisiae
FT                   YMR200W ROT1 Protein that may be involved in cell wall
FT                   function mutations in rot1 cause cell wall defects suppress
FT                   tor2 mutations and are synthetically lethal with rot2
FT                   mutations"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21262"
FT                   /db_xref="GOA:C5DBV5"
FT                   /db_xref="InterPro:IPR019623"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBV5"
FT                   /protein_id="CAR21262.1"
FT                   /translation="MLGALSLISLLAFTATVMGDSDSDALYGTWTSKSNQVFTGPGFFD
FT                   PVDELLIEPSLPGYSLSFTKDGYFEEAAYRVSGNPQDPHCPTAVLIYQHGTYEVQSNGS
FT                   LTLTPFEVDGRQLLSSPCTDNGTSVYSRYNQTETFKSFLVQLNNYHGVKELQLYEFDGT
FT                   AMMPLYLAYQPPVMLPTITLNPTASATSTETGSHNKRSLRGLVKRGLENRYKTSAVKRN
FT                   REPVNAAAYWWTSVGLIAFGSAVFFVF"
FT   gene            <469968..>471845
FT                   /locus_tag="KLTH0A05676g"
FT                   /old_locus_tag="KLTH-ORF16316"
FT   CDS_pept        469968..471845
FT                   /locus_tag="KLTH0A05676g"
FT                   /old_locus_tag="KLTH-ORF16316"
FT                   /product="KLTH0A05676p"
FT                   /note="similar to uniprot|P40343 Saccharomyces cerevisiae
FT                   YNR006W VPS27 hydrophilic protein has cysteine rich
FT                   putative zinc finger esential for function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21263"
FT                   /db_xref="GOA:C5DBV6"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017073"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBV6"
FT                   /protein_id="CAR21263.1"
FT                   /translation="MSAAVSTPSQLDSLIQRATSESIPNGEIDLSLALEVSDVIRSRRV
FT                   PPKECMRCIKKRIMSSRSNPNRSLSAWRLTEVCLKNGGVPFIKEVCSREFMDSLEHAIL
FT                   QEESNDELEILCKGMLQDLYVAFRNDSQLNYVSKVYQRLEAKGVDFPSNPSRHSELAAA
FT                   MFDSKTPADWIDSDTCMICSNKFSLLNRRHHCRSCGGIFCQEHSSRFIPLPDLGIYDNV
FT                   RVCDNCFDDYETKKQSDKKRKKKKKGHGKSSSVRDQEEEELKKAIELSLRDARSEDTFV
FT                   PVVPVQKAPSPQAIDEEEDEDLKAAIAASLRESEEAKRRQQERQQTPVAEGYSVPDVPP
FT                   PLPSNELTTSEEDDIQLFASLVERMKYQPPTAILEDTQLQQLYRKVMGTVPKLNIALSE
FT                   TSHKYNTLMNMNGKISDIMNIYDSLLEKQLQSINLNQQYFMPQLPSDPYAYYNVGQQNS
FT                   PHVNPAALPQQNQHIQVSSPALNRQHVSESKVPSMPASELRPLEGHASPNHIEQLKSIA
FT                   IEQEAPQKQSLSSPRPYPDETQEEQNPCLSDPYPNGISKNGPAQAPSDPPYPNDDEEKE
FT                   ESLRQAHPKLDKITNFDFPTVPVQQPPVEEHVKEEPEEANEQEQLLIEL"
FT   gene            complement(<472128..>473270)
FT                   /locus_tag="KLTH0A05698g"
FT                   /old_locus_tag="Klth0A.mRNA.2929.m"
FT   CDS_pept        complement(join(472128..473150,473244..473270))
FT                   /locus_tag="KLTH0A05698g"
FT                   /old_locus_tag="Klth0A.mRNA.2929.m"
FT                   /product="KLTH0A05698p"
FT                   /note="similar to uniprot|P28519 Saccharomyces cerevisiae
FT                   YMR201C RAD14 Protein that recognizes and binds damaged DNA
FT                   during nucleotide excision repair subunit of Nucleotide
FT                   Excision Repair Factor 1 (NEF1) contains zinc finger motif
FT                   homolog of human XPA protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21264"
FT                   /db_xref="GOA:C5DBV7"
FT                   /db_xref="InterPro:IPR000465"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR022656"
FT                   /db_xref="InterPro:IPR022658"
FT                   /db_xref="InterPro:IPR037129"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBV7"
FT                   /protein_id="CAR21264.1"
FT                   /translation="MNAEQKARIEANRQRALEKLKKRGIIRSEQAEKIESRNEPRPKPA
FT                   APELAQSVAENKAKALERYKHHQQNLRDASSNINQSVELDKSSGRKRPLDRIRPTVRKQ
FT                   DYIEYDLATMKNSYGGFINAEEDFSEGPENKKQQSLEEWQKAQKERKALYENAPPPDHP
FT                   SLAPRCIECHINTELDPLLHDVFKLQICKACAKAIPEKYSLLTKTECKEDYFLTDPELN
FT                   DQELFHRFEKPNPHSGTFARMQLFVRCEVEEFAYKKWGGEEGLDNEWQRREEGKAQRRE
FT                   KKYQAKMKEMRVKTRAQEYTKKLLERKHGKEHVHEFSTAIDGGLNEEGIKLSKRRCIGC
FT                   GLEVNEIAL"
FT   gene            complement(<473454..>474338)
FT                   /locus_tag="KLTH0A05720g"
FT                   /old_locus_tag="KLTH-ORF16312"
FT   CDS_pept        complement(473454..474338)
FT                   /locus_tag="KLTH0A05720g"
FT                   /old_locus_tag="KLTH-ORF16312"
FT                   /product="KLTH0A05720p"
FT                   /note="similar to uniprot|P40344 Saccharomyces cerevisiae
FT                   YNR007C ATG3 Protein involved in autophagy E2-like enzyme
FT                   that plays a role in formation of Atg8p-
FT                   phosphatidylethanolamine conjugates which are involved in
FT                   membrane dynamics during autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21265"
FT                   /db_xref="GOA:C5DBV8"
FT                   /db_xref="InterPro:IPR007134"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="InterPro:IPR019461"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBV8"
FT                   /protein_id="CAR21265.1"
FT                   /translation="MIRSKLASWREYLTPVTHTSTFQSSGQITPEEFTQAGDYLCHMFP
FT                   TWEWNSTSKDVSYRDFLPKEKQFLVTRKVPCSARAEQLTTVEGAEEGDNADGWVVEGQV
FT                   KTRSTEEHANADIEDMLEGMDLEEVEQDDDDMVAIAPNDRRFYDLYITYSTSYRVPKIY
FT                   LVGFNGDGSPLTPEQMFEDISPDYRTKTATIERLPFQHTHVTSVSIHPCKHANVMRVLM
FT                   ERIREVKQRKNASLANTTNPSSGRGKEGDEDWEDIQNDVEGGLRVDQYLIVFLKFVSSV
FT                   TPGIEHDYTMEGW"
FT   gene            <474516..>476417
FT                   /locus_tag="KLTH0A05742g"
FT                   /old_locus_tag="KLTH-ORF16309"
FT   CDS_pept        474516..476417
FT                   /locus_tag="KLTH0A05742g"
FT                   /old_locus_tag="KLTH-ORF16309"
FT                   /product="KLTH0A05742p"
FT                   /note="similar to uniprot|P40345 Saccharomyces cerevisiae
FT                   YNR008W LRO1 Acyltransferase that catalyzes diacylglycerol
FT                   esterification one of several acyltransferases that
FT                   contribute to triglyceride synthesis putative homolog of
FT                   human lecithin cholesterol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05742g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21266"
FT                   /db_xref="GOA:C5DBV9"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBV9"
FT                   /protein_id="CAR21266.1"
FT                   /translation="MGVKNRRKRQESSPESVTDKGQEKRHGAAASHRHVHKKSKKSSQE
FT                   SKKTWRESRRIVFSLGAILGLLIAVYAGAYGGKTNNTLFDNFVNFDSLQDYVDDWKEIL
FT                   PQGLMSLISDAQRTTSPKDLTESFAVGKQLHKDMNLTDKHPVIMVPGVISTGIESWGLY
FT                   GDEECSSEAHFRKRLWGSFYMLKTMVLDKVCWLRHVMLDPETGLDPANFTLRAAQGFEA
FT                   ADFFMAGYWIWNKVLQNLGAIGYDPNKMATAAYDWRLAYLDLERRDSYFSKLKQKIEMD
FT                   YKLTGEKTVLVGHSMGSQVVFYFLKWVEAEGPLYGNGGVGWVEKYVDSFVNVAGTLLGA
FT                   PKTVPALISGEMKDTIQLNALAMYGLEKFFSRKERVDMIQTWGGVPSMLPKGGSMIWGT
FT                   NEVSVEDNTHNNSHSFGEFIRFERESQSVFSQRSFSMDDSIDLLLRLSPTWLQKRIKDQ
FT                   YSFGVATSEKQMRENELHHTYWSNPLEVPLPDAPSLKIYCIYGVGNPTERAYVYKEDPE
FT                   HPDLNITIDYESSNPVSFTDGDGTVPVVTHAMCQKWAQGRSPYNPSNASVKIIEIKHQP
FT                   ERFDIRGGAKSAEHVDILGSAELNEYVLKIAGGKGDSIEPRELTNLSQWVRDMPFPM"
FT   gene            <476615..>477211
FT                   /locus_tag="KLTH0A05764g"
FT                   /old_locus_tag="KLTH-ORF16307"
FT   CDS_pept        476615..477211
FT                   /locus_tag="KLTH0A05764g"
FT                   /old_locus_tag="KLTH-ORF16307"
FT                   /product="KLTH0A05764p"
FT                   /note="weakly similar to uniprot|P53718 Saccharomyces
FT                   cerevisiae YNR009W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21267"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBW0"
FT                   /protein_id="CAR21267.1"
FT                   /translation="MPAELERKPLGAVSQSRINQLKGRTHGKVGKPAATTKLPSIMSII
FT                   HQETSADTHAPETNTRGSELARPSKSAPECDFDLISEKLRIRMQLAHYKFKTKQGHLKF
FT                   RQLQPAVPAVTLSAPAEGPRDASSGTTSPLSSSQRRSKPSRRLVGSQGALRTPVKPRTL
FT                   SSHALAPRAAAESGQNTPMSVEAARSLIDLFTSQH"
FT   gene            <477538..>478206
FT                   /locus_tag="KLTH0A05786g"
FT                   /old_locus_tag="KLTH-ORF16304"
FT   CDS_pept        477538..478206
FT                   /locus_tag="KLTH0A05786g"
FT                   /old_locus_tag="KLTH-ORF16304"
FT                   /product="KLTH0A05786p"
FT                   /note="similar to uniprot|P32352 Saccharomyces cerevisiae
FT                   YMR202W ERG2 C-8 sterol isomerase catalyzes the
FT                   isomerization of the delta-8 double bond to the delta-7
FT                   position at an intermediate step in ergosterol
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21268"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBW1"
FT                   /protein_id="CAR21268.1"
FT                   /translation="MKLLYVVGVLLSTYYIMDKLLYTWLPTNCVFDPDRLVLIANKVIA
FT                   THNQMGNSTTEQLLMDVREELAKEYGDKWINPYEKDKWVFNNAGGAMGQMLILHASFSE
FT                   YLILFGSATGNEGHSGVHFADDWFTILKGTQLASLPENPSPEVYNAGDVHLMRKGYAKQ
FT                   YSMARESYALEYARGWIPFMLPFGFLDTFTSTLDFYTLGKTVWITGRDMLRHLFVNGKF
FT                   "
FT   gene            <478459..>478818
FT                   /locus_tag="KLTH0A05808g"
FT                   /old_locus_tag="KLTH-ORF16301"
FT   CDS_pept        478459..478818
FT                   /locus_tag="KLTH0A05808g"
FT                   /old_locus_tag="KLTH-ORF16301"
FT                   /product="KLTH0A05808p"
FT                   /note="some similarities with uniprot|P33308 Saccharomyces
FT                   cerevisiae YNR010W CSE2 Component of the Med9/10 module
FT                   which is a subcomplex within the RNA polymerase II Mediator
FT                   complex required for regulation of RNA polymerase II
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21269"
FT                   /db_xref="GOA:C5DBW2"
FT                   /db_xref="InterPro:IPR011425"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBW2"
FT                   /protein_id="CAR21269.1"
FT                   /translation="MASSSLSNASLAQIEALLVPNAQSSGQSSEFIPQLYYALHQVKKD
FT                   PNSSVNSLETATSSIRHRLKQCKSHIAESEECRALLSKTPEEWEAALRQRQKDLAVKQQ
FT                   VFARLERQIRDLGDH"
FT   gene            <479011..>480180
FT                   /locus_tag="KLTH0A05830g"
FT                   /old_locus_tag="KLTH-ORF16299"
FT   CDS_pept        479011..480180
FT                   /locus_tag="KLTH0A05830g"
FT                   /old_locus_tag="KLTH-ORF16299"
FT                   /product="KLTH0A05830p"
FT                   /note="highly similar to uniprot|P23644 Saccharomyces
FT                   cerevisiae YMR203W TOM40 Essential component of the
FT                   preprotein translocase of the mitochondrial outer membrane
FT                   (TOM complex) in which it constitutes the core element of
FT                   the protein conducting pore"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21270"
FT                   /db_xref="GOA:C5DBW3"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR027246"
FT                   /db_xref="InterPro:IPR037930"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBW3"
FT                   /protein_id="CAR21270.1"
FT                   /translation="MSASAPLPLGDFSKIPAIPGVSPMTDSQKRESFWSSNPIFSYLNS
FT                   VYNNIHAHRQSLALVNPGTIENLNKEVSRDVLVGQYFFTGLRADLNKAFSLNPAFQTSH
FT                   TLSVGSANLPSYAFSALFANDNMFIQGNVDNELSVSGRLNYGWDKNNITKVTLQFSQGQ
FT                   PSMCQLEQDYQGSDFSLNFKSLNPSVNSKGIFTGVAVGSILQSITPQFALGLEAIFSRG
FT                   QAGMPADAAVSYVTRYVSPKQDWIFSGQLQANGALVASFWRKVAENVEAGLETSLQASM
FT                   VPIADPVIGTPIGIQPAIEGSTTLGCKYEYRQSVFRGAIDVNGKVGCFLERKILPTLSV
FT                   LFSGEIDHFKQESKLGCGLQFETAGSEELLMLQQGLDPNGNPLQAPVQV"
FT   gene            complement(<480862..>482028)
FT                   /locus_tag="KLTH0A05852g"
FT                   /old_locus_tag="KLTH-ORF16297"
FT   CDS_pept        complement(480862..482028)
FT                   /locus_tag="KLTH0A05852g"
FT                   /old_locus_tag="KLTH-ORF16297"
FT                   /product="KLTH0A05852p"
FT                   /note="weakly similar to uniprot|Q03694 Saccharomyces
FT                   cerevisiae YMR204C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21271"
FT                   /db_xref="GOA:C5DBW4"
FT                   /db_xref="InterPro:IPR024758"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBW4"
FT                   /protein_id="CAR21271.1"
FT                   /translation="MSGLKASGSTAGEALIRAQQKDPANGAKPSKKKQQSPFKSIKNTL
FT                   LLRSHKHKKSGANAELVSLNPPKLRRDIVGKSASREKADQKCQQRFSAQRVTLFKYEHV
FT                   KVMNCNASSQRSNSDSSASTVTSQSTVLRRSSSRDNPSSGSFKRETCLMSNGVLEIYQI
FT                   ITYNVKSPPQKMTYLCLGRKGNIIHPILPRLQVTRLDSPEFKISILLFNPERFWEIEFL
FT                   PSGELAKLNDQIIFEFEGIISTICSYKSEKSLALDEALPPQQTPGTPDSNESDLEYLLE
FT                   DSDESFDENVSITGSTCNKDDLIHDAFQKAMKNIAYLDASEKGRGIENKRFSSYPTSSI
FT                   PSRLQYRSPIVRSTSFPLRLHSNNNDIVNFNILRGSWMDISLDDLRDK"
FT   gene            complement(<482307..>485327)
FT                   /locus_tag="KLTH0A05874g"
FT                   /old_locus_tag="KLTH-ORF16295"
FT   CDS_pept        complement(482307..485327)
FT                   /locus_tag="KLTH0A05874g"
FT                   /old_locus_tag="KLTH-ORF16295"
FT                   /product="KLTH0A05874p"
FT                   /note="highly similar to uniprot|P16862 Saccharomyces
FT                   cerevisiae YMR205C PFK2 Beta subunit of heterooctameric
FT                   phosphofructokinase involved in glycolysis indispensable
FT                   for anaerobic growth activated by fructose-2 6-
FT                   bisphosphate and AMP mutation inhibits glucose induction of
FT                   cell cycle-related genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21272"
FT                   /db_xref="GOA:C5DBW5"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBW5"
FT                   /protein_id="CAR21272.1"
FT                   /translation="MRNSVSITSSFYDFIKDKLREVRPKRANLAQRRSKSNFSTSESIF
FT                   LSIEMTVDIPLVNGTSECTVTAYSKDTYQSAVDFYAQFLQLEQESAAGTSTFLRNSNVA
FT                   LEVVLVEDSKKHAASEERLQKLTSSLETADWRSLVSDSLVFKAVDVAQCKANLEEQKAS
FT                   YQAYPTDLFPMELYAVDPVGNVVGVTKTKNAVSAMPTAPPASKGSFTSTAPSSAQSTID
FT                   LTSAGSMSISDSLTAEPKGSEQKAIAVMTSGGDAPGMNANVRAIVRTAISKGCRAYVVM
FT                   EGYEGLVRGGPEYIKQFNWEDVRGWSSEGGTNIGTARCMEFRERAGRLLGALHLIEAGV
FT                   DALIVCGGDGSLTGADLFRSEWPSLLEELRDTGKITSEQYTRYKHLNICGTVGSIDNDM
FT                   STTDATIGAYSSLDRICRAIDYIEATANSHSRAFVVEVMGRNCGWLALMAGIATTADYI
FT                   LIPEKPASSREWQDQMCDIVSKHRSRGKRTTIVVVAEGAIANDLTPISPNDVHKVLVDR
FT                   LGLDTRVTTLGHVQRGGTAVAYDRILATLQGVEAVNAVLESSPDTPSPLIAINENKITR
FT                   KSLVDSVRLTKSVAEAIHAKDFKKAMSLRDTEFVEHLNNFMAVNSADHNPPKLPQEKRL
FT                   KIAIVNVGAPAGGINSAVYSMATYCMSQGHRPYAIYNGWSGLARHESVRSLDWKSMLGW
FT                   QSRGGSEIGTNRVTPEEADIGMIAYYFQKYQFDGLMIVGGFEAFVSLHQLERARENYPA
FT                   FRIPMVLIPATLSNNVPGTEYSLGTDTALNALMDYCDVIKQSAASTRGTAFVVDVQGGN
FT                   SGFLATNASLAVGAQVSYVPEEGISLEQLSEDIETLRESFETAQGRNRFGKLILKSKNA
FT                   SKVFTPEVLAEVMTSEAKGSFSAKSAIPGHVQQGGLPSPIDRTRATRLAIKAVGYIEQQ
FT                   QEVIAKARADDEEFDPDNKEISATAAVLGIKGSHVVFSSIRQIYDFETEVVKRMPKVIH
FT                   WESTRAIADSLVGRKKV"
FT   gene            complement(<486445..>487485)
FT                   /locus_tag="KLTH0A05896g"
FT                   /old_locus_tag="KLTH-ORF16287"
FT   CDS_pept        complement(486445..487485)
FT                   /locus_tag="KLTH0A05896g"
FT                   /old_locus_tag="KLTH-ORF16287"
FT                   /product="KLTH0A05896p"
FT                   /note="highly similar to uniprot|P50107 Saccharomyces
FT                   cerevisiae YML004C GLO1 Monomeric glyoxalase I catalyzes
FT                   the detoxification of methylglyoxal (a by-product of
FT                   glycolysis) via condensation with glutathione to produce S-
FT                   D-lactoylglutathione expression regulated by methylglyoxal
FT                   levels and osmotic stress"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05896g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21273"
FT                   /db_xref="GOA:C5DBW6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBW6"
FT                   /protein_id="CAR21273.1"
FT                   /translation="MHSVARYLGRLTNVYRLPAIRKMSSEAKFYPIKIEAAQNDASLKL
FT                   NHTCVRVKDPQRSVEFYKSKFGMELVGHKKFPDAKFDLYFLSFPKSNLQHNSRGEIDVF
FT                   RENGMLELTHNYGTESDPTFKVNNGNEEPYRGFGHICFSVADIEKTCKDLEEKGVAFKK
FT                   KLTDGRQKNIAFALDPDGYWIELVSYGRSDSGEPVKDEGYKFNHTMVRVKDAQKSLEFY
FT                   QNVLGMKILDISKHENAKFTLYFLSYDGAKPRWMQESVLELTHNWGTESDPDFQYHNGN
FT                   SEPQGYGHICISLEDPETLCKEIESQYGDKVQWGVKFNQGKMKNLAFIKDPDGYSIEVV
FT                   PYGLCT"
FT   gene            complement(<487673..>490363)
FT                   /locus_tag="KLTH0A05918g"
FT                   /old_locus_tag="KLTH-ORF16284"
FT   CDS_pept        complement(487673..490363)
FT                   /locus_tag="KLTH0A05918g"
FT                   /old_locus_tag="KLTH-ORF16284"
FT                   /product="KLTH0A05918p"
FT                   /note="similar to uniprot|P20095 Saccharomyces cerevisiae
FT                   YNR011C PRP2 RNA-dependent ATPase in the DEAH-box family
FT                   required for activation of the spliceosome before the first
FT                   transesterification step in RNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21274"
FT                   /db_xref="GOA:C5DBW7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBW7"
FT                   /protein_id="CAR21274.1"
FT                   /translation="MSGTISGTGKRRLKSHDVVDDAPIKKPKAHEEGASQNDGLQAQQK
FT                   STDLNTGEVDHNIDEMRILARRQYLASREQLKLQVLQQELVFLEKDVEKYGWEQLTQKE
FT                   RDEITLKRELVALVQQREDAGKHGFKFQDDYIDENGSIDLNRKQQLLKRKPAQNGEKES
FT                   RQKLWEDQQMKNAVRAASGAEEIYVEGSQGYDFVFDDEAMIEFTEDSNEDVLPEEHSEY
FT                   DNKLLTELERENKRLLTIQETRKSLPVYHFRQELLTSIKENQILIVVGETGSGKTTQLP
FT                   QYLVEDGYTQRGRYQIACTQPRRVAATSVAARVADEMNVVLGKQVGYSIRFEDKTTPDT
FT                   TILKYMTDGMLLREFMTDPELSKYACIMIDEAHERTLATDVLLGLLKDILPHRKDLKLI
FT                   ISSATMNATKFSSFFYDAPIFNVPGRRFPVDIHYTLQPEANYLNAAVTTIFQIHTTQAL
FT                   PGDILVFLTGQEEIEAAQQSLEDIAHALGDKIKDMVIAPIYANLPQEQQSKIFQKTPQD
FT                   CRKIVLATNIAETSLTIDGIKYVVDPGFVKENSYVPSTGMSQLLTVPCSRASVDQRAGR
FT                   AGRVGPGKCFRIFTKWSYFHELEPLPKPEILRTNLSQVVLLLLSLGVTDLINFPLLDKP
FT                   SIPALSKALENLYILGALNSKGVITRLGRMMCEFPCEPDFGKVIHTAATHESCKGALEE
FT                   VVTIVAMLHETASIFVHARAERDQNKTAVVGKVSSDHMLYLRTFNSWRDMDYSKSWCFD
FT                   HKVQYKTMVRVRNIRDQLWRCCDKLGLAALNEKAMKSLNVDENLEPRIIKSFIAGFPTN
FT                   VARLSPTGYRTLGKSQGGVNVSIHPTSTVFQAARQDMKKPSKLILYQRLVLTSKEFMRD
FT                   CMPVPREDWLQEMVPHYFNGDNTQD"
FT   gene            <490562..>492037
FT                   /locus_tag="KLTH0A05940g"
FT                   /old_locus_tag="KLTH-ORF16281"
FT   CDS_pept        490562..492037
FT                   /locus_tag="KLTH0A05940g"
FT                   /old_locus_tag="KLTH-ORF16281"
FT                   /product="KLTH0A05940p"
FT                   /note="similar to uniprot|P27515 Saccharomyces cerevisiae
FT                   YNR012W URK1 converts ATP and uridine to ADP and UMP
FT                   Uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05940g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21275"
FT                   /db_xref="GOA:C5DBW8"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBW8"
FT                   /protein_id="CAR21275.1"
FT                   /translation="MGGLESNSNSNLSLFIGPEDGSQELRRTGDPADHGPRYIPPWTTP
FT                   YVIGVGGSSGSGKTSVAAKIISSINTPWTVLISLDNFYKPLTQEQREQAFQNNFDFDEP
FT                   DSIDLDLAYECIRSLKEGKKTSIPLYSFVHHNRVPGKSVTIYGSSVIVVEGIYALHDKR
FT                   LLDLMDLKVFVDVDLDVCLARRLSRDIISRGRELDGCIQQWEKFVKPNAEKYVNPSMKN
FT                   ADVIIPSMGNNAVATQTVINHIKSRLQVKSRKHLQELRNLGHTKELKPLSEMGNVHQLE
FT                   HTSQVVALKTILLDKYTPRDDFVFYFDRIASILISRALDDMPLHPQKQITTPTGIKVTA
FT                   PSVHFDKVASINIVRSGDCFMRSLKKAVPGMAMGKLLIQSDSNTGEPQLHCEFLPPGLE
FT                   NYEQVLLADAQIISGAAVIMAIQVLLDHGVPLSKIKVLVYLATEIGIRRIVNAFSGSVT
FT                   IHAGEIVATEALGTHHCKWARKRFVDSQYFGCD"
FT   gene            complement(<492119..>494842)
FT                   /locus_tag="KLTH0A05962g"
FT                   /old_locus_tag="KLTH-ORF16279"
FT   CDS_pept        complement(492119..494842)
FT                   /locus_tag="KLTH0A05962g"
FT                   /old_locus_tag="KLTH-ORF16279"
FT                   /product="KLTH0A05962p"
FT                   /note="similar to uniprot|P27514 Saccharomyces cerevisiae
FT                   YNR013C PHO91 Low-affinity phosphate transporter deletion
FT                   of pho84 pho87 pho89 pho90 and pho91 causes synthetic
FT                   lethality transcription independent of Pi and Pho4p
FT                   activity overexpression results in vigorous growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21276"
FT                   /db_xref="GOA:C5DBW9"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBW9"
FT                   /protein_id="CAR21276.1"
FT                   /translation="MTASLYTSNLRHVAEVSRTCLRSRACPGGYSPVGDLPVHRQIASL
FT                   IKVPRASHRSLALLPHRPMKFSHSLQFNAVPEWSSRYIAYSQLKRLIYTLQKEKLYQSS
FT                   VSDPELVPLHDSYEHKFLEALDKELHKIDAFFAQQETRIFASYHELKDDVAEFYAQQPL
FT                   HEFLSRRSSASGASAVSEGLRPALRHAASLSDDDDDDDDDDDDDDDDDGHNNRAGNGGH
FT                   ANSTNNSGFRRRGNSASEMVPLVSRSTHYAGLLDPLMEDRINLKKRLVVAYTQLSELKS
FT                   FIELNQTGFSKICKKFDKSLDTNVKPGYIASLSSRAHVFSPAALADIDASIGDAISMYA
FT                   RLLGLSTDPNQDPAAIEEAERELSLHLREHVVWERNTVWKDMMNLERQAQNFKTAAHAK
FT                   RKATQKSLDDEVRMSPSPDELPNATLTDALHMTPAHYFRVLLRSPGILRFTGITAIFLL
FT                   ILEFVPIRDTLQKNCLSIVIYASMLWATETIPLFVTSLLVPLLIVVLPVLKDSEGNVMT
FT                   SQQSSQYILSTMWSSVIMLLLGGFTLAAALSKYNVAKVVSTHVLASAGTNPKIILLTNM
FT                   CVALFVSMWVSNVAAPVLCYSIIQPLLRTLPKNSSFAKSLILGIALASNIGGMASPIAS
FT                   PQNIFSIGMMDPQPTWGQWFIVALPVCAICTLGIWVMLLISFPVDRSLKLLQLHPIKDP
FT                   FTVQQWYVTLVTIVTIVLWCMAKQLSGIFGEMGIISIIPILLLFGTGMLSSSDFNNFMW
FT                   TIVVLAMGGTTLGKAVTSSGLLASIANTIKDHVQDKPIFLIVLIFGIVILVMATFVSHT
FT                   VAAMIIVPLMSEIGKNLPNGDHSRLLIMIAALLCSAAMGLPTSGFPNVTAISMIDELGD
FT                   RYLTVGNFITRGVPASIWSYFVITTVGYGLMKLIGY"
FT   gene            <495293..>495949
FT                   /locus_tag="KLTH0A05984g"
FT                   /old_locus_tag="KLTH-ORF16269"
FT   CDS_pept        495293..495949
FT                   /locus_tag="KLTH0A05984g"
FT                   /old_locus_tag="KLTH-ORF16269"
FT                   /product="KLTH0A05984p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21277"
FT                   /db_xref="InterPro:IPR031426"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBX0"
FT                   /protein_id="CAR21277.1"
FT                   /translation="MESSENRPVDAHLVVRYAVAEDNGETGAGSAEGAAWEHGSRRGSV
FT                   QGTSICVVEPWRGPGQGSTPEAAPTRRLSASMRVSDLYQCVHSRETSMSGPGALWGAGG
FT                   EEVSPGTSPGTSPRTSVAQQGAGGVETRVPTAAAAPPPSRNSSLLSSSSQQSPRSRTGS
FT                   QDSEALGACPGHECASHDAHGDCWIDASTPCDRHHHRRKSTAIKFRKALYEDPGT"
FT   gene            complement(<496157..>500506)
FT                   /locus_tag="KLTH0A06006g"
FT                   /old_locus_tag="KLTH-ORF16265"
FT   CDS_pept        complement(496157..500506)
FT                   /locus_tag="KLTH0A06006g"
FT                   /old_locus_tag="KLTH-ORF16265"
FT                   /product="KLTH0A06006p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21278"
FT                   /db_xref="InterPro:IPR012965"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBX1"
FT                   /protein_id="CAR21278.1"
FT                   /translation="MIKIRAFTKKLSGGFDSPKAHKKRSVSEYDKKHESSRSARSSMRR
FT                   RAISSTQNIKTELPPLPTQEYTLSTASTASQDDTLGSPARASRSGKHYIYDQEAYKKAS
FT                   SALAKPDPNYSILNKKNGINPTSAKDVMHYLVLHFKHTLIQQTTGESDKKMDSIKAAME
FT                   IFRPNLSHYVSHEVGETIHILESFFPLDGCSLTGDALKKEINEQIGTSKHKLILALRII
FT                   WSKLPLGVVPWESYLKFCTVESKQNFSKMCFENFLPQVLPDNDYKCCAFDFMDVLVSII
FT                   SMVDLVVDKAAQMDLLFTAGQVCFVKTPELLNYIDHKDSENADCITLAKLYRARGEALY
FT                   RLFVSYLNSLAEEGKIKNFYLIDNFRIDEYPPKPYRPVTQRALTLTIPQLWDPEENNFN
FT                   ELIRVAAKTQIRTYSSNHPFSKLENSFLDKFEENPYKIVSTLFSRSSKRYLYKFDPHFD
FT                   AEYFKPLSKKYGTPSTLGPGDQQAVATWINSCKERGFNDFLSVLDDNNHGEGTLALGFS
FT                   FPKVSQEESESLPPVRVSKVEISECFISSWKYETFLAKVHNTLVIKLTKRIGDCEWLVI
FT                   AMDERVGNFGYVAPSKPNESAKERDWSTLSTPPLPSKNPASYHSASDSMSSVKTRPPPP
FT                   SLLGEPSSSPLLDSATGVFSDRSSVRLSSRPTSDLTSVYSNVRHHTKNNSSFDQRKFSA
FT                   FDVHESPLQHSSPRLSSQSEHVTKVGSHSSKVSSRVISVSSPLSEVRDDEETQPLRTEK
FT                   KEATETPSVQHKSHSNKNDANESQLQQPKTGAEAAAKPEISRGLESPLKLDRVPASQGT
FT                   AKVENSARVEEPLKSEQTEKVGQHAEAEKCAEAKTPVNAENPVKVEEPLKAEESLKFEK
FT                   PEETEEPEKTEKPEKTGEALKANKPLKTEEPLKAEEPVKAKEVVENEEPVKATGDEKFV
FT                   KAEEPSKLEKPYEVGRSAEINESVKTEEQPKIEEHAKAEEPVRGEELLKAKEFSKVKQL
FT                   AQLDDEPKVETTIKSNDINENTVPLCGQSPTEKEETVQSSSPDENVEAKNALAESAANR
FT                   TLHAEENYSLSKNGKNLTQLRLSKGSTDSDSSGETSSDQEISSLESAVEVPEVHGQKPG
FT                   FGHSSETLTIGDNLAKNERKQKGLSESTQTTIDWAQQSEPSDSAKKPESESKADSKAEV
FT                   TLQSPLAIKLKYEDSSLSVSTPVNALPPNGLPQLPMKVQNPSVASFADATVKPDSAEST
FT                   MDTSETTQVQEEPKAKAKAATKNPEPYSGSIQKRNSRVVEELRKSKILSNDVLTEDLLS
FT                   DLLENYDTLSTEPINSENGPTVFERVRVYFERQAANAEEAFSGSTDGDSPATRESHTES
FT                   LNSKNGTWFSCNVTPPNRSGKRVKNPKNLQLHGTERAAGGPDGSGALSRTPSVAGRGLE
FT                   KNGVWLELEDHPSSPAEMSSPTQAMFRHMMMKTKRSLRSLKKSSDAA"
FT   gene            <502053..>503246
FT                   /locus_tag="KLTH0A06028g"
FT                   /old_locus_tag="KLTH-ORF16256"
FT   CDS_pept        502053..503246
FT                   /locus_tag="KLTH0A06028g"
FT                   /old_locus_tag="KLTH-ORF16256"
FT                   /product="KLTH0A06028p"
FT                   /note="similar to uniprot|P53720 Saccharomyces cerevisiae
FT                   YNR015W SMM1 Dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21279"
FT                   /db_xref="GOA:C5DBX2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBX2"
FT                   /protein_id="CAR21279.1"
FT                   /translation="MVTYTGKLVLAPMVRAGELPTRLLALKYGADLVWSPEIIDKKLIQ
FT                   CKRQVNDKLKTIDFVAPSSNDNKPPCVVFRTFPDAERGRLIFQMGTSTPSLAVEAAMVV
FT                   IKDVDGIDVNAGCPKHFSIHSGMGAALLKTPETLCSILSSLVEKVGRPHEKPISVKIRI
FT                   LDSEELTLNLVKKLCGTGISNLTVHCRTTPMRNRQAPIRNYVPSIYKICQANNVSLIMN
FT                   GAIQSLEHFRQLRKQMDLPETIGGMMADCAEANPTVFSEAPLSWPDTARAYLDLASKFD
FT                   HSVNNVKYMLSRIIPGKSKFYQYFTRCKTMEEVMYVSQQMGSDGEVLSDPTDYLAKRRE
FT                   HERILKQKAGDMKAKAKQKQDQTTANKDSAEAELTNSEKRREGGLEVGMGKKRAKIE"
FT   gene            complement(<504244..>510936)
FT                   /locus_tag="KLTH0A06050g"
FT                   /old_locus_tag="KLTH-ORF16252"
FT   CDS_pept        complement(504244..510936)
FT                   /locus_tag="KLTH0A06050g"
FT                   /old_locus_tag="KLTH-ORF16252"
FT                   /product="KLTH0A06050p"
FT                   /note="highly similar to uniprot|Q00955 Saccharomyces
FT                   cerevisiae YNR016C ACC1 Acetyl-CoA carboxylase biotin
FT                   containing enzyme that catalyzes the carboxylation of
FT                   acetyl-CoA to form malonyl-CoA required for de novo
FT                   biosynthesis of long-chain fatty acids or YMR207C
FT                   uniprot|P32874 Saccharomyces cerevisiae YMR207C HFA1
FT                   Mitochondrial acetyl-coenzyme A carboxylase, catalyzes the
FT                   production of malonyl-CoA in mitochondrial fatty acid
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21280"
FT                   /db_xref="GOA:C5DBX3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBX3"
FT                   /protein_id="CAR21280.1"
FT                   /translation="MSEESLSEVGVSQKDQYEVTDYTSKHASLAPHFLGLNTVEKAEDS
FT                   PLKEFVKCHGGHTVISKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDL
FT                   EANAEYLRMADQYVEVPGGTNNNNYANVDLIVEIAERADVDAVWAGWGHASENPLLPER
FT                   LAKSPRKVIFIGPPGNAMRSLGDKISSTIVAQHASVPCIPWSGTGVDQVHLDKENGLVS
FT                   VTDDVYQKGCCDSPEDGLAKAKQIGFPVMVKASEGGGGKGIRKVEREEDFIPLYKQAAN
FT                   EIPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKP
FT                   DTFSEMERSAVRLGKLVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVTGVN
FT                   LPAAQLQIAMGIPMHRVKDIRLLYGVDPHTATEIDFDFSSKDSKQIQRKPTPKGHCTAC
FT                   RITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVSSSGGIHSFSDSQFGHIFAFGENR
FT                   QASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEGNSITTGWLDDLISQKMTAEKP
FT                   DPTLAVICGAATKVFIASENGRKEFITSLQKGQVPNKSLLQTMYPVEFIHDGKRYKFTV
FT                   AKSADDRYTLFINGSKCEVGVRKLSDGGLLIAVGGRSHTIYWKEEVSATRLSVDSMTTL
FT                   LEVENDPTQLRTPSPGKLVKFLVENGDHVNAGQPYAEVEVMKMQMPLVSQESGIVQLLK
FT                   QPGSTVSAGDILAILALDDPTKVKHAMPFEGMLPDMGAPIVEGTKPAYKFRSLVSTLEN
FT                   ILNGYDNQVIMNASLQQLIEVLRNPQLPYSEWKMQSSALHSRLPIKLDEQLEQLVNRSL
FT                   SRNAHFPARQLGKMLEAAQKESDDPLFGTVIEPLLDISTRYADGLEAHEHSVFAKFLQN
FT                   YYQVEKLFSGTNVREEDVILKLRDENAENLDRVALTVLSHSRVSAKNNLILAILKHYQP
FT                   LCKMSSEVSSRISEPLKQIVELESKATAKVALQAREILIQAALPSVRERTDQIEHILRS
FT                   SVVQTAYGAFDNKRTDPDLEILKDLIDSNYVVFDVLTQFLTHRDPSVAAAAAEVYIRRA
FT                   YRAYTIGDLKHYNHANNAVVEWKFQLPSAAFASVPQMKSKLGMHRAISVSDLTYVSEGD
FT                   NQPLRTGILIASTHLDDVDEGLSKGLQLVPHHTSSSGPVPDRSGSNATLSNVANVSVSS
FT                   TDGFESEEEVLRRLREILDMNKQQLVEASIRRITFIFGYEDGTYPKYFTFRGPSYAEDE
FT                   TIRHIEPALAFQLELGRMSNFNIKQLFTENRNIHVYEATGKNSAVDKRFFTRGIIRTGR
FT                   ISDDITIQEYLTSEANRLMSNILDNLEVIDTSNSDLNHIFIHFSAVFDVSPEDVEAAFG
FT                   GFLERFGKRLLRLRVAAAEIRIIIKDPQTGAPVPLRALINNVSGYVVKTELYTEVKNAQ
FT                   GEWVFKSLDKPGSMHLRPIATPYPAKESLQPKRYKAHLMGTTYVYDFPELFRQATVSQW
FT                   KKISPKTKLSDEFFIANELIEEEDGELTEIDREAGANTIGMVAFKVTVKTPEYPRGRQF
FT                   VIVANDITFKIGSFGPQEDAFFNKVTEYARKRGIPRIYLSANSGARIGVAEELIPLFNV
FT                   SWNDPENPAKGFQYLYLSSEGMAELKKQAKDASVVTERVVEDGEERFVIKSIIGADDGL
FT                   GVECLKGSGLIAGATSRAYKDIFTITLVTCRSVGIGAYLVRLGQRAIQIEGQPIILTGA
FT                   PAINKLLGREVYSSNLQLGGTQIMYNNGVSHLTAEDDLAGVQKIMEWLSYVPARRDLPV
FT                   PILETEDKWDREVDFTPSTSEPYDVRWMIEGRNTPEGFEYGLFDKGSFQETLSGWAKGV
FT                   VVGRARLGGIPLGVIGVETRMVENMIPADPANPVSTESLIQEAGQVWYPNSAFKTAQAI
FT                   NDFNYGEQLPLMIMANWRGFSGGQRDMYNEVLKYGSFIVDALVGYKQPIFTYIPPTGEL
FT                   RGGSWVVVDPTINAEQMEMYADVNSRAGVLEPEGMVGIKYRREKLLATMARLDETYKNL
FT                   KTQMSDPGLSVEKHQEIATKLAAREKMLMPIYHQITVQFADLHDRSGRMVAKGVISKEL
FT                   DWPEARRFFFWRLRRRLNEEYLMKRLNTELPNAPRLEKIARLSSWYPASVDREDDRIVA
FT                   NWIEENYSVLEEHLKALKVESFAQNLAKSIRSDHENAISGLSEVLKLLSAEDKAKILNS
FT                   LK"
FT   gene            <512774..>513424
FT                   /locus_tag="KLTH0A06072g"
FT                   /old_locus_tag="KLTH-ORF16234"
FT   CDS_pept        512774..513424
FT                   /locus_tag="KLTH0A06072g"
FT                   /old_locus_tag="KLTH-ORF16234"
FT                   /product="KLTH0A06072p"
FT                   /note="similar to uniprot|P32897 Saccharomyces cerevisiae
FT                   YNR017W MAS6 Essential protein of the mitochondrial inner
FT                   membrane component of the mitochondrial import system"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06072g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21281"
FT                   /db_xref="GOA:C5DBX4"
FT                   /db_xref="InterPro:IPR005681"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBX4"
FT                   /protein_id="CAR21281.1"
FT                   /translation="MSWLFGGSNKETEGSQKTAQDESKLQSTLGFDPSQVTNVSSIIST
FT                   PGALDPARLHPLAGLERGVEYLDLEEEQLSTMEGSRSLIPSRGWTDDLCYGTGAVYLIG
FT                   LGLGGSYGFFEGLRNIPPNSPGKLQLNTVLNHITRRGPFLGNNAGVLTLTYNLVNSTID
FT                   GLRGKHESANSVAAGALTGAIFKSSKGLKPMGYASGMMAVAAAGWCGLKSVLL"
FT   gene            complement(<513667..>515157)
FT                   /locus_tag="KLTH0A06094g"
FT                   /old_locus_tag="KLTH-ORF16233"
FT   CDS_pept        complement(513667..515157)
FT                   /locus_tag="KLTH0A06094g"
FT                   /old_locus_tag="KLTH-ORF16233"
FT                   /product="KLTH0A06094p"
FT                   /note="similar to uniprot|P25381 Saccharomyces cerevisiae
FT                   YCR045C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06094g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21282"
FT                   /db_xref="GOA:C5DBX5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034193"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBX5"
FT                   /protein_id="CAR21282.1"
FT                   /translation="MRTSLIGALVATSASLAQAEEFLVRLKAPRTLAKAVESRISDGIL
FT                   DVFSEGKILRTFSFGKFEGLTVDFPLSLVSKLRGNPLIAEIVPNVEFNVFDAVEGLEGW
FT                   GDDEDEDGDYDDDNEEGEDEGDDDVLSIVAQKKAPRHLARISRRTALPYDPENISVPAT
FT                   NFSYYYDDEFSGTCVNAYVIDTGIYKEHPQLEGRAKFGADLVGEGPGDFNGHGTHVAGL
FT                   IGSRKFGVAKDVSLIEVKALNAKGQGNLTSVISAIEFTVNHCRKSRRGCVANLSLGSFR
FT                   NTVLNQAVEAALEAGVVIVVAAGNSNANACWSSPASSLSAITVGAFDDRTDTIARFSNW
FT                   GNCVDIFAPGVKIESLSNVPPFKPVAFSGTSMASPIVSGMVANLLDSGIHPFDIKTELI
FT                   DLATDSVFHKRTLLFKPGTPNRVAFTGIDKTDDVYEDAVYPSVDIDRLVKDLQSYNSDG
FT                   HVAEDDATLPLGEIKIKKRSQIVTTLAPPHLSPHSQLA"
FT   gene            <515543..>516289
FT                   /pseudo
FT                   /locus_tag="KLTH0A06116g"
FT                   /old_locus_tag="pseudo-Klth0A-515543-516289"
FT   gene            <517260..>517925
FT                   /locus_tag="KLTH0A06138g"
FT                   /old_locus_tag="KLTH-ORF16225"
FT   CDS_pept        517260..517925
FT                   /locus_tag="KLTH0A06138g"
FT                   /old_locus_tag="KLTH-ORF16225"
FT                   /product="KLTH0A06138p"
FT                   /note="similar to uniprot|P53721 Saccharomyces cerevisiae
FT                   YNR018W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06138g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21283"
FT                   /db_xref="GOA:C5DBX6"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="InterPro:IPR040153"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBX6"
FT                   /protein_id="CAR21283.1"
FT                   /translation="MKILTEEEIEAHHYHTLSGGVKGTVAGLVISGLLFRYAPVKFPKF
FT                   QPKRMPWSLKTAMFITPPTLLASIGAEEASTSFDNMMYGSGSASRDAIEEHRRWKSLPL
FT                   SEKLTEGASNHKYKIIVAAWAASMWGSWKFVDRDPIMTKTQKAVQARMYAQGLTVMLLL
FT                   GSIGLSMYEEKLHPDAKKLDRSKRWERLLERAEEEEARAQKEAGFRSNEDRVKAKIFK"
FT   gene            complement(<518116..>518625)
FT                   /locus_tag="KLTH0A06160g"
FT                   /old_locus_tag="KLTH-ORF16222"
FT   CDS_pept        complement(518116..518625)
FT                   /locus_tag="KLTH0A06160g"
FT                   /old_locus_tag="KLTH-ORF16222"
FT                   /product="KLTH0A06160p"
FT                   /note="similar to uniprot|P25626 Saccharomyces cerevisiae
FT                   YCR046C IMG1 Mitochondrial ribosomal protein of the small
FT                   subunit required for respiration and for maintenance of the
FT                   mitochondrial genome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06160g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21284"
FT                   /db_xref="GOA:C5DBX7"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBX7"
FT                   /protein_id="CAR21284.1"
FT                   /translation="MLGFRGFSKTFSRGYQVKSTTFKTIPVYPAVQSPSNHNLLSSLSK
FT                   QELDKKLDPEGWRRSLISSHNKERLRAGDVVRVAYNQQKCKYDNLMGYVLSVDRKALEQ
FT                   DASILLRNQYSKTFVEVRVPIFSPLVERIDLIRRADGRRQRSKHYYIRGTKLDVGDLEA
FT                   GMRKRR"
FT   gene            complement(<518948..>519754)
FT                   /locus_tag="KLTH0A06182g"
FT                   /old_locus_tag="KLTH-ORF16220"
FT   CDS_pept        complement(518948..519754)
FT                   /locus_tag="KLTH0A06182g"
FT                   /old_locus_tag="KLTH-ORF16220"
FT                   /product="KLTH0A06182p"
FT                   /note="highly similar to uniprot|P25627 Saccharomyces
FT                   cerevisiae YCR047C BUD23 Protein involved in bud-site
FT                   selection diploid mutants display a random budding pattern
FT                   instead of the wild-type bipolar pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06182g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21285"
FT                   /db_xref="GOA:C5DBX8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR022238"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039769"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBX8"
FT                   /protein_id="CAR21285.1"
FT                   /translation="MSRPEDLAPPEVFYNDSESQKYTSSTRVQHIQAKMSLRALELLNL
FT                   SHMSFVLDIGCGSGLSGEILTEEGHVWCGVDISPSMLATGLTRELEGDLMLHDMGQGLP
FT                   FRAGTFDAAISISAIQWLCNADTSYNDPKQRLMRFFNTLFACLKKGGKFVAQFYPKNDD
FT                   QTEQILGAAKVAGFSGGLVVDDPESKKNKKYYLVLSAGASQEEEQVNLQGVTMNAEELA
FT                   KTKRDRRKEVESNKVYINRKKELMRKRGRKVAKDSKFTGRKRRPRF"
FT   gene            <521514..>523202
FT                   /locus_tag="KLTH0A06204g"
FT                   /old_locus_tag="KLTH-ORF16216"
FT   CDS_pept        521514..523202
FT                   /locus_tag="KLTH0A06204g"
FT                   /old_locus_tag="KLTH-ORF16216"
FT                   /product="KLTH0A06204p"
FT                   /note="similar to uniprot|P53629 Saccharomyces cerevisiae
FT                   YNR019W ARE2 Acyl-CoA:sterol acyltransferase isozyme of
FT                   Are1p endoplasmic reticulum enzyme that contributes the
FT                   major sterol esterification activity in the presence of
FT                   oxygen"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21286"
FT                   /db_xref="GOA:C5DBX9"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR014371"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBX9"
FT                   /protein_id="CAR21286.1"
FT                   /translation="MTKDPKRPKKVLTQEFEKIQEISKNTESRRPLPGVETGMEEYGSE
FT                   NVPKKQDEEPLYKSYAAVLHNKEKHRFHWQTGEMRSLFGDVGFDRRNTIMDNLVESSLT
FT                   ETSFKGAGWGKLQREKEIEAVPAGADPERVFFNFSGFYVLFWMIVAFIVLRVGVDYYIS
FT                   HNGDLSQSEILRFMTTDLISVAMIDLVMYLCTYFVVFVQLACKHKWITWNNLGWYLTSA
FT                   FEVTFVLVFLYVAENVMKFHWVAKIFLFLHSLVLLMKMHSFAFYNGYLWNITAELDFSK
FT                   KTLAKYKDYTLEKGFKEALEKSVEFCEFELSLQSPNLKFPDNLTLKGYFTYSMFPTVVY
FT                   QIEYPRTEKIRWMYVFEKLCAIFGVIFVMMIVAQFFMYPIAMRAMAVRDAGMPIFWERI
FT                   REWLYLLLKLVPSFIMMYLLVWYLIWDAILNCIAELTRFGDRYFYGDWWNCVSWDEFSR
FT                   QWNVPVHQFLLRHVYHSSISFLQLNKTQATLMTFFLSSVVHELAMYVLFQKLRFYLFFL
FT                   QMAQIPLVQLGNSRFLKDKKILGNAIFWIGICTGPSLMCTLYLTF"
FT   gene            complement(<523293..>524024)
FT                   /locus_tag="KLTH0A06226g"
FT   CDS_pept        complement(523293..524024)
FT                   /locus_tag="KLTH0A06226g"
FT                   /product="KLTH0A06226p"
FT                   /note="similar to uniprot|P53722 Saccharomyces cerevisiae
FT                   YNR020C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21287"
FT                   /db_xref="GOA:C5DBY0"
FT                   /db_xref="InterPro:IPR019165"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBY0"
FT                   /protein_id="CAR21287.1"
FT                   /translation="MGDVIPPNEEIKRPKPPLDESSVRGFNWWRRTFQYKTGLGLTTVE
FT                   KDRYENDYQFIIQRDQCNKCYEYRDWLLKYSPTVIFMAQQIAKLNKKDTNALKFDESKI
FT                   ICDICPEWRSGGFHPELGILLCQNRIRDKWHLEDTMAHEMVHYFDNLKWQVDWLNLKHH
FT                   ACSEIRASSLSGECRFMQEFSRRGFGFKVSGGHQECVRRRATLSVMGNPNCKDQKHAEK
FT                   IVNEVWDSCFGDTRPFEEIYR"
FT   gene            <524183..>524791
FT                   /locus_tag="KLTH0A06248g"
FT                   /old_locus_tag="KLTH-ORF16214"
FT   CDS_pept        524183..524791
FT                   /locus_tag="KLTH0A06248g"
FT                   /old_locus_tag="KLTH-ORF16214"
FT                   /product="KLTH0A06248p"
FT                   /note="similar to uniprot|P25631 Saccharomyces cerevisiae
FT                   YCR051W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21288"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBY1"
FT                   /protein_id="CAR21288.1"
FT                   /translation="MNIWIAASDGRAELVEKFLSEGFTAESKDPNGYTPIHAAASYGHI
FT                   DLLRELCSAPYSGSVNVRDNDGDTPLHHCEDANTARVILEELGGDAKLTNNEGKTALAV
FT                   CEEDGEFTDLIQYLRGVSGQQEEPLGIDSEQLAQFKDNLRYTLENDPETDDPQSIERRQ
FT                   KLEQILNGGNPEQDLENYIRDLVRSQLLADDEPSKRRKD"
FT   gene            <525035..>526264
FT                   /locus_tag="KLTH0A06270g"
FT                   /old_locus_tag="KLTH-ORF16213"
FT   CDS_pept        525035..526264
FT                   /locus_tag="KLTH0A06270g"
FT                   /old_locus_tag="KLTH-ORF16213"
FT                   /product="KLTH0A06270p"
FT                   /note="similar to uniprot|P53723 Saccharomyces cerevisiae
FT                   YNR021W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21289"
FT                   /db_xref="GOA:C5DBY2"
FT                   /db_xref="InterPro:IPR012879"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBY2"
FT                   /protein_id="CAR21289.1"
FT                   /translation="MSILEPFLKLSNYANKLNEKYAAMPIGELRALTLAERIRFYNWTF
FT                   EIWALALLAAVYGAYVIGTRLNSRRATQLFDSLTDGFQKLAFAKVGFSTKAGEKKQYVA
FT                   EQNNTWYTTFATGRSSIESITARAHMTARYNPLTLLMERVVGLFFPSLFEKDLGEFLEV
FT                   SIVPNGIYVTSPNADLPKEDAVTAILSRFKFIASIVNKSVMTKARETNYFLSLTHTSES
FT                   EKLPVEYVFMSESNQLNGFFEHYAGPEFKDLLAKCSRFLSFVSFTDLPEEKPITDKLWN
FT                   LKQKPRCVIHCEFVTGTKDLNLLNQLIAEIVKIFDAVTQDYAQNPTKAFLTNDMLKKAS
FT                   NLRSQELQKIVKVMKQVERELAQEKKQDVEREKRRQMRSKLSGQEQDKIDQKMREKRER
FT                   RMRNRQKVRM"
FT   gene            complement(<526397..>526825)
FT                   /locus_tag="KLTH0A06292g"
FT                   /old_locus_tag="KLTH-ORF16209"
FT   CDS_pept        complement(526397..526825)
FT                   /locus_tag="KLTH0A06292g"
FT                   /old_locus_tag="KLTH-ORF16209"
FT                   /product="KLTH0A06292p"
FT                   /note="similar to uniprot|P53724 Saccharomyces cerevisiae
FT                   YNR022C MRPL50 Mitochondrial ribosomal protein of the large
FT                   subunit not essential for mitochondrial translation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06292g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21290"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBY3"
FT                   /protein_id="CAR21290.1"
FT                   /translation="MFKAPALRAYSALSKRSKKVKVQLLKDFPQFQLYKGQVTQVSPSL
FT                   MRNYLHLSNGARYILHEEEIDEGLRAESIAAAAARATSVQKAVKRQIEAAAEKIKGNDA
FT                   KESEKTKESEKPDAEKQAPRVFNSGVTINDVKIPGLDI"
FT   gene            <527454..>528776
FT                   /locus_tag="KLTH0A06314g"
FT                   /old_locus_tag="KLTH-ORF16208"
FT   CDS_pept        527454..528776
FT                   /locus_tag="KLTH0A06314g"
FT                   /old_locus_tag="KLTH-ORF16208"
FT                   /product="KLTH0A06314p"
FT                   /note="some similarities with uniprot|P53628 Saccharomyces
FT                   cerevisiae YNR023W SNF12 73 kDa subunit of the SWI/SNF
FT                   transcription activation complex homolog of Rsc6p subunit
FT                   of the RSC chromatin remodeling complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06314g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21291"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBY4"
FT                   /protein_id="CAR21291.1"
FT                   /translation="MSKPRKQSIQPQANQRTTPLPITQPTDAYIPPFLVEQVPELKSYK
FT                   QLLEAESKIDIYISRKKIDLYQSVSQWNSLKQEAQEKQYLRIFVSNIAENQAWQTNDAN
FT                   AQPSWTLRIEGRLLNDLDVNDPQRPKFSSFLQGIAVDFTRPQNADAGAQDQQQPQPLVP
FT                   SIVEWHADPSALAEFDGLDVKRDGAENVKCRIAIQPRGVTGEWIQFSPELSSIIGMSRG
FT                   TLHEAVYSLYKYILINDLLTSEDDVQAPGNPSSNSTNGERTITKIDKYLAALFPDERKT
FT                   MRLAEIPSLVNRHISPLPPIRIDYTIRVDKASTYGETVIDIEVPAVSEDEVAREGMSLL
FT                   TELNQLSTTLEPQMQALNQELNILQLQLNASANKYQFFSKLSKDPVPMLQEYMDSSSRA
FT                   LKVLSGDDGFNEDTVRRAQFYKDNEAMLFENLSVLLSNGRM"
FT   gene            <528991..>530520
FT                   /locus_tag="KLTH0A06336g"
FT                   /old_locus_tag="KLTH-ORF16206"
FT   CDS_pept        528991..530520
FT                   /locus_tag="KLTH0A06336g"
FT                   /old_locus_tag="KLTH-ORF16206"
FT                   /product="KLTH0A06336p"
FT                   /note="highly similar to uniprot|P16120 Saccharomyces
FT                   cerevisiae YCR053W THR4 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06336g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21292"
FT                   /db_xref="GOA:C5DBY5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBY5"
FT                   /protein_id="CAR21292.1"
FT                   /translation="MSKTYRSTRSSSKDTKSFEETIIQGLASDGGLFIPSEIPQVSEET
FT                   LKQWSQLSFQGLALEIMKLYISSEEIPEADLKVLIERSYSTFRSKDVTPLAKDVTGKNE
FT                   HLHILELFHGPTYAFKDVALQFVGNLFEYFLQRANKDLPQEQRKRITVVGATSGDTGSA
FT                   AIYGMRGKKDVSVFILYPTGRISPIQEEQMTTVPDQNVQTLSVKGTFDNCQDIVKAIFG
FT                   DVEFNKKHNVGAVNSINWARILAQMTYYFYAYFQATNGSPSKVKFVVPSGNFGDILAGY
FT                   YAKKMGLPVERLIIATNENDILDRFLKSGVYERSDDVAATLSPAMDILISSNFERLLWY
FT                   LARDVLASNDDQKAGEILNQWFTQLKTKGKFEVDSAVVKHALVDFDSERVSNAETTSTI
FT                   KETYANSQNPQHYILDPHTAVGVCATKRQMAKDNDKSIQYISLSTAHPAKFAEAVNEAL
FT                   SSFEGYSFEKDVLPDELKVLSTLEKKLKFVEKADVELVKSAIEEELAKMGL"
FT   gene            <530619..>532197
FT                   /pseudo
FT                   /locus_tag="KLTH0A06358g"
FT                   /old_locus_tag="pseudo-Klth0A-530619-532197"
FT   gene            complement(<532367..>535114)
FT                   /locus_tag="KLTH0A06380g"
FT                   /old_locus_tag="KLTH-ORF16202"
FT   CDS_pept        complement(532367..535114)
FT                   /locus_tag="KLTH0A06380g"
FT                   /old_locus_tag="KLTH-ORF16202"
FT                   /product="KLTH0A06380p"
FT                   /note="highly similar to uniprot|P25636 Saccharomyces
FT                   cerevisiae YCR057C PWP2 part of small (ribosomal) subunit
FT                   (SSU) processosome (contains U3 snoRNA) Eight WD-repeats
FT                   with homology with G protein beta subunits flanked by
FT                   nonhomologous N-terminal and C-terminal extensions
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06380g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21293"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027145"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBY6"
FT                   /protein_id="CAR21293.1"
FT                   /translation="MKSDFRFSNLLGTVYRQGNILFSEDGTQLISPVGNRVSVFDLVHN
FT                   KSFTFEYEHRKNISCVALNPQGTLLLSVDEDGRAILVNFRAKTVLHHLNFKEKVRDLKF
FT                   SPDGKLFALACGRFVQVWKTPEVAEDRQFAPFVRYRVHAGHFSDIISLTWSQDSRFLVS
FT                   TSKDLTARIWSLDSEEKDLASVTFAGHRDYVMGAFFSSDQERIYTVSKDGAVFQWEYTI
FT                   RPGYEALGEEPETEIDPSLYSWRITKKNYFYASQARVKCVTFHAKSNMLIVGFNNGEFR
FT                   LYELPGFTLLQQLSMGQNAVNAVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGH
FT                   FDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTSAVTGLAFAKKGQVLF
FT                   SASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAIHVWSVQT
FT                   GQLVETLDGHEGPVSCLSFSRENSVLASASWDKTIRVWSIFGRSQQVEPLEVYADVLSI
FT                   AVRPDGNEVAASTLDGQVLFFDINEGKQVGAIDGKKDIVSGRHLEDRFTAKSSARSKYF
FT                   TTIDYSFDGLSIVAGGNNNSICLYDIPNSVLLKRFIVSRNMSLNGTQQFLNSKKMTEAG
FT                   SLDLIDRDAENSDLEDRIDNSLPGSSRGGDLSTRRVRPAIRITGLKFSPTSNAFAAAST
FT                   EGILIYSVDDSLIFDPFDLDIDITPQAVIETLQEKEYLHSLVMAFRLNEEYLINRVYEA
FT                   VPLKDIELVSSGLPVVYLARMLKFIGDFAMESQHLEFNLIWIKALLSAHGHYISSHKNE
FT                   FGSCLRSVQRFIGRIAKDVVAASKDNKYAYFFLTSTDGSVEGGVSDGEDHKHVNNSDSE
FT                   DEADGSEDEVLTGASDDEEGWIGVTDTKNKLPLQLEEDSDEDLI"
FT   gene            <535357..>535836
FT                   /locus_tag="KLTH0A06402g"
FT                   /old_locus_tag="KLTH-ORF16199"
FT   CDS_pept        535357..535836
FT                   /locus_tag="KLTH0A06402g"
FT                   /old_locus_tag="KLTH-ORF16199"
FT                   /product="KLTH0A06402p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06402g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21294"
FT                   /db_xref="InterPro:IPR019324"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBY7"
FT                   /protein_id="CAR21294.1"
FT                   /translation="MSKEVSGKLSSRVMNMKFMKQADQAEEIEQEKQKVQHHVDTSEWA
FT                   LSGGEEFKSRLRPQLRTAGTTEIMEQTQSAPVVGRRKFGSQAKTEPEGTTEPGLDELWE
FT                   NQKGKKRKAGEAAGEKDEKETDQSEDEEEEAPAKRFKSQQEKTDKRERKSSKRKN"
FT   gene            complement(<535960..>536772)
FT                   /locus_tag="KLTH0A06424g"
FT                   /old_locus_tag="KLTH-ORF16198"
FT   CDS_pept        complement(535960..536772)
FT                   /locus_tag="KLTH0A06424g"
FT                   /old_locus_tag="KLTH-ORF16198"
FT                   /product="KLTH0A06424p"
FT                   /note="similar to uniprot|P25637 Saccharomyces cerevisiae
FT                   YCR059C YIH1 piecemeal microautophagy of the nucleus (PMN)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06424g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21295"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBY8"
FT                   /protein_id="CAR21295.1"
FT                   /translation="MSQEELQQELEAIDAIYPDFMERLSETQCVIKIPEHEAISVHLSF
FT                   PTGYPTQSAPQVLQVNGAHDPKALRDQFEGVMEDIWKQDVCIFDFLTEVAEACSQVSDQ
FT                   DLLLSESDVQADAALQQQLESLQLEVSAAALDVTWFQSDPVVDRGSTFIAFAAHASSEE
FT                   DACLKLDQLRMDPKVSKCQHVMTAWRIRGEGSVTYQDCEDDGETAAGGRLLHLLTLMDA
FT                   WDVVVGVARWFTGTHIGPDRFKHINSTAREAVLRGSFADASKAGKKKK"
FT   gene            <538144..>539985
FT                   /locus_tag="KLTH0A06446g"
FT                   /old_locus_tag="KLTH-ORF16191"
FT   CDS_pept        538144..539985
FT                   /locus_tag="KLTH0A06446g"
FT                   /old_locus_tag="KLTH-ORF16191"
FT                   /product="KLTH0A06446p"
FT                   /note="similar to uniprot|P25639 Saccharomyces cerevisiae
FT                   YCR061W Protein of unknown function green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm in
FT                   a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21296"
FT                   /db_xref="GOA:C5DBY9"
FT                   /db_xref="InterPro:IPR018825"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBY9"
FT                   /protein_id="CAR21296.1"
FT                   /translation="MRRSLIMAGAAAALGVAVRGDMDMDMEMGMDAGDSAEIMPMGGGS
FT                   AASKTEAGAGGSAAASAPSAVLSAVPHEPKHVHGLPILQTQLTAAERLYWENYNTTTFF
FT                   NLPEGTRGAGLARYHAAAVALATAAVYPASLVLYGARQCSARCARLYVAVVVANGALLF
FT                   SAMAALLALRGHNPVPYPGNAYAKTCYVVAVLCAVQTLAAVARFWTHDRHVTSVAGDGG
FT                   LAPADAERFELVAADRHHSHSSDGSELSAALSHQHKPEPESEPTLEFDAERALDLEAHR
FT                   RALSFHTDADSRLARVAGLVQSLTTWPLLYMLMIHCVIGLAVGNLFGEGLRVFNLLAHW
FT                   IKGGVFVLLGMLSLARYSGYGAGRGWAWNRSIVRVHPTSAVNNLRRMILPYGSVITMEY
FT                   IESFLIFFYGSTNVFLEHLSNTDGQWHAKDLQHVSIAFMYIGCGLCGLITEYKLSDWRR
FT                   KHATSDPGECQTSDSNVTGTPGYTPNPFPAFTIFWTGILMSQHAQASAVSTAIHVQWGL
FT                   LLSYGSFFRLLTFFMLIWKPNTDSKPSRPFTELVTSFCLLCGGLIFMESTDQVVEALEY
FT                   RGLTSMFTFNLSVGFTTLFMAWEMILFMWGDWLHQRA"
FT   gene            <540882..>541502
FT                   /locus_tag="KLTH0A06468g"
FT                   /old_locus_tag="KLTH-ORF16185"
FT   CDS_pept        540882..541502
FT                   /locus_tag="KLTH0A06468g"
FT                   /old_locus_tag="KLTH-ORF16185"
FT                   /product="KLTH0A06468p"
FT                   /note="similar to uniprot|Q07923 Saccharomyces cerevisiae
FT                   YLR011W LOT6 Putative NADPH-dependent FMN reductase with
FT                   strong ferricyanide reductase activity in vitro gene
FT                   expression increases in cultures shifted to a lower
FT                   temperature"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06468g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21297"
FT                   /db_xref="GOA:C5DBZ0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBZ0"
FT                   /protein_id="CAR21297.1"
FT                   /translation="MLIGVIIGSTRSPRVCPQIAQFILDTIERSKSYQELSEKPLLKII
FT                   DIADWNLPLYDESNVPSQIKRSEDYDHEHTKLWSLEIQKYNGFIFVTPQYNWGYPAALK
FT                   NAIDYLFNEWKGKSAAIVTYGGHGGTKCNEQLAVVLEGLRMIPTQSRVLLSFPDRDTLY
FT                   AAASGKDLGLSSNPSGDLWTTEKTQIEATFNELFESIVKTQDL"
FT   gene            <541900..>541994
FT                   /locus_tag="KLTH0A06490r"
FT                   /old_locus_tag="Klth0A.tSer.CGA.6"
FT   tRNA            join(541900..541936,541950..541994)
FT                   /locus_tag="KLTH0A06490r"
FT                   /old_locus_tag="Klth0A.tSer.CGA.6"
FT                   /note="tRNA-Ser (CGA) cove"
FT   gene            <542323..>542790
FT                   /locus_tag="KLTH0A06512g"
FT                   /old_locus_tag="KLTH-ORF16182"
FT   CDS_pept        542323..542790
FT                   /locus_tag="KLTH0A06512g"
FT                   /old_locus_tag="KLTH-ORF16182"
FT                   /product="KLTH0A06512p"
FT                   /note="highly similar to uniprot|P25337 Saccharomyces
FT                   cerevisiae YCR063W BUD31 Protein involved in bud-site
FT                   selection diploid mutants display a random budding pattern
FT                   instead of the wild-type bipolar pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21298"
FT                   /db_xref="GOA:C5DBZ1"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBZ1"
FT                   /protein_id="CAR21298.1"
FT                   /translation="MPRIKTKNTKATPAGFDKIKPTLIDFDIQLKELQDDKASRLAANA
FT                   DQGAWKVFQLSHERTRYVYDLYYKRKAISKELYEWLLREKYADKMLIAKWKKKGYEKLC
FT                   CLRCIQTSETAQGNTCICRVPRATLEKNSKDGVVTFTRCVHCGCSGCASTD"
FT   gene            <543130..>544806
FT                   /locus_tag="KLTH0A06534g"
FT                   /old_locus_tag="KLTH-ORF16177"
FT   CDS_pept        543130..544806
FT                   /locus_tag="KLTH0A06534g"
FT                   /old_locus_tag="KLTH-ORF16177"
FT                   /product="KLTH0A06534p"
FT                   /note="weakly similar to uniprot|P25364 Saccharomyces
FT                   cerevisiae YCR065W HCM1 Forkhead transcription factor
FT                   involved in cell cycle specific transcription of SPC110
FT                   encoding a spindle pole body (SPB) calmodulin binding
FT                   protein dosage-dependent suppressor of calmodulin mutants
FT                   with specific defects in SPB assembly"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21299"
FT                   /db_xref="GOA:C5DBZ2"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBZ2"
FT                   /protein_id="CAR21299.1"
FT                   /translation="MEASAGTAVVGVEHSKRRRDSADAAEPPTLTPPHSTLRKAGTPVK
FT                   RGKNQHPLSPELSSPIRPHKTRKSKSDTPLITTRSSNSQTLEELIEAFTDRKRLLLLQD
FT                   PNKKPPFSYAMLIGLAILQSTEVRLTLSQIYQWITYHFPYYKLGDYGWQNSIRHNLSLN
FT                   EAFVKGEKAPDGKGHYWQVKSGCEGKFFKSGQTDDEVRTKLRKLCSDVLAVTSNPRSPE
FT                   PELLGKSLYDEGTTTEVERRRLGGRKLDDVYALDISSDEDESFQEQSINNLSRVASSPV
FT                   GLREALLPFEQASANKEAINQDAFIGELSPAIPYSENDAGASETKNETAFPSLRKSYSA
FT                   DCPQQELWSAPSLTLSPKKDAKKYTCSFNANFEASPHTRTPKTGPLLEGFGSPGSELEG
FT                   VDFTGPLDLLKTPQLKHANNHEFSYTPRGNTSMKKWRTPTVLFQDFSRSPVLMNSAGPP
FT                   MMVIDDCVSEEVSCRKPDPFQLGKFCSLPLCESQTHSHKFFENIRYSSGLFGVDVCSVW
FT                   KRAVEGSRETADRSGKETLLDTPFQGTSRRASTSKEDRVYE"
FT   gene            <545636..>547018
FT                   /locus_tag="KLTH0A06556g"
FT                   /old_locus_tag="KLTH-ORF16172"
FT   CDS_pept        545636..547018
FT                   /locus_tag="KLTH0A06556g"
FT                   /old_locus_tag="KLTH-ORF16172"
FT                   /product="KLTH0A06556p"
FT                   /note="similar to uniprot|P10862 Saccharomyces cerevisiae
FT                   YCR066W RAD18 Protein involved in postreplication repair
FT                   binds single-stranded DNA and has single-stranded DNA
FT                   dependent ATPase activity forms heterodimer with Rad6p
FT                   contains RING-finger motif"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21300"
FT                   /db_xref="GOA:C5DBZ3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004580"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR039577"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBZ3"
FT                   /protein_id="CAR21300.1"
FT                   /translation="MSRLPKLSEQIQDVSDPRDFLRTKLPELVDLDTLLRCHICKGFIK
FT                   TPVLTPCGHTFCSLCIREYLNRELKCPLCLAELRESMLRSEFLVNEIIASYVGLRSKLL
FT                   EIARSGPDGTVPHSDTSLIEIAPGDEGAHELSGDDDLQIIETRRNRPAKRNAEIVLMPS
FT                   KKSRRDSEKPGISSMISKSKSPALPEDSAECPICQKHFPLEYLQRTHLDECLTMGSLGA
FT                   AAKPTSPPKIGKASNETTVSVQPAAERISEPSVSANTTHSNRYLESGQKQGVARLAKLN
FT                   FSSMSMQQLKSKLTSLKLSTIGSRQQLINRYNHYEMLWNSNFMDSIEPLEEKELRRRLA
FT                   SWEATHNSSEGTLRKGNISKLLNKNSTTRIKDFKTDRFDRKGWILAHQQEFNELLEEAR
FT                   HNLAKANKMKYSASNQDEVEDAEQAESHPNSISCEKGEIPSNQLVVKTEEISTSSQGTT
FT                   GV"
FT   gene            complement(<547101..>550316)
FT                   /locus_tag="KLTH0A06578g"
FT                   /old_locus_tag="KLTH-ORF16171"
FT   CDS_pept        complement(547101..550316)
FT                   /locus_tag="KLTH0A06578g"
FT                   /old_locus_tag="KLTH-ORF16171"
FT                   /product="KLTH0A06578p"
FT                   /note="similar to uniprot|P11655 Saccharomyces cerevisiae
FT                   YNR026C SEC12 Guanine nucleotide exchange factor (GEF)
FT                   glycosylated integral membrane protein of the endoplasmic
FT                   reticulum important for the initiation of transport vesicle
FT                   budding from the endoplasmic reticulum through activation
FT                   of the GTPase Sar1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21301"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBZ4"
FT                   /protein_id="CAR21301.1"
FT                   /translation="MSHKRTMKFQQAVYNIGYPAYGARFLNDNVLLVAGGGGEGNNGIP
FT                   NKLTALQVSFDKRKVIKRFRELTLNENDDSPTTLDAANNIILMGCNENSEKIKATGENL
FT                   HLRKYVFENEHLKFVASIDMDHSSKFEDYTKLTYMSQDGSVAAIASSKVPTVIRIMNPN
FT                   LLTETYEIETGNDVKDLHFSPDGKVLSYITSSTLEVISIVTGRFIVRKTDFDKSWALSK
FT                   IKFIGEDTVLIAAALKKGTGIVLSKVSLKSGTTSVLKTRLVTTKLRGVTSMDVDPTGQL
FT                   AALSGNDNSIVLVRLKNLTVAKFFKQVHSFAITKVAFSPNGKILASVSAANTIHVILVP
FT                   DKLATSVPILERIVKLFINFVLIVVVAAAVQISYKYDLHTKAYRYGVAKWNARRDSFIM
FT                   NDVFRQTTLVGDVVSIETHTNFAPTESSSVNTPIYETTVPELSTTSPYSSSWSSPVPED
FT                   PLLTSDASTVEEPEYFPSSLEEISAENESANSEASSSMTVSASMTASISGVQESAVSAS
FT                   EEKPTQATQKSSSESEALLSDSNDISTENGLNKSKAQQQFYEVDKTLEQQPTPTSVQSS
FT                   DVHSGISLTAGNSKGEEASPSHKISSASSGASSNISLGEPVSKLPSASKASPMDTPIEE
FT                   SSPETRVAVSEESSKSASTVPELTPKIARDVSNEKPVEKSANAIPEASTQALSPALAEA
FT                   PVKTHSSFSNQEATSLTTTPAFSATGRVASADSPKKANSEFGELQDTERERDFDLKASA
FT                   GASDAISSEEPVTENKTYDASSPSSFISDTTNTQIASSPIANSVSSTIANSSLSSESKK
FT                   AKEINTSSPSRSQEPARSEIITTTASTAVEDKSAAPTTLSQAISQDESDGSKAKTESNV
FT                   IPTQASATGIVSPVQLMASTESSNLNKVPKSSNSAQSETEVAEAKVHLSTPEELQSTEK
FT                   TDEIKTSSPHISSWGKNPSSNTNAPTNSIALPDDFENRFTPEDETYSEEKRSPIEDEEL
FT                   EADAQIYSEQVYPSQIEVADPLPQSTPEPSVSREPKDTESYSEPVGSQSGDSTAGSSSV
FT                   SASGSVEETSATSMQTEVTHDEL"
FT   gene            <550407..>551324
FT                   /locus_tag="KLTH0A06600g"
FT                   /old_locus_tag="KLTH-ORF16167"
FT   CDS_pept        550407..551324
FT                   /locus_tag="KLTH0A06600g"
FT                   /old_locus_tag="KLTH-ORF16167"
FT                   /product="KLTH0A06600p"
FT                   /note="similar to uniprot|P53727 Saccharomyces cerevisiae
FT                   YNR027W BUD17 Protein involved in bud-site selection
FT                   diploid mutants display a random budding pattern instead of
FT                   the wild-type bipolar pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21302"
FT                   /db_xref="GOA:C5DBZ5"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBZ5"
FT                   /protein_id="CAR21302.1"
FT                   /translation="MARKVLSIQSHVVHGYVGNKAATFPLQYRGWDVDALNTVQFSNHP
FT                   GYGHFKGFRSEASDLQGIIEKGLLGGLDIQYDAVLTGYLPDIEGLRAIGKTLIKLCEKD
FT                   HRVKWVLDPVLGDNGKLYVPEEAIPVYRDILTHGAVYLATPNQFEMEVLTGVQICDLAS
FT                   LKQSIQQFHELYPRVQNVVVTSVSFHSAGDSISELICACSEQESRRAHYFKVPKIDAQF
FT                   SGSGDLCSALLLDSFLTQNPAARDLCAALNQVLSLVDSILLNTFELYKASIAAPPLKIN
FT                   DLRLIESRELLKQTTAPKYVPIKL"
FT   gene            <551457..>553004
FT                   /locus_tag="KLTH0A06622g"
FT                   /old_locus_tag="KLTH-ORF16166"
FT   CDS_pept        551457..553004
FT                   /locus_tag="KLTH0A06622g"
FT                   /old_locus_tag="KLTH-ORF16166"
FT                   /product="KLTH0A06622p"
FT                   /note="similar to uniprot|P25641 Saccharomyces cerevisiae
FT                   YCR068W ATG15 Lipase required for intravacuolar lysis of
FT                   autophagic bodies located in the endoplasmic reticulum
FT                   membrane and targeted to intravacuolar vesicles during
FT                   autophagy via the multivesicular body (MVB) pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21303"
FT                   /db_xref="GOA:C5DBZ6"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBZ6"
FT                   /protein_id="CAR21303.1"
FT                   /translation="MDDTKSLKRRTRFRIFKSHLGLASFVLATICAVLLWYKKHEYTSV
FT                   SIRDRGSSQSSFRLTRTYRHGISQDPYMQVLDIDEQVLQAGQERFMEHVSMLSDEEAQD
FT                   DDMWTSKPEYSTSNPLDFEFRLASEPLRMKRMLHRDPQFVESYLDFSHENPHMAAKVNL
FT                   EWIDKTVLVPNVSDKQTVISLALMSSDAYVRLPHTGDWRNLTEPWNHTHNSGHGWENDG
FT                   LRGHLFVNSEQDIVVMAVKGTSARGLAGSGEDETTVNDQINDNLLFSCCCARISYLWTT
FT                   VCDCYMKSYTCDETCLEQELSRKDRYYKAVLNFYKDVVAEYPNSTIWVTGHSLGGALAS
FT                   LLGRTYGLPVVAFEAPGELLATRRLHLPMPPGYPDYLEGIWHFGNTADPIFMGTCNGAS
FT                   SSCSIAGYAMETSCHTGKVCVYDVVKDKGWHVSMLNHRIHKVIDGVIDSYEGPARCIPP
FT                   GPCHDCYNWKYVQKGHSSSVSQTRSPKTTSTSTVPPEPTITSSCVGRNWIGICTEYE"
FT   gene            complement(<553084..>555270)
FT                   /locus_tag="KLTH0A06644g"
FT                   /old_locus_tag="KLTH-ORF16165"
FT   CDS_pept        complement(553084..555270)
FT                   /locus_tag="KLTH0A06644g"
FT                   /old_locus_tag="KLTH-ORF16165"
FT                   /product="KLTH0A06644p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06644g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21304"
FT                   /db_xref="GOA:C5DBZ7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBZ7"
FT                   /protein_id="CAR21304.1"
FT                   /translation="MAEKSSSKVSKPRKLKKNGQRALKACDSCRRMKTRCIPSPLPEEV
FT                   QCLRCDTFNLRCSFQDLLSDDEGAETLALLKEQKSSSGTGSATYESAELTKRLLKSGYS
FT                   PEDFAVHAKLLQNVNKNVTKILELLANQAPPAAPESSSHPAAPGNPSSRAVSALTEAVQ
FT                   MMTSSSGHTLVPSGLVGPESREVSPELDDISAKRTEQRHLTPYLTCPFTMVSQMVSREN
FT                   LPLPICKIQDHEMLPQGLVDDVVGLNLLTLEEVVLLTQDFRDGYGKWCSFPESMSTEKL
FT                   VEVLRSRNASLLLSAICVLALRYTLSYHDLKTRIYKNLLYKLKSDLELSLRHNPHGIEF
FT                   IQALVVLSMYASSYSSDIMSVDAWYLSGIGLQQFLTLNIPDALFNRENDYAEPTDFFSL
FT                   GLSSPLDSAPSHLLSPESQFQKLQTSRLWNHLCLAHITNCVFSGRMCIVDGVRIDLCRR
FT                   ILDFPNSTNFDGRMVAEISMQLILYNFVQHCNVHPPKSPNSTTAFDKVHEELQVWIEEW
FT                   RYLFSQPIHPNTQYAEFAYNYSRTIVLYTWYHRCYRARKMHLAKRARVNPSRPTDLNIM
FT                   NKTSIGNYLSQEYPVEDVINSIPKDKRLDMLKHAHRSLETMINDNPENFRYLSDQLFFQ
FT                   CVHCSLVCLIIAHSLYHFSDGLLGEDHLEQILSDVKKYSLRLQKIREGELKSFWVEEVD
FT                   LKIPSVILQYHRAIETCLQDKFPEYEIHVDDGYP"
FT   gene            <556052..>556993
FT                   /locus_tag="KLTH0A06666g"
FT                   /old_locus_tag="KLTH-ORF16160"
FT   CDS_pept        556052..556993
FT                   /locus_tag="KLTH0A06666g"
FT                   /old_locus_tag="KLTH-ORF16160"
FT                   /product="KLTH0A06666p"
FT                   /note="similar to uniprot|P25334 Saccharomyces cerevisiae
FT                   YCR069W CPR4 Peptidyl-prolyl cis-trans isomerase
FT                   (cyclophilin) catalyzes the cis-trans isomerization of
FT                   peptide bonds N-terminal to proline residues has a
FT                   potential role in the secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21305"
FT                   /db_xref="GOA:C5DBZ8"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBZ8"
FT                   /protein_id="CAR21305.1"
FT                   /translation="MLVNYVLWVLSALMCFAKAATIDDAKLYAPNPPVTHRAFFTIEYF
FT                   NNATQQVEETDVTIELYGTVVPKTVDNFVKLAKGVTAVMKGKDEKKDRFTLGYKNTLFH
FT                   RIINDFMIQGGDVLPDVGPFNTFGGMFFDDENFDLKHDRPGRLSMANINKPDTNASQFF
FT                   IVTSTRALDELDGKHVVFGQVVAGLEGLLEKVQFVETTKDEYKPKHDVKLKYSLVEDLQ
FT                   ISNKEQLHEKYLQDLLAFQNGDRSKGLTMSTTIKQGAKEEKIMRELRYEDLHHPLVKVV
FT                   LGMVLISAIYVVSKNRKRIFSKTTKIVSMRHE"
FT   gene            complement(<557036..>558268)
FT                   /locus_tag="KLTH0A06688g"
FT                   /old_locus_tag="KLTH-ORF16157"
FT   CDS_pept        complement(557036..558268)
FT                   /locus_tag="KLTH0A06688g"
FT                   /old_locus_tag="KLTH-ORF16157"
FT                   /product="KLTH0A06688p"
FT                   /note="similar to uniprot|P53729 Saccharomyces cerevisiae
FT                   YNR029C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21306"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBZ9"
FT                   /protein_id="CAR21306.1"
FT                   /translation="MSALKDFSYKEDEDGDIPSLIEGNEENLSDILNSIKSDGGGTIVS
FT                   DKKIELANTQIEEAGSSEAPRVPVTIITGYLGSGKSTLLEKIALKGSDKKIAVILNEFG
FT                   DSSEIEKSMTIRNGENSYEEWLDLGNGCLCCSLQDVGVKAIESLIARCPGKIDYIILET
FT                   SGIADPRPIAKMFWQDDGLYSNVYLDGIVTVLDAENILTCLDDVSPATHWHGEKVVTDD
FT                   NITIAHLQVALADCILINKIDRLGAAANQDAVREIENRVRQINAAASLHHTSFGEVSLD
FT                   KVLDLHAFESVKFEGSSDSTMHDPRIRTVTLTFRALKDEDEFQRFLDGFLRTVHWKGFG
FT                   HDLEGDWEIQRTKGLIIVGDNCKVVQGVRETFDVLPGKRLDSAVSCKMVFIGKGISREA
FT                   LLQILKTVIEV"
FT   gene            <558390..>560036
FT                   /locus_tag="KLTH0A06710g"
FT                   /old_locus_tag="KLTH-ORF16154"
FT   CDS_pept        558390..560036
FT                   /locus_tag="KLTH0A06710g"
FT                   /old_locus_tag="KLTH-ORF16154"
FT                   /product="KLTH0A06710p"
FT                   /note="similar to uniprot|P53730 Saccharomyces cerevisiae
FT                   YNR030W ECM39 Alpha-1 6-mannosyltransferase localized to
FT                   the ER responsible for the addition of the alpha-1 6
FT                   mannose to dolichol-linked Man7GlcNAc2 acts in the dolichol
FT                   pathway for N-glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21307"
FT                   /db_xref="GOA:C5DC00"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="InterPro:IPR039485"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC00"
FT                   /protein_id="CAR21307.1"
FT                   /translation="MKLDVWDVALLAVIFLHLWYSPFTKVEESFTIQAIHDILKYGIRD
FT                   ISKYDHLQFPGVVPRTFIGPLIIAFLAKPLVAGSELLFGSDSGPSSGLRTQLLVRGVIG
FT                   FTNGLSLVFLKHQVQALFDRRNDVAQTKKEQDVSETPTNSYVGTLFALFSTTQFHLMFY
FT                   SSRPLPNFVIALPVANCAFALIMAHRFGSAIALLGFASVVFRLEMTALTAGIALSVLWF
FT                   KKASLVRVIEFGALGVMSGAALSIFVDSHFWRYSTFPEADSFLFNVVAGKSVEWGSTPF
FT                   YSYVTSSLPSLFLPPTALLLNFIGLRAAPQEVKIVAQAAYFHILILSFQPHKEWRFIIY
FT                   AVPAITLVASCGASRIFQMKGFKEANLLKAVILISSVVSLVISVAFSFISSMNYPGGEA
FT                   LQQFNEYASRRNVSNTVVHLDVPVCMTGATLFGQLEDAHNITYDKTEDLGSLRKNWDSY
FT                   DFLITSIPDPFDFPVESNDQWELLHSTKAFSGINILQLSIVLESELRDNFPTLKMLVYT
FT                   RSLAPVVDAIKGAITTDTIFTYKRSGSKFNT"
FT   gene            complement(<560106..>560624)
FT                   /locus_tag="KLTH0A06732g"
FT                   /old_locus_tag="KLTH-ORF16151"
FT   CDS_pept        complement(560106..560624)
FT                   /locus_tag="KLTH0A06732g"
FT                   /old_locus_tag="KLTH-ORF16151"
FT                   /product="KLTH0A06732p"
FT                   /note="similar to uniprot|P25642 Saccharomyces cerevisiae
FT                   YCR071C IMG2 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21308"
FT                   /db_xref="GOA:C5DC01"
FT                   /db_xref="InterPro:IPR007740"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC01"
FT                   /protein_id="CAR21308.1"
FT                   /translation="MLVRFGLRTARHQGGLVCSGLQTIRPAMRLASSSLDINSGKLDDG
FT                   RELSALTEQEINDLSTAFEEQTFSVFPRLQDVKPEELVGFAKFGVQSYFIERSATGNLP
FT                   VYTDFKRGGKVVTEIRKIHGDPVQLRNDLQARLSHLPKDSFKVMMQAKKIIIEGDVVRQ
FT                   VKEALSSKF"
FT   gene            complement(<560921..>562465)
FT                   /locus_tag="KLTH0A06754g"
FT                   /old_locus_tag="KLTH-ORF16150"
FT   CDS_pept        complement(560921..562465)
FT                   /locus_tag="KLTH0A06754g"
FT                   /old_locus_tag="KLTH-ORF16150"
FT                   /product="KLTH0A06754p"
FT                   /note="highly similar to uniprot|P25382 Saccharomyces
FT                   cerevisiae YCR072C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21309"
FT                   /db_xref="GOA:C5DC02"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC02"
FT                   /protein_id="CAR21309.1"
FT                   /translation="MATLVPPPSKKQKRQAQQPRQVDLIPEDLPHVLVKFQAFDTGESV
FT                   GGSVRVPGAMTEQQLEQLLNQLHGETDEPVPYTFSCMVDAEKGKPEQLVDIKDNIYNSI
FT                   LKPGYKTTEDFITIVYTPRAVFKVRPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAG
FT                   DNTARIWDCNTNTPMQTLKGHFNWVLCVAWSPDGELIATGSMDNTIRLWQSEKGENFGD
FT                   ALRGHSKWITSLSWEPIHLVKPGDKPRLASASKDGTIKIWDTARRVCLFTLSGHTNSVS
FT                   CVKWGGRGVLYSGSHDKTIRAWDMNAGGKCINILKSHAHWINHLSLSTDYALRVGAFDH
FT                   TGKKPSSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTG
FT                   HQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGTFIATFRGHVASVYQVAWSSDCRLL
FT                   VSCSKDTTLKVWDVRTKKLSVDLPGHKDEVYTVDWSVDGKRVCSAGKDKMVRIWTH"
FT   gene            complement(<562932..>567503)
FT                   /locus_tag="KLTH0A06776g"
FT                   /old_locus_tag="KLTH-ORF16146"
FT   CDS_pept        complement(562932..567503)
FT                   /locus_tag="KLTH0A06776g"
FT                   /old_locus_tag="KLTH-ORF16146"
FT                   /product="KLTH0A06776p"
FT                   /note="similar to uniprot|P53599 Saccharomyces cerevisiae
FT                   YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
FT                   kinase kinase kinase activator of Pbs2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21310"
FT                   /db_xref="GOA:C5DC03"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017240"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC03"
FT                   /protein_id="CAR21310.1"
FT                   /translation="MAEKDYFSFKQGYTLEDRGAPSGRHKARTRLRSGGPGTGPSRSFS
FT                   PSRQGPRSPGYYTANSLRSPPAAAGSSPLSTMKLSASAKHTMGTAMANAMGSSMGMAGP
FT                   PGGRKSRNPSVSGPSSNTAGGGGGSMSASSSMSVTSPGRQHRANSLSLSSTRMSSTQSA
FT                   ESSASVTPTLVLPPNLASLNSQSTSNMSLQGGAGHSTSSSSTSLKPMQKQYVLNEELYL
FT                   NRMKNSNLDDYYTRGIAASANDEEDETDTDAEDTDADESAFGTNFFTTTEKGGALKFDD
FT                   ELITISPKFLLARMDWLRNADPDSPDVKGLLGPQQRLPSGPSAGRTLFAAAAPPTAEGN
FT                   SYGYLQRLAKNSHVLERLEWQAMLANVLKGDIVKSEKSKIAYQGGSLNTSSQYADELWL
FT                   ELKAWMNCRTIEEEKTTLEYLRNSTDSVFQEIMDMNFADDVPVETAVNTIKPLIDRYHQ
FT                   VTSYWRTEQHMHYDKPVTGREEFIHRVAAMNTFLTLKQAFECEIEALKKWTGNDSLDVK
FT                   FTNTFYDIEGVYKNDRPFAEQILKERDIESIFQKKLFYRHAPWILKAKVSIFTLSQTVK
FT                   EMNLPLLHNELEILLMFPFKLVKEIILIRIEYAKKLQNPTMMMIDQMIDDFSSYIRLSV
FT                   QIKHTVIVYCSDWEFTTKIDADFDDAVNEAIVYLFKLLHLKLIDSARKSFKTFREPEEL
FT                   LKYWDQLKNVGCFIPGAGHVVAEGFSHLTLRLLNRLHSYILREQNHPPAFEKESDVEKW
FT                   LVQAMENCGTVKRKINRFSNVLTKAFQNSVNYRVNDNKELLKRLKESGHFLVYTGGELE
FT                   GNGVYLFCSSELLGCSDDEILKILHNVEIGSDLIPNVEINNSLSVYNALESGWDQNATL
FT                   FQEYCANGVAYYHVQSEQQNKSSGGRVRRAAAAHANPFEDFKSEEDELFELEMKLKSLG
FT                   YIIAYCPKEPILWEGEMLNLSEDKVLTMQDFDIKLPADSLVLLNQGSTYAMEYQSDKFQ
FT                   HYVGESVSFSERRCSMNAIEYTLQKINRAYFRITYSVLANMQKVTNAIQKEFRGNETLN
FT                   NLFLFCRDFARNFLRLNVATYEKKSIIIMLLMRISINWIKFLVDDCDPTDLHTFRWCVP
FT                   AMEFAMQMTTGWNILGLDEDQFSVLQEKISGCMSLLISHFDIMGARTLEAEKNNHPQVR
FT                   SYIGTCEDDTDSILAVNSKVRVEAINELEKRLKGNPRHIGKVLDESDKDNQYLQSLASS
FT                   LSNVSIRWQKRHFIGGGAFGTVFSAVNLDTGEILAVKEIKIQDRNTMKQVFPAIKEEMS
FT                   VLEMLNHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIEDEMVTQVYALQMLE
FT                   GLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKVANNGSEGKTDGVN
FT                   SMMGTPMYMSPESVTGAKKGKFGSSDIWSLGCVILEMATGRRPWFNLDNEWAIMYHVAA
FT                   GHVPQLPSRDEISPQGTDFLLKCLKQDPDKRATAMELLVHPWMIEIRKLAFGDGEEAES
FT                   SQA"
FT   gene            <567632..>568699
FT                   /locus_tag="KLTH0A06798g"
FT                   /old_locus_tag="KLTH-ORF16142"
FT   CDS_pept        567632..568699
FT                   /locus_tag="KLTH0A06798g"
FT                   /old_locus_tag="KLTH-ORF16142"
FT                   /product="KLTH0A06798p"
FT                   /note="highly similar to uniprot|P32838 Saccharomyces
FT                   cerevisiae YNR032W PPG1 Putative serine/threonine protein
FT                   phosphatase required for glycogen accumulation interacts
FT                   with Tap42p which binds to and regulates other protein
FT                   phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21311"
FT                   /db_xref="GOA:C5DC04"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC04"
FT                   /protein_id="CAR21311.1"
FT                   /translation="MELDRCLERLYAGELLPEATIRALCFKLKEKLVRESNVVHISTPV
FT                   TVVGDIHGQFHDLLEIFHIGGAAPDTNYLFLGDYVDRGLYSVETWTLLMVLKLRWPSRI
FT                   QLLRGNHESRQITQSYGFYTECVNKYGGSSDVWRQFTDVFDYLALCCVVDDELFCVHGG
FT                   LSPNVQTVDQIRVIDRFREIPHDGAMADLVWSDPEETGGQDARDGRTTGLESSSPHFQV
FT                   SPRGAGYTFGRSVVEKFLQLNGMSKIYRAHQLCNEGYQVYFGGLVTTVWSAPNYCYRCG
FT                   NKASILELYDKDNGYFNVFEEAPENKLLHHASTSGQITNNNAFLNEFFDERGGDVFSDE
FT                   YQAASASRRHVEYFL"
FT   gene            complement(<569895..>570116)
FT                   /locus_tag="KLTH0A06820g"
FT                   /old_locus_tag="Klth0A.mRNA.301AT.m"
FT   CDS_pept        complement(569895..570116)
FT                   /locus_tag="KLTH0A06820g"
FT                   /old_locus_tag="Klth0A.mRNA.301AT.m"
FT                   /product="KLTH0A06820p"
FT                   /note="similar to uniprot|Q6Q546 Saccharomyces cerevisiae
FT                   YNR032C-A HUB1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21312"
FT                   /db_xref="GOA:C5DC05"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR039732"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC05"
FT                   /protein_id="CAR21312.1"
FT                   /translation="MIEVEVNDRLGKKIRVKCEGEDTVGDFKKVLALQLGISWTKIVLQ
FT                   KGGAVLKDHITLDDYEVHDQTYLELYYL"
FT   gene            <570282..>572528
FT                   /locus_tag="KLTH0A06842g"
FT                   /old_locus_tag="KLTH-ORF16139"
FT   CDS_pept        570282..572528
FT                   /locus_tag="KLTH0A06842g"
FT                   /old_locus_tag="KLTH-ORF16139"
FT                   /product="KLTH0A06842p"
FT                   /note="similar to uniprot|Q6B1Q1 Saccharomyces cerevisiae
FT                   YNR033W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21313"
FT                   /db_xref="GOA:C5DC06"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010117"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC06"
FT                   /protein_id="CAR21313.1"
FT                   /translation="MVLNVLFVDFYDSFTYNLVSLIRDQGQHVTIIHFDSYGEDIERFW
FT                   KDLQCFDCIVLGPGPGNPENGFPDVGFMEQLFVRQVDLPVLGVCLGFQLMCKSVGCTIE
FT                   QLPSIKHGQVYDVKLSSGAETAGSLFEGYPSSFKSVRYHSLHVNCKNSDVSRIVPLAFT
FT                   DDEGGTVLMSVQVANKPWFGVQYHPESCCSELGGKLIENFLKITERHKQARVRASESSD
FT                   LSTAQGVIRNLDQTIDKSSIYQKQDLQAQNIQIEEIPIEPCTLLALQICNLLTEPFFLM
FT                   SSSTIHENRGEFSIIALPNERSTVYTHYDQVHRTLVHQWRDQRITLEGFASAAETGLSC
FT                   DGVDIINQSKHEFWKTLGTFMQPKMMANNPDIPFIGGLVGVLGYEMGQFTVHDREGKLV
FT                   PDAKMVYVENSVVVDYQKGVLMLISLNNKFPENARSAVMKIVQGSKPGTRLPQLPDGVE
FT                   YDITMPTKESYVRAYNKSQSYLNKGDSYEVCLTTQTRVVPSKRIEPWRIFQTLICRNPA
FT                   PFSSFFEFTDIKPGHSDLCLLSTSPERFLKWDADTCELRPIKGTVKKDGNTTRELATKI
FT                   LKTPKEFGENLMILDLIRNDLYELLDVVTVDELMSVEEYATVYQLVSVVKGHGLRQAPY
FT                   SGIDLLQHSLPPGSMTGAPKRKTVELLHDEIEKELNSHISPTSARGVYSGVTGYMSCND
FT                   RGDWSVNIRCMFSYDNARTWRLGAGGAVTVLSTLEGEWQEMLTKLESALQVFQN"
FT   gene            <573655..>574686
FT                   /locus_tag="KLTH0A06864g"
FT                   /old_locus_tag="KLTH-ORF16133"
FT   CDS_pept        573655..574686
FT                   /locus_tag="KLTH0A06864g"
FT                   /old_locus_tag="KLTH-ORF16133"
FT                   /product="KLTH0A06864p"
FT                   /note="similar to uniprot|P50278 Saccharomyces cerevisiae
FT                   YNR034W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21314"
FT                   /db_xref="GOA:C5DC07"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC07"
FT                   /protein_id="CAR21314.1"
FT                   /translation="MTTTVPRVFAFHEFAGVAEAVADHVVHAQNLALSKEPYALKNTGG
FT                   SNSTPANSSSLNVPGSNGAGNAPVSRQSSSRSIGHSHSAAGSGLRGPSSSKLKKIKEKR
FT                   FKIALSGGSLIQVLHEGLLKRQDVLWGKWDIYFADERLVPFESSESNFGNTKRKILDLI
FT                   DTCTYGTPRVYHINESLINDPQECADDYEKELIKGFAGRDSVKLPMFDLFLLGCAPDGH
FT                   IASLFPNFSENLRENLAWVVPVTNAPSGPSNRISLTIPVICHSHQVTFVVEGATKAPVV
FT                   KTIMERPEKGLPSSIVNEGAAGRVAWFVDDDALTDVQVTKKKYKFLVNTDASQISPSPP
FT                   VPE"
FT   gene            complement(<574848..>575597)
FT                   /locus_tag="KLTH0A06886g"
FT                   /old_locus_tag="KLTH-ORF16131"
FT   CDS_pept        complement(574848..575597)
FT                   /locus_tag="KLTH0A06886g"
FT                   /old_locus_tag="KLTH-ORF16131"
FT                   /product="KLTH0A06886p"
FT                   /note="similar to uniprot|P17261 Saccharomyces cerevisiae
FT                   YCR075C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21315"
FT                   /db_xref="GOA:C5DC08"
FT                   /db_xref="InterPro:IPR005282"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC08"
FT                   /protein_id="CAR21315.1"
FT                   /translation="MNLESALGYGYVIPWSVSIYPVVWHNWRHRSASAMSIDFVIINVF
FT                   GYLYLLLSLWLQLFCWQTGQEHEDSTRPKITAFDFYYCLHGVVMNMVVVSQVLWGNRVW
FT                   NFKSGGSPRMKPVYRKLLIGSMIVASLSAGQFLTHNFQMGWNNDNTLAFSNTLYALKIS
FT                   MSLIKYLPQVKHNYERKTLRGFPIQSVVCDVMGSLCSLAQLVVQVTRDRTPLTTAVLSA
FT                   NFGRIGIAAVTLFFNFIYISQWLVYGQ"
FT   gene            complement(<575902..>577665)
FT                   /locus_tag="KLTH0A06908g"
FT                   /old_locus_tag="KLTH-ORF16129"
FT   CDS_pept        complement(575902..577665)
FT                   /locus_tag="KLTH0A06908g"
FT                   /old_locus_tag="KLTH-ORF16129"
FT                   /product="KLTH0A06908p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06908g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21316"
FT                   /db_xref="GOA:C5DC09"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC09"
FT                   /protein_id="CAR21316.1"
FT                   /translation="MFWLILLVAAGLTAVCSFLSVNRYLSFKLHKNTLPFTLATLLVNM
FT                   WILLAITYLLPLDVFYAARASRDDSNAGLNGTAVAQPTPHLLARGLKSVRELEGDTSEG
FT                   NESYAPDFSALWYGIYWLEFFICWFVLPVLISYLDLKYLFPTQLYVSQRKTIFQRVKKA
FT                   VTVNIKFYALCALGLLGGVLYLVFGTNRGIVDLKPLIISFSHLYSLSYTLILLSMGLIL
FT                   LPKALLTNRTDENKLFVDLSKSNDESNDAKMAMTDYAGKILSIREVNNGDVALAQAINE
FT                   CKLEVQSLVNETQISLPHLPNGDQHINLDKINKYYNGFKKEYYNYLYYQAKSDRVIHDL
FT                   AQSQVKTISATKSVVRMVFGICCLLLSILVVFLEFTPSKFAHSKLFQGTSWFNFLLEIS
FT                   ILVYNTFASLYAMTCFKWQNLHLIPNGQSSPKNALYYSLYSSRLLLPLCFNFMALISHD
FT                   PGAPECSFEKVLYKDLKLIPLVDILNRYLPVFFIIAVPVGYFLDLKNRVLVRVLGKEYC
FT                   YELFGILTDPAPQSDSSAQPSHEASQAIDRSRLDEDYEYSLQDGRYLFQRATSNYNLRE
FT                   DSADSDRRAYV"
FT   gene            <578040..>578300
FT                   /locus_tag="KLTH0A06930g"
FT                   /old_locus_tag="KLTH-ORF16127"
FT   CDS_pept        578040..578300
FT                   /locus_tag="KLTH0A06930g"
FT                   /old_locus_tag="KLTH-ORF16127"
FT                   /product="KLTH0A06930p"
FT                   /note="similar to uniprot|Q3E830 Saccharomyces cerevisiae
FT                   YCR075W-A Identified by homology to Ashbya gossypii"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21317"
FT                   /db_xref="InterPro:IPR021591"
FT                   /db_xref="InterPro:IPR035098"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC10"
FT                   /protein_id="CAR21317.1"
FT                   /translation="MSSQSTTKARLAQLVPNAIGLLAFDGNCNVIEASGVAKNRLEDIV
FT                   QINQAKVDSEGFALLRDGDIQVMVYKHDGETLAVYTQENSL"
FT   gene            complement(<578369..>579304)
FT                   /locus_tag="KLTH0A06952g"
FT                   /old_locus_tag="KLTH-ORF16125"
FT   CDS_pept        complement(578369..579304)
FT                   /locus_tag="KLTH0A06952g"
FT                   /old_locus_tag="KLTH-ORF16125"
FT                   /product="KLTH0A06952p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21318"
FT                   /db_xref="InterPro:IPR013886"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC11"
FT                   /protein_id="CAR21318.1"
FT                   /translation="MAQQTDHKKVENKLDLVAHLFLIYLSHSSLLADNVNVQVKDIGKK
FT                   NIEFHINVDAESAIAKLNLESCNGPLEVIVMDMSGGEKCMISLCYQEQALKQGIFNYSR
FT                   ELVPDADKIVFPLEKSQVVDYYTELVDWNLDVKFRLKDQPSQKPSHLRENEGNSSPSAV
FT                   HEKLEHLKFGNPPVPSSHSHSRNPYTDIPGFEDEYEIQQQPGIPVTGAFGVPGLAAPGP
FT                   SAGYGDQDLYPGGQKYPNLQDPSSRFPAAQRQPGQGGMVFDPFRTGQGDPRSNPLRGEG
FT                   PTGPTPPFPGARFDDPFGRTSQQGGGGGFI"
FT   gene            complement(<579496..>582102)
FT                   /locus_tag="KLTH0A06974g"
FT                   /old_locus_tag="KLTH-ORF16124"
FT   CDS_pept        complement(579496..582102)
FT                   /locus_tag="KLTH0A06974g"
FT                   /old_locus_tag="KLTH-ORF16124"
FT                   /product="KLTH0A06974p"
FT                   /note="similar to uniprot|P25644 Saccharomyces cerevisiae
FT                   YCR077C PAT1 Topoisomerase II-associated deadenylation-
FT                   dependent mRNA-decapping factor also required for faithful
FT                   chromosome transmission maintenance of rDNA locus stability
FT                   and protection of mRNA 3'-UTRs from trimming functionally
FT                   linked to Pab1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21319"
FT                   /db_xref="GOA:C5DC12"
FT                   /db_xref="InterPro:IPR019167"
FT                   /db_xref="InterPro:IPR039900"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC12"
FT                   /protein_id="CAR21319.1"
FT                   /translation="MSFFGFDSSLPNQGKGGGREKRTATPDKPLDFDETYQGLGEYQNE
FT                   EDDYLNNETFGNATDLGTDFDFGYGKGELSSNSAPSAAQVDHGRSYASAATTGPVVTNP
FT                   GYVAAAPHSMDEGMDFTPMESLWTNQPMMMQHPQQPQHPQVLSMEELERQQQQQQIGVP
FT                   HGQQQGYMGMPPMPPMGYGYAPQAFMPQAQVMPGAAYPSAPQGMPPQGLPLPPQGMPPQ
FT                   SMPPPGMVPPQYQQHAMAMQQQPGAHQQAVQQVPSVVSPLAQQELQQSPHLVPKAALPA
FT                   SAGVVSDFATPSPPHLAASKSASGQARLASPSQMAPSSQDSRESTPRGTRRGSMRKHQE
FT                   PLSQDDFKRLQVRQAKVDKILRHSGVMTPRDKDFITRYQLSQIVTDDPYNEDFYFQVYK
FT                   IIQRGGIVGESNKGLIARAYLEHSGHRLGGRYKRADVALQRMQSQVEKAVTVAKERPQK
FT                   NRENFDGAKEGVLGKISSAKNSKAPRRQLQIPQQRDEDEDLGTSAIEDVVESLNGVDIS
FT                   SSSRARRRSSYAFRSVDQRAVLSRSGGRKFVLSLIETVYAEVLDLEALLRSGKETDSTH
FT                   LWESLHIADDAYEVSPFISILSFDKGVKIMPRIFNFLNKEQKLKLLYCFFSELSHLNII
FT                   VTSSYKTNPDPSDSQLKKIELFQSVFLKIIVSFLSSSAEFLEVLGLLLALVKNNNVSFI
FT                   STSKIGLNLVTVLISRAALIKQDVSRGSVLSSVEASSWNEIYDKLFTALETKLAAVFPP
FT                   EEYTSKVVATSSNGTPTSATVGQSSGHQFYDQSYIWQFLASLALSGKLNHQRVIIDEIR
FT                   EEIFGTISRAEQLVKNVPVEEQQIALYQRDKLYQDLNLFLNVMGLVARDGEISELK"
FT   gene            complement(<582435..>583391)
FT                   /locus_tag="KLTH0A06996g"
FT                   /old_locus_tag="KLTH-ORF16120"
FT   CDS_pept        complement(582435..583391)
FT                   /locus_tag="KLTH0A06996g"
FT                   /old_locus_tag="KLTH-ORF16120"
FT                   /product="KLTH0A06996p"
FT                   /note="similar to uniprot|P53731 Saccharomyces cerevisiae
FT                   YNR035C ARC35 Subunit of the ARP2/3 complex which is
FT                   required for the motility and integrity of cortical actin
FT                   patches required for cortical localization of calmodulin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21320"
FT                   /db_xref="GOA:C5DC13"
FT                   /db_xref="InterPro:IPR007188"
FT                   /db_xref="InterPro:IPR034666"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC13"
FT                   /protein_id="CAR21320.1"
FT                   /translation="MLHLRPENLLVQKTLTEAWNASKAGSPLTLDRVISDFDYTTLHVS
FT                   NSPDDKSILWLSIRTKAWQSVVKCGGDFAGYLKSKYNGFHAVSECSPEQGYDFTVQVKL
FT                   DELDADAIVQLSLMKIHIMSYPFQLAFDEFARLSQLPEGSNASDTVHQIQYRDDENIFI
FT                   KPSSDRITVIFETFFQDETDKVFGKVFLQEFVDARKRNRNIQSAPQVLFSHEPPLEAAS
FT                   LMAARSADKNRRFITFVLFPRHFQTPELQFSSVCHLSLFRNYFHYHIKCSKAYMHSRMR
FT                   YRVDTFIKVLNRAKVDDEEEAGEQTTRRTITGRKLVY"
FT   gene            complement(<583576..>584091)
FT                   /locus_tag="KLTH0A07018g"
FT                   /old_locus_tag="KLTH-ORF16116"
FT   CDS_pept        complement(583576..584091)
FT                   /locus_tag="KLTH0A07018g"
FT                   /old_locus_tag="KLTH-ORF16116"
FT                   /product="KLTH0A07018p"
FT                   /note="similar to uniprot|P53732 Saccharomyces cerevisiae
FT                   YNR036C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21321"
FT                   /db_xref="GOA:C5DC14"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC14"
FT                   /protein_id="CAR21321.1"
FT                   /translation="MLFPSLTSRFVLGLSRASMIPRAPARSSAMAIFSPLRAFSICRPN
FT                   WATLNQIKRGVEPPKRKKATVSPDLYQSPLRKGVVLRVMVLKPKKPNSAQRKACRVRLT
FT                   NGKVISAYIPGEGHNAQEHSIVYVRGGRCQDLPGVKYRVIRGTGDLSGVVNRITSRSKY
FT                   GVKKPQKA"
FT   gene            <585536..>586978
FT                   /locus_tag="KLTH0A07040g"
FT                   /old_locus_tag="KLTH-ORF16112"
FT   CDS_pept        585536..586978
FT                   /locus_tag="KLTH0A07040g"
FT                   /old_locus_tag="KLTH-ORF16112"
FT                   /product="KLTH0A07040p"
FT                   /note="similar to uniprot|P25646 Saccharomyces cerevisiae
FT                   YCR079W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21322"
FT                   /db_xref="GOA:C5DC15"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC15"
FT                   /protein_id="CAR21322.1"
FT                   /translation="MGKSQPFVLLKPSNLVLKSSGMHHAGSVASTMATRESSSPMLRVN
FT                   LRKFPGFIGHCSSRINRLTNEDSYSINMLKMPTVGSEMNCLWNKGIKDKEVHWATKLPL
FT                   NKSILNLSVFDGHGGDQISKLLASELHNELAATFPSREAFFELLKQYNDVIGGKYWGKI
FT                   YDRKEQYFKKFIATCNTKQEQVLFDDKSGSRMIFDQWGNIIDKTSLLTENERLRIFLSY
FT                   MRFDLKRCCAPASTEGAQRDENVITGGSTASSIFLTPYDEPNSIGDTFFINSEGLLKLV
FT                   VTQVGDTKIVLCDKNGIAHSLTKMHHPSSSRESRRLRTSFQTDSFGETRFLNNFANTRS
FT                   FGDFVGKQEGLSCEPDIYSYLIGNTQYLPHSERSKLQFGGDECFVCLITDGVSDLMSDQ
FT                   ELVDLITSTVNMRGLKVASPQYVSEEVIRFIAAIGGKHSDNATCLVLRLPNWGNWPTVD
FT                   RTGAIREEKLMSGSSGSERSNV"
FT   gene            complement(<587250..>587525)
FT                   /locus_tag="KLTH0A07062g"
FT                   /old_locus_tag="KLTH-ORF16111"
FT   CDS_pept        complement(587250..587525)
FT                   /locus_tag="KLTH0A07062g"
FT                   /old_locus_tag="KLTH-ORF16111"
FT                   /product="KLTH0A07062p"
FT                   /note="highly similar to uniprot|P53733 Saccharomyces
FT                   cerevisiae YNR037C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21323"
FT                   /db_xref="GOA:C5DC16"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC16"
FT                   /protein_id="CAR21323.1"
FT                   /translation="MQFTLSLLSRSVWKGPNIVPLPVKEALAKGAPIRTNARSATILPQ
FT                   FVGLKFQVHNGKEYVAFEVSEDMVGSKLGEFAPTRKRFSYTHTKNK"
FT   gene            <587692..>589578
FT                   /locus_tag="KLTH0A07084g"
FT                   /old_locus_tag="KLTH-ORF16110"
FT   CDS_pept        587692..589578
FT                   /locus_tag="KLTH0A07084g"
FT                   /old_locus_tag="KLTH-ORF16110"
FT                   /product="KLTH0A07084p"
FT                   /note="similar to uniprot|P53734 Saccharomyces cerevisiae
FT                   YNR038W DBP6 Essential protein involved in ribosome
FT                   biogenesis putative ATP-dependent RNA helicase of the DEAD-
FT                   box protein family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21324"
FT                   /db_xref="GOA:C5DC17"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC17"
FT                   /protein_id="CAR21324.1"
FT                   /translation="MFAARFDPTAVQSVAVDQEEKVRASKPVVPQKRRAESEEDSEEDE
FT                   DEEKDEVDENENVRENHIPEENPSDEEDHKSDVEMDLATNDEVTSSKYSGVYSRFQKTL
FT                   QIQDKLAPYDLVNTEDENDNSDTEQHELVPIPQPEIVRNTHLTTEVVNLKGKSAAWLHT
FT                   ARVQYDSSMVKPFSAYKDILNDKLISNVTSKFSENAFPVQTVILDTVVPKMNFAQSVNK
FT                   KSFPRRVGDILVNASTGSGKTLAYSIPVVQCLSKRTVNRLRCLIVVPTKILIHQVFETL
FT                   VKLSQGTSLITGISKLENSLREEHRKFQAQEPDILVITPGRLVDHLQLNTFSLKNLKFL
FT                   ILDEADRLLNQSFQNWCSVIMERLKTDKEEMHPVSVIKMVFSATLTTNTEKLHGLQLNR
FT                   PSLFMMDSVKLYHLPKQLQEFNIKIPTAKSFAKPLFALQLIAALSPTDPRILVFVRSNE
FT                   ASIRLATLLEILVNNKVLPIEFRTQIASINSNNTKGLNSKLIKQFASSSPEKVTKILVA
FT                   TDLMSRGIDINNVSHVINYDLPISSQQYVHRCGRTARAQASGEAFNLLVGKGEQTFWSD
FT                   NIDSDLSRDLDGCRPKPYEEEQALENILEITKDAEENYKDSLEQLKNNVTSK"
FT   gene            <589774..>593877
FT                   /locus_tag="KLTH0A07106g"
FT                   /old_locus_tag="KLTH-ORF16108"
FT   CDS_pept        589774..593877
FT                   /locus_tag="KLTH0A07106g"
FT                   /old_locus_tag="KLTH-ORF16108"
FT                   /product="KLTH0A07106p"
FT                   /note="similar to uniprot|P25648 Saccharomyces cerevisiae
FT                   YCR081W SRB8 RNA polymerase II mediator complex subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21325"
FT                   /db_xref="GOA:C5DC18"
FT                   /db_xref="InterPro:IPR019035"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC18"
FT                   /protein_id="CAR21325.1"
FT                   /translation="MPSKYLLTPPEGLHSLTSGNTKKIYPDFDPWSHTPLDDKIFLNFV
FT                   SKGYYNSAKVNFESISSRSSLQESLPAVSGLLADQLSDVVRIREEKINRITANSTSSAK
FT                   KSGMPSDLSGPGFSLPKRVTLTDHRRELWLQEMSSPQSSLSETSKTIPHGLKRRQLLEQ
FT                   CYLKQIPIPRAIWLIKCCFSLEWKTLANKQGATQIEDGIDKLLKEWSETMVHLLERLVF
FT                   EMTQYYNEPVKLSNWRQKIKYYLSLLGNCYSLNLMDSNFFHHWLVDFIAKIENFEYLPM
FT                   ALHILTVFWGGIFEACRHSEDPQQLFLVNKMTEALLYKYYMVTSSRSMINDEQYLINDV
FT                   KKNNKVNKTILAKLKGLIEKIFQGQSMEAFVFPNNNWDIYKKCLYEILQVDKIREDDGS
FT                   SSEASKKLELIVYRNDSLKFNTILHDADTESLGSGNETPNNLENIFVPDTVLKLKRIDY
FT                   KLTKALDENCPGDDWATFADQKLRRVEQIIQMMLWAVHPSRSHHYEASQLVAKLLLLKL
FT                   NSRNGNLEYSLEDKIWALVFVFAKTKSEDLKFMVSLTRLHQLLNVFIGYGIVKVPTYIR
FT                   KLISSGVLYLTHSSDKLFHCNLLINLKISPLMKIQYNMVLRNVHESNPEFYDNYNYDRL
FT                   MEMLEGAKESLSSGNYEFVKEVPYSIKLMASEWYLNVICSPIDGSLRTVRKLDVIEKLK
FT                   VFCVNLKVYHQFYKWVEFIVYHQLLNDLEALECLVDILMYYDKLFPLLINDHTLLMKTI
FT                   LHLHSLKLAPQNTASQNLLLFNDFWLFFMKRFPLALEIDTDLQTKLIEAYESEKAQIER
FT                   LAKPHSRNDGTSPLKADNDSIQSVKKESQNFPSVFQPNLKCLLTSGEEESLRNARKNMR
FT                   VLMIINLTEYNKFMSIFLKRRSASDEELARLISLKVLSLSLIKKVLGGPAVVNLLDTRY
FT                   CDCGMAFELQKKTFTKQNLRLVMNALCEDLPGSYQKLLNVIGEFSTTKNGQEQISNIVN
FT                   KVQVKGGKDTFSFITDLLNLGVNNSEWGNFEPLPESARHDLFEDDGEVTEEETDVLDLF
FT                   SRLNFTNLWIFQILTSLYLQSMNCLSPAKPHFALDIIELTGCDVAASKLFDKISNVEVL
FT                   EKTLQTLEVDFFQRKSIKDPEVSYYYVIIETIVNISRRLNKVSTSSIPMGEESFRLMKE
FT                   CCHEFISKDPTDLAKLEYRLDAFLKILIVHQKFILKEGLEKPQPAFEGYSEFLRMLCQL
FT                   FHKIDFSLKLKLLLYDVLASMKSFVIYSSTGRNHQLSIKKNLKVPKELLDLPPFKISSF
FT                   MPGDIPSGEANKVEPGIKDRNPSDEPRKPVFFLYNKSSNTFEEKLSLRPFHLLDNFQEE
FT                   GPEFNNTPLNLCLFNASYYRKNPT"
FT   gene            complement(<594164..>595864)
FT                   /locus_tag="KLTH0A07128g"
FT                   /old_locus_tag="KLTH-ORF16106"
FT   CDS_pept        complement(594164..595864)
FT                   /locus_tag="KLTH0A07128g"
FT                   /old_locus_tag="KLTH-ORF16106"
FT                   /product="KLTH0A07128p"
FT                   /note="similar to uniprot|P53735 Saccharomyces cerevisiae
FT                   YNR039C ZRG17 Endoplasmic reticulum protein of unknown
FT                   function transcription is induced under conditions of zinc
FT                   deficiency mutant phenotype suggests a role in uptake of
FT                   zinc"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21326"
FT                   /db_xref="GOA:C5DC19"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC19"
FT                   /protein_id="CAR21326.1"
FT                   /translation="MGSPNLSTKEDFGSSFSFGGLPSTPQHMNCIVEEDHAKDGLAEEM
FT                   EREPSKTPQRPLSFYSNADGNNSSNSLIMNPAFSFGASATQENKRHSMKYVPTPKLPPS
FT                   SSSRTKSPARGNRSPSPDRGKRRGSLVLDKPFNFSSSTLQPPASAGSATRASFRKGHRY
FT                   KHSSVSMNFFQEPEVQVPLNIAKAMPIPDFADLKSNIPWPHGYAQLAIAALQIIACLVT
FT                   FRLGHVKSWNNFITLSHFVLYDVIGSLAIILVENLSQFQVWNTGTITFPFGLNRMDVLL
FT                   SFALAISLCFMGLDLFFHILEETIVLFVESTNDSNQHNDIAPKIPHSHHSSAFLHTASE
FT                   TQIWYWTLLPNLALSLLSLFKTYHSNAHTKFKTKNPVITCTYILYLSLYPLIQKVVSSS
FT                   DYIATSLLSIFIMSYGWTIAKWTSTILLMGFSTASLNGLILDDDPSLSDDRPTKALLVR
FT                   SKSTLPIAVANNNSSKPNKNNSKICDSTHVKSKIMESVQELPLFRANCKLANEDLVIVK
FT                   VNFDQYIVLIRLRMAGGSNDDELNLRLAIDKCIRKILKTVDTTIDIDRL"
FT   gene            <596361..>597467
FT                   /locus_tag="KLTH0A07150g"
FT                   /old_locus_tag="KLTH-ORF16102"
FT   CDS_pept        596361..597467
FT                   /locus_tag="KLTH0A07150g"
FT                   /old_locus_tag="KLTH-ORF16102"
FT                   /product="KLTH0A07150p"
FT                   /note="similar to uniprot|P32378 Saccharomyces cerevisiae
FT                   YNR041C COQ2 Para hydroxybenzoate: polyprenyl transferase
FT                   catalyzes the second step in ubiquinone (coenzyme Q)
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21327"
FT                   /db_xref="GOA:C5DC20"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC20"
FT                   /protein_id="CAR21327.1"
FT                   /translation="MITARGVTLGVYRGWRTQLIAQAKSAGRNGVFFVRYSSQLRKEVR
FT                   KPVFTPEELEKARETRLRGLEPYVSKLPAKWIPYAELMRLEKPVGTWLLYIPCTWAISM
FT                   AAMETMAPISSAMWMLSLFGVGSLVMRGAGCTINDLLDRNLDDKVIRSVERPIASGRVS
FT                   PKQAVAFLGAQTAGGMGILTQLPAECWWLGLASLPLVFTYPLFKRFTYYPQAALSACFT
FT                   WGALLGFPAMGVMDWPTMIPLYTSSFLWCMTYDTIYAHQDKSFDVKAGIKSTALAWGPK
FT                   TRKICTAMSVAQMGLLGLAGLNSGLLLGPGFLGGLAIFGYRVFSMVRNVDLDNPADCWK
FT                   HFTSNIRSGLYFSAALLLDYFLRILGFL"
FT   gene            complement(<597528..>598358)
FT                   /locus_tag="KLTH0A07172g"
FT                   /old_locus_tag="KLTH-ORF16097"
FT   CDS_pept        complement(597528..598358)
FT                   /locus_tag="KLTH0A07172g"
FT                   /old_locus_tag="KLTH-ORF16097"
FT                   /product="KLTH0A07172p"
FT                   /note="weakly similar to uniprot|P53736 Saccharomyces
FT                   cerevisiae YNR040W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21328"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC21"
FT                   /protein_id="CAR21328.1"
FT                   /translation="MFRPAALRFVPRTTWRGAAHSTAGLPFSSKLAALIAKTSPEQIYT
FT                   YSVPRLVKFGSWTLSGVFLVYGVSFADWSLTSSLELYGEEVQQPPSSWWKHPKLLLAAR
FT                   VAGSALLTLIPLTLSCVAIYAPSRIVTAVSYVPHGACKLTRGALLTGKPVSRVADLSHV
FT                   ARNQKAKVYTGVGPQGTDDRASFAFLLTDSHRPAWDRFYIVNRSGRFWAQDGRIFDALF
FT                   GGESARSLECPSATQTTGPPPATSPVQRMIEVEQTRSKIHDHASRVKSIVMKPK"
FT   gene            complement(<598542..>598940)
FT                   /locus_tag="KLTH0A07194g"
FT                   /old_locus_tag="KLTH-ORF16094"
FT   CDS_pept        complement(598542..598940)
FT                   /locus_tag="KLTH0A07194g"
FT                   /old_locus_tag="KLTH-ORF16094"
FT                   /product="KLTH0A07194p"
FT                   /note="some similarities with uniprot|P25372 Saccharomyces
FT                   cerevisiae YCR083W TRX3 mitochondrial thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21329"
FT                   /db_xref="GOA:C5DC22"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC22"
FT                   /protein_id="CAR21329.1"
FT                   /translation="MFKTSVFRCSQALPRNGTLLRPIARTQSTVAQLQTLQQFQQAVAR
FT                   KNLSVIDFYATWCAPCRAVAPHFDKLSEKHTDVAFYRVDVDSAPDIAGFCGVSAMPTFL
FT                   FARESKTVGKVVGANLRALSEEIESLQK"
FT   gene            complement(<599149..>599559)
FT                   /locus_tag="KLTH0A07216g"
FT                   /old_locus_tag="KLTH-ORF16088"
FT   CDS_pept        complement(599149..599559)
FT                   /locus_tag="KLTH0A07216g"
FT                   /old_locus_tag="KLTH-ORF16088"
FT                   /product="KLTH0A07216p"
FT                   /note="weakly similar to uniprot|P25649 Saccharomyces
FT                   cerevisiae YCR082W AHC2 component of the yeast ADA
FT                   acetyltransferase complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07216g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21330"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC23"
FT                   /protein_id="CAR21330.1"
FT                   /translation="MPSDPPAPAAYELVRQFQEQALSENADYALLQHSRAHLHNKLMQK
FT                   KFFLKQLRLLYTQLDKTHNYQELVDALVGHRALLREIFAMERGARRGRRAHAPPAIAWQ
FT                   KYGVDVEQYLLAQDDAASRALVHESGWVFHDV"
FT   gene            <600411..>601712
FT                   /locus_tag="KLTH0A07238g"
FT                   /old_locus_tag="Klth0A.mRNA.637.p"
FT   CDS_pept        join(600411..600455,600564..601712)
FT                   /locus_tag="KLTH0A07238g"
FT                   /old_locus_tag="Klth0A.mRNA.637.p"
FT                   /product="KLTH0A07238p"
FT                   /note="similar to uniprot|P32377 Saccharomyces cerevisiae
FT                   YNR043W MVD1 Mevalonate pyrophosphate decarboxylase
FT                   essential enzyme involved in the biosynthesis of
FT                   isoprenoids and sterols including ergosterol acts as a
FT                   homodimer"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21331"
FT                   /db_xref="GOA:C5DC24"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC24"
FT                   /protein_id="CAR21331.1"
FT                   /translation="MSIYTASTTAPVNIATLKYWGKRDKTLNLPTNSSISVTLAQEDLR
FT                   TLTSVATSESFTEDQLWLNGQPESLQGERTQHCLQDLRNLRSRIEAQDSSLPRMSQWKL
FT                   HIVSENNFPTAAGLASSAAGFAALVMAIAKLYQLPDSHSEISKIARKGSGSACRSLFGG
FT                   YVAWEMGSEPDGSDSKAVEVAPQSHWPEMKAAILVVSADRKDTPSTSGMQHTVATSDLF
FT                   QERIRNVVPKRFEEMKQAIQDRDFTRFAELTMRDSNSFHATCLDSFPPIFYMNDTSRKI
FT                   VKLCHQINAFYDETIVAYTFDAGPNAVLYYLQENEAKLMAFVHHVFQKNSGWDTKFSQN
FT                   DLEKFSEVFKTRVAPEVAFEFDEELYKGVSRVILTQVGPGPQDTTECLINKSTGYPN"
FT   gene            <602127..>604328
FT                   /locus_tag="KLTH0A07260g"
FT                   /old_locus_tag="KLTH-ORF16082"
FT   CDS_pept        602127..604328
FT                   /locus_tag="KLTH0A07260g"
FT                   /old_locus_tag="KLTH-ORF16082"
FT                   /product="KLTH0A07260p"
FT                   /note="weakly similar to uniprot|P35995 Saccharomyces
FT                   cerevisiae YKL222c"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21332"
FT                   /db_xref="GOA:C5DC25"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC25"
FT                   /protein_id="CAR21332.1"
FT                   /translation="MSSEDHVEDEGGFEPNEDQFEVDGRSKKRRKAIKQCLFCRKRKLK
FT                   CDKKKPMCTTCVTRGLGECIYVEQFGRDVSARELLNSAPNVDLLNKIKALEKELDSYKH
FT                   TSLTKGEGFNPLRDVQILIKKDERTIYHGCTSFRAALSESRFKFSTYHAFFWARVKDDR
FT                   RRWKALNGYTTLKEITVIEKERDNGLSVLGAVCKALPPFEQIEAIVKKFFTSILLEGYK
FT                   VLDMKKTLQNLHMSFIRGPQNPITGMHPVIHLWPSFKKNYYCIGIILEIMCLMSYSSVI
FT                   PEAIDVFNKYLTSFVTKKAFYIERVQYLFLRYLYKSLNYGGGDDSNLVFLAQAMSASAI
FT                   CVGLHRNIRDLLKGDNVDRGDAVYFENLWLWILQADLETSFNVGTPPKIAESFVNYQMI
FT                   EDPNYGSCELLKNLIRPMRNIMTVIYLENRIPDMEAIVGKIKRLLETHFKPLKLYREKE
FT                   NLKQIPFVEIDLYTWLLGMIGVFSNFRRVYFKDHSPSAINSALQFTILPLAMSMSTIEA
FT                   FFELDKEAAAKTQAPLQGGLPFHLAIANSLVQKHFPRSLSEIYTLMGSLGSFPDFGTAR
FT                   FQYPLSPVFDIPLDSLECVGDHYVSFKQASEVIENLLSKWEEEKNRDMVKLLKRYSYAF
FT                   VVSYAIQKSHKDLFDQCFKRRELQFTRGEEQSNPDMEQKAALPSPSNSFGGQEFIPDET
FT                   LKELADEFWKNYDIEVDDFFSDAFDQTSIWFDSSAQPQQ"
FT   gene            complement(<604949..>607126)
FT                   /locus_tag="KLTH0A07282g"
FT                   /old_locus_tag="KLTH-ORF16080"
FT   CDS_pept        complement(604949..607126)
FT                   /locus_tag="KLTH0A07282g"
FT                   /old_locus_tag="KLTH-ORF16080"
FT                   /product="KLTH0A07282p"
FT                   /note="some similarities with uniprot|P18323 Saccharomyces
FT                   cerevisiae YCR084C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07282g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21333"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013890"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC26"
FT                   /protein_id="CAR21333.1"
FT                   /translation="MASSAVSASQNKLNELLEAIRQEFGQISQEANTYRLQNQKDYDFK
FT                   INQQLAEMQQIRNTVYELELTHRKMKDAYEEEIGRLKLELDQRDRQVATLAAAAQQQQH
FT                   QQQHQQQQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPTG
FT                   PILASSNAATPGIQNPVLGSQAVQSPALSAAGPAAPAQAPRLAALEPSQTAPTITAQAP
FT                   HMKKLASEHQINSPPVQGAGIPTGPAVLAAPAAPGTPGTPAAALAAAAAPTPPSASGGP
FT                   LAAPTNQGAVAPPAPMAPMAPIAAPVSENKSQEYYLVPPHQRASHAKPIPPFLLDLDSQ
FT                   LVPQHLKKQTNDYYILYNPALSRELDVDLHVSLDHSSVVCCVRFSNDGEYLATGCNKTT
FT                   QVYKVSTGELVARLSEDAASAPSGNSGDGASGAENAEQTPAVSTSASSDLYIRSVCFSP
FT                   DGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIW
FT                   DLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENEL
FT                   GTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTEGKANTAASEVTYTGHK
FT                   DFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPE
FT                   YGVFATGSGDCKARIWKYTKKSEPKLREVKE"
FT   gene            <607568..>608095
FT                   /locus_tag="KLTH0A07304g"
FT                   /old_locus_tag="KLTH-ORF16075"
FT   CDS_pept        607568..608095
FT                   /locus_tag="KLTH0A07304g"
FT                   /old_locus_tag="KLTH-ORF16075"
FT                   /product="KLTH0A07304p"
FT                   /note="similar to uniprot|P25651 Saccharomyces cerevisiae
FT                   YCR086W CSM1 Protein that forms a complex with Lrs4p
FT                   located in the nucleolus Lrs4p-Csm1p heterodimer binds to
FT                   Mam1p at kinetochores during meiosis I to mediate accurate
FT                   chromosome segregation may be involved in premeiotic DNA
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07304g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21334"
FT                   /db_xref="GOA:C5DC27"
FT                   /db_xref="InterPro:IPR020981"
FT                   /db_xref="InterPro:IPR038608"
FT                   /db_xref="InterPro:IPR040349"
FT                   /db_xref="InterPro:IPR041671"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC27"
FT                   /protein_id="CAR21334.1"
FT                   /translation="MDPISQYKAAVQSRLDNADILVSKLVHENRMLAQDVENKDQEIES
FT                   LKRQLAAAEARSKECEERTGAAEEETDIVKDLFEHLCGVRVHKSYEDESGLWFDTSQGG
FT                   KAGVMDYKLGFVKGEPSGTEVVYVPLLKQRSAEELQQLQKQLPGYLFDTLSFPLRSLQQ
FT                   FYSKMAKCLSRG"
FT   gene            complement(<608380..>608883)
FT                   /locus_tag="KLTH0A07326g"
FT                   /old_locus_tag="KLTH-ORF16073"
FT   CDS_pept        complement(608380..608883)
FT                   /locus_tag="KLTH0A07326g"
FT                   /old_locus_tag="KLTH-ORF16073"
FT                   /product="KLTH0A07326p"
FT                   /note="similar to uniprot|P37263 Saccharomyces cerevisiae
FT                   YCR087C-A Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21335"
FT                   /db_xref="GOA:C5DC28"
FT                   /db_xref="InterPro:IPR014898"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR039999"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC28"
FT                   /protein_id="CAR21335.1"
FT                   /translation="MVTFNCEVCNDTVPKKNTEKHYYRCPQAYYTCIDCNVTFDDGTGY
FT                   KKHTQCISEDEKYQKALYKGKKKPQEKKPQQQKPEESKPKQEKQQEQETRKDKNTKLEK
FT                   AKLQKGKVQKPEEQKPLKQKSVLSEKKGASLYKILKSIDDKEEKKNLLKSLVVNENGQL
FT                   EVKA"
FT   gene            <610049..>611929
FT                   /locus_tag="KLTH0A07348g"
FT                   /old_locus_tag="KLTH-ORF16068"
FT   CDS_pept        610049..611929
FT                   /locus_tag="KLTH0A07348g"
FT                   /old_locus_tag="KLTH-ORF16068"
FT                   /product="KLTH0A07348p"
FT                   /note="similar to uniprot|P15891 Saccharomyces cerevisiae
FT                   YCR088W ABP1 Actin-binding protein of the cortical actin
FT                   cytoskeleton important for activation of the Arp2/3 complex
FT                   that plays a key role actin in cytoskeleton organization"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07348g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21336"
FT                   /db_xref="GOA:C5DC29"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR035718"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC29"
FT                   /protein_id="CAR21336.1"
FT                   /translation="MALEPIDYTTHCREIEEVFQKVVRGSDAEIEWLVLSPNSKKEYTA
FT                   ESVGSGFSEFLGTFEDTKVQFGLARVSPPGSDVQKLILIGWCPDSAPLKTRASFASNFG
FT                   VVANQVLKSYHVQVTARDEDDLDENELLMKISNAAGARYSIQQEPTRTSSAPKPRPAAT
FT                   PKATPSSNNVSTAPKPSADFTPKPSTTASVPKAAPASAPKPAAQFSTPVSGRDAGRSNS
FT                   SGEDDDWDEPEIEERDFDSKPLKPNKSSWQPVGKVDLQKLIAEENAKQDPRLVNMVKSD
FT                   TPVKLNPQDDIQKLKQESRAQRDAELNKFMGTKPPTGSVPKKDDDKVIRGFQNEKSPAQ
FT                   LWAEKHQQKVTSPQKASAATEAAEGKKEDEDDEEEEAPEVSNVKAKFEKMAVNEPTIIK
FT                   PGQPKTPAPVESDSAPAPPKASLGRPLPGMHTELDDDQDANSSNAQDDDDDWDDQSDEE
FT                   VKPPAPAPRPSLPARTSTATSSSPAPAPGPRPQSNLTQEVPTKTQVDEKPAAAAAPSLP
FT                   TRTSESSYVPPPPPRRNVPVTEEPEEPEEPETVEGSQKNAAEDELQLEEKLPSAIAEYD
FT                   NEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQLIK"
FT   gene            <612403..>616227
FT                   /locus_tag="KLTH0A07370g"
FT                   /old_locus_tag="KLTH-ORF16062"
FT   CDS_pept        612403..616227
FT                   /locus_tag="KLTH0A07370g"
FT                   /old_locus_tag="KLTH-ORF16062"
FT                   /product="KLTH0A07370p"
FT                   /note="some similarities with uniprot|P25653 Saccharomyces
FT                   cerevisiae YCR089W FIG2 Cell wall adhesin expressed
FT                   specifically during mating may be involved in maintenance
FT                   of cell wall integrity during mating"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21337"
FT                   /db_xref="InterPro:IPR025928"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC30"
FT                   /protein_id="CAR21337.1"
FT                   /translation="MKLAFVLTSCSTALASTYPRVYYANTSTVKQSATSYRELTSLVLS
FT                   STHSDGLVSTFVSEAFVSLTTLTTNDVVTVVTTWCPLGSEVVNSQLSSYSEESRASSSN
FT                   LNAPTTTSPTSVFIDMSGTTETIQKSQIHTKEITTCPTCSVRPTSASTVPESTDIASSS
FT                   VASSISHSKDLVSQAGSSLSSSAKSSSARMPSITTSGEIGTSAVDTGNLSPSSSSNSYQ
FT                   SGSSSTETHATTSQNTLSSVSGLSKSAYSPGLSSFDVRPVLTTETVDGKTTVYTTWCPL
FT                   TSHSISSLYSVVTSDNPSSPSSVRIASSESQVSDENEHESDFSTQASSLQEHGYSSYSM
FT                   VTITSTSLRTVVYSTELCSSRRCSPSLTSVLESIVFTTSVHPTGLGSSSERSRNTYSNS
FT                   KTDSILKGQLCSLTSCQETSTSDTSGTGSSSKPTSVSQSATSEAAESSKSLSEGYQSSV
FT                   SSKSFATSQSCVSCASQRNYYTTESETYLSEKASLTSAESSQKLSLSSFSSVPDSSVSS
FT                   SLLSTYSIVTTTSNGVVTVYTTWCPLSNLKSSSNNGLVSSSLALKIVSTEQSGTKKLSS
FT                   TQQYRSLSKTASSFMTLGSGALTFSTPSVTNSKPISGSTLASSTQRPSVETHNFIQRSS
FT                   FSASHFSSLVATSHGISGSIDTVQSGSSTSLSTSSAISTEHLSNTRYSSISEGSNSQLQ
FT                   KTSTGSLISVLSSSSRSVPVVSTANSKNEETSCTQCQTSSHTSFSTEISSIVSLSVPSQ
FT                   SQDLKTSARSSTSLKSSVTYTSKVITTTSSGIRTVYTTYCPWTSSASQESQNSEKQKSS
FT                   AASSSASSPASSPASSSASSQQELSSSVASTSESQKHQTSSSLDSEPQRSSKATIQSVG
FT                   SQASSSKTWTSKVVTTTEGGVTTIYTTWCPQEDLQSSGTVAAVSPSTSQQKSSSLVTTT
FT                   SESQTHETPSSLDSESQRSSKATIQSVGSQASSSKTWTSKVVTTTEGGVTTIYTTWCPL
FT                   EDLHSGTVAAASLPSKFTDSTYISSTSSPSGLSSVPSINEGKTASSALKSSEIAKTLSD
FT                   SSAKELTLYGTSSSMKASEAGSSDSMSSTIVPRMSTAESSAIIQSTQDASKKSSKGTVT
FT                   TGRPSTSNVERSPSTTLGTTESLVSSSHTFSSTKTPAVSPHSSAIISSKATTYSSSFTI
FT                   SVTTVLPFTKTSTGDNGQLFTVVSSQPSTIPTVTTVLVKTRVPVTTYSQVSITESASQQ
FT                   ATRKSSTEDTTSSWAIASTVSTYEGSAASTRRFDRILKVATALLLTFIM"
FT   gene            complement(<616307..>616864)
FT                   /locus_tag="KLTH0A07392g"
FT                   /old_locus_tag="KLTH-ORF16060"
FT   CDS_pept        complement(616307..616864)
FT                   /locus_tag="KLTH0A07392g"
FT                   /old_locus_tag="KLTH-ORF16060"
FT                   /product="KLTH0A07392p"
FT                   /note="similar to uniprot|P25654 Saccharomyces cerevisiae
FT                   YCR090C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21338"
FT                   /db_xref="InterPro:IPR008584"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC31"
FT                   /protein_id="CAR21338.1"
FT                   /translation="MLYVVLSASVSENIGRLKVKDLDTDPADYAFELVCTNCREKHDSK
FT                   VTINRLEKHTMSGSRGEASFVMKCKFCGKDCSINLERTQEELYNLEEESNRELVEKTRV
FT                   YRKKIGIKNVDSSKAILLALDCRGCEALNLDFSNLTFEACLVSGKVMEATFEEENEWYD
FT                   YDDDAGEEVSITGLQFDIIKGK"
FT   gene            <617043..>618317
FT                   /locus_tag="KLTH0A07414g"
FT                   /old_locus_tag="KLTH-ORF16058"
FT   CDS_pept        617043..618317
FT                   /locus_tag="KLTH0A07414g"
FT                   /old_locus_tag="KLTH-ORF16058"
FT                   /product="KLTH0A07414p"
FT                   /note="weakly similar to uniprot|P07390 Saccharomyces
FT                   cerevisiae YNR045W PET494 Specific translational activator
FT                   for the COX3 mRNA that acts together with Pet54p and
FT                   Pet122p located in the mitochondrial inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07414g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21339"
FT                   /db_xref="GOA:C5DC32"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC32"
FT                   /protein_id="CAR21339.1"
FT                   /translation="MYCFRQYFTRGFPFTWPKRHSRGIKLSQRYYGRSPRCKGRLTLRP
FT                   MGTGMTLWRYFNAPGNVMFVTTNVVTLLGIMSYTTIQNMAREQAMQEYLEHKSFGDDTV
FT                   DIELTQGSPRKRYRKENIKLSKNQPPSNCYAQHAKMSLFHLLYSFYICRDVASENEVRG
FT                   SSEWKEELDDLQDEVPERHSSHISTRMFYHLWRSEFGQIFDNLSRSQQFHMPNWKHYPG
FT                   SLQVVCQSLYDSELRTVADFIKFYKGVKQGTLKELLRAWFYDNMQLFQSTSDNDNEYFY
FT                   RYLVQACENDEPLFNQYASIMLNPSNPRRRAFFNRRNQYSSASLETFVEVLKGNLRAAA
FT                   GAVEKSYYHESILNLVSMLRTSCFLAQNSNGSHEVRILLPGNMNVCDSLPYPHTSSADR
FT                   FACYKLVSENAEVMAVLGAISKLPS"
FT   gene            <618523..>618924
FT                   /locus_tag="KLTH0A07436g"
FT                   /old_locus_tag="KLTH-ORF16056"
FT   CDS_pept        618523..618924
FT                   /locus_tag="KLTH0A07436g"
FT                   /old_locus_tag="KLTH-ORF16056"
FT                   /product="KLTH0A07436p"
FT                   /note="highly similar to uniprot|P53738 YNR046W
FT                   Saccharomyces cerevisiae TRM112 Protein required for cell
FT                   viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21340"
FT                   /db_xref="GOA:C5DC33"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR039127"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC33"
FT                   /protein_id="CAR21340.1"
FT                   /translation="MKFLTSNFLKCSVRECDRSNENFPLKYNGEKCQLEQDESLEFNPE
FT                   FLLRIIDRVDWSAVVSVAIDLGNSSLPSSKPEFTSEDLSDEDMIILKDLHTLLIKTNIV
FT                   EGEMSCRNCGHIYYIKNSIPNLLLPPHLA"
FT   gene            <620459..>623080
FT                   /locus_tag="KLTH0A07458g"
FT                   /old_locus_tag="KLTH-ORF16052"
FT   CDS_pept        620459..623080
FT                   /locus_tag="KLTH0A07458g"
FT                   /old_locus_tag="KLTH-ORF16052"
FT                   /product="KLTH0A07458p"
FT                   /note="similar to uniprot|P53739 Saccharomyces cerevisiae
FT                   YNR047W Putative protein kinase that when overexpressed
FT                   interferes with pheromone-induced growth arrest localizes
FT                   to the cytoplasm potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07458g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21341"
FT                   /db_xref="GOA:C5DC34"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC34"
FT                   /protein_id="CAR21341.1"
FT                   /translation="MDNLQVLSQPPATVSEGEQRSRSVSLSKLIPRSFRKASGTPTNES
FT                   SAGSVNSLENGKPTPSATNRGAEDMELRETPESPSRAHFRTASNTENSSSATPQPEGSE
FT                   ETKPHQQIQTGGKLSARLKKIFLPASKLPEPPQPAAEISTAGSAPLQSPDRKSLENPDL
FT                   PEPPTSSHTHEPLHTASIQGVAGPNRRTRSPSTPIMPSHVPTPDATGKSDNRHNGINQG
FT                   SSNANNSGVDRRSTRADTVRSSNPYFAFQGLPPHALSSQDFEGGNISASTRNNDSSVLM
FT                   TPPPTSSTATTSYFYSEFSATSNKSLNDINENEEMEDFKAANSKGNSNSPSGKFFSPGP
FT                   AYKSSPSPQHLPSDLTPNPIVIVEPDFEENSLSPLPPPALKDITQDDPSSPVKPGLRRV
FT                   ASEPNAIKVANGQGSGTVKKALGGNQPKVSSANASPGDAYLNEEPRRSRRLRNKSFSNK
FT                   FKEVIVGPQSFEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRKKIKRILAE
FT                   QEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIEEDDARFYSS
FT                   EVVAAIEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLSVQAKDTKNPVVKGSAQASL
FT                   LDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKADT
FT                   TNKTFSNVLKNEVTFPNNNEVSRNCKDLIKKLLIKSETKRLGSKFGASDIKKHPFFKRV
FT                   QWSLLRNQEPPLIPVLTENGYDFTRLSNNVNKGNIKQDAVDNDKEKADPIAEQEKIMFE
FT                   EKVERDDIVADDDPFHDFNSMSLMKQDNNSLIYGDNNSYGKISYTPNQNRSRSNSHRFF
FT                   KR"
FT   gene            complement(<623145..>626252)
FT                   /locus_tag="KLTH0A07480g"
FT                   /old_locus_tag="KLTH-ORF16049"
FT   CDS_pept        complement(623145..626252)
FT                   /locus_tag="KLTH0A07480g"
FT                   /old_locus_tag="KLTH-ORF16049"
FT                   /product="KLTH0A07480p"
FT                   /note="similar to uniprot|P25336 Saccharomyces cerevisiae
FT                   YCR092C MSH3 Mismatch repair protein forms dimers with
FT                   Msh2p that mediate repair of insertion or deletion
FT                   mutations and removal of nonhomologous DNA ends contains a
FT                   PCNA (Pol30p) binding motif required for genome stability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21342"
FT                   /db_xref="GOA:C5DC35"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC35"
FT                   /protein_id="CAR21342.1"
FT                   /translation="MSYQPAISKFFKSNSKNSAKRSASGNGNTGSPSPQPVTGSRSQSS
FT                   GFWKDTARKSGDGTAEKHEANAADPARAVSKVAKAALSEYSFTRAKSTEDAPSRRGIQE
FT                   SDDFSEKVQSALRKRASGTLDREADQDSSTDAAAIEPASKKSRKSDKLTPLDQQVKDLK
FT                   LQHMDKILAVRVGYKYKFFAMDAVIVSKILQIMLISGKLTLDDSHPCDRSYKQLAYCSI
FT                   PDNRLQVHLQRLLRHNLKVGVVEQAETQAIKRAHGTSSGVFRRKVDKVFTKATFSINET
FT                   FNRAEANSTGELSTIWALKAAEDEHFFHFWLLSVQLSSGEVIHDKFSDRKKMSAIELDK
FT                   RISYLSPIEVVSRGPLPEVIVSFIKKRQSEVQFYDLSTSEPEAPQGSHLGGIKLPEELL
FT                   ELRATLRHYLENYDTHKILDILHNYKPFDTKTNMILSPNTLESLEIFENQTDLTTRGSL
FT                   MWILDHTRTPYGYRLLREWISRPLTDKNEINKRLDAIECARKEITSIFMEALSNMLKDT
FT                   PDFLKNLNRISYGQTSRQEVYVFLKHLDKIAKHFISHHYYLQEQVFDTGGRVHQRSTLL
FT                   TSVLQQLDDALRKINVTHLLNMINVEGALDKNKEKSCNEFFDLNNYDNAEVIISKLRDI
FT                   DSVKEELQRELERIRRVLRRPRFFFKDEIEYLIEVRNTQLNGLPTDWVKVASTKTLSRF
FT                   RTPETTKLVNQLEYHKNLLTYVCDEEFKKFLVRISADYAQLRDIINKLATFDCILSISA
FT                   ASFNRNYVRPKFSENSRQINIKNGRNPIIESLDVNYVANDVHMKEDANKLMIITGPNMG
FT                   GKSSFIRQVALIGILAQIGSFVPADSAEIPIFNNVFTRIGAHDNLIKGDSTFKVEMLEM
FT                   LDILKNCNENSLLLLDEVGRGTGTTDGVSISYAIIKHFTSMETKCPFILFITHYPILGS
FT                   ITSPLLDNYHMSFIEERRPGERWPTAVFLYKLTRGLASDSYGLNVARLANIPTDIINKA
FT                   FEISEQAKFEMEGDKHLRFISAVKAALLDKGSSYKEKLLRLLEIEE"
FT   gene            <627176..>633685
FT                   /locus_tag="KLTH0A07502g"
FT                   /old_locus_tag="KLTH-ORF16044"
FT   CDS_pept        627176..633685
FT                   /locus_tag="KLTH0A07502g"
FT                   /old_locus_tag="KLTH-ORF16044"
FT                   /product="KLTH0A07502p"
FT                   /note="some similarities with uniprot|P25655 YCR093W
FT                   Saccharomyces cerevisiae CDC39 Component of the CCR4-NOT
FT                   complex regulating mRNA levels"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21343"
FT                   /db_xref="GOA:C5DC36"
FT                   /db_xref="InterPro:IPR007196"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR024557"
FT                   /db_xref="InterPro:IPR032191"
FT                   /db_xref="InterPro:IPR032193"
FT                   /db_xref="InterPro:IPR032194"
FT                   /db_xref="InterPro:IPR032195"
FT                   /db_xref="InterPro:IPR038535"
FT                   /db_xref="InterPro:IPR040398"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC36"
FT                   /protein_id="CAR21343.1"
FT                   /translation="MHTSPELQQSQRSKEVKEVAQITLTQISILITSLDESNCKKIENE
FT                   ILSLLERSPFVVYLKYWKKLLPLASDFIKQHRRLNTSSEPLHRLLYSLIQDLEFKNREV
FT                   IEILTKEVFQNAEFQAQTSLNFTDLLALLDPEEDKRIIEQIDPEAAIKRLKKLRNLKMN
FT                   AAQSLQDFLASETPDTLEQNLSSLLCSLKGESLNDSVALILAEILSPGSQNIQLPSTAW
FT                   FTPNAISEASQRGTQISNAFTKLGPSAINWNRVFNLMSTKYFLNRPISISLASLNSLLA
FT                   ALNRGRLIDQFLSCDWNMQFKLSVCLLFHKWNLQQGCIDLLSMPDIKKVTNNIQNSSPK
FT                   NTLLYLKSVARLDVEIFLLREELAGNPLLPAFQECFFEDYDLAPEYLALVVMSDNKHFT
FT                   MLVDNKSIIDDLLITLLVKVFENSPAALTDLLKQLPFEKVVDMGSIIIRKDSSPLLNLV
FT                   QVLSEVNILPEFIKTLPLHEALKVTPSAKKLGWIGFEDYMKSQLSAETVPLILDHLELQ
FT                   SKMDESSTTFYSSKVYDLSALHYLISLLNSFPLSGKERENLENVQFSLIIAFPRLINFG
FT                   HGHDKAIIANGDSVPIPMDVEKEMQNYLQKMYSGELAIKDVIEVLRKLRDSDDPHDQDL
FT                   FACMTHAVIAESNFFKDYPLEALATTSVLFGSMILFQLLRGFVLDVAFRVILNFAQDGT
FT                   ESKMFKFSVQALYAFRMRLKEFPQYCKHLIEAVPALQSQPQIYQTLSQAAAQSPERSNN
FT                   GATKVQKPPEMIALKYFAISEVPPKVLQESPPKETTEKILFIVNNITQDNFEDKIEALK
FT                   LNLKDKYFGWFSNYLVNQRAKTEPNYHSLYARLINSIGSTLLHDYVLNATFKQLYLLLS
FT                   TKELQFNEKNFLKNLGAWLGSITVALNKPIRYNNIAFRELLLDAHRAERLEIIVPFVCR
FT                   VLQQASSSKVFLPPNPWTLGILKVLLELNQKANWKLNLTFEVEVLFKSLKLKLTDVEPT
FT                   NYLDNADSIAFISGDLFRLTAEQQQAEQQQIVTVMQQYQQQAVLLHNRQQRKAQQPQPP
FT                   QSQQPQQSQTQQRASSTGFSGLPSGLDQPVSTGDSQANENPFNTLLGNTLFVTHPDLKR
FT                   VFQMAIAKSVREILVPAVDKSSSIAVITTVNVVLKDFATEVDEMKLKTAAITMVRHLAQ
FT                   SLARATSIELLKDTIRSTTQSLAPNLMNVPNSPIEELNVAINDNISIALALIEKATMDK
FT                   ATQYVGEQLMQAVAIRRYHKERRSGQLFLAQNANSFSLNLPEPLGLKPTGVTPQQFRIY
FT                   EEFGKNNIFDTVSSASGGGFSAEGGPVSQQQILGQQLLQQQQRQQQQQQQEQHQQQRQQ
FT                   LLEHEQQKQQQQQQLQLQQQQQLQQQQLQQQQQLQQQQQQQQQQQQQQQQQQLLLQQLQ
FT                   QPHAQSQPGTPQAQTQPSVQVELEQSHRVLVLLMDSLVAQIKENADKALDSLGQENGIK
FT                   DILFQILTLISRSNQKDQLALKVSQAVVNSMFATSESPLCREVLSLLLEKLCSLSIVAR
FT                   KDVVWWLVYALDSRKFNVPVIRSLLEVNLIQSSKLDTVLVVAIKNNMEGALQFAVNLLR
FT                   DVILSEKPLFMRSDFVQTLTYLRTVDCDITNSFFQDFEKANILPVNEVRSATNKERMLL
FT                   VFTEWVKLLQRVPSDDVKVAVFISQMIEKGVLSETNNVIEFTKAALELSVGSFKESDPT
FT                   SEVFTATDAFSKLIVNLLVLQDFSEVDRSSYFKLIFSVITFVFSEDQGKTENTFNERPY
FT                   FRLFSSLLCDWEDISSHNFVKVEDQRCRAQLVEFNKEFYRVIASFLHAYQPIAFPGFSF
FT                   AWITLISHRMFLPKMLKLPEKAGWSQLVLLFTDLLKFMAQYTKKQDVPDAVSVVYKGAL
FT                   RVFLAVANDAPEFLVENHYELLNNLPHVYMQLRNVVLSAFPKHVSIPNPYNPKLSIDTV
FT                   KICDQPPNVFYDPVHDLKTLKKPVDNYLRIPSASLSRTISSNVFRSEYEKDNGIGFDTV
FT                   SVDVKLINAIVLHVGIEAALEKQRTTANAVFNVKSSYYTLLADLLNDGTTEVRFHVVQA
FT                   IANQLRYPNAHTQWFNYVLKNFFNSEEWGENKTEIQEIIVRTLLERIVTNKPHCWGIIV
FT                   TFTDLLKSTECSLMDLPFVKDVPEVELIIKHLSKYIVKTEETTNEQQNERAPAEVASRA
FT                   "
FT   gene            <634227..>635408
FT                   /locus_tag="KLTH0A07524g"
FT                   /old_locus_tag="KLTH-ORF16036"
FT   CDS_pept        634227..635408
FT                   /locus_tag="KLTH0A07524g"
FT                   /old_locus_tag="KLTH-ORF16036"
FT                   /product="KLTH0A07524p"
FT                   /note="similar to uniprot|P25656 Saccharomyces cerevisiae
FT                   YCR094W CDC50 Endosomal protein that regulates cell
FT                   polarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21344"
FT                   /db_xref="GOA:C5DC37"
FT                   /db_xref="InterPro:IPR005045"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC37"
FT                   /protein_id="CAR21344.1"
FT                   /translation="MLWFRKRAAKDSRSSESLTTKSRKPPNTAFRQQRLKAWQPILSPQ
FT                   SVLPLLILISAIFAPIGVALIITANNVQNLSIDYSYCENLANSEAFTTIPTKYTKFHFK
FT                   RKASVQPTWKLSEDSEGELTCQLQFEVPVNLKKSIYIYYRLTNFFQNHRKYVQSFDIDQ
FT                   LKGKAVDEDSLNDDCNPLKSEGDKVIYPCGLIANSLFNDTFAGVLKGVNDTDTDYQLSN
FT                   KNIAWHADRKRYKKTTYNASDIVPPPNWAKAFPSGYTDDNIPDLSQWEELQVWMRTAGL
FT                   PKFYKLALKNESTTLPKGTYRMDIGLNYPVRMFGGSKSFVLTTNSIIGGRNMSLGVVYL
FT                   IVAGISILFGIIFLVKLIIQPRKLGDHSFLNFDDATESESRPNTSDIPLREIL"
FT   gene            <635570..>636217
FT                   /locus_tag="KLTH0A07546g"
FT                   /old_locus_tag="KLTH-ORF16035"
FT   CDS_pept        635570..636217
FT                   /locus_tag="KLTH0A07546g"
FT                   /old_locus_tag="KLTH-ORF16035"
FT                   /product="KLTH0A07546p"
FT                   /note="highly similar to uniprot|P21734 Saccharomyces
FT                   cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme that
FT                   mediates selective degradation of short-lived and abnormal
FT                   proteins plays a role in vesicle biogenesis and ER-
FT                   associated protein degradation (ERAD) component of the
FT                   cellular stress response"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21345"
FT                   /db_xref="GOA:C5DC38"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015368"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC38"
FT                   /protein_id="CAR21345.1"
FT                   /translation="MSRAKRVMKELQAIKDDPEAKVDLQLVNENDIHLLKGSFLGPPGT
FT                   PYENGKFIVDIEVPMEYPFKPPKMKFDTKVYHPNVSSVTGAICLDILKNAWSPVITLKS
FT                   ALISLQALLQSPEPNDPQDAEVAQHFLRDKASFDKTAAFWTKTYAPLESAKAEAPVDQA
FT                   ALYGIDRSLVDQFAAQGFDEEKVVEVLRRLGLKSMSTNDNETANKILEELLR"
FT   gene            complement(<638520..>639071)
FT                   /locus_tag="KLTH0A07568g"
FT                   /old_locus_tag="KLTH-ORF16033"
FT   CDS_pept        complement(638520..639071)
FT                   /locus_tag="KLTH0A07568g"
FT                   /old_locus_tag="KLTH-ORF16033"
FT                   /product="KLTH0A07568p"
FT                   /note="weakly similar to uniprot|P53604 Saccharomyces
FT                   cerevisiae YNR049C MSO1 Probable component of the secretory
FT                   vesicle docking complex acts at a late step in secretion
FT                   shows genetic and physical interactions with Sec1p and is
FT                   enriched in microsomal membrane fractions required for
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21346"
FT                   /db_xref="InterPro:IPR028095"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC39"
FT                   /protein_id="CAR21346.1"
FT                   /translation="MHQESPAAYQKSGKFWSKVKSSTKSFSSSFSQLSLKQERDGDTPT
FT                   STVVHKALVKFYSTQEPFQGFPDWLGHKEDLPDEQKVLRKQKHHSPTHSTKPSEPALHL
FT                   PSTCSNSAAVTPTPRTAGTDFRGIYKSSSESRATSVDYMGSRPLPRQSQDASRQENTAQ
FT                   LPPPTQRTSSMLMRERLKRK"
FT   gene            complement(<639228..>640568)
FT                   /locus_tag="KLTH0A07590g"
FT                   /old_locus_tag="KLTH-ORF16031"
FT   CDS_pept        complement(639228..640568)
FT                   /locus_tag="KLTH0A07590g"
FT                   /old_locus_tag="KLTH-ORF16031"
FT                   /product="KLTH0A07590p"
FT                   /note="highly similar to uniprot|P38999 YNR050C
FT                   Saccharomyces cerevisiae LYS9 Saccharopine dehydrogenase
FT                   (NADP L- glutamate-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21347"
FT                   /db_xref="GOA:C5DC40"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC40"
FT                   /protein_id="CAR21347.1"
FT                   /translation="MVKNVLLLGSGFVAQPVVDVLAGTEGINVTVGCRTLAKAQELAAS
FT                   SKSAAISVDVTKDDDLDAALAKHDLVISLIPYIYHAAVVKSAIRLKKDVVTTSYVSPAL
FT                   RELEPQIKEAGITVMNEIGLDPGLDHLYAVKTIDEVHRAGGKIKSFLSYCGGLPAPEDS
FT                   DNPLGYKFSWSSRGVLLALRNSAKYWKDGKIEEVSSEDLMASAKPYFIFPGYALVCYPN
FT                   RDSTPFKEFYKMPEADTVIRGTLRFQGFPEFVKVLVDVGMLKDDENEIFQKPISWKEAL
FT                   HQYWGSKSSSKDDLIAAIDSKTQWVTDEDRERILNGFSWLGLFSDNKINPKGNALDTLC
FT                   ATLEELMQFEEGERDMIILQHKFGIEWADGTPETRTSTLVAYGQPGGYSAMAATVGLPC
FT                   AIATKLVLDGKIKGPGLVVPYSPEINDPIMKELKEKYNIFLKEKTIS"
FT   gene            complement(<641201..>642262)
FT                   /locus_tag="KLTH0A07612g"
FT                   /old_locus_tag="Klth0A.mRNA.gf.450.m"
FT   CDS_pept        complement(join(641201..642153,642217..642262))
FT                   /locus_tag="KLTH0A07612g"
FT                   /old_locus_tag="Klth0A.mRNA.gf.450.m"
FT                   /product="KLTH0A07612p"
FT                   /note="similar to uniprot|P25366 Saccharomyces cerevisiae
FT                   YCR095C Cytoplasmic protein required for replication of
FT                   Brome mosaic virus in S. cerevisiae which is a model system
FT                   for studying replication of positive-strand RNA viruses in
FT                   their natural hosts"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21348"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC41"
FT                   /protein_id="CAR21348.1"
FT                   /translation="MLVPPANFGIAEEGIYRCSKIETLNLSFLETLNLKTVVFVGGQQP
FT                   SKFFQEFFERSCIQWYVVKTADVSSSLAPVNVSTSKPAVDEKLTPLGSSDNETQYKLSD
FT                   NDDLMILKSYSLKRTFELLLNTINHNTILVDKTSIVVGVLRKMQKWNIASIINEYRLFS
FT                   GKNCNYFAETLLEMISVQIIQEEGITGSKDNDQGLINNIDDFDEAHSCHEWEVIKESDL
FT                   SLPPSIPAHLLQILQDVQEDSQETVGETAASTPLMRTQSDMGIFGNRYRLAFNKKERAD
FT                   YEFYKGAEQNVLTINIPKESQLPKWFIRQRDTWENDNAQEQHNFYRESIFV"
FT   gene            complement(<642477..>643940)
FT                   /locus_tag="KLTH0A07634g"
FT                   /old_locus_tag="KLTH-ORF16023"
FT   CDS_pept        complement(642477..643940)
FT                   /locus_tag="KLTH0A07634g"
FT                   /old_locus_tag="KLTH-ORF16023"
FT                   /product="KLTH0A07634p"
FT                   /note="similar to uniprot|P53741 YNR051C Saccharomyces
FT                   cerevisiae BRE5 Ubiquitin protease cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21349"
FT                   /db_xref="GOA:C5DC42"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039539"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC42"
FT                   /protein_id="CAR21349.1"
FT                   /translation="MTDIDNIQEVGYAFLKTYYQRMHQDPFKVHHLYSTTAELTHVNYQ
FT                   MDFDYTADTLPTTKLTGKENISKFYTRHSKKVKSIQIKIDACDFQFTGSNNSSILILAL
FT                   GELCWANTPSYRFCQNFVLAPVPSNPKIYDVTNDVLRFIPYFPTLIRDGKTSSSNPGAV
FT                   KDVRKDDYLKEPFCQHIDSEQNIAQKREDNMNNENNREIAEQQHFTDKPKLAEHEQKHD
FT                   TEKPFQANDMGIVQEAEAGDIQKAEDFDGSEESPVALESNIIDEGVLPEKTNARSDLKK
FT                   EAYTAEDAPVPSSAQFPSELNHNETTKVKSPEADKPALEPAKKMNWASKLAASESKDVP
FT                   NATTKYIRAELAPVQPKKAPERKSVSPSGQLKDVKNYKKKQFYYVNKDGFYPVYVRGTG
FT                   GVSDEQLVRALESEFGTVRKISSQETFAVIDFEDQRCQTEAIERGVLRINNVEVHMEPK
FT                   TVRKANASTSSTSPSGQRFSKKHTSKRKA"
FT   gene            complement(<644272..>645540)
FT                   /locus_tag="KLTH0A07656g"
FT   CDS_pept        complement(644272..645540)
FT                   /locus_tag="KLTH0A07656g"
FT                   /product="KLTH0A07656p"
FT                   /note="weakly similar to uniprot|P39008 Saccharomyces
FT                   cerevisiae YNR052C POP2 RNase of the DEDD superfamily
FT                   subunit of the Ccr4-Not complex that mediates 3' to 5' mRNA
FT                   deadenylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21350"
FT                   /db_xref="GOA:C5DC43"
FT                   /db_xref="InterPro:IPR006941"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR039637"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC43"
FT                   /protein_id="CAR21350.1"
FT                   /translation="MQSVNRQIHELPIGEQFFPQQTQQHQHPPGIGPQIFSPQLLQARL
FT                   QQQQGGLVQDVHGIEKNQNLQNVYLLKQKLEAANAAFGQQQVPQRQSQTQQMLNNGSQN
FT                   ATSAALGSLAGLPPGVGMVQHGTSGMGPPSGAIHPQLAMGSFSLPPPTYFVVREVWSNN
FT                   LHAEFMSIRKLVDQYNYVSISTEFVGTIARPMGNFRSKNDYHYQTMRANVDLLNPVQIG
FT                   ISLSDANGNKPENKHSTWQFNFHFDVTKEMVSAESLELLKKSGINFERHQNFGVLAFEF
FT                   AQLLIDSGLISDNVTWVSYHAAYDFGFLVNMLMNNSMPNNKEDYVWWVQQFVPNFYDLN
FT                   LINKFSQQHPSQLQQQHQPQFTLETMADELGIPRFSLFSSTAGQSLLALLTFTTLLNLP
FT                   LPQPQLGPDLTRYKNMIYGITNE"
FT   gene            complement(<645874..>647803)
FT                   /locus_tag="KLTH0A07678g"
FT                   /old_locus_tag="Klth0A.mRNA.2787.m"
FT   CDS_pept        complement(join(645874..646572,646994..647803))
FT                   /locus_tag="KLTH0A07678g"
FT                   /old_locus_tag="Klth0A.mRNA.2787.m"
FT                   /product="KLTH0A07678p"
FT                   /note="some similarities with uniprot|P53742 Saccharomyces
FT                   cerevisiae YNR053C NOG2 Putative GTPase that associates
FT                   with pre-60S ribosomal subunits in the nucleolus and is
FT                   required for their nuclear export and maturation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07678g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21351"
FT                   /db_xref="GOA:C5DC44"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012971"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR024929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC44"
FT                   /protein_id="CAR21351.1"
FT                   /translation="MGTGKKEKQRRVRQNDTRDGNLRVKGENFYRDAKKVQFLNMYTDG
FT                   KSIRNKKGDLIRAAPLQGVEVPTARVQPDRRWFGNTRVISQDALTHFREALGDTEKNNY
FT                   QVLLRRNKLPLSLLDEKDVQESPTAKILETESFEQTFGPKSQRKKPRVAASSLEELAEN
FT                   AVKHNEQFEEKRELDSTLGLMAQNEQNEDGWTQTAKEAIFSKGQSKRIWNELYKVIDSS
FT                   DVVIHVLDARDPLGTRCKSVEEYMRKETPHKHLIFVLNKCDLVPTWVAAAWVKHLSSER
FT                   PTLAFHASITNSFGKGSLIQLLRQFSLLHKDRKQISVGFIGYPNTGKSSIINTLRKKKV
FT                   CQVAPIPGETKVWQYITLMKKIFLIDCPGIVPPSAKDTEEDVLFRGVVRVEHVSHPEQY
FT                   IPGVLRRCQRKHLERTYEISGWKDSVDFIEMLARKQGRLLKGGEPDESGVSKQVLNDFN
FT                   RGKIPWFMPPPEKVERSAEQDSSQKKRSAQDQSSSDQHAKKIKS"
FT   gene            complement(<647969..>648877)
FT                   /locus_tag="KLTH0A07700g"
FT                   /old_locus_tag="KLTH-ORF16017"
FT   CDS_pept        complement(647969..648877)
FT                   /locus_tag="KLTH0A07700g"
FT                   /old_locus_tag="KLTH-ORF16017"
FT                   /product="KLTH0A07700p"
FT                   /note="similar to uniprot|P53743 YNR054C Saccharomyces
FT                   cerevisiae ESF2 Essential nucleolar protein involved in
FT                   pre-18S rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21352"
FT                   /db_xref="GOA:C5DC45"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034353"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039119"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC45"
FT                   /protein_id="CAR21352.1"
FT                   /translation="MASESSDSEGYISEDDHDVLLVDKRKFQGKDVFDDQIDSEEEDSE
FT                   VDTAGQVSKSRKKASAHELEENPKPVSSEDIKQEKLERLKKLRASKKSKHKTGVVYLSK
FT                   IPPYMKPAKMRQILSRFGEVDRLFLKREDEQRHKNRVKGGGNKKVMFEEGWAEFVRKKD
FT                   AKLCASTLNGNILGGKKGSFYHDDVMNVKYLSGFKWADLTEQIARENDVRQAKLQLEVS
FT                   QANKMNAEFIRNIEKSKMLNNIRSKKRSNVSEATSNENSDSQPAPAHFKQRKVTTNRAS
FT                   GPEHLKKASSGRLEGVIKNLL"
FT   gene            <650427..>651605
FT                   /locus_tag="KLTH0A07722g"
FT                   /old_locus_tag="KLTH-ORF16014"
FT   CDS_pept        650427..651605
FT                   /locus_tag="KLTH0A07722g"
FT                   /old_locus_tag="KLTH-ORF16014"
FT                   /product="KLTH0A07722p"
FT                   /note="similar to uniprot|P32804 Saccharomyces cerevisiae
FT                   YGL255W ZRT1 High-affinity zinc transporter of the plasma
FT                   membrane responsible for the majority of zinc uptake
FT                   transcription is induced under low-zinc conditions by the
FT                   Zap1p transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21353"
FT                   /db_xref="GOA:C5DC46"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC46"
FT                   /protein_id="CAR21353.1"
FT                   /translation="MFTQRHSHSHAGSHDEASLAEASSSAAWWAQWDPNTVTIWDDTVP
FT                   TSWKKCALDGVYFGGSEYQGSLNARISSIFVILFVSTSFTLLPVIFTKVKGIKVPKACY
FT                   LFARYFGTGVIIATAFIHLMEHSYMSIGSNSCVGSSGRWADYSWCSGIVLTTVFVVFLV
FT                   DLLSEVYIERKFGISCSHGDLVEGAISDNNPRLKENDAETGSPVISNKDDVSYDVVSGV
FT                   NSEIAVKPFESQIGAFLVMEFGIIFHSVMIGLELGTTGEEFSILYPVIVFHQSFEGLGI
FT                   GARLISIAFPEGKKWWPYALCILYGATTPIAIAIGLGVRMSYNAHSFKMSIISGVLDAI
FT                   AAGILIYTGLVELLARDFMFDPNRTKNLKKLTFMIICTFSGAGLMALLGRWA"
FT   gene            <652578..>653339
FT                   /locus_tag="KLTH0A07744g"
FT                   /old_locus_tag="KLTH-ORF16012"
FT   CDS_pept        652578..653339
FT                   /locus_tag="KLTH0A07744g"
FT                   /old_locus_tag="KLTH-ORF16012"
FT                   /product="KLTH0A07744p"
FT                   /note="similar to uniprot|P39721 Saccharomyces cerevisiae
FT                   YAL049C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21354"
FT                   /db_xref="GOA:C5DC47"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC47"
FT                   /protein_id="CAR21354.1"
FT                   /translation="MPLFQIIKKDKMSGKCCFTGNLHTGEPLGKFEEVFGLKTYVTGSP
FT                   SNEKVLVILTDVFGNELNNTKLIADQLAGEDFKVYVPDILFGDNVKSLDGSVDFHEWAH
FT                   NHRPEITRPIVDQFMKSLQATFSPKFVGVVGHCFGAKYALHQIDVKQSTANAIAVAHPS
FT                   FCEQEEFRAIGKHPILISAAQTDSIFTVESRHETEKTLNDIGAVYQIDLFSQVTHGFAV
FT                   RGDVSDPCVLYAKEKVTLDQIHWFKHFSKDA"
FT   gene            <654163..>655980
FT                   /locus_tag="KLTH0A07766g"
FT                   /old_locus_tag="KLTH-ORF16011"
FT   CDS_pept        654163..655980
FT                   /locus_tag="KLTH0A07766g"
FT                   /old_locus_tag="KLTH-ORF16011"
FT                   /product="KLTH0A07766p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21355"
FT                   /db_xref="GOA:C5DC48"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC48"
FT                   /protein_id="CAR21355.1"
FT                   /translation="MRVTSKRSRGGCRNCKRSKIKCDERKPKCGHCIRKGKDDCTYSLA
FT                   LRWGNNPSRSLKTRKGDSKTTLLRDAINVTSSRDPHSSSATVNFPSLVPAEAGIEQLLW
FT                   PTGHELLSSPGVSYRPQSFKESFLQAPLSPFSFDSPFSGHSERPINSGLAEPGTLELSH
FT                   PSPSILSNSPYFSELFGFFLRETSRLLVPVPSYAYRSNPFHTLIPQMAMQSPALMGLIL
FT                   AFGANHRNKMTAYQEQCSFPSLDEKSSAKNIDGLLADELLSSTISQLLVKLMNAEERRS
FT                   DTTLATILMLAGFDIFFCDTRNKWRAHILGAKKLLMDRLNSKSGTKTMIFKIPSANNVL
FT                   DTETFLVHWFSYLNIIASLSSASPKNSTEASRGVGYEFCYEDNSAHTHELRLQLRDIDY
FT                   FTGVDTKILSLLAGVSCLIEEKKVIEQPFGIHNLVLKALELDHEIRSYLEASEAARDRV
FT                   ESQLLGEDASSDTKLRFQTYKTMRATNLIFGLTGVLQLKRRVIGIPHNSKILKDLLAEV
FT                   TALIDKEIPHNSSAASCITFCLFCCGCELIDDNLACHRETYTEHIEALLRKGVTSALQA
FT                   QSIMKECWREKKCWWEILEEKNLDLAFAI"
FT   gene            complement(<656853..>656955)
FT                   /locus_tag="KLTH0A07788r"
FT                   /old_locus_tag="Klth0A.tLeu.CAG.8"
FT   tRNA            complement(join(656853..656896,656919..656955))
FT                   /locus_tag="KLTH0A07788r"
FT                   /old_locus_tag="Klth0A.tLeu.CAG.8"
FT                   /note="tRNA-Leu (CAG) cove"
FT   gene            complement(<657742..>659067)
FT                   /locus_tag="KLTH0A07810g"
FT                   /old_locus_tag="KLTH-ORF16010"
FT   CDS_pept        complement(657742..659067)
FT                   /locus_tag="KLTH0A07810g"
FT                   /old_locus_tag="KLTH-ORF16010"
FT                   /product="KLTH0A07810p"
FT                   /note="highly similar to uniprot|P40896 Saccharomyces
FT                   cerevisiae YJL213W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21356"
FT                   /db_xref="GOA:C5DC49"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC49"
FT                   /protein_id="CAR21356.1"
FT                   /translation="MSSCAIDVNERNNKKLEDLAVPWRFKPLQKYCIKNSNLVDVVEGT
FT                   TFPEAYIFVENGKISKVEFGSGQPVDVDTNEYQIIDGTGKYVTPGLFDNHVHMASVTGE
FT                   LDLGKLMTMPKTVSLLRVRYTMEASLARGFTTVRDCGGAESYIKAAVNDGSVIGPRMIT
FT                   CGHAISQTGGHGDLRPGNLPASAFESCSCHYGQVGVVADGVGECYRAAREEFRRGADFI
FT                   KMMAGGGVASPTDKVTNVQFCHDEIRALVDVANTYHTYVTAHAYTAEAIQNCIKLGVRG
FT                   IEHGNLLDEETAELMAKLGCYLTPTLVTYKIMASDQFGSFLGPVNSQKNAEVLSQGIDA
FT                   LKIAQSKGVKICYGSDLLGPLAGYQTQEFFIRGKVQTAQEVLLSATVTPAEMNGLGDKL
FT                   GQIKPGFIADLLLMNANPLDDISILDEPETNLFLVMKEGRIY"
FT   gene            complement(<660003..>661517)
FT                   /locus_tag="KLTH0A07832g"
FT                   /old_locus_tag="KLTH-ORF16004"
FT   CDS_pept        complement(660003..661517)
FT                   /locus_tag="KLTH0A07832g"
FT                   /old_locus_tag="KLTH-ORF16004"
FT                   /product="KLTH0A07832p"
FT                   /note="weakly similar to uniprot|P15365 Saccharomyces
FT                   cerevisiae YJR152W DAL5 Allantoin permease; ureidosuccinate
FT                   permease; expression is constitutive but sensitive to
FT                   nitrogen catabolite repression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21357"
FT                   /db_xref="GOA:C5DC50"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC50"
FT                   /protein_id="CAR21357.1"
FT                   /translation="MSEEEKPVQRGTIEEAEISSRSSSLIEKPDKITNEDALNDEYLET
FT                   VTFTAEEEKALVRKIDLYILPLMCFVFLSQYLDKQSLSYATIFGLTKDLKMGQHDISWC
FT                   STIFSIGQLGANFVFTYLMTIVPRAPMTGACVVIWSVCCMCLAAPTTKEGFWVGRLFLG
FT                   IFEAVVQPACVLITSYWYRKREQPLRTACWISMNAIAQIVGSFLMYGIGKTNKSSVADW
FT                   KLMFIACGVISLVAGIAFYLLIPVSPRTAWFLTKREKEIAVKRLFDESDRTATNKFKKD
FT                   QLFECFKFDWLFLSSLAFGFLVTVTSGTIIFQSLMLFSFGYDKFEVMKYGSPAGAVQLL
FT                   FIWVAVVAVKLFPRERAMISLALVCVPLAGSIMVLSLKQSSGWWIIVGSWLGSVISCIM
FT                   SILLSLISSNVRGNTKKSVCSNAFFAGYCLAAIIYPQWWVGTYKGGLIVNIIMWIIMDI
FT                   YLIFYRFKAIFENKKRDKLQEEGFTLETHLVDDLTDKQNIHHRYVY"
FT   repeat_region   662041..662457
FT                   /locus_tag="KLTH0A07854t"
FT                   /old_locus_tag="Klth0A.LTR.6"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   repeat_region   complement(663681..663866)
FT                   /locus_tag="KLTH0A07876t"
FT                   /old_locus_tag="Klth0A.LTR.7"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <664228..>664299
FT                   /locus_tag="KLTH0A07898r"
FT                   /old_locus_tag="Klth0A.tGly.TCC.7"
FT   tRNA            664228..664299
FT                   /locus_tag="KLTH0A07898r"
FT                   /old_locus_tag="Klth0A.tGly.TCC.7"
FT                   /note="tRNA-Gly (TCC) cove score=66.72"
FT   repeat_region   complement(665204..665617)
FT                   /locus_tag="KLTH0A07920t"
FT                   /old_locus_tag="Klth0A.LTR.8"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <667116..>669619
FT                   /pseudo
FT                   /locus_tag="KLTH0A07942g"
FT                   /old_locus_tag="pseudo-Klth0A-667116-669619"
FT   gene            complement(<670591..>672450)
FT                   /locus_tag="KLTH0A07964g"
FT                   /old_locus_tag="KLTH-ORF15997"
FT   CDS_pept        complement(670591..672450)
FT                   /locus_tag="KLTH0A07964g"
FT                   /old_locus_tag="KLTH-ORF15997"
FT                   /product="KLTH0A07964p"
FT                   /note="similar to uniprot|P38724 Saccharomyces cerevisiae
FT                   YHL047C ARN2 Transporter member of the ARN family of
FT                   transporters that specifically recognize siderophore-iron
FT                   chelates responsible for uptake of iron bound to the
FT                   siderophore triacetylfusarinine C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21358"
FT                   /db_xref="GOA:C5DC51"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC51"
FT                   /protein_id="CAR21358.1"
FT                   /translation="MVDNHGEDPVSGVIHASNEVDGKNIVVEKLFSKNADMEQESPDTF
FT                   EVTESIVIRKAELMAKQYDSWFLKSLFLFTVFICSFAYGLDSIIRDIYMTYAMNAYETH
FT                   SLLSTVNVISMVISAVGQIFFARLSDVFGRLSLFIVSIVLYVVGTVIQSQAYDVQRYAA
FT                   GSVFYNVGLVGAMFQVTLILSDCSTLKWRLFYNFVPAWPAIITVWISGNVVHVANPLEN
FT                   WSWGIAMWAFIFPVSCIPFIACILHMRWKVRNSHEWRELQEEKSFYQTHGLVQTFVQLF
FT                   WRLDVVGVILLSVFTGCICVPLTVAGGVSTEWRSGKVIAPFVLGFSLIPAFVYWESRLA
FT                   RFPLAPFLMLKDRGIWAPLWIYFLIAFIYEMAAEYLYTILLVAANESDLSAIRITSLYS
FT                   FVAAIFSPIVGLLVARSSRLKPYTVVGCSLYFVTMGLFYHYRGGNDAGKGVIGAMVVWG
FT                   ITSCLYDYPISVSIQTVTSHENLANVSALSSTIFRIGGAVGAAVSGAIWTQTLYPKLLK
FT                   ALGDAGMAEAAFNSPLDFITDYDWGTPVREATVEAFQYVQKYEVLVGLIFVVPMFVMTF
FT                   FLRDPPLNEEFGQNLNGEEYVKENDDPINDWIAERLSRFKKQD"
FT   gene            complement(<678392..>679639)
FT                   /locus_tag="KLTH0A07986g"
FT                   /old_locus_tag="KLTH-ORF15995"
FT   CDS_pept        complement(678392..679639)
FT                   /locus_tag="KLTH0A07986g"
FT                   /old_locus_tag="KLTH-ORF15995"
FT                   /product="KLTH0A07986p"
FT                   /note="similar to uniprot|P53095 Saccharomyces cerevisiae
FT                   YGL196W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21359"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC52"
FT                   /protein_id="CAR21359.1"
FT                   /translation="MRYPYQYTALSKKAELLEAFKGKKLSELPTPSFIVDRGKFKENCE
FT                   KMLANVDRLNVDFRAHVKTHKTVEGTLLQLGSENIKTKKIVVSTLMEAWGLLPLIEKGL
FT                   IIDVLFSLPVVKSRLPELADLGARIPNLRLMVDNGEQFEVLAEFSKKHKIQKKWSLFIK
FT                   VNMGSDRAGFDESSTLDEALFDLLQSPAKDYLSLYGFYCHAGHSYASSTEEQARHFLLN
FT                   EIDSGNNACKKALNIDPSLKLQISVGATPTAHASQSLDISSIGELYGKLELHAGNYPFC
FT                   DLQQVSTHCVGLDQVSCRVLAEVLSSYPQRGSRGPGEQLINAGVIALAREFGSLPGYGK
FT                   IVSPKGYENWIVGRLSQEHGILTCLQDTETKMIPLGTKIGIVPQHSCITAASYPWYFVV
FT                   EHGDIVVDIWVPWRGW"
FT   gene            <681796..>682542
FT                   /locus_tag="KLTH0A08008g"
FT                   /old_locus_tag="KLTH-ORF15993"
FT   CDS_pept        681796..682542
FT                   /locus_tag="KLTH0A08008g"
FT                   /old_locus_tag="KLTH-ORF15993"
FT                   /product="KLTH0A08008p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21361"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC53"
FT                   /protein_id="CAR21361.1"
FT                   /translation="MSLVGKVALITGGTKNLGRLTAIELASKHKANLFLHYNSTQGDEK
FT                   KLANELSSKYNVKVELYQGNLGSARNVEKLFEAAKAKFGSIDIAINNVGKVLKKPMVEV
FT                   TEEEFDEMDLVNNKIAFFFIAQATKHVSSGGSIISLVTSLLAAYTPFYAVYQGTKSAVE
FT                   FYTKSASKELIGKRVSVNCIAPGPMDTPFFYAQEQPEAVEFYKSVSFDNRLTKIEDIAP
FT                   IVGFLATSGSWMTGQTLYASGGMTAR"
FT   repeat_region   complement(683907..684323)
FT                   /locus_tag="KLTH0A08030t"
FT                   /old_locus_tag="Klth0A.LTR.9"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            complement(<685177..>686193)
FT                   /locus_tag="KLTH0A08052g"
FT                   /old_locus_tag="KLTH-ORF15992"
FT   CDS_pept        complement(685177..686193)
FT                   /locus_tag="KLTH0A08052g"
FT                   /old_locus_tag="KLTH-ORF15992"
FT                   /product="KLTH0A08052p"
FT                   /note="highly similar to uniprot|Q02895 Saccharomyces
FT                   cerevisiae YPL088W Putative aryl alcohol dehydrogenase
FT                   transcription is activated by paralogous transcription
FT                   factors Yrm1p and Yrr1p along with genes involved in
FT                   multidrug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0A08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21362"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC54"
FT                   /protein_id="CAR21362.1"
FT                   /translation="MPIVQQVRLGSSGLKISPIIVGCMSFGSKSWAPWLLDDKEEIFKI
FT                   LKYCYDNGLRTFDTADIYSNGLSERLIGEFLRNYNINRETVVILSKVNFPVDESLDLSV
FT                   KSIFNVDEVTALTLTNQRGLSRKHIIDGVAKSVERLGTYIDVLQIHRFDSETTMEETMR
FT                   ALNDVVESGHARYIGASSMLATEFSDLQFTVERNGWFKFISSQSQYNLLYREDERELIP
FT                   YAKRHGIGLIPWSPNARGLLTRPVGVATERSSSDPRFQKLTNAGMEIINRVEEVANRRN
FT                   VSMVVASNAWVLHKGCHPIVGMSSTARVDEAVQALTFKLTDEEVKYIEEPYRPKSYE"
FT   repeat_region   686725..687141
FT                   /locus_tag="KLTH0A08074t"
FT                   /old_locus_tag="Klth0A.LTR.10"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
XX
SQ   Sequence 687718 BP; 181351 A; 162604 C; 162532 G; 181231 T; 0 other;
     atctatatat ctagatcccc gctctccatc cactctccct cgtctgcttc catacccccc        60
     acacccttct ccttaactta atcgcttaca taatcacgaa cctcaccact tcatccccct       120
     ccaccaaaca ccgtattctc actctttttt ctcggatcat atctcttcaa acgcacttac       180
     tcgacctatc caactcccga ctcttcatct gctctccttc gtctgcttcc ataccctcca       240
     cactcttctc tctatcactc tatcttacgt aatcacgaac ctcactacct catccccctc       300
     caccaaacac ctttttctca ctcttttttc tcgaatcata tcttttcaag ctcactcgtt       360
     ctatatgtct agatctccgc tctccagtcg cttgccttcg cctgcttcca taccccgtct       420
     caactcttct cgcctcttct cgcttacata atcacgaacc tcactacctc atccccctcc       480
     accaaacacc tttttctcac tcttttttct cgaatcatat cttttcaagc tcactcgttc       540
     tatatgtcta gatctccgct ctccagtcgc ttgccttcgc ctgcttccat accccgtctc       600
     aactcttctc aactctcctc gcttacataa gcacggacct caccacctcg tccccctcca       660
     ccaaacgccg ttctctcact cttctttctc aaactatatc tttccagatc cactcacctc       720
     atatgtccaa ctctcgactc tccatccgct ctccttcgtc taatcttcgt gctcccaatt       780
     gatactcccg gacacttgga acagctcggg atacttgaga cactccctct agtacacccg       840
     ctatatatta aagcaactgt ggagaagaac atgatggcag atgactctgt gggagacggc       900
     actccaggac ccattactgc ctacctcata tctgactaca ccctcacgta ttcagtgatt       960
     actggtgctg tagacggtat agacacagtt agagcacttc cacaatgagg gtgtcaggac      1020
     actagtacta cgctcactgc acgagctcta cagctcctag ttgaggactt gggaaatgat      1080
     tcttttaatc cttcagtgaa gtcaatctac gagcccactt ttcatattta ggtgtcagaa      1140
     tatatttttc aacgtccatt tgtctcgata taggaacaac tataaatgct agacaggaaa      1200
     tagatgcacc gcaatactcc ctcatcaccc ctcttccatg tgaagttttt ctgcaaccgc      1260
     tcattcgtaa acctacccat acatctcacg cccgtacaac cacctctaca ccatgtgacc      1320
     ctattacagc cctccccgca gctcctactc gcatcaccgg cagtttgcgc accgcccagt      1380
     cctacaactt tggcgccggt ctgttgcggc tattaacaaa tatcaggtag ccgtccaagt      1440
     ggtttgcggc cttctgcatc tctgcctttt gctctatgaa ctccagtaag agatgatgtg      1500
     gcccctcgct ctcaaacacc gagtgccaga gcaggagggg aaactatgga tatccaaaat      1560
     aggagtgttt ctaattagtg gaggtgacat ttggtgggag agaggtggga ggtttatagt      1620
     gagaggagaa ggaggaggag aaggaggagg atcaggagga taagaccttc ttttattaca      1680
     gcaggcagcc ctccaagata agccaattgt ttatcgatag ataaggtttg tgcagcccat      1740
     atcgcgatca agaatgtgca gcactttaac gaatccacgc ggggggaatg gcaaatggca      1800
     aatggcaaat ggcaaatggc aaatggcgaa tggcaaatta cccaaaagcg aaagaatatg      1860
     agtcgggatg gcacccggag taatcaagac acgtgactgg tgacaggtga caggagcatg      1920
     tgatgagaga gtagcacgtg acgcagggac aagccacgtc atgctctaca ggctctacaa      1980
     gccaagctca cgctcacact ctcgaaagct cttcatcgaa gagtgcacag ttttgggtat      2040
     tttcaaaaat atacgttacg gaaggatccc ccaagacatg ggtaaaactc agaaaaaact      2100
     acgaaactcc ccactcgtgc gctggcgcgc actcgttaga gagagaggat ccggagcgat      2160
     ccaggcacgt gacggggaag aggagcctgt gatgggtgat agaggcaggt gataggagcg      2220
     tttgactgga ggagaacgca ggacaaacat ctctttggac aagtcaataa gctaagctct      2280
     atacgctgag ttctgtaagg taaagcctca gaaaatacaa aaaaaaatac actgcacact      2340
     tgtgcgctgc ccctcaattc tcagatccgg aaacattctg gagacatttt ggagaactca      2400
     cgctgcacaa catttttcac ctggcaccta ttttttcatt tgtgctcatc ttgactctcg      2460
     caagcctttt tcaaggcgtt attcatggct tcaaagtttc tttgagctcc gcccaaaaca      2520
     ggtttgagta gcggcagagc tacacccgag aacgtttcgt gttgtaacaa tgtacatttc      2580
     tgaccgccgt tttcttcctg gaactcaaac gtgtgaatgc ctgagaaaaa ccattgccca      2640
     ataagagatc cctcccactt aaacttgttt acagtgttag cgagaacggt tggtgtgaac      2700
     ttattgactt ttccagatcg tatatctttc attgttactt ccaagcgatc gccaggctta      2760
     atctgggaac ttaaatcatg gccgtcatgt tcaaacaata caattgaggt aaaaaatggg      2820
     ttccatttgg catgcccact gaaatcgagt agcgtttcgc gaacgaccga agcaggtgca      2880
     ttgatttcca ctcttgtaca aaccttcata actttagaag tctgagagag agagaaacga      2940
     gctcatgctt gtgaggatta ttgcttcgtc cttttatgct gattcaacga tgctatgtga      3000
     tactccactg tgcagggtac ccttgaaatt tgtcatcaat atcatggagt acgtatcgag      3060
     tggggaaccc ctcttgggaa tatgctagac acgcccacac atgcacgtgt cgtcaccgac      3120
     caaaccggaa agaatcaatt atttaattag aaaatatagc cgagagcact gttgcgtttt      3180
     aactttactt tttaggctaa tgtcgaaaaa tgctgcgggt catttaaaat ccgctattga      3240
     gaggttgaat cggttacctt gttgtggagt cctagatttt attgggcctc acaagtactt      3300
     aaaaaatgtg aagcaaggtt gtatactact caaacaaaaa ttccatgata acaaatagaa      3360
     caaaataatt cagtccctgt tgaagatact aggcctgtgg aagatagtgg aatcagggga      3420
     caagcggaaa gaggcaagat atagtgaaaa taaaacgaat gagaaaaaat tgaagtataa      3480
     aaatattgat gggattctgg gccgttggtt gagaggttgc aaattcattg gctgggtttt      3540
     ccaataatgc gatcagtaaa ctactctgtg tatgatggta ttaaataccc ccactggtct      3600
     tgtccacgat tttgatatcg cggctaaact aatttatcca gatttataca aattttccag      3660
     gggtggctca tgctcggcta tggggtgata attattgagg cgagtttggg tcactggtcg      3720
     aaagggtctc aaattccttg gctaggattt ccattataat ctaggtaaac tacttcgtgg      3780
     atgatggtac taaatatctc ccccatcttt cttcagtcca agattcatgt cttgcaaacc      3840
     aaagagatga tccggattta tacaaaatgt ctgggacgtg gctgagtctt aatcataagg      3900
     tgataattat actggtggca ccactcctta ccttctccaa gccactgtgg tctgatctgg      3960
     actatgaacg gtcaatgtgg accttctgtg tggcttaatt gggtatccgt cgcatttatg      4020
     atatgtccat gtgccatatc atttcatacc aatgtgtcat tatgcaactt ggcactatca      4080
     cacaccaacg aaccgatcac aatctgacaa taatagtatt gtaagcctct gtcaatcgcc      4140
     tccaacgcac tatcgtctga tttgggcttt taacggcagc tttgtgtcat catatgagtc      4200
     ccagctgatt ctttgccgtg tctataattt ctaagatatc aaatcgtttt gtactactct      4260
     gtcattacac aatttggcaa tatcacacat cagcgattcg actataatat gacagttccc      4320
     atgagatgag ggatccgaat tagcaataaa atgtgttcaa tatttgtgga ctaataaaca      4380
     caaaaaagtt acatgtgcca gaccaaagaa taccagtaac aataagatcg atgctacaac      4440
     tgatgctcct catgctaccc aagaggatta aacaccccaa caccgagtat ttataagacc      4500
     agcagacaaa ttatatccgc aagatatagc ctatcaacaa taagctgtgt ttccttaact      4560
     taagtcgagc cgaataaatt gatcaactca ttctctcaat caagaactta catcaaatta      4620
     caacagattt ggattcaatg cgcgggttac aatattcacc taaagacaaa cagtggcagc      4680
     atcgataact gaatctaata cctctaggtt ctaaaattga ttccttgaaa gtaaagactt      4740
     cagagtcaga cgagaatatg atgcaggcga attttacgtt gaatacggaa gcatcaaaga      4800
     aaacacagca gatacgttaa caaaaccctt gcctgcggat atctttcaaa gtttaatcaa      4860
     tgcacgggta aaccagttat ggattagcac tattagtagt atgtcggagt ataattgaat      4920
     tgctggtgtg tgatagtgtc aaattgcata atgagacatt actaaaaaat aatgagagtc      4980
     aacatcttat gatgataata cgaacctaga taaaagcaca aagaaagatc aacagctatg      5040
     aagagatgtg gaaactgatc ttagttagcc agagaaaatg aggacttgca ccacgagtgc      5100
     aattacgcca caggcgtagt tcttatctca tagtaattca aagccacgcc ccaaaacatt      5160
     gtatcaactc cgatggtttg atagaagaac aggattctaa tcttggacca gcgaaacaag      5220
     cgaaagaaac ttgacaccat cattcgtaaa ataatttact aatcttatag gggaaaagct      5280
     agccaatgaa attgacagct attctacgaa ctaccaagtc tcatcttaat aacaggttgg      5340
     tcggagttcc tgcatgtttt atgtttgtta ctttatagat ttaccatggc aacttaggtc      5400
     aagcagttgc ggacaatagg gacaaagata tgaaatcaac aactaatgac tacaatgcca      5460
     gtactcaaaa attcttgtct tccttcttga tggcgagaat tccctcttag cttaaacaca      5520
     agagggctgg agctgatgtc ttcactcctt ttaaaatgcg tgtctggggt atttctgcca      5580
     taagtcaagc gactgtaagc aacaagctgt tttttttcat aacccgttgt ttagttggta      5640
     ttttttggaa gcgcgtttgt tgcagatact gttctttggc tacgctattt ctacatctca      5700
     aaagattcct caattatacg ttcttggttc tgaacctcaa tttcacttat gtaaacttct      5760
     accgcgttaa tctcctttgt aatattaaga aggagataga taggaggtcc atttgaatct      5820
     cagtgactat ttttgcttga gggtgcattt acactgctcg ttggtatctc accttttcac      5880
     cttataattt cttctgctgt tcggacaaaa aacgactaca tcccaaaggt tggcttaata      5940
     gaagggaaga gaaaatttgt tgtaaataga atcttgagag atggcccgtc aaaagaggga      6000
     tcaacagaca agcaattttg ctatcgattt tgtggcaagc cttcgtcagc aatctattgt      6060
     agccagcata tgtggccaga tcagtgtctt tcatcccttt tagtactttt atggtgcatt      6120
     tgaccttgaa tcttacaaaa cttgaacttg cgcatgcaac gtttaaccgt gaacattcct      6180
     aatgaaatgt ttcatatcat agttaggttg cttatgacct gattttctga aaaaattcag      6240
     gagagaagcc taatgttaat tattgctccc ttacactcaa ctattttaat tggactagta      6300
     ggattttggt ccaaaaattt taaggaagag tggcccatgt atgtcataat cacattgtct      6360
     tgggggaaat ttttacatta ttgccagctt gtgtcttgta ttttgcgaaa ttcaaactct      6420
     attcagactc cagcagcctc ttctttattc aatgtattgt ttcaacttag aagtattaac      6480
     tcgaaccatg taaatagatc tgatgacaaa ccgctcaacc ataggaataa aacccaatta      6540
     ttttagatta gttttgcttt aattccacta ttgatcttag tcgagtcgca atacttttac      6600
     accaacaaat aacgtgagaa aaagtggaaa atcatgacgg aagaagaaag agccacccaa      6660
     ttccaggcca cgacagactt tgggaacaga aggcaagaat ccaaacttca acatcaaaag      6720
     aaaattatgt gccactaaat tcacgatcag tgtcagttaa acacgactat atagagacac      6780
     ttacatgcat aaccaggtgc tgccggggct taactaagcc caaagaatct aaactatttt      6840
     ctttgttcaa gaatctgttg ctacaactca gggttttttt ttattagaat gcggccgcat      6900
     tactgatgtg ctataatgaa aatttgtata acaacacatt agtggaagtt gatatggaat      6960
     tcggcagcta atggctatta taagagcccg aaactggctt tattaaatga gaaatagcga      7020
     agaatggcgt cacaagtgca gttaccccac ggatgcaaat cctatattgc agtttcggct      7080
     ctgccacatc tcgctgtttt ccataaagcc ctatagtttg accgaaaaac agaaaataaa      7140
     tcttggacta gaaaaaatgg agaaacataa agtatatatt taatcggcga agtggtttac      7200
     tgatcttaaa acggaagaac tagccattgg atccggcgac ttctccttca acgacccaga      7260
     ctcgcctcga tacagacatc agctggtagc ttatgtataa atcaaattcc gacttttctc      7320
     aaccatttaa gaatatatta agagtgtaaa agtgaacaaa caacgtatag tacacttttt      7380
     ttacgataag aaagttaggt tttgttctga gagttagtca ttaaatgaat gaagaaaata      7440
     tctttgagcg cttattcctt gagcttgatt ccattgtatt ggtatcttca aactttcttc      7500
     atccatgtct tgcctttgcc cctcttcgag attgacttca tagactttta cagtgccaaa      7560
     accccgattt ttcaggaggt taacacccac atacgacaaa aatacggctg gtaataagat      7620
     gtaggcattg aaaaagtctc tagaagcaaa tggaacaaga ctggtccaac cttggacaag      7680
     ggctaggaat atatttgcag tgaggctaaa aattgtcgtc cacgggtaaa ataaggtttt      7740
     ataagtaagt tcgtcgaccg atttgccttg aaccacccat gcttttctaa agcgaaaatg      7800
     tgttatcgaa attatagccc acacaatgaa aaccccaaca ccagataggt tgacaatgta      7860
     gttgtatgcg ttcgacgctc ccacactcac gttcatcaat gatattactc ccagagagtt      7920
     aaaaagaatt aacgcaggaa caggcactcc tcttctattt gtccatccga ggtatttggg      7980
     gacaagacct tcgtgagcca agtgactaat tgttctgctt ccaatatagg gagagttgtt      8040
     aattgcagaa atgcatgtca ttaagatgaa agcattgacc aagtgcatac ctcctgccca      8100
     gcctactctc gctagggcga tgcttgttgg agacttaagt gttttagtct gcgaacccaa      8160
     tgtggaatta tcgtaaggaa ctgtaacgcc atagaaattg gctataccaa tgtaaactat      8220
     tagaattctc cagaatgtct gcttaacagc taaaggcaca gcttttcctg ggctcctgct      8280
     ctcagtagca gtgagggcaa cagactctgt acttgaatag aatgttgagc aaaagacaaa      8340
     tactaccgca atacctttga agtcattgga caacgctcct ggattgtttc agtactggaa      8400
     gccaatagct gatttgccat aaataccccc tgatatgtac accagagaaa aaatgtagta      8460
     ggcaactaac cccagaatct taaaccacgc gagccaatac tcacactctc caaaggcgcc      8520
     tacaccaata aggtgaaagc acaagaagaa gatccaaaac ataatgatgt gtccataaag      8580
     aggcacctgc ggtccccaga actgcaggat ggatgatatc gtgctgcatt catttgccaa      8640
     cacagcaaaa aaacgacaat atacgcgtaa ccggaaaccg cagataagcc gttactatga      8700
     aatcttcgcg ctaaggtttt gaagccacca ccagatggat agagtgtgac tagttctcca      8760
     attgattcca tgactgaaaa gcacactgcg ccattaattc cgaaatctaa caacaaagcc      8820
     aaaggtcatc ctttgtttag tgcatttcca gcgccaatga ggcgccctgg gccaataacg      8880
     cctcctaaag ctaagggtga aatgtatctg tttttcaaga ctctttttac acctgaattt      8940
     ggatcaaact gtgctaatga tgttccatcg agcgagccaa catcaagctc taagacttca      9000
     ggttcgatct tacgtagcat ttcatttgct ccgacacagc cttcataaat tgcatccata      9060
     atgccctgat ttaaatccag attaccgtca ttaagtcctc aacacacaat ggttatctac      9120
     taaattttat cttactacca ttttataggt cccaaatgtt ctaaacctcc ctttcatgag      9180
     caaacctaag ctaaaatttt cgtttttcgt ttgtctttcg aagccacaac ttttacccaa      9240
     ggttgaatga gattaaatag tttttgaaga caataggcgt tttgtagcct cagcggctaa      9300
     ctacttaatc ttgctgctct attacactaa acttactatg gcattttacg caacttgtga      9360
     ttccctgaaa tactatgcat gagcaggatg ctcacttgtt taaaacccta ccacgattaa      9420
     tagcttactg tcttaagtcg atgttcaaat tcagagaact tcatgatttg cagaccggtt      9480
     cattaagagc ccgggtggct ctaagttcct gtgaacataa gctcacagag ctcagtatct      9540
     acatggaaaa ggtttatata tttcaggtca acgtaagggg aaaaaataat gagccctttc      9600
     agaaaggctt tatattggat aacttggtag gcatttctct gcataagcaa catctctgtt      9660
     ggcctttgtt ctgactcctt taaactgatg tagaagtaat ataactctgc ccatagcatc      9720
     acagcatcgt ggaaaaaaca ctgctaaata actttcgcca ccatttaaaa caaatatgat      9780
     catattacta accagaaact gaaaagttca ttaaatcaac cgaattctct gtaaattatg      9840
     atgagaagca gagcattgaa aaatcacgtc aaaacggttt agaagttcag taattcagat      9900
     acatcgatta aattgacaac catgaaattt ttcacttgaa agaacagctc taattttgtt      9960
     acatgagagg ataactgcat gacaaaggtt agtaacttcg ctgacgcctc agttgcaaag     10020
     acaaagatga agaagcagca tatactgctt ccagtaacgt aagctaaaaa taaacccaaa     10080
     aagcagtctc acatcttcct aaagcggtgt aattgcgctt ttgagattcc acttcagact     10140
     acggctatcg gtgagacaag cgatagtacc tgttgtcagg gtcgaacccc ttatgcacta     10200
     tttacgtaaa ctattatttg ctttcccact aactgagccg cagatagggc tttacgcgcc     10260
     ttatgccact acggaattat gtggtctggt ttctgtttac atagctagta gatagtcatc     10320
     ctcggtttga atcaattgta tgctgccacc ggactctacc gcaaagaagc tgcagacaat     10380
     tttgaacatt tacagtagat ggcaactgtt tggagcggaa aacaattgga ttggttgggt     10440
     gtttttacca atatatatag gaaaaatttt aacgctcaat tcaagtattc tttgaacagc     10500
     tcaaaaaacc aatttaatgc cgatcctcaa tatttctttc accaaccgct cctgcgtttt     10560
     tcaagcaatt gttgataaaa aaagccctca tgtaatcaaa ggcaaaggag ctaggattgc     10620
     aatagaaaaa aatgcaaaag aaaacgaaga tattagacgc cgttaatggt gcagccgttg     10680
     actttcctgg ctgaggaaac gaaaaggttt ttgaaaacat tggtaaagct gctcgtcaac     10740
     ctacatactc atatgcccct tatgtctcaa acagaagctc cgagccgtta gcctaattct     10800
     acgtagaata ttctgctgaa ggtgcttttt ggcggctctt tggtgttcat cgggctctaa     10860
     agcaatgaga atgctttaag aattattagg caatattact tggaacgagg attaccaggt     10920
     tagctgaaac cgatgagaag agagaactct taccatggtt ttactctagg ggctcaatct     10980
     atcccttgga atccaaaagt cggcccctac gaaccatatt taatggatcg cgagcacatc     11040
     aatattagaa ttccttttgc gtattcccac cgctttaaga gggacgatga gaccgaaatt     11100
     gaatacggtc aaaggcttat tttagacctc aaaaaaaaat attgtcgaaa ataatccaaa     11160
     cgctatggcg acagccacta tcgaaacagt accgggttct tagctaggta ctatccctcc     11220
     gcctaaaagc tacttgaagg gaattagaga cttgcgtaac aagtactata atattttcca     11280
     ccttgataaa gttatgtgtg gaactggaag gagcaatcca aacggaacac caaattgctg     11340
     ggaaaacctt ctcgatccct gcaatgctcc agatattcaa actgtgggta gggactttgg     11400
     gatctggata cgtgactttt gcaggagtat taattggacc gaaaattacg aaattctttt     11460
     tagctgggtc aaaaactata actggagaaa ggttctattc tagccatgta ttttcttgcg     11520
     cacttgctct tggggttcaa gaaaaggtaa aaagacaaaa attaatgtct aatatattta     11580
     aaatgggaaa tatttacgaa acaagcccag gagcgccctc attcgtaagc ataacatagt     11640
     cggggatatg aagagagctc ctagattttg ggctctctta attgtcagtg acaggaccac     11700
     gaaagagctt ttcgaccgcg atttgaatgt gggacctcgg ttgcaatctg tttgttttca     11760
     tagcggaatc tacataattg atctttctgt tgatcctggc aaaagctgcg gcgacagagc     11820
     attactagct ccttcctttt cattagaaat tatttaacag attaaaacgt aaacaaaatg     11880
     gtgagatctg ttgaagagct ctcaacacat ttgaagattg agggcgtttt tagctatttt     11940
     ggaaaaacca tgtttcacgc agtatttaaa agggtaagcg attaagcaaa tctgtgctgg     12000
     aaaggaccag atagctatct tatgcatcct ctgagcttat atcaatcaac tttgtatagc     12060
     cggaaactgc aatatcgcca ccatatgagt atttttacag atattcacta taaataaatt     12120
     ataatagttg aatgtcacca gattaatttg attagcagta taggccttat aaggacagca     12180
     aaactcccgc atcactcttg tttactaaac ttttaaaagt tctcatgttc ctgaatttct     12240
     tcctgacatt tttgtcagat caaagtcgga ctgcttaaac cttatagtga tagtgccaaa     12300
     ttgcataaca aaacattagg gaaaagtggt atgggaattg aaaacagctt atagtcatat     12360
     aaagagacca aagaaagatc tgcatctatg ccagaggtcg gaaaaatctt tataaaatca     12420
     gaaatagcag gtgaaattat agcacaggtg cagtttttat ctcacagtca agtctcagcc     12480
     acaccttgga attctataaa aaaattaata gcttgatcag gaaacaggac atcaatctta     12540
     aaccacaaga attggggaga tatttagtac tatcattaaa gtagtagctc aagggtctta     12600
     ctatggaaag acgaggcaat aaatttggta aactctcggc caacgaccca gacttgcctc     12660
     aatagaaatt aaaccttgtc cgctgctttg agcgatcaaa gtgattgtta gatgcaacgt     12720
     atctgacgct caggctaaca aaaggattac ttctttactc tgaaagggca aagaatttga     12780
     agaaaataaa gacaggcaaa gttgtagaga gtatataccc gtgattaaaa gccactgcta     12840
     cacaattgaa tgctctaatt tttaaacaaa cgaataagag gccacaatca gattacagcc     12900
     aaatccaaag ctaggagaaa gctcactctt aatttgctag cagctccatg ttaagcggac     12960
     acgggaagca aagaagtact ttaagctgtg ctagctgggg actcggagct gggtgtgcca     13020
     gctagagatc cggaaccagg ttgaccaact ggaggtcaaa aaccaggcgc gccagctggg     13080
     gatctgagac caagcgtgcc agctggagat ccgtaaccag atgattttga tcaggactat     13140
     gtaactcaat gttcaaattt catggttgtg gtgccagttt gaacgttaat ctccgtcgaa     13200
     ataatttttt aattgaaatt tgttttgatg gtatctgtgg tgtcactttc agtcaccaat     13260
     gttgaaagcg ttaaggtttt tctaggagga acactactag tgttaccata gaagacagac     13320
     tttggagtct cagcgtagta caccgtctca gtaattgcgg tgacatcgga gccagtgaac     13380
     gtcgtcgccg gtggagtcgg tcgaggtgaa agagccgatc caaggggcgt actttatgag     13440
     cttcttctag ttctccagga tctcgacgtg gtgcacggtc tcggtatcgg tagttgcaat     13500
     accattggag ccgacgaacg tgcttacatc ggtggagcaa gtggtagcga aagtgccagt     13560
     ccatggggtg tgaatcgtag actcaacctt gtccttcggg gtctcaactt ggtacaccgt     13620
     ttcagtgatg gcgataccgt cactaccagt aaaggccaaa atatcggtgg agtagatggc     13680
     ggtagaattg ccggtccatg gagtttattt cgtggactca accttgttct ccggggtctc     13740
     gacgtaatac aatgtttcag cagttctata accatcttca ccggtgatgg tgtactcggt     13800
     tgttgtaact tttcttgttt caaggccgtc ataagctgtg attctagtgg aggtgtggtt     13860
     accagttcag ggttcttcta caaaaatgac attgttggtt ctttcctttc cctcgggggt     13920
     tttttatgtt gatgcgacag tatgagaagt gatgcttgaa ccagccaaga atttagttgt     13980
     gtaatccggc ctaacatcac atttttctcc gtctttgaca ataagaatgt aattttccca     14040
     cgtctcgtgc tcgactccat ctggcgaaat gaagtggatt tcagagcgcc cgccccattt     14100
     ctctgtatga agaaaatacg cagtagatag tagtatctct caaccgaatc aatggaaata     14160
     gtactagttg tgtcaggcta ctgtgtacta aggacaaagc caccaggatc ggcaactgcg     14220
     ttttccaagt cacagcaatt aaacgcgttc ccagcgccag cattaatata cgcaaggtcg     14280
     tcgacgtacc tcaaattcag ttgatatgtt tcagtggcct agaatagccg ataagaagca     14340
     tggaaaaatt agttatagtt actggagaag ggtagtatta ctcttgactg tcacactaga     14400
     agaaaaaccg ctttttccgg tttcaaaagt gacgtaggtt gcgccggagg catttccttg     14460
     taaacctgta ccataagtcg cgcaatcttt ccataagtga ctttcttggg agtagatggg     14520
     atctccgcaa ggtctggttt tagtcatggg taaactatag aatgacacat caaacgatga     14580
     ttgtcgaatc tagtaagttt tggaggctgg aattgcgcct tcgttgattt gcataccaag     14640
     taaatacgca aggaacgaga aaacatgaaa cgcaactgca aaaagcatgg agaatagtgt     14700
     ctatgctata aaatgttgaa gtgcacctaa caaaaaggtt actttatata cagtgtatga     14760
     aacttccctg caattttcaa tcagaagaga caaatgcgta aggcgtgcaa tagtgatggt     14820
     ggtgccagct atctgcgagg ttttcgcttt tgaaagattg tcttccactc gagctgagtg     14880
     tgtcgctgct gcggacaata tatgcagaag ttgtaactag tagtggccaa tatgataatt     14940
     gcataaaaga tgtagaacgt tctctattac gtcattatgg gtcacccttt ttctgagacc     15000
     tcaggatctt tatcgtgata ctcgcgtagt aaacttatca gggtccaacc aaaaatatct     15060
     tcatcgaata aatatataca aaaacaacta tcatttcccc gcgaatgttg caggatgaaa     15120
     agctttccca atggccatgg gaaaatcatt aactctaagc atgacaagtt ttttaaaaaa     15180
     aaaaaaaagg cattacaaac atctcttttt ttgtagcctg gctgagcgac aatactcaaa     15240
     gggctttgag aaatttattc tccaatcaag tacaacgagt ttcgcgacaa atgcctgtat     15300
     acttacgata agttgaaagt atttaaaata aaaaggcata ccccaatgtt agagagatac     15360
     ccccaaaaat gtccgaacgg gtcgcctgaa actgtttcaa aagaattaca agcagtggca     15420
     cctgatgaat gctgattcaa aagacagcag caaaacatcg ggcaatacag cccctatttt     15480
     ttctgagagt ttagatgcac tgtatcactc cagtgtgaag gaagatccgg caaaaattag     15540
     tcctaacttc acgggagggg gagttgcgct tttttcaaaa gccaaaagtt agcgaatacg     15600
     ggcctgcgat tgaaatcaca taaaactgcc tgtcgttgaa gtgcttccgc tcctttttca     15660
     tcgctgaaga attatcagca ttgaaggatt cttggccagc tagtaggaaa acggcgtgct     15720
     ttatgtacct cctcaaacat gcaaaactac catctagaag acagcaagca ctaagagcga     15780
     agtcgaggca agagtcttgg ggtaaacttg ctcaagggtt gtcgtaggca acagcccttt     15840
     ggacctctag atcttgaaat tggattcgtt gaaaaaactt gagcagagct gctttatttc     15900
     tgtaatttcg aactgcaaat ggccatactt ctttaattgc aatactaact cattaaactt     15960
     aaggaacgct taaaattagt ttgaaatatt tggtggagtt catgcattcc aagatttttg     16020
     cagtcgctac aggtgatatt aggaaatcat ttgcataaaa aagtgatgca aaggtggaca     16080
     atatatttga ttgccctgtt aggctaaaag ataacgcaga agcatggaaa tttgagtcaa     16140
     aaccttgaag tcgggtatca aataataaat gcaagtctaa aaccataaca tgaaatagaa     16200
     aaatcttaaa tgtgaaagga ggttctgatg ttcctgggtt taaaatacca atgcctgcaa     16260
     tagagaatgg aaacagacgt aaccgcgcag caagtaataa tattatgttc tgtgactgct     16320
     atattatttc ttttctgcaa atggtgtcaa agacccgcta ccaaacacaa ttgtgtgacc     16380
     aacaaaatct ggcttttatc aattttcaat ccttgagagg tgagcagaga aaaagttgca     16440
     agctcggtat tcaacttgag ccgctgaagc tactccactt ccgacaccaa aaataaatat     16500
     gaagcaccaa ataaccaaaa tgaaacctcg ggaaatggat aacacttcag gaattgaaaa     16560
     tcatgctaaa agaaatagag ctcgaaaacc aataagcgca ggaactcttc caaatataaa     16620
     aagtgggcga gaaatgaagt gtgctaaaac acttgcgtct tgttgcaata tcccgactct     16680
     tccaacattg gtctcctgtg ggtgttataa atttagatct tttttagact accccgaaaa     16740
     accacctgtt tcaccctaag gtgctgacag aatcttaatc tttttctgaa aatcagttgc     16800
     aagactctat cccctataac ctaaggttgt aattttgagt aatttatggg ctgggcaacc     16860
     gtaaattctg ttctgagcat tcccctccct acgtttgctt gaacctacca tacaagtcgt     16920
     tgtgaacaga aatgtttatt attttgtttg ctgcggtgtg cggtctcttg atttataccc     16980
     agcccatcaa aagtaattac cgctaaaaat ttcagtgttc acgtctttaa aattatgctg     17040
     aaacagaact ctgcactctg ttacttttat tggaatcacc gtgagattat gtgatctcag     17100
     catttggact gtctatgaag cgctaaatct ttgagccgga ggtcaacatt tttgttagcg     17160
     caagcatttg attagatcca gcgaggcgct caaaaacgca agcttggtta gctgcctatt     17220
     tgcttgctta gccagatgaa gcaagtaaca agccaagaag aaattgatct tgaatcttcc     17280
     gttttccctg tctcaagtat tccagcaaat acgctgaaat tgcaacagcg ctttaatgga     17340
     agcttaagaa taaatatact ctgaaggtgt taaagcaatc tggcagtatt gagaatgatt     17400
     ttttagggtt tctacagtgc cgtcaagctg gctgttatgg aactccatga accttttgaa     17460
     gtgtacggca gtgctgttca gctcaaaaat tacaaccttg cccgtaaaaa tgattagagc     17520
     gggagcacta cctccgagct ccggcatccc tacgctattt atattcgatt ctctcgaggc     17580
     aaagctttct tttttttttc ttaatgcttt aacctctttt tgacgatggt ggcgcctaga     17640
     tcttctggtg taccgggtgc cgcttgaatt gcggtattgc aagtattatt cgtaagctat     17700
     tgagctgctc aagtttcgtg acatagtctc aagatgtatc ctttagatta taagcatctg     17760
     gaaacccctg caaacccgtc aaacttgagg catctgagca ggaccttcaa gtatgctatg     17820
     cgaaagtagc gatctttaat attctgtttc acactcttat tccctataga ctgtgattat     17880
     ccatcgtagt agctgagaga gatgcttgaa attaacaaaa tttcagtatt aatcaaggcc     17940
     cagagttttt ttgatgtcat ttcgccaccc aaatttgtta ctcgttggta ttcgatggcg     18000
     cactgtctaa cttgaccccg cacaatatct tcggattatt tatccctacc ttacaagatg     18060
     tagatatggg tggagaatga tatcttcatc caggtaaccc ttcgcatggg cggtcaaacg     18120
     tactctattc ctgagtcgtt gtcattacaa tgttcgagtc gttgggaaga attctacccc     18180
     tcatcgtaca acattatttc agcatcagat gatctggctt cttatcgtgc ataattttcg     18240
     tttatgcgtt taatggaaac acacctacgc ttcaatgaaa ttatacgctt actgcacttt     18300
     gtccggcatc gaccaatata ccacgtgata tgaagatgcg tggtcggctc ctgatgaagc     18360
     aattatatca ccatatattt ttcaattata tagaaatacc ttgaactatt tgtgtatctg     18420
     tcatatatca tcctaaacat ccacatttaa gttgattttg tttttaaacc ttcatctacc     18480
     tactattgtt ccgacgacac aatggccgtt aaacacattc ttatgatcgc aggcgatttc     18540
     gttgaggatt acgaaatcat ggttccattt cagattctgc ttatggttgg gcataaggtt     18600
     gatgttgttt cacctgagaa aaaagctggc gagaaaatcg ccactgccat tcatgatttc     18660
     gaaggccacc agacttatac cgaaaaacct ggtcacaatt ttatgctcaa tgccacctac     18720
     tctaatgttc aagctgatga ttacgacgcg ctggtcattc caggcggaag ggcgccggaa     18780
     catctgggaa ccaatgaaag cgtcctcaat ctggttcgtg cctttgcaaa tgcgaacaaa     18840
     ccaatcgctg ctatttgtca tggcccacag cttctagcag cggccaatgt catttccgga     18900
     cgaaaggttt ctgcctaccc agcctgtcgt gccgaaatta tagtggctgg cgcgcagtat     18960
     caggctattg caattgatgg tgctgtaaca gatggcaagc tcgtgacggc cccggcttgg     19020
     ccagcccacc cggcttggat gagtcagttc cttaaggttc taggttccaa aatcgaagca     19080
     tgatattcta gtttgttagg ggacgcctat tacgagtgaa gtctccgttc atgctggtct     19140
     agttttatgt gaatgccgaa agttgtcact gcccatttac tgagcagtca ccaccctcca     19200
     actgtgaaat atccttagga acaccctggt ggaaattgtc gctgcagaca gttttactgt     19260
     cagacagtag gtcacaaaac tttttcacga agtccttgag cttcgaagag gagttgcaac     19320
     ctgatacttt tctgacgaat cagatatgcg cagtatccta acaacgagtg aaatatgtcc     19380
     gccagaacat tttcactttc gttacatcct atttgttttc gccgcgcaga gtagaacact     19440
     gtatacaata tgaaatactg gatttcttgt gataacaggc cgatacttgg tacccggtcg     19500
     tgtcaaggcc tttgaggcag gagttgctcg acctactgct gacgctactg tcactgctcc     19560
     agtttggtgg ccttcctggc atcttcagcc gcctgtgtct cctactactg gtctgtttgc     19620
     caactcgcgc ttcattggct accctgcggg ccggttacag caccctttta cactcctgcg     19680
     tcgttttgca atttatcccg ctcgctgcta cccaaaggtg cgcgactaag gtcctgctct     19740
     ttctcttgca cttggaagat caggtgatcc gcccgccgtt tgactgggtt cagtttaact     19800
     gctccattta tcttccgcgc ctaaatttta cacacatgct tgctttcatc gaaggcagcg     19860
     ttagctgcgt ccagaggccg cgtctcggcc tttttgtcga ccatagtcgc catccaggtt     19920
     gtggtcaggt tcttcgccca ttcttctact gctccgcaag ggtttctttc actccaagac     19980
     aaatccaaat ccaagaaaga atgtcagaaa aacgaggtaa cataagtaga aaaagggatt     20040
     tctgattggc aattgaaacc ataaggcgca ggtacaaaag cggcatcaac cgagggggca     20100
     aagcagcaac ataagcaggc taagggctgg tgttaggttt tgctcccaga cagaatgccg     20160
     tgaaacggta aagaagattc cgccaggagg tcactctttg agatttgcta accgatgcgg     20220
     cctgtaaaaa atgaacatct gggtcggttc attgacaaac tggaaaaaaa acatgtcccc     20280
     cgcgagcatg actacaaggt tttcgagggg tggcagatcc ccgagtctac acgtgcttaa     20340
     ctagtgacat ttctatgaac taagatcgta atttaaagtt tggtactggt tgtttaaaat     20400
     tattaccaac agttatagca gtgctcgaaa attgctactc gtggctgtcc gtcttcattt     20460
     ctgcaggaga ctttgatgtt tccattatat ctgaccccag aagcagtatc tgcatatagt     20520
     aggacagttt tgtaatgtta gagcttgacc aacagtcttg tgcctactgc ttgttaaaca     20580
     atctttcaga tccccctgtg gggccgcttc gtggtcctcg gtttagtatt taggtaatga     20640
     aatatatgtt cgtcgccttc ttagtcagat aacaattaag catggcatga aaataggagg     20700
     agatctaatc gcagagcatg cggtacgcgt agctatccga tgatactttc ttgtgctgcc     20760
     tacatgttga gagtccgcac tttgtctttt ttttcatcca caacgaaatt gtcaaaatcg     20820
     tagtaaataa tttgtttaaa actacttgat tacggtatca aagagtataa ttatctcata     20880
     tcaagataag aacataatgc agctgtatgt ttaattaaag taaaattgga aactaaatct     20940
     cgctagaatg agaagagtaa atagttagca tggcaacttt caagccgctg cttgtttagc     21000
     ctgcttaagg aatggttgca tgcctcccaa aaggtaaact gagtgcccgc tgcttttcgt     21060
     taattcttca aaagtgcttt tacagtgctc cccatcgaag tatgtaagct gagagctgcc     21120
     aagaagcctc tggtctaggc acttattcat gtacttcgca accaaactcc acttttcaat     21180
     gctgctatga ggctttacag tagctacagt ggccaacaag gttgccacat gaagcggcgt     21240
     ttttggaaaa cggccaaaaa tagcaaattg gttgtaaaga ctgaaatgaa gcctatgcta     21300
     ccgcaatagg ctaccaattt tgaaacagca acgccaaaga cttgaagaag aaagagtatg     21360
     acgaaacctg ccccgataag gattgaagaa actaccgtaa atgctgaaca tctttcaact     21420
     ttcccaaaaa tcctcatgaa attaaaaaac attcaaagac ttgtacaccg ataattgtct     21480
     cggggcaata tatctttaat tccttcggtg atgtttgata ttcttgtttc taaaaactcc     21540
     ctccaccaag cgccaaactg agtgttatag atccgcatag cactttcgat tagctctttg     21600
     tcatgcaggt cgtactggcc aggatcctca actatatttt gaaaaataaa atggcactgc     21660
     tctccctcaa aaacacaacg cggactcggc cactttcctg aagagtacaa aagttcattc     21720
     attctctctg cgatgatatc ccattgattc gaattcgaat tcacgccagg ggcttctgtt     21780
     acaacaattt cgcacagttt ttcgccggac ttttcaatag tacggaaaac attgtattcg     21840
     acaacaaaca acgttgttat gatacaggag aaagccaaat aagcttttcc tccttttcga     21900
     gaatgccata aaatgtcaac ggtggcaata gtgaaaagga ggtagaatag gggtattccc     21960
     ttcaattcaa tcaaggatca cagaagatag ttcccgtata cgtatttggg gagttttgat     22020
     ccttccagtt tctcgtaatt aaaaaaaggg tctttgccgc tcatcaaagc cttatccaag     22080
     cgtttctttc ggctggaaaa tgttcaataa tcagaagcta gataagcatt ttgtaggata     22140
     atacgttgct cgtgataata tagcataaag tttttaccat tttactaaca gtaataggtt     22200
     caaattcaaa gtaggtgctt tgaaaccaac ctcgctatta agccgatcaa ctctactgga     22260
     aaacctcgaa atttattgga tttgaaacaa agacctttgt atatcgttaa ggatgtgtag     22320
     tactgtcaga ttgtgatcgg ttcgttggtg tgtgatagtg ccaagttgca taatgacaca     22380
     ttggtatgaa atgatatgac acatggacat atcataaata cgacggatgc ccaaataagt     22440
     cacatagaag gtccacattg accgttcata gtccagatca gaccacagtg gcttggagaa     22500
     agatggggga gatatttagt atcatcatcc acgaagtagt ttacttagat tattatggaa     22560
     aacctagcca aggaatttga gaccctttcg accaatgacc cagactcgcc tcgtaaagtt     22620
     tcctgttgat ctaacttaaa tttcgcgtca agttaggagg cattgaaccc tcgcatcaag     22680
     agaccgccag tgccagggaa gcagctgctc tgcggcctaa gaccaaaatt ttgtaacttc     22740
     acgatgtctt caaactctca ttagtgtatt ctctgaccaa gcgcctatta tttatagttc     22800
     aaactagaat ttgcagtctt taccttgctg cgagaacgta tttacaaaat ggccaataac     22860
     ctaaccaatc acatatggcc agaagccaca tcaagataga agaaacttgc ctttatgggc     22920
     tagcgggaat ctcaataact tttcatatgc agagttcaac tcgtcaaaag caagatgcta     22980
     ttccgatatt atcgagcctc attcgcctat aatagttctc tttccacaat aagggcctgc     23040
     cctcttttgg ctacgccagt ggaacagggt tttttcctta tctcgtccgc tctgtatctt     23100
     tcccgcctag atttagcgat cttaaacccg gctactgttg cccggcctaa taactctgaa     23160
     aagaaaaata tatatataaa gaaatgactt agaataaatc gcaggaagat caagagccaa     23220
     gcttattttg tgcacgaggg agcggtgtta tcataaataa acatgcatca acgctgatct     23280
     cataacttta gagccgtagc gatgatggct atcagtactg ttcttgtctc agcttgcaga     23340
     agattctgga gcgaaccctt tacataagtg acccacgaaa tctaatattt tcaggctctc     23400
     aatgtctaag agcttgaaat atatgagatg accaacgaaa aggaagagct cccaagcgga     23460
     gagcttaaaa agacagaagc tgtccaggtc tgtgagacgt atgaagcaga ttctgtagaa     23520
     ccgcaaaacg cgaatgagcc tgaagaaggt gttctataca atgacagaac aagattgaag     23580
     caagggctga aagagcgtca cattaaaatg ttaacacttg taggtgtttt tgggaccggt     23640
     ttatttctct cttcaggggg aactctaaag aaggccgggc ctgctggtat gtttctggct     23700
     tacgttgtag tcgggatagt ggtgggttgc aaccagatcg cgattgctga ggtggcttca     23760
     tttatgccag caacaggggc aacaatcaga cacgccgaac agttcattga cgagtcagtt     23820
     ggctttacat tcggttggat ctcaacttat tcttcgttga tgcctggcga gctttctgct     23880
     accgctgtgg ttatgcgcta ttggactgat ataaatccag ctgtctggat taccattttt     23940
     ggtattttat ttgttctcac caacatttat accataaggt tctacggtga agttgagtac     24000
     ttttttggtt ggatgaaaat tattctgatt attattttga ttgtcacagg gttagttata     24060
     gaccttggtg gggctaagca agaaaggctt gggtttcact actggagaga accaggaccc     24120
     tttgctgaat acatagtaaa gggggaaatc ggcaaatttg ttggtttttg ggcggcgctt     24180
     tcctctgtcg tatattcata ctcaggcatt cagaacattg ctattctggc tggtgaaacg     24240
     aagaacagca gacatgcaat ttttcatgga gccagaaatg tttttctgcg tattattgtt     24300
     ctatatctga ttgctgttct ggttctcacc ctaattgttc cttataacga taagttgatt     24360
     gcgactggta ctggcactgc caagtcaagt ccttatgtta tcgctattca gcgagcaaac     24420
     ataaagatct tacctcatat tatcaatgct atcattctaa cctcggcttg gtccgctggc     24480
     aatttagcca ttgtggaggg ctctagaaac cttttcgctt tggcatccaa gaatcaagca     24540
     ccaaaaatct tcttgaccac caacaagaga ggaattccgt atgttggaat tgccttcatt     24600
     tctgcgtttc ttcctttatc gtatatgtct gtttcgagct cttccgcaaa tgtgttcagt     24660
     tggtttcaag agctcgtgtc ttcaaacact cttttacgct ggattttgat atcggctaat     24720
     cacatccaca tggatagagc cttaaaggca cagggctaca gtagatctga tctgcctcac     24780
     tctacatgcc ttgggccatt tgctgcgtgg ttttctggta tcatgtcttt aattttctta     24840
     ttaacgggcg gtttttacaa ctttatccat ggccattttg atattgaatc atttttcaca     24900
     aggtatttca ttattccact cgctatcatt cttttcacat tctggaagct tttcaagaag     24960
     accaagtacc ttcgtccagc tgaagttgat ctagaatcta tatttgagga cattcgccaa     25020
     aatcctgaaa taactttagc aactacaact tgatggaaga aaataattta agtaatatct     25080
     caccaatttc taatttttaa taccattcaa gctctgtata cagaaacaac acacctgacc     25140
     tttgatattg gtttatgacc attagcagta gtaaatatct ttagttaaac tcgacggttc     25200
     attattggag caatactgaa ggtttgaaga aaaaatcgca tctcttcaat aactcgacaa     25260
     tgatgaaggc attgctaata tctggtgatt caacagcgtg aagttttgcc gctttacgac     25320
     gcgctatagc gctgtgctga tttttccgct gaaatgcttc tctaccacct ttattctcaa     25380
     ccttagggcg ttgcacaatt cactttacgt tctcgtccca gtgtttcctt tacgcgcagc     25440
     tgctttcgct ccattcctca gtcttgtgcc atcatcattt tttgtggaaa gcatggaggg     25500
     tagtgtgagt taaaaaaaat gggagatccg cccgtatgca gttgttgatt ctgacaaaaa     25560
     catttttaga tgaatagcgt tgcttcagtt tttgcaactc tccaaacttg ctaaacaaaa     25620
     gataattatt caatgcactt ctttttaact gctatcctaa tggaaatggg agcatcttaa     25680
     caatgaataa gtacacatta cccttctgct tcacatgtgt atcattaagg acctttaaaa     25740
     aaagaacaaa gtgacagtac agcttagcca tcctttatgc tcgtccaggc tctttcgatt     25800
     tgttacaaca tgtattacgt catcaagatt gttaggtttt gcatcttcct actctcttga     25860
     atcagccaag tcattatttt tgaaagaagc gtcttccgcg gttcaagcgc accaaaaaaa     25920
     ggtgcgggca tcgagtctgg ggatcaataa gcaagcttca agaatcccct tatattgttc     25980
     acaccaaata actgaaatgg ttgatataac taatgagcac aaatacccct ttttgttttg     26040
     gccaaacgtg ggacgcaaac atctcaatct gggaacatac tacaggtgca acttaaaggt     26100
     ttcgatagca catagctttt ttcttagttc ttgaccaagt agctatttgt tggtgctaca     26160
     aatatgctgc gtgcccaacg actacttacg ataactttct cgatttccag gacaagtagc     26220
     tctctatgtt tgcaaatttc aaaattataa tttttaaact aagcgagtag gcataaactg     26280
     gtaatggcta tgaacgataa ttgaataaac tgatagatcc atctcacaca tatatttttt     26340
     agtgctcaag ctcctggcat gcgaaattat tatggattct tattcatgaa gggcttcaac     26400
     agtacggaag ttcttcctaa taatcccacc aattgcacgt atacaataac gagaatgttc     26460
     aaatattttg taaaggcgcc aatcatagcg ctttgcttaa taattgctac agcgatggtg     26520
     ctgttcttaa taatagtttt cgagcacaca tgtattgcat agttataggt caaatgtttg     26580
     ggacttaaat agcttatgtg ggcctccact tgttagtttg aattaagtcc gtttcaatcc     26640
     ttgagcacct gcagtgtttt aatgttttga attgccacag agacacaaaa ccgagttcaa     26700
     gagtgagctg ataagggaat acagctttaa tcatgacaag caaattagct taacccctaa     26760
     aaatacaatg tttaatattt tgatatgcag ataaactctg cttgataatt aaacagtgga     26820
     acaatagtcc ttacggggac tacctaaaaa ttacattcaa tattctgaga atagggtaat     26880
     ctacgtgtcc tgaattttcc cacatacggg tttaaaaaac aagttttgac tggggctccg     26940
     actatcagct cagatattac gatggaaaca cagagtgctt acaatagtgt ttcctttctt     27000
     caaagaaaag ctggaaaaag aatgacaaaa gggccaatta aacttccaaa aatttaaagt     27060
     tcaaaccagt aacttcatac attcgtaatt ttggcgcatg tctgcaagtc tgcgatatct     27120
     tctgttttga attggcagtt gtggagcatg atttgtggat ttaatcgtaa ccactaagcg     27180
     ttgatggata tttttccggt tttagaagga attgaacgtt tttggtaaaa caaaactgta     27240
     tgcgaaacta taaaaaaatt ttcaagcaca aacgtttctc taacataatc tgcggcaaat     27300
     agctgaggtt tcttcggggc cctcatttct ttcgaaggag ccatactata ataattaaat     27360
     tgagagccaa aaagttagcc ctgtaggggg ctcgaacccc taaccttatg attaagagtc     27420
     atacgcgcta ccgattgcgc caacaaggct agtgtgttgg tgttgttatg taacgaatac     27480
     atcacaatgt ttgtgacatg catatgactc gtagtcaact tataaagtga ggcactaacc     27540
     cagtctcacg taagttattg tcagattgtg atcggttagt tggtatgtga tagtgccaag     27600
     ttgcataatg acacattggt atgaaatgat acgacacatg gacatatcat aaatgcgacg     27660
     gatacccaac taagtaccat agaaggttca cattaaccgt tcatggtcca gatcagacca     27720
     tagtggcttg gggaaggtaa ggagtggtgc caccagtacg attatcacct tatgattaag     27780
     actcagccac gtcccagaaa tgttgtataa atccggatca tttctttggt ttgcaagacg     27840
     tatatcttga agaaaggaga gagcggggag atatttagta ccatcatcca cgaagtagtt     27900
     tacctagatc ataatggaaa caccagccaa ggaatttgag accctttcga ccaatgaccc     27960
     agactcgcct caataaagtc atagtttcag caccgctgta tggtctagta gtggcagagg     28020
     tgatttccaa aattggcgtt tgtccatatc cttaagtctt gatatagcag atttcttcca     28080
     cagtctgctt accaccctcc ccactgaagg ttgcgatttc ggtatcataa gtaattgttc     28140
     gaggttcacg aagttatttt tattgaggcg agtctgggca ggttgtatga gatattgcca     28200
     gattcgttga ctaggttttc catgataaga tcagttaagt attcgtagat gatggtacta     28260
     aatatcaccc cgtgatttct tcttccaagg tttaggtctt gtgaacttaa gaaatcatcc     28320
     agatttatac aaaattccta ggtgtagatt agacttgact attaggtgat aattgtgccg     28380
     atagcaccac tccttatggt atctatgtca ctatcgtctg atccgagctt ctgatggtaa     28440
     ctttgtatca tcatatgaga actggctgat tccttgtcgt gtctatagct tgtcgaacgt     28500
     caaatcatgt tttactaacg tgtcattatg caacttgaca ctgtcacaca cacacacaca     28560
     caccagcgat tcggttataa tctgacaaac ttgaatattc aaaaagcagc tgctaggcga     28620
     gtcaaaaaac ggcttaaaat atcacaggcc tgttccaaaa ctcttcaaat attcatgaac     28680
     gcttattcaa gggactaaat ttatttctat gaaaggattg tttattcagt tacgaatttt     28740
     ttgggtcaaa agagttgatc gaagccacat ttacaagtcg acagttttga agccgcgaaa     28800
     attatttcat ctttggaacg ttttttaccg ttgctagaat gaaaattcgt gaatacgcat     28860
     caaaggcact cgagagtaca ctaaccaaat ctgtaggcac ctctcgagat tagaaaaaaa     28920
     acagtgcttt aggccgctag caatttgccg cgaattctag gacttaatca aatggatata     28980
     acgggtggaa tgattgattt ccccatcatt ttcactggaa aggccctctt gcgatcttct     29040
     gggacagcat taattagcag tcgtccgagc agggtggaaa agttgtgagt ttatgagttt     29100
     cagtctaaat gcggtactct gaagtcagca gtgggagcgc aagaagtcac tctcatctcg     29160
     agttgaaaaa ctcgcgcttg actgggagtt tgactctatt gggtatagcg aaaaaaatgg     29220
     accgtcaaac tcgctttggt ttgacaaggt ggaaagagcc ccttcgctag ctataggagc     29280
     ctaaggattt cgattcgcgc tgattttatt ggttcctttg tttcttggct tttttgtttc     29340
     cctggtttcc atatctctat aaacgataat cgtagctgtg ataatgcaga aactgttccc     29400
     gccgcccacg acttgaactt gctcgatata ttgctaatgt attcgttgaa tgtgatgttg     29460
     atatgggttg ccggattggt catctcgaga tagtgaagct atcagtgagt aatcccgtca     29520
     aaggcatctc gagcacttgg tcttgtgact tgaagcacca attccgacag acgctagact     29580
     gttgtcctag agcaccgcca aagaagccct tgtgctctga gttcttcgtt taccccagat     29640
     gggcgatatc ttatttattt gtcagacagc agttccgtga gaatgactct taccccctaa     29700
     aggttcgtga ctgtgtgtga aggtgtattt atagtttcac ataagggaag cctgatatcc     29760
     gatattgaac attgttctaa tcaacaactg agggaaactg atcatagtaa tgtatatccc     29820
     aaagctgaca agcgtcgatg acttcgataa gcaggctaga accatcaaag atcatccctt     29880
     gggtattctt ttcagttact cggctcctaa aatagcactt acagactttc ttttgggtga     29940
     taaaattgac aagccggttg acagcgagat gtgcgccacg catgtgccat ttttcctaca     30000
     aaagtcacaa gatggcagct gtcgactcgt tgcccatttg gctggtaaaa atcagcaaat     30060
     taagttgctt aaagagaacc ccagttgtat ggttgtgttc caaggcccga actcctatgt     30120
     cactcccgct tggtacccag aaaaagagga aacgcataaa tttgtgccaa cttgggatta     30180
     ttcatgtgtt cacgtttatg gaaaagccaa gattatagaa gaaaaagagt ggttgctgaa     30240
     aatgctggac agcttaacgg atcaagaaga aaataaaagg cccgacagag atgaatttga     30300
     gagtaagtgg aaggtggagc agacaaatca gaagtacttg gactctttga tcaaaggaat     30360
     tgtcggctta gaaattgagg tatctcacat tcaatcaaaa ctcaaagttc atcagaatca     30420
     gaaccctaaa aatgtcaacg gcgttctaag gggatatgaa atggagatgg gtgacgatac     30480
     agcaaaacaa atgtgcaaac ttgtaagaga aaattatccc agagagttat aggtcgaata     30540
     ccaacaaaag agcactggac cagctttcct ttatttattg aatctgtatc atatctaaaa     30600
     gcgtttggct ttgcaagttt ccctcatgca attaaccaaa aatcgtttag gattgattaa     30660
     aacattttgc tccgcaggta gcttcttgaa agaagctatg ctggttttgg tatcacattg     30720
     atccgtagct ttgttagatc aagaccatag tatggcaaat tctcttttgg ttcagttacc     30780
     ttcccaagtt agcttttgtt ttatatattt gctcagaaac atttaacgtc tccctaagct     30840
     ctatctgttg aaccaaatat ttgacttcta attgtgattt ccaactgtta ctcttaatga     30900
     ttagctgcag acgaggaaga aaatatgaga gatttataaa acgcgagtac tgaacagttt     30960
     actgagttta aaagctatgg aactttgaaa taatatattg tagaaaataa agtataaccc     31020
     cacgaagcaa gatattcaag aagttttcta gcattttatt cttttctttt cattgacgtc     31080
     gtaagcttgt acatcagagg aacgaccatg gtgcaattga aggttttact cttttttgtt     31140
     gaatttgaat ttatgcacga agtattatag gtcaagagta agcccactgt tgacactttt     31200
     tgtgatctgg aagaacctaa tacttaataa tgacctggac ataagaaaag ctacggttct     31260
     cggtaatcat aatcgcacaa ctttcaaaaa aatgggacat aaaaacctta cagcttccta     31320
     attgggctat caaatacctt tatcgttgtc tttcaacgat tgtctctatt tcaactcctt     31380
     ccacagcaca aatatctttc acaaggcgtg aaacagcaaa tcccagcgct gtaaagaagt     31440
     tagggcacac gcctgccttg caacacaaag atcaaaatac ttatattaac gttcagtgaa     31500
     gccgcattta gggcgctatt ttcgagagtt cttgtcgatc gaagagaata tcaaggcgct     31560
     tttctattgg acgcgaccac gccttctcca agaactttct cattttgatt gtgctctggt     31620
     ggtgaaagcg ttcccccaca ttcaaaaggt atctcagagt acagcttctt tcgtgaatag     31680
     ttgtcgaaaa gcaccccgta accaccaaag accatagcag tatcccccaa atgttgtttt     31740
     caagtggaat cgaggaaaat gcttcaaaaa tctcaaaacg cactttttga attgttgcgt     31800
     gctgaatttg aaactcctca aatttcagaa cttttgaaac aagtaagtaa ctcgacttcg     31860
     ctacaattgt accaaccact gcactcagtt ttgccttttc aaatagctgc ttgtcgttgg     31920
     atttaacctg taacgacaat acaggccctg tgtaaaaaaa ggccagagtt tcaagaagtc     31980
     gtgcacgctg aaaccagacg gatgactttt caagaggcat cggaagccgc ccgatatatg     32040
     aaacttttgc tagaatctcg aatgcatcta atgcaggccc caaaacggga ttgttcatcc     32100
     attcaaaatg gcagcagtaa agtgggcgct ttaggacgtg gctaatttct ttaaatatgc     32160
     aaaacgggct tggaagtcgt gatatattgg tcgcaaatag gattgtcacc gaataattgt     32220
     aaataaagct ttcaatgtac atgcgctcat atggttgagt agataggttc tcttcctgtt     32280
     ctttctgttc tggctggcgc ataaacttat tttctatttc gtaagcaagg ttttgtagcc     32340
     caacgctcgt gtgaatatgc tggttattcc tcattaagat ggtgttcttt atcactaaat     32400
     atgatttaga gagacattga acacaatcat caactgaccc cgacgacgcc attttgctac     32460
     gcaggcaaag tagctgaaat gaagccaaca gccatggacc agcgtccgtc aatgactcat     32520
     catgcaaata cttttcgatt aacaattgtg aactcttgta aagactattc gacagcggaa     32580
     caaatttaac atcgttatac cattcaaggt atgttgctcc acagcacata aacacttccc     32640
     tcagggggat actattttca gcttgtggga cgaatgtcgc gcaagcagtc agaagcgggt     32700
     gagtatattg agttccgaga ttcggaataa acttctcaac acaagcgtaa aggagcaatg     32760
     cctcatcatt ctctatgtta atattaacac taggttcgcc tcggtcataa ttttctagaa     32820
     tcttgctgta tttccctgcg tcaccgcatt cattagcttc caagttacca tctctggaag     32880
     aggcgaaagg cttctcaggg gttctgtttt ttttcatttt ggattgaatt cctcttttta     32940
     cttgaaagct catgcttgtg ttttgagagc gcggtactaa agccccgggg agattcttca     33000
     aattggctaa cctcgaaata aaaaaagggt gttagctgca agtcgaaata gtccttatag     33060
     gtcctactgt tttctaattg taactcaact cgatttgcat caccgctcga gtactcgcga     33120
     tcatttaaaa ctccattatt acgcggatca gggacttcag tattttcttt gctcttcact     33180
     tcactattac aagctagttc aatttcagtt attgctgttt tttttgagtt cacgagagcg     33240
     ctgttttcac cactcaaatt gtgtttagag tagtgctttc tgctaacttc agcttcatgt     33300
     ggtatgctat ctgttagctg caagagactt gaaaatgtca caagcgctct gggagcaggc     33360
     gtctttgccg ctgtcttcag ctcattcagc tgcggttttt tcaggtcttt ctgtggaaca     33420
     tggacgaagg agaactttga atttggatcc ttttctttgt ttcccaggat gggagagtat     33480
     tcattgataa aaaaagaagg ccagctgcaa tcgagcatgt tcctagtaca cccaccacag     33540
     cgaggcctga cctcatcgca tttttttctt ctgtggcggc atgtaaagca tccacttttt     33600
     gaccttttct cagtatgctt cacaagtcca tcatcttttg ggtgtttccg aacagatctg     33660
     tatcttattt tcgccatggg atagctcaga atccttcgag atcccagatc ttcatatttt     33720
     gagtggtttc actattttta ttaggggttc tggggatact tgggacgttc atagagataa     33780
     aaagttaacc cgttgatctt agataacgta gatgcatctt atctcgctat aattttttga     33840
     gttgctttga taaaggaatg ggatgcgaaa aaagcgatgt agttaaaagt gaccaatcct     33900
     attaatctca actcttcgca tgagcgaaag ctttaaaaaa aaataaggtt ctaagcaaac     33960
     tcaagttgaa tcttagaaca cattctggca agagtactcg tagaaggttt ccttaggttt     34020
     gtttttattc gttaaatatt taattaaatc tgatctgtgc ttggatgatc tcatgcagac     34080
     tgttttctag acatcttgcc tcaaacttcc ggtttttttt tgctttacgg tcaaggaatt     34140
     caattgaatt ttattctttc gtcaattttt cggattgttc atatgcctgg gaatagtgcc     34200
     gaacattctc caagacattt gagttgtatg atgttgatat gatttcaagc gcttctgcat     34260
     agacagaatc tacttttatt cgagaacgtt aattgaggct tgttgttagt aaagtgacta     34320
     gatttctgta gcgaatggcc ctgttcgtga cctaacacat ggcaaataat cttaaacaca     34380
     gtgccttgtt ttttgcaagt tttgaaaaaa gcttttaagt tcaaaagtta gaagaggctg     34440
     tttgtgtttg gagctgaaac atcttattca gtggccttct attatgtaca tttaagaatc     34500
     aactcccaaa gaatttacca attatgcagc tcattcgtct ccaacacagg agacttgcgg     34560
     aacactatcc ttttttatag tcgaagctca aggagtttca aattttcaaa taggaaagac     34620
     caacgttctt ggtgcaaccc agatttttta tcactagtaa agcccccatc cttcagaaac     34680
     caatttactc tccggtattc acaacacatc tcccaacaat ttctccgtta tccatctttt     34740
     tgaaaatttg aggtacttga gatagcccgg cgaccttgat tgcgggccgt attaaacctc     34800
     gagagtagaa atcgagcgct tcccttgtgt ctgctctatt cccgacactt gatccaacta     34860
     tcttgatgga cttcacaacg tgatcgaaaa cttctgagac gcatgttgca ccacttggta     34920
     tacctacaag cacaatgacc ccatttgctc tacaaaagcg aactgaggtg ttgatagcgt     34980
     tctctgatgc agacaagttg agaactccat gtgccccccc ccccccacct gtggcactta     35040
     caacttctgg aacaaggttt tcacttttgc tgaagtctag aaaaacatca ccaccaaggt     35100
     cgttaaacaa gtgctctttt tcagctccgc tatcaatccc aacaacagaa taccccattg     35160
     cttttgcata ttgaatagcc atagaaccta agccaccgca agcccctgaa atggcaaccc     35220
     agtttccggc cgttaggtta gcagttttca gggccttgaa aacagttatc cccgcgcaca     35280
     atactggcga gacttctgcc aagttggtac caggtggtat cctggcggcc tgtacagcgt     35340
     ccgcagttgc atattgttgg aaagatccat cgcgtgtaaa ccctgaaatg tcagcgtatg     35400
     cgcaattagg ttcgttagac agctcacact gttcgcaaga catacagcag ctattaagcc     35460
     atttgatacc agcatagtcg cctattttcc atcctcgtac gctggctccc attgcaacta     35520
     cgatgccagc tccctcgtgg ccacccacta gtggtaattt tgtttttgtt ggccaatcac     35580
     ccttccaagc atgcaagtca gagtggcaca cacccgaaaa cttgacgtta atcagcagtt     35640
     cattggcttt cggcgactga acttcgatgc tcttgagctc gagctttcct gaatgcttct     35700
     tgaatatgac ggctctctgt gtgagaggaa tactagaggg cagcttctca gtcataattg     35760
     gcctctttaa aggtaatcta actgccttag caaacttccc aggtgtaaaa gaaacagatc     35820
     atgatctaat gacatagctc caatgtagct ttatagtttt tggtgtctcg ctactcaccg     35880
     ttctcccctc gtttcccgta aagtgctaat acagtgttat atccttatct caaattacaa     35940
     catgcttgat tgtcctgagg ttttgatgtg tcgtgcacaa ttcatgaaga cgttaaacgc     36000
     tctcttgttt ggcgtttgtc ttacgcaaag acggaattaa tcgctttgcc cgaagcagcc     36060
     attatgtgat tgtgaaaaac gccaagaaaa attgatactg aaagagcaaa ttttaagctt     36120
     gtcggctaaa ctagatccct aaatacctta tctcagaagg tcgtgaaatt acaaagggaa     36180
     agcagaattc tgtagcatca ggaattctct tattgctatg tagcttcaag agccagcaat     36240
     agtagtgttt ctggcaaaac aagatgcaaa acattaagtg caataacaac aaactgtata     36300
     gttaggtttc tttcaccttg aagacatatt tcaatagttc tagaacaaat taaagttacc     36360
     gccttcttgg gcttctcttg ggctttgcag cgaaaccgaa cgtgaagtag catgaagcaa     36420
     aattcttccc cgtattgtca tttgaattcc tcgtagtgtc tatcgagaag atgaagatgc     36480
     acaacacata ttattgaaga gtcaacttgg ctcttttgat aggactatct acagtaattg     36540
     atattgtaac cctcggagga aacgcgcgta ccactctccc agttgcgaac attagccaac     36600
     ctcaacacag ctcgacccgc atacgcttag ctcagtttga gactaaatga atggttatac     36660
     aaattactta cagtatttgt gatatctccc gcacgtgata aaaagtctca agttcaaatt     36720
     agatagataa agttaagcgc gttaaaagta acattttagg tagcaaactg atagccccta     36780
     acatatacag cgcgattaag tgtacgaact cgaacggcgg gcggtttctg cttgagcaac     36840
     taggcacagt tagcgcttgt aataccccca gtacagccat aagtaactat cgtgcaagca     36900
     ggtctttatt acttttgagg acagcttcta aacgcttgac ttcttaatca agatccatga     36960
     ccggaacata atcggtcaag ataggagact agacatttag gtgatcatgc atctgcgatt     37020
     attttgtata ataatgggag cataagcagt gagtgccgtt catactccag acgtactctt     37080
     caagcgcagt gctttcaata tgacaacagt tatagattac aatgtcattc caggggactc     37140
     acaccttgta gactttgacg aaacaagaaa aagtggtgaa cgtgagggta aaatcgtttt     37200
     aaaccctacg ccttcggacg acccagatga tccgcttaac tggactcctc gtcgcaagtg     37260
     gaccgctgtt gcgtgcgtgt tgatatacac tctcggagcc tgtattccaa ccgcagcgat     37320
     atactcagtg ctccccaaca tcgaagcaaa cactaatatc actttgagtg aactgaacaa     37380
     cggtactggc tatatgtttc tgttcctggg tcttggttgt ctcatttttc agccactggc     37440
     gttacaattt ggcaagaggc cgatttacct cttctctatg cttgctacgg ctttgatatg     37500
     tgtttggccc ccctatacaa aatccaacgg cgaatgggtt gcgtctaaaa tcctacaggg     37560
     ctttgttgga tcatctatgg aatctcttcc ggaaatttcg atgagtgact tgtttttcga     37620
     gcatgaaaga tcttttgctc tatctctata cggcttaacc cttctctctg cctctttctt     37680
     agctcctttt gtggcagggt ttatatctga aggccaggga tgggagtggg ttatgtggtg     37740
     gtgtgctatt ttcggggcag tttgcttcgt cttactgttt ttcttaatgg aggagaccaa     37800
     ctatgacaga aagcttaagg ttgatgctgc aacaggagag gtaatcactt tggcgtctcg     37860
     aaagcagcaa ttaggtgcgg ttttcactaa tattgatgaa gttattgcca gtaattctga     37920
     aggtaataat gctggtgaaa agaatgaaac caagacaaac gatattggtg cctcactgca     37980
     aactgaagaa tatcctgaga acataaatat cgtaaatcag gtcagtaatg ttgaggtggt     38040
     tgattcaaac tcttatgccc caaactatga gggaacgaag acctacttac aaaagctttc     38100
     gctattcggt gggagaagaa agaagttcct tctgcagcat tacatcttcg cacctttcct     38160
     tatggctcgc ttccccgtgg ttttgtgggc tggattcctt tatggtagct cgctggtttg     38220
     gttcaacgtt ttgaatgcaa ctgcggctct cattctcggt ggttctccct atgatttttc     38280
     ttctagtaca attggagtag cctacctctc accaacaatt tttagtgtca ttctattctt     38340
     catctcgggt ctttgttctg attggctcaa ggtccgcgta gcactttgga gaggtactgg     38400
     attgagcaag ccagaagata gactttggat attagtcata tactgtgttt tggggtgtgc     38460
     tgcttccatc ctttgggggg ttggagcata ttatgaaatc cattggtttg gcctcgtttt     38520
     cgggatgggc ctcttaggag gttgcggcat ctttggaata gcgtcctcgg ctacttatgt     38580
     ggtggatacg tacaaggagc tggacacaga agcaatggtt gtggtaatca tcatccgcaa     38640
     ttgcatgtct ttcggcgtga gttatggtat aacggattgg gtcaccgacc ttggctacaa     38700
     aaaatgtttt attagtgttg ctttcctgtg ctttgctgcc aactttacct tccttgctat     38760
     ggtttatttt ggtccacgac tacggaatcg gcagaagcat atgtattggt cgatggttga     38820
     caaatatcgg aagctgggta tgcattaatt tgagcgcagg ccgcttttca taccgccgcg     38880
     ataagcgcac ttcaaacact acttttcggc aaaagacgta ttttataaat atcttctcta     38940
     tgacactagt ggctgcacga aagttcgttg tgagcagggt ttaattgcaa acttagacca     39000
     tggatacatt tcgcggagta agacaaggtc tatcgctctt gcgacttatt tcaggctatt     39060
     cgtttctcag aacatcatct caattatatg caccatactc aatccccgcg tacgcccact     39120
     tgttttgaag caagaaaact agatacaatt ttctgtaaag cttgtttgaa ttactcgctc     39180
     atttttgaag ctaattcctt ttgaggcttc ctatcttctt tatatcaaac ttgataggat     39240
     tcatgaagat atgtccggga ttatttgacc ttacgaatga attagccaat ttcgacttac     39300
     tctgtttatg caataattca gattcgcctt ccttgtgtta aattaaggcc tgtcttgatc     39360
     ttaggctaat tcaaatgggg tggccgtttt tgcttagttc taattgcaag atattttatc     39420
     taatgtcaac atgcggggtg tgcgccggtt ctgagtggtg acctttgatg ggcgcggtct     39480
     tacatcattg ttggaggtcc gtagacgggg cgatttttag ctgttctgag cgcgagacag     39540
     tttcgaacca tgatttggtt gcctgtttca gatagctttg caacaacgta cccagtatgt     39600
     agttttataa agttttttcc tcccagtcag ttttttatgc acttgccatt tgaattacta     39660
     cagtatgtta acttccggcg gttaacaacc cgatctgcac cagaaaaagg gctttgcaac     39720
     ttgggggctt ttgtttcatc catattacgc aagcgctttc tgcagcttac gcgaaactat     39780
     gttattaatg gagagttcgt actccaggat gcaaatgtat cttccaacaa cattgaagac     39840
     agatattgta tttatgtcgt attttgagac aaagccttcg gtgcctgcca acgtccttcg     39900
     aggcctcgaa taactagtta acaagtaaaa aaatcactgg gaatattaca ccgcagcatg     39960
     ctgcaagggt ccgtggtact ggttttattt tctttgagcg ccattggcta gaaaatactt     40020
     agggagtata gatggaactc gccgaacttg ttgttatcac cagacgaccg ataacgacaa     40080
     tgttcgagaa tgaaattctg aaaaaaaggt atttgaacga gcctttaaga aaaggactct     40140
     tccgtcctga tatgttttcc aagacgatca ctgcgttatc ctaataaaaa tgaagtgctt     40200
     acaaactgtg ctggcatcag ctatttgttt aattagtaaa gctgccgctg aggttttcat     40260
     tgtcgacaac gacactccta ccgctttgca agttttgctt cctttggcgg ctggcaagca     40320
     ggtgttgggt attacaacaa acctcggtga ttacgatact gatgctgcaa cttatgaagc     40380
     agcaatggcg ttgtcgacag gtaacttgac atcctgtgtc cctgtgtaca aaggcgcaga     40440
     gcagcccttg ctattagatt acaataccta ccacttgtgg caagacctgt atggcgacat     40500
     cgtctggcag ggcgcttggg acaaagacta cgaaagtcct gtccccgtta acgcttccta     40560
     cgagtacaac aagactgttg gcgcccctca gtggattatg gatacagtca aaaactccaa     40620
     ggataatgtg actattgttg cagctggcac aatgacaaac ttagctctgg ctcttgccca     40680
     atggccagct atggcagaga aagtcaaatt ggttataatg ggcgggtatg tcgatggaca     40740
     gattgctcaa accactggtg gagactttgt caatgacatg tacactgatt tcaacttgat     40800
     ggtcgaccct gaggcagctc aaaccgcgct ctctgctcca tggaaggaac tggtgattgt     40860
     tggtaacata agttccgaaa ttttccccac tcaggatctt tacaatgaac taattgcagt     40920
     gtctggcggc ttagctgaga taaagagcaa caaatctcta ggttacgtga gcgaaactgt     40980
     cgggaacggc actttgccct cgttcaatct gccatactgg gatgaggtcg cctctgccat     41040
     agctgctgat cctgaaatag tcactgcttc ttacgacgcg tacgtctctg tcgacacttc     41100
     attttcttct cctttctacg gcagtttaag gatttatcca gcaaacttac gtgctaagaa     41160
     aggagttaga actggcaaag caaaaatgat tacctcgatc gatgagggca aacttaatgc     41220
     tatgattgtc gatgcgctcg tcagagactg gaccaattac tgtaagactg gcagtgctcc     41280
     aagtgtggca attatgtgac tgattcgatt cgtgataaat cttggaactt atagaagaat     41340
     tgtttagagg caggtcatat tcgccaaaaa tccacgtact gtgtaaagga agtacttgat     41400
     caagctttcc agtcatatcc gggtctttct tgcttgcctg tgcccctgga tgatccttag     41460
     tttcaacata ccgcagcgcg tcaaaagtga gattgatcga cgatctctag ggatggtatg     41520
     aagctgttag aagactagga acaaacagaa gcgtcgctga gctgaaactc ggaaaggatc     41580
     cgccatgtaa aatgaccatg atagggcaac ttccccacga catgttatag attttctccc     41640
     tcgaaaaacg tggtttcatg cctactaaac aacctttgca aaaaaatgaa ctacaaatat     41700
     aattagctct cccctatagc gcgtatgtac ttgtgtactc tcttggccac cagtattgtg     41760
     tgaataattg ctagccttat cccaagttac tgaacttctc tattcgagat gaaaataccc     41820
     gaaagaagcc tgcctgtttt gtttatcgca tctcctctcc aggtttgacc gaaaattcaa     41880
     tatagagact tcatagtgcc caagaggact aatcaattcg aatctcttcg tcagcgcgtt     41940
     accgaaacct ggatcgagtg cacaaacgat atcaaaaagg aggtgaatga aaacgctcaa     42000
     actctgaggc aaaaaaatga cacagcatct atcctctgaa gcgcagtctg agtgtgcgag     42060
     tgctagtcct cgccaagctc actactacgg caacgcgcga tacttgtctc ctcaactttt     42120
     aagtggccat cattgctgtt cgctgcccgc cattcaaagt cacccttata tgaagggatg     42180
     ataagacttg aagctgaatt aacatgaaca cgttctgtga cccaaagcgt ctgtaacaat     42240
     gagacttgat atgcttagct tctggtcgat ggtttttttt cgggatcgga actgacctga     42300
     aaatctccac acttctagta atcaagtggg aaatcaaata ttcttatcta caaaagatag     42360
     gtatttgtcc cataataaat atatatctca tgaaatatga cgctaaacca ggaaatgccg     42420
     gcacttggac atcaaaatca ggatgcctca cagatcaaaa actgcctgtg ctttatgcaa     42480
     agccgagaag aaatgttgcg ataagaaacg tccgaagtgt agtcactgca cagatgagaa     42540
     cgttgcttgc tcctaccctt taactttgag atggggaggg agaccttaca aagacaaaac     42600
     caagcagatc aaaataccta agaatactgt acttgtggat ggagtgctaa tggtcagaga     42660
     taaaagtcat ctctccccaa acagatatga gagaaggagt cgccttgttc tgattaatga     42720
     aggacctgtt ttcaccaaag atattacgaa aggcaaggtt cgtaaggctg tggaaggtgc     42780
     ttcagaggaa tcgagtgttc agatttcgaa tccttgctat tttacgcccc aaggctccat     42840
     gccctcattg aaactgctaa actgctcctt ggaacactca acattctttg aattctacgt     42900
     ttacaaaacc tcctatcatt tcgtggctct gaacaagggc tgcaagtcaa acccttttca     42960
     cacaatagtc ccacagatgg ccatgttcaa cccatctttg atgaaacttg tcatggcttt     43020
     cggaggagaa catagggagc gatttcgccg cctggaaaat ccgcagttgt gttattcgtt     43080
     agatgaagat ttcgtgggca agaaaccact tactatgaca ggacaggagc ttctcaagca     43140
     aggcgttatg gagctggttg atcaattggc atctcctaag acagttatcg atgacacagt     43200
     ccttgcaagt gtgcttgttc ttgcgagctt ctgtatttac tttggcacta ttgagaataa     43260
     gtggcatgcc cacttgtatg gggctgaggg aatcattttg agagaactga aagagaaatc     43320
     aaaaatcgaa aagggtctac tccgttatac ttgcgaacag gggccttact tctttttgag     43380
     aagatggttt gcatatatgc gaatctgggg gtgcatatct tctgcaagtt tccgacagaa     43440
     gacagttgaa aggcctctct tggaaattga ttttgaagag gcacaagatc caaggagaca     43500
     taaaaacggc gatgtggact atgctctata tacaagcggg atggaatcgc ttgttctctc     43560
     ttatctcgca caagtggcga atctgatttt gaagtcagaa actcggcctc caggatcaga     43620
     tagggagtat atctttagag atgctgttga gttggagtat aaaataatga actatttggg     43680
     tagccgtaag caagaaggag aagcttctct gaaacgattt ttacctttaa ctgagggggc     43740
     gccatgcgac tctacaaagc aatattcgat tctaattgct acaaatatgc tttttgggct     43800
     aactggagta ctacaactaa ggaggagggt gctaggacta acacatgaga gccttttggt     43860
     tcaaaatttg gtccttaaaa taacagatct tattgaaaaa aaactatcaa cagggacatt     43920
     cgtccagcct tgtttactct tttgcttttt cagctgcggc tgtgagttgt tagatgagtc     43980
     acttgtacca aaacgcacac tgttcttgaa cttgttggat tctctaatta gagatggagt     44040
     ggaaagtgca cggcaagcga gatcagccat gcaggagtgc tggcggacgt ccaagccctg     44100
     gtgggaagtc ctgaaggagc gaggtcttga catttgtttt gcgatatgac cattgagccc     44160
     cggagcaggc caagatcatt actaaacagt caaaatctcg tctagtttcc catagagaca     44220
     tcgatttggt aaggcaactg tgtgtaccgg aatgcctagc gcgctttatg gaaaatcgag     44280
     catctagaac gttcaaggat tggtaggtac tgctcggcac tacggccatc cactcacact     44340
     tcaattattt tacatgacat atgagccttt ctttttatgg ccaaccttag ttaagtttga     44400
     actcacagaa agaatactca acaactttat agcataattc aaaaatattc ataggatatt     44460
     aataaaaact tctatttggg tacctgccgt tccttgggaa cgattaacat tccccttttt     44520
     tccataatcc tcccttgaac cactttaagc agatcataga tcaaagttaa gtatggagct     44580
     tcaactccgt ttttcttcgc aattctgacc gggtttccac aaataacctc aacttcaagc     44640
     gggtttcctt tatcaatgtc aacgagcatg gagggcctgt aatagactgg atcctttgac     44700
     ctaatcatga aatccataag cgcttcagag agctcgacgc catctgactt tgcaatagcg     44760
     atgacttctt tcattgcctt gcgaattatc gagtcggtgc cgccaaatat ctccagacgg     44820
     ccaacatctg cttcagtgag agcacaaaca gggttgagac aagcattata aactagcttt     44880
     cgccatctcg agtatttaac gttctcgtca aaaacacatt ggttcttatc atttttatac     44940
     atgctcacaa accttttgca caccttttct tgatgctcgt tggtgaggtt gacattttca     45000
     aaatatccga cgctaaggaa atctcgatcc gaatgctcta tatggccttt gacgtttgaa     45060
     gatgcaatca tgctgacacc gctcaatatc acgttgccgg ggcatttaaa gagagcttcg     45120
     tcctcaattc cgatgccgtt ttggataaga acaatcgcgg tatcttttga aactgctggt     45180
     gcaatgatgt caatcatgct cgaaacccct ggaatgcatt tggtcgctaa cacaacataa     45240
     tcgaaagggc catactgctt actagcttca atactgttga caacgttact gggcctataa     45300
     cgtatgcccc gaccatagtc gcaggaatta attttaaacc cgttttcaac aacatgtgca     45360
     tagtctgatc gcaacacaga ggtcactgag gattcccctg aatactctaa agcgaatgaa     45420
     gccatggcgc ctacgccacc tgcccctaca agaaggacat ttggcttgtt cggcattgct     45480
     agctagtata tgaggctttt aaccaagtac cagtagactt ggtttcagaa ccttgttatt     45540
     gaagtagatc aaatacttgg aatgattgat agtaatctag ggatcgaatc gttagcttat     45600
     agcttaccca tcaatagaca gaaaggatga ctcagcttca tcgttctgag tgctagctgt     45660
     cacagttttg tgtgataccg ccgagaggag accaccttcg taatagacaa gtgaataaac     45720
     ctggggtgtt gaatcgattc cgttcttacc acagaacgct ctcaggctta ttatttctac     45780
     caaattacct ctttatgtga aggtcgccct cggcaccgac gagttgctgt tgcgcagaga     45840
     tggcgccaac cacatcgtgg acctgcaagc ctactgattg caagacagtt ttttattcgc     45900
     tgaatgaggc attctttgaa aacatttaca tcattttttt ttatttagaa aggttacggt     45960
     gtggcttgtt ggttttgtat agtgacactt cgaacgcaac cgtaattttc tagtgttttt     46020
     cgcattcgta gctactagcg ctgtgatctc aattgcctag cagaccaact tatgcggcga     46080
     aattttctgc tctagcgtcg taaaagttac ctgcgcgctc catctctgtc gtcaagtcag     46140
     tcgatacata tattactgat gtattgttct cacgtcacat ttctcaacac aaggagaggc     46200
     aacgtccggt atgtgtcttc atgtggatgt cgaagtaact tgagtgcgtc gactactcat     46260
     acattgggaa aggagcccag gaaggagaca cgtacctttt gctacctagt ttctcgagga     46320
     tcttcgaaat ttgttgaacg tcgttgctgc ttagcttcac aattttcaga ttagattgca     46380
     ctctcttgga gtttaccgac tttggtagaa tacagtaacc tctcgtaaca ccccaactaa     46440
     tcagaatttg ggcaggctca acctggtgtt tctcagcgag cttgataaga tcaggatctg     46500
     ttaacatcga agactcgctg gagcctagcg gagaatatgc ttcaactata atgccttttg     46560
     atttgcaata ttcgatcagc tcatcctgtg gcaattgtgg gtggatctca atctggttcg     46620
     cggccgggac acttaaacca agctcaggct ttaagatttc ctcgatgttt ttaattgaaa     46680
     agttcgacac tccgatagct tttgtcttcc ccgatttagg caagtcttgc atgagctgcc     46740
     aagttttcac aaaactccac ccatcgatat caacatccct tgcaccatca gctctaaccg     46800
     ggattgaaag aacgttgcca tctttgataa ggtctgtttt caacgccacc gggaagtgca     46860
     tcaggtaaag atcaacataa tcaagcccca acctctctag tgaagcgtta agagcggatt     46920
     gtgggtctct ttgctgggta caccaaagtt tggtggtgac aaaaatcttt tctcgaggaa     46980
     ctccagaatc tcttatcgct ctgcctaccg cagcttcgtt gcggtaaatt gcagctgtgt     47040
     caatgtgccg atagccactt tcgagagcag caagcactgc gcggtaggtg tctccgtctg     47100
     cagctttcca cgtgcccaag ccgagcacag gaattggctt gccagtgttc atttgcagtt     47160
     caagagtggc catgttgtcc tcgcgtttta aggcccgcac tgaacatcat gtttgtctgc     47220
     cttttgctgc tcgcccgcgc gtcactctcc tttatatatg aaggcttgtt gtgagtttcg     47280
     gaccaaaaat atcaagataa cagtatgtgt aaatatgtcc aattactaat gtgcttctca     47340
     aaggggcatg cgagaataac gaaagcgcgg tgcaacaggc ttcaacatag ctatatcaca     47400
     gtatgtttct gatggatacg ctactcttgt tgtgttcccg aataggaagg acaatcaatt     47460
     tcttatcact ttaacgatga aaagcgcacc gttaggtcag agccactttt aagtagtagg     47520
     ttaagaaagc tttactagct acctcaatcg ccggggcaag aaagatgtag tccaaggagt     47580
     ttcataagtg aagcttgttg ctctgcgctc gcaaatacgg ttaaagcttg atataattta     47640
     aaagcacaaa acgagggaac ctgtacgctc ccacgccaag aaacttgata ccctgtcgga     47700
     catttggaaa agacaatcgg aaaaattggc gttttcaaat gaaatcaaat gatagaggca     47760
     gttcgtcgtt ccaactaata gtgcgaaagt taagcatatt ttggaatagt aatgctacga     47820
     gacaaacagg gctatcccag ttctatcaaa gcatatttct cagcatactt cccaatgtac     47880
     tccctagcaa gatcctcttt gaaaaggagt taccactagc cataaatctc tcttcaagag     47940
     ctaatgtcca aacgaaatat tacacatctc aaagaacaac gatccgggtt gaaaagcaca     48000
     aagcttacag ctgtatttct cggctcggct tacttcccct attcaaaact ttgaagctgt     48060
     acagcgtcga caacaaatat caagaacaaa tttctatggt tttgcgcgca tatgcacgcg     48120
     tccatctcgc aaattatgtt tcttagggac gcgggtgcta cgaactgcac catgcaacct     48180
     ctgaaacgaa tgagcttgag tttatataac cacagataac ccatccaacg catttttatc     48240
     tgagtttgtc tttccgaagc taatgaacct ggtttaatga caccggttat taacaggaca     48300
     aaggtggtac agactctgtg ctttttaact tgcggcgtgg aataactttg gcgaatttgg     48360
     agaagaaaac ttactttaaa gacctgcttt aaatgaagcg ttagcagcgt atcttttctg     48420
     cactagaact gaagttgact gccggcaaga ggagaaagcc gaaaagtgag aagatagact     48480
     gcagataaag atggaaattg tggtttttgc atctatgctg atcattctgt gatcattgcg     48540
     cttgtctatc ttatcatcaa ctactcccag gtctcatgtt tattttattg caacattgat     48600
     ctttttaagg caaagccttg tcgggcatcg agccgttctc ttgtgctata tgctgcaata     48660
     ttgtgacaag ggagtgtcat ttagcaacta acgccgaacc cccccctttg aaggattccc     48720
     agagtggtga agtttatata aggtgagctg cttcagctgt gcttttgttt ttccaagaag     48780
     ttttagacac gtcgatcttt ccgaccccag cagttacaag taatctgcgg ttgccacaga     48840
     ggttcacaaa gctaacctgt ttgacgcagc ttttgtttat ctgggcacag aggtcgctag     48900
     ctttggcctc gttacttcga gagctcagcg tatcaaccat actagaaaga tacaagacag     48960
     acaaccaggc tatgacattc acaaatatgc taagatttat gaccttctgg ctgtctctct     49020
     gaacaacgct gggtactgtt ttataaaaaa ggaactcagg taaaacggtt ccttccttgg     49080
     caaaaaaggc tctgttggtt atattctcac tagtttaaca tggtgtcaaa taacccataa     49140
     atagcacaaa agattttgcg ataaccgcct aacaatacaa tcaaaaacct agtgtcgcct     49200
     ccaaaactag tttcaagagc aagactggta cctaaaagga gcattcgagt tcaaacttaa     49260
     gagtaactag atagacaacg accacctttt ctcacatctt ttctgttttc gggaggcgac     49320
     atccaaggtc ctcagtagag gggacttgaa tatcgatgca aacatttctg aggagaataa     49380
     ctgaaatacg agaaaatact gattcctttg atgttcccaa ggatgccagg tcgtatatgt     49440
     aggtcaacca tgttgataga aaaacttatt cttaatactt atgccagttt aggcgacgaa     49500
     ctaaatgtat gtatattagt agactctata agctgtagta gttccttgca gggtatctcg     49560
     atcgaaggaa atcacaacag ggctagtggg atagccaaaa gaagaccagc tcttagcttg     49620
     ttggcagcac cctcgaaggt agagacgcca gccgtagtag agacggcagc gacggaggaa     49680
     gaagactgca cctcaagaga agaagatgga gtttgggtga cgtatgaacc agaagcgcct     49740
     ggggtagtgt aagaaccgct gtaagctgga gaagattcaa cagattttgt ttgcgaaccc     49800
     gatggagaag cagcctcagt cttttgagca gagctcaatg gagctgtggt ggtgtagaca     49860
     gtctcagtac cagagatggt gctggtagta acaatctcag agttagctgg gccaggagag     49920
     gttgtttcga cagcagagct cactgggcat gtagtggtgt agatggttgt tgtgcccgat     49980
     acggtgtcgg tcacgataga ctcagtgaca ggtgtgccgg aagcggagga gacaacaaca     50040
     gactcggagc tagctggagc agtagtagct ggctgagatt cactggctgg caaggtggtg     50100
     gtgtaagaag tcacagtgcc ggaagcggag gagacaacaa cagactcgga gctagctgga     50160
     gcagtagtag ctggctgaga ttcactggct ggcaaggtgg tggtgtaaga agtcacagtg     50220
     ccggaaacag aggagacaag aacagtcttg gcattatcag ggccagtggt agttggctcg     50280
     acttccgtga tagggcaggt agtggtgtaa gaggtaacgg tgccagattc agtaacagtg     50340
     accactgact cagtctgtgc aggcccagtt gtagttggca aagtgctttc aggacaagtt     50400
     gtggtgaaaa tggtagtcgt tccagaaaca gcgcttttaa caatggtttg acaagtagaa     50460
     gtagttggga tagagccaga ggtagctgga acggagccag aagtagctgg ggtaccggag     50520
     gtagctgggg tagtctcaga agtagctggg acagagccag aagtagctgg ggtaccggag     50580
     gtagctggga cggaaccaga agtagctggg gtagtctcag aagtagctgg gacagagcca     50640
     gaagtagctg gggtaccgga agtagctggg acggaaccag aagtagctgg ggtagtctca     50700
     gaagtagctg ggacagagcc agaagtagct ggggtaccgg aggtagctgg ggtagtctca     50760
     gaagtagctg ggacggaacc agaagtagct ggggtaccgg aggtagctgg gacggaacca     50820
     gaagtagctg gggtagtctc agaagtagct gggacagagc cagaagtagc tggggtaccg     50880
     gaggtagctg gggtagtctc agaagtagct gggacggaac cagaagtagc tggggtaccg     50940
     gaggtagctg ggatggaacc agaagtagct ggggtagtct cagaagtagc tgggacagag     51000
     ccagaagtag ctggggtacc ggaagtagct gggacggaac cagaagtagc tggggtagtc     51060
     tcagaagtag ctgggacaga gccagaagta gctggggtac cggaggtagc tgggacggaa     51120
     ccagaagtag ctggggtagt ctcagaagta gctgggacag agccagaagt agctggggta     51180
     ccggaagtag ctggggtagt ctcagaagta gctgggacgg aaccagaagt agctggggta     51240
     ccggaggtag ctgggacgga accagaagta gctgggacag agccagaagt agctggggta     51300
     ccggagccag aggtgactgg ggtagagctc aaagaaactg ggtaggaggt ggatccagta     51360
     ccagcagcag tggtagtgtt gtggtagtat ggagtactat gtggaaccga ggaaactgga     51420
     gcgctggagc ttggagcaga agaaactgga gtcgaagagg tctcagagac tggagtggag     51480
     caggtggtgg tgtagacggt ggtcgaccca gacacagtgc tggtcacaac agtttggcag     51540
     gtagaagaag actcagagac tggagcgctg gagcttggag cagaagacac tggggtcgaa     51600
     gagaactcgg agactggagc gctagagctt ggagcagaag aaactggagt cgaagagaac     51660
     tcggaaactg gagcgctgga gcttggagca gaagacactg gggtcgaaga gaactcggag     51720
     actggagcgc tagagcttgg agcggtggtc tctggagtcg aagaggtctc ggaaactgga     51780
     gtggagcagg tggtggtgta gacggtggtc gacccagaca cagtgctggt cacaacagtt     51840
     tggcaggttg aggagctctc ggaaactgga gcgctggagc ttggagcaga agacactggg     51900
     gtcgaagaga actcggagac tggagcgctg gagcttggag cagacgtcac aggaacagaa     51960
     gagttgccaa agcctgaaga actggagctt gggtagtagg tggtacctgg gacagtagtg     52020
     ccaggagatg tggagcagct acgagtgcct gggatagtgg tgcctggggc agtgcttggt     52080
     ccaacaggag tctctggggt agtagtctcg gaaactggag tggagcaggt ggtggtgtag     52140
     acggtggtcg aaccagacac agtgctggtc acaacagttt ggcaggttga ggagctctcg     52200
     gaaactggag cgctggagct tgggtagtag gtggtactag gaacagtagt tccaggagca     52260
     gtagatgggg tgagaggagt ggtagacttt gactttttgg tgcacgaagt cttagagaac     52320
     ttgctcttag tgcacgatgg cttggtgtgc gtctcagtag tttcggtgct tggagtctca     52380
     ggagtggtct gagtcttgct cttggtgcac gaagtcttag agaacttgct cttagtgcac     52440
     gatggcttgg tgtgcgtctc agtagtttcg gtgcttggag tctcaggagt ggtctgagtc     52500
     ttgctcttgg tgcacgaagt cttagagaac ttgctcttag tgcacgatgg cttggtgtgt     52560
     gtctcagtgg tttcggtgct tggagtctca ggagtagtct gagtcttgct cttagtacat     52620
     gatggtttgg tgtatgtttc ggtagtttcg gtgcttgaag actcagaagt ggtctgggtc     52680
     ttactcttgg tgcacgaggt agtcgtaggc ttgttcttgg tacacgaagt ggtcgtaggc     52740
     ttgttcttgg tgcaagtctt cgaagtagca gaggtcaatt gagtggtaga aaagacggat     52800
     gaggcagaag aagctccgca gctagatttg ccagagcact gataagacca gtagaatcct     52860
     ggggcgtcag tcttggagtg gccttggttg tcgtagttgt tacagccagt aatcaaacca     52920
     aacgacttgc tgttaccata aacatcgcac tgattgttgt agtcatactg aatctggaag     52980
     tttggcatcc acactctaca gttgctggtg tcttcttgac cgtacactct gaaggtagca     53040
     tcgtagtcgg tagggctgtc gaccttagca atgttgttat ttctgtcata caaccagaag     53100
     gtgccgccgt caggcccatt gataccaata accttcaaac catcaataca gctgatggcg     53160
     atgttcttct caccttgcac gtgaactgtg atctcataga tgttgtcctt gacccactgg     53220
     acctttttca tggagatgtc atagagcatc tggccagtgt ttttgggctt ccaggtgaag     53280
     tccaggttag ggcatccgtt ggtgatttct gtgcaagttg cttggctctc tttggggcct     53340
     gtgttttgac gtgggtttga gcatcttttc tgaagaggcg aacctacggc agtgctagtc     53400
     aacgctgtta gcgctgagag agcccaaata caacgcatcg gggtatggtt gtgatagatg     53460
     agatggttct gctgatagaa gtagataaaa caaacacctt taacagattt caaactccgg     53520
     tgcttgcgct acctttttat acatgaaggc gccggcgcca tcatcccaac gcgtcgaagg     53580
     ctccatacgc accaattccc aagaaacaag gaaggtgaaa caacagttcc ctaaaatgta     53640
     agcaaagacg cgatttcccg cttagaaaag gcccacttcc tctctgcacc gaagaggggt     53700
     cttgtttacg ttcacctgtg catgcgtctg taattagtga agtcatcaaa cccacgagaa     53760
     atttcctagc tcttctgtct ggagaggctt tgcagaaaga gcactcttcg cgttacagcc     53820
     gctgtcgctg tcgttgatgc ggacttaccg ttggttcaca taccgacctg cacggacacc     53880
     gtgcgttccg aaacatagcc tttctgcagg tctgacgcac gaacggtgtt cgtaggcaag     53940
     tacagaccga aaaaacaaat aggcacgttt cagcccgtat accgtaatca ttcgcatgga     54000
     catgtcaaat aagaaaggag tctctgttgt gtgtgaaaag cgttgcactg cacgcacaca     54060
     cacgcacaca ttggaattgt tactatacgc cattgctgtg ttcctggaag tcagcgttat     54120
     tggccttctg gatgcctcgc tcacagtgtt caagcatgac attatgtgcc tcgatgtgat     54180
     tcgacgcagc atgtcatgca tcgggtttgt tctggaatat gcgtttcatg cactaatatg     54240
     cgaggaatct tctgtaggca caataggaac gataaaacgt tcgtgagaga atgcagacat     54300
     gacacttcta cacctagtcg actatgcgcg gagccagtaa tgaaagatgc atggaaccat     54360
     tttcgagatg gattcatatg gtgacggtca gagggcaatt acggtaacag gatcggtgtt     54420
     ccagctgcgg atggacggtt ggacgacaga tacagaggga cgaagataac ttggggcctc     54480
     gacggcgacg ataaattcca aacataaaac gcgaaagggt gagtggcgac gtcccttagc     54540
     gacagaagtg cgaaaggttg aacaaggccc cagacgacac gcgcggagta ttagcgcgga     54600
     cacttcttca aaaagcgccg tccaagcacc agagcaatcc ctcctggctc aatgcgaaga     54660
     ctgtcgcatg gggaggaggg gaaccaagta aaacaaatat tgcccaacag agacgcgccg     54720
     aacgggtaca gtgagtcaag ctcgagagcc ccgcggcggc cgcggagatg ctttggacgt     54780
     ttgcgtgctg ggctccttcg gaccttgaag ccgatggcga cgcgcgaagg cgtgcgaaga     54840
     atgttcgctg gcactgttag cagtgggttc ggtgaaaagc acgcggggag ctgtgcgaac     54900
     tagatacgcc caaaaccttg agagcccttt gtgcgctggt gtaccggaaa gcgtcagatc     54960
     gtcgccgtaa ccccggaatg ctgctagggc ggaaccgcca ggacgaaatc tagggcgccg     55020
     cggcctgagc ttggcgcaca gaaggcaggc tcgcacttag ccgcctttgc tgcgacgcca     55080
     gtactacatt ccccgaacga cagggtttcg agaggtcgcc cgcaaggggc ccgaggatcc     55140
     aaggcctcgc actatcccgc ggtatgtgtg gcgaagctgg ggtcgctgct tgtttgtaga     55200
     cacaggactg ctgtttggtc aacatgaaag gcgcagccta acccgcggcc tgcaaattca     55260
     ttcctgttac agatgttcgt ttgcttgctg cgtgttttgg cgaaatacgc taacttttct     55320
     tcactacata ctcttgtcta tagaaaaaca ggcgcttgct aagaagatac ccatgtacga     55380
     tgctggttgg gatgcgaggg gacaaccctg gaagccttgt ccctcgcaac tgggcctcgg     55440
     caagcgcgtc gcaaatcctc gagcacgctt gcgggcgtgc gataaatagc ggggctccgg     55500
     gccgtgtcgc gacgtcgtaa ttcgcgcgcg ggccagcgcc cacgtgcgta gcctaaggga     55560
     cttgtgttgt ctggcgcggt ccgagcggtg ccgtggtcag agctggcctc tggtacgatg     55620
     cgcgcgcggc gtgtgcgaag cgccgcgcag gaggcgcact ggtgccggag ccgggtcgtg     55680
     tgaacacgtg acctggaccg cgggccctgt ttgcggacct cctgttctcc gtacgttcgt     55740
     gcgcgcgccg gtgcatgtgt gtatctttgt gtgtctgtgc gagtgtgctc gtgcccggaa     55800
     aaccggacta cacgaaccac agcgcgagcg ccgctgcgga caccactagc acccgcgacg     55860
     cctgtctgcg ccacgactcg ggcaccgcgc acgctagatt cagttcaata gggcagtcaa     55920
     tcattgttcc tttctttgtt ttccgcttcg cgagatggtc tgtctggtct gtcgagtccg     55980
     tcaagtccgt caagtcctac cgttccgaaa gacttcttcc cgtggccctg gcactcagcg     56040
     tttcacacgc gctttaaata ctcgccgggc cccctcccca ccgcccgcgg acctcctgcc     56100
     accgccgccc tcgccgccgc cgccattatc cttgcgcaac gctggctcct ctctgtttgt     56160
     tgtcctattg cacgcgcgcc tcaacggttt gggtgtgcgc aagcaccgcg cgcatcaaag     56220
     cgcccgcacg gtcaggacgc tgcatcggct ccgccgcgcg accccgtctg cgcccactcc     56280
     ggtctcagct tctgcgaaca atcgcttcat caccgaaccg cacgtatgat gcaagaacaa     56340
     tcgaccttgc gcgcgttctg gaaagatgac tgcatgccgt cgcaaatttt tccaattctg     56400
     cggacgctgc gcaggcacgg cgcgcacatc ctggcgtagc tggtctgtgc cactgcgctg     56460
     tgcgtccctt gcctacgggt gcactaaaat tttttttcgc agcaccaagc ccgcgctgtg     56520
     ggcgaagccc ggggaagctg gtcagagaag gcgggcttcc ggtgttgttg ttatttttgt     56580
     tgttgttgtt gttgttgttg ccgtcgcagt tgctcctgct gtcgacgatg atcgcgcagg     56640
     ctgtgcagct gggcgcgcag ctgcggacgg agtgcgcgag gcgccgcgca gcgctgctca     56700
     ccacacctgc agctcgtcgt agtagtcgac gcggtgggcg ctgcgcgcaa tctgctcgga     56760
     gacgtagcgg cgcacgagat cgtcgagcgc cgggttggcg cacgaagtca cggcgatggg     56820
     gccgtcggcc gcgtcgcaga agcggcgcac aatttcgtgg acgcggggtc tgccgtagga     56880
     gacgacgaac tcggcaggca cccaggcggg acgctgggcg ccgggccgcg ggcgcgtcac     56940
     gtggatgcgc agctcgaagc acgtggtcgc ggccgcggcg cgcacgtgct ccgcggcggc     57000
     cagcagcgag ccgtgcatgg actccagcag gccctccgtg ggcacggccc acacaaaggc     57060
     gaagcggcgc acgtgaccgg gcgccagcgt gagcttctgc aggtagctca tgggccccgg     57120
     gatgcccgcg ccgctggaga ccacgagcac gttgcggtag gtctgcagcg gcgcctcgtg     57180
     gccgtagggc ccctccaggg ccaggcgcag cgggaccttg gcgccgtcgc gtggcagcgc     57240
     gcgcagcagg tcgcgggtca ggccctcctt ggccttgagc aggatctcga ggccttcgcc     57300
     cgcgcgcatc agcgtgaacg ggtgcgactg ccagaaccag cggcggccct gcacgtgcag     57360
     gaacgcgtag cagccgggga agaagcggaa gcggctgaag tcgacgtgcg gaacgacgat     57420
     cttgtagatg tggtcctcgg cggagatcac gtgcgcgtag ccgtgggtgt agccgccgaa     57480
     gcggaagaac aggcgccaca ggcgcagcgc gcggtccgag ccccagatgc ccagggcaag     57540
     gtagatccag cccagccagc cgaactccgc gcagtgcttc aggcaggcga ccaggaagag     57600
     cagggccagg gtcacgtgca gcacgacgaa gacctcgtac cagcgcgcct tgatggagtg     57660
     cgccgagtgc acgagcagcg cggcgcaggc cagggtcgcg tagatgcccc agcgccagta     57720
     ggcgaagtcg tagaacatgg aagccacggg ctccggctgg ccgtagatgc cgtagacgaa     57780
     ccacagcagc gcgtgcgcca gcgagtgcag cgccatggtg cgcgaggccc acttatggaa     57840
     gaacatcatg ctcgagaagg gcattccggt gagccactgg agcgcgttgt tcctgcccgc     57900
     cagcaggacc gtgagcggga tcaggccgaa gcccagcccg ccggtgcggt tcgcgacgca     57960
     cttcaggagg aacatcgcct tggtgtcgaa cccggtgctg acaagcgggt agttgtagca     58020
     cgccagcgcc acgttgagcg cgaggaaggc agccagcagc acggcctcgc cacgcgtcgg     58080
     cagcagcaca cggtagaacg gcagcgtccg ggtctcgccg tggtgcgcgg tgccgaaaat     58140
     ggacggcacc agcagcttgg cgcgcacgaa gcgcgtcacc ttgtcgttgg cccgcgagtg     58200
     cttggcaacg gccgcaatta caacggccgc cgcaacggcc aggttgatca gcaggctgaa     58260
     gctgaacgcc gcggaaaagt tgtagtagat gtagtggaaa tacttcaggt tggcgagcat     58320
     cgtgcgctcg ggcagcacaa taggcgtcgc gagcggctgg ccgtatccca cggacgcgcc     58380
     gtcgcgcaga aaccgcgtcc cgttctccaa ggctgctgca tagtcttcga gtgtcagttg     58440
     cgagcccgcg aagagcgagc agtacttcgt gaagggcgcc agcttttctt ccaccgagcc     58500
     ttcggcgcca taggtgacaa aacattgcag agcggtttgc atcgacggtg cgtactggcc     58560
     acaggccttg ccgtagaacg ggcccccctc gtcgccgttc cagagccacg cgtatcggtt     58620
     aacctctgat acgcaggtga tcatcagctg cagtgactcg ggcagaggcc tcgaatgaaa     58680
     ggacaaagcg acggctcgta aggcgttgga catgcttgtg gtggtgaaca atcgcacctc     58740
     tctctatctc tggcgtgcaa ctcaaccgca ggatcaaccg ctttgtgcta tagtggtccg     58800
     gagctgtctt gatagaatca tcattgtaat gttttcgaca atgcattaaa taccgaaatg     58860
     cacccacaat gatataaact ttaaacaggg tcttgaacgg cgctgaacaa acaaataaga     58920
     aataaccgaa acaaaacccg atataagtcg tggtaactac aggcattctc agaagggatg     58980
     agctgtgttg agtgacagcg ctggtttctg ttaagttctt gttaaaatgt atgaataaat     59040
     aatattaaca aatatattcg acaaaagcgt tgcatgcgca agaagcctgg aaaagcaggg     59100
     aagtggggta aaaatctggg ctttccagaa accagccgta gttgggggaa agccgctccc     59160
     tttccttgcg ccgcagcggt gctcttttag tgaaatagtc aagatggtta tcgtggtttt     59220
     aggcgtaaaa atcatcgcat ttgtgtgcaa tttgtgcaga gagaggcggg aagccggggt     59280
     gccgggaatc cgggagccag gccgagaccg tttacaattc gtcggcgaat ggcaatttgg     59340
     cgacatcgcc cacggcagcg tagctgaatt tgcccaactt gaagtccttg acgttgtcga     59400
     gcgagagctg gacggggaag gccgcagtct cgttgtgcag cgccagctgc aaagcggcag     59460
     cgcccttggc agcggagatg tccttaccgg tcttcagggt ggcgacgacc ttcttgatgt     59520
     tctcggaaac aacggcagcg tcggagccct tgacgtagag cgagaacaga ccggcgttgg     59580
     agtactggtc gagtttggcc ttagtgacca atggagatag atcgctcaag gcagaggtta     59640
     ggtaggtagc caagacctgg taggtggcga agtcggcctt ggccactggc acggcgatag     59700
     cggccacgga gtcgccctcg gcggatctca gacgggtctc gccgacgaag gtctttgggg     59760
     ttgcctcctt ggccagagag gtgccttgag gcagcgaagc gaacagcgag tcgttgacga     59820
     agcgcttgag gtcgctctcg ttgacgccct ggcccgcgat ctcgatgttg tcacgtgtgt     59880
     acaccttgtc tgcgtacgcc ttgatgtcgt cgagcgaaac cttctggacg gcgtcgtaca     59940
     agaccgcgtt accgaggtcg ctgcggaaca cagtgctgta cagcaggttc tcggcgctct     60000
     tcactgggca cgcctgcgcg acggctaggt cgtggtgcgc agcaggcaac acggactctg     60060
     gcaactcgtg tggtctgtaa gaggtcttgt acacaacgtc gcccagcgcg ctgacgtagt     60120
     agggcagatc ctccttcagg aaagtggcct tcaaagtgat gtactcacgg tcgaccgtcg     60180
     attcgaaacg accgcccagt agctcggact cgcgcaccag acgcaacgca gacttgttgc     60240
     cggtgttgtg gaagttgaat ctcgacaaca agtgcgccaa accctccttg ggggcataac     60300
     gcgcgccggc gtgcacacgc acggctaggg tagacacctt gcttgcgctg tccttggcgg     60360
     agatgtggta gtgacgcgct agctgtctgg cgcctgccat tctagttctt gacccaatca     60420
     ttattccaga tgtttccagt aagtacctcc ctgttgtaaa gtcctgtatg tgacggtggt     60480
     gaccctcttg gaacctcaat cctctagctt cgggaagtcc ttctgctaag ttgatgcgcc     60540
     agaccttgaa aaatctttct atcgatatta ccgggctatt gaactagctg ccaaataaag     60600
     cgatatgatt ggtgcacacc gaaaaacata gaaaacctag ggaaaaaggc gcctgatggg     60660
     tgccctagaa gcatctccgt tctgcccgcg ccacggggca ttgaatggtg ccccttggcg     60720
     gccctcggcg cgtcgcgggc gctgccggaa aatccaggcg aagggccgga ggccaaacaa     60780
     gccagatatc acgtgctgaa tatagcaaca cgaaccgtac ataaagacat tcatatacca     60840
     cgtgacgaac taatatcgga tcacgtgact ttgtttcccg tttgtttctc gattgtttcc     60900
     taataaatgt ttccaggatt cgccaaaacc gcataaataa tattttgaga ctccgcgagt     60960
     gagttaaaat gtgagttaga atgagttacc taagaaggac tcggcgacag cgctggagtg     61020
     acagcaagtc cgggcaccaa cgcgagaaaa aagcctaggt gtctcgatgc gttgaaaaca     61080
     gagcttaaca gcgagacagc aggggcgtga gcaggtgcag gcttgtggga acggcgggcg     61140
     taggcactat gtgctttatg cgcccgccag gcgcagcgac cgcattagaa ttcgcgcaga     61200
     gcaccagcga cagcacagag ctcgaaaggc cccagttagc atgggaagtt caggacaatg     61260
     gagggcctgc tggtgggaca gttttttctc atctcatcgc actttcttca catgatctac     61320
     acacggcgaa gttgatgaaa attttggtaa tattgacatc ctagatcaaa gctcatcgca     61380
     ttgatttgaa gcgccccaga agtagcaagc gcggcgtcca atggctacaa attctgcttc     61440
     tcccgagtcc ctcgatgaca aggaagtgat caacggctct gtggcgtctc tcgaggcgcg     61500
     tggtctcaat ccagagagct ttctctaccg ggagctttgc aagacacacc tgggtgagcg     61560
     ggcggccgcg gtgatgaaca tgctagtctc caagggtcgc ttgagtgcgc gcgaactgtg     61620
     cgatcggctc gacatggatt taaagagtgt caagcgcatt ttggtctcac tcgtgcagct     61680
     gcgatgcgtg cagtactgcg ccgaaaccag cgtgtccggg cgcaccaccg tctattacag     61740
     ctactgcgag gacggcctgc tgctgatgct atacgcgggc gagatcgtcg aggccatgca     61800
     ggtgcacttc cagtcggacc tggcagctca gatcgtacag aacgtacttg ctctaggctc     61860
     gctgaccttg aaggcatacc tgagctcagg cctctccgag gtgtcacctt ctgaggtgtc     61920
     tgcgtacttc ctgaggcttt tcgaggccgg cttccttgta ccgcttacag ccaatgatta     61980
     ttgtcctgta agtgaactgt ggacgcggct ctacaagaag gagtacgacc tcattccgaa     62040
     gaactcgacc ttgtctgatc tcaagaaaag gacagaggcc aagcagaagg ccaagaaaca     62100
     gttctaccag ctagtcggcc cccctgatgc ctcgagcttc atagtgactg atcctagaac     62160
     ctctctaaga caggtcgccg attccgtgcc gctgactttc agcttgggca ggtacttaaa     62220
     gctcaaaaga tccaagcagc tggttcagtt ttccgctgcc aaagttggca aggtccctgc     62280
     cgctctttac aaaattgccc ttcgcatgac ggagcggtct tctcccgaaa taactgatcc     62340
     tctcaccaag acaggccttc tacaagatgc agacgaactc gcggctactc aagacgaggc     62400
     agcgcgagca gaagaaaaga atccgggagt taccttcaat gccatggata tatcaaaaca     62460
     cctcagcgac gatatagatc tcagaggcac gatcgcctct caaatgaagc ggcagaggcc     62520
     gagttcagcc gaggtccagt ctcacaaaag agtcaaaaca gaagacggct tcgtggttcc     62580
     tcctccacca gccaataacg gcgctgaagc cgacgaaatg gcagatgaca acattgatct     62640
     cgatttggac gacagcgaca cagaccctca ttctgtcact ctcatcaacg ggcacttgaa     62700
     gttgcttgca agctctactg tttccttcct acaggagcct caaccgggct tgtactacgt     62760
     gccttacact aggctcatgc cgttgctaaa gtcctcagtg tatgaggcgc ttctgagtta     62820
     cacgctaggt gggtctgcat gtagaatcct ccgctgtatt cgtgacaaca acttagcgac     62880
     agagaagctc attaactcca cggcattgat gagggagaaa gacatcagat ctgttattgc     62940
     caccttgatt aggtacaatg ccgttgaaat ccaagaagtc ccccggacgg ctgatagagc     63000
     tgcgtccagg tcagtctttc tatttcgaaa caacccaagg cacgcatacg acttcatgac     63060
     caagaacctc acctggaaca ttgcaaatct ttatcacaaa atcgaagatt taaaaagcga     63120
     aaactcgacc cttctccaaa aggctaatcg tgaagacgtg aaaggtaaag aaacggagct     63180
     cttgcttcca agcgagctta atcagctgaa gatggtgaac gagcgtgagc tcaatgcatt     63240
     aacaagaacc caaagacttc ttttgctttg ggaagtattc aggttttttt aaaccgtact     63300
     agcgtagttt gccgcaggtt tatctatatc tccaatatat caattgcata gggggtcgtc     63360
     cctcaaaagc accctttcaa gctagagagt gcttccttgt tccaaggaca gaggaagatt     63420
     gacctttgaa ttttggacaa gttccctaaa ctgctataga actcgctcat cttcctggca     63480
     gggaccttat tctgtccgcc agctgcgata cgtgctctta tcttcttgtc cagtgagccc     63540
     caggatccac tgtcatttgg aaagaaaaac gcagttcttt gccattgctg ctgactttcg     63600
     cagtcttggg aaagctttgt attgagctgc tggatcaaaa atggaatgtc gcggtgtctg     63660
     tcagatatca tatcactcaa gggcaggctc ttcagttccg acaagatagc gcgcatgtca     63720
     tctggaatac cctccaagag cgaaatcact gcgattgtga gcgtaacagt caggtctgga     63780
     ccgttggagt taatataatc caccaattcc ttgagggcaa cttcgcgagt ctcttctgac     63840
     tcaacgttgt agagaatctt agcaaccaat atcactagtt gctttgattc ccctgggcgg     63900
     tcaagcaaga ctttgaagtg ttctagagtc tgatcgaagt catccaggaa aaaagaagct     63960
     agtcccatca cggcatggtt tgaggtaata cacttctccg ctacctcgtt gttgtgctcg     64020
     gcaagaatac ccaacgataa gtctgcactt tcgattgccg tctcgtaatc ttttagacca     64080
     agatagacac gagcaagttg cgacttcaca atggcaaaat gaaacaactc ggaatcatct     64140
     tgtgcctttt cgaaccgttt ctcaagtatg tccagaaggc ggtcagaaag tttacgcgcc     64200
     gctgcataat tgcgtagtct ctcaagagtg agtatagcgc attgtagggc aaatttgtca     64260
     tctgggttct ttttcaaata atcatctaag ccataagcta cagcgctcag ctcctgacca     64320
     ggtcctatat ccctctcatc atcaccgctt ccaattcttg ttttcaacac gctcttagcg     64380
     tacaataatt gggcaccttt tgacttcccg tttgacagaa caaatgaatg tgcaaatagt     64440
     cgcgcactgt cttgtgtcaa gccttctttc tcggacgcaa gagcaaggcc aaaccacgga     64500
     gtagagtctt gtggcgcaat gctttgagac ttcatcaaaa cggcacgtgc gaaagcaaca     64560
     tcgttgtatc ttaaggctag aatagccata tcgtaccata cactcgtttc cctcggattc     64620
     agcgctgtgg ctttgataaa acagtgctgc gcaactctga cgtttaggtc aatagaagct     64680
     attccaaaac caatccaagc ctctgccgtg ttggattgat actcaattga cttcttgaaa     64740
     ctttcaatcg cggcatcccg atgggagttt gacttcagta tcacaaacgc cattagttca     64800
     actattccta ggttgtacca caaggaggct cttacggtcc ggggcaacga agcgtagtcg     64860
     gagcatgcga tggcatgttt gccggacaag acaaggaatt gcgcagcaat tgcaacgttg     64920
     tcttgttcga ggtcggacaa cagccccgaa agcgtgacat gatctatttt atcgatttca     64980
     tcagtattgc gaagttctgc cacctcaaaa atatttacca agctttccaa aggtaacaaa     65040
     tgaacctgtg attgtaccaa acaaatcacc ctgagcgcgt tggagagcga tagccacatg     65100
     ccatgaattt tgtagtcaat atgcaaaaca atagactcta tcttgcgaat agcatcggca     65160
     gcagcagcaa ccgatcttgt caaaaagcct tgagaacaaa gcacattaca gtgctcaacc     65220
     aggacttcaa ccatggaaac ctggtagctt tcctcgtcgg ggtgctcagc tgtgagctct     65280
     cggaaaattt caatgctctc atcatagagc cccatctttg acaatgaaag ggctttgaag     65340
     tagtgggcgt acgcattgcc ggggctaact tcaagggcct tctcaaagac cttgactgat     65400
     gcctccaccc tcccacagct ataatatgcc tgaccgagac caagccaaga ctccaaatca     65460
     gcaggctcaa cacgtagcgc agattggaac cattcaatag actctgattc ggcttgtttt     65520
     tcgaggtgtg caatacctaa aacgcgataa ggccaattga cgttttgtag aatgctttta     65580
     gacttctctg cttttacaac acgttccgct atcagtgacg cagattgcca atcacaggaa     65640
     ccacagtact tttcgcacat gtacctagcg gcagtcaaat cactaggatc catctcgaaa     65700
     gatttgaagt aacacttgaa ggctctggtc ggatcttgat agtattcgga atatatatca     65760
     cccaatgtcg aataaccagg cgcaaaattc tcagacgttt tgacggcttg aactagctgt     65820
     ttaaatgcaa gcttgatata ttctttttca gagctctctc cggcattaat ttccccgtgc     65880
     tgtttgtaga cataaccttt cgccattctc cagtggttca atgatctgaa ctcgagtacc     65940
     ttcaagtcag aaccttcgac gttgttcagg atatatttga acctttcaat ggctgcatct     66000
     ggggcatcca aatgaagctc actccatgca aattctgaga gaacttcgta attgtccgga     66060
     tatctttcag ttacctcttt gagaagctca tacgcttctt gccagttcct gcgttcgatt     66120
     gctatcagac cttttcccat ttttgcgtgc acattgtccg aattttctgt gagaagcttt     66180
     tcaaacaagg ctagggcagt tgggtggttt ttcggcgctt caaagtaggt atatgtagtc     66240
     gccagatcta aagtcaattc tcttttagag ttgcttaggt gtgcacccat gtttttgaca     66300
     ctttgtgcgc aaagtacaat acctgcctta gtgtagtgta aagctgattc atattccctc     66360
     gttgatacgt aataatgaga gacgatgcgg tgcgcgacta tactttgttg ggtctttttg     66420
     atattttcag taagcgagag aaggacttcg tcttccgaca gaccgaatgt tgcttcctcc     66480
     atcgatggat ccactaactg ctggagccta cgcttttcag attcgtccat gccatcttcg     66540
     accacgtcgt ttatgctatc aactgaggaa gtacccgaat tgtcggtatc ctcaccttgg     66600
     aaagtctttt cataaaactc cttagagttg taacttgatt gttctgaaca aacccaggca     66660
     taaagtactg ccgccaaagg ctccttagga aacttcttga gaaactttga aatgacgttc     66720
     acgtccatac agtctaggtc cgaatagtcc tgccattcaa agtaaagctg ccacgcaagc     66780
     aggaagtcat ggtcaaccac caccatatct tcgaccatat tcctgacttt tgtaaagaaa     66840
     tgatgcttta tatccgcagg catcgactta agcaccctta ttctgtactc tagccattta     66900
     gactcaagac cccgcctttt ctcgtcgtca tctgttatgt taatgagctg ttgatagagc     66960
     tcgtcgatct ctgagtcttg ataaacttgc cacgcgatgg aatttacttt taagttgtaa     67020
     tcaggctggt tagcacttat tttgagcctt tcccgactga cgagtttgga cacttgttgc     67080
     tgctcttcgg ccgagactat gttgagtaga ccttgaaggg catcctgtgg ggttatcagg     67140
     tgccgcgaca agcgctccgc cattggtgtc cctgggcgca tgtgtcttaa atatgattcc     67200
     tgacagtctc tgtaaaagtt tttgaagttc ctgatgtcgt taaccagatc caccatgggc     67260
     agctgctgct ggacaaggtg ttcggcgtat tctccacata agtcaaaaaa ctcatcaaac     67320
     gacacaatcg tgggagcaat gttggctgtt ctaaagagca tgaaaatccc cttccatgcc     67380
     aacatatttc cggggtccat atcaatggcg gccttgtagt gcttcttaga ctgcgccaag     67440
     tcgccggtgc acgaaaatgc ctttccaaga aagacatgag caaaataatt gtttttatca     67500
     agatttagaa cctctttcga cttctcaata gactgttcat agtcctcgct agctagtgca     67560
     ttcttggcat cctttaacag ctgctttagt tctgccattg cgtgaagccg ttgatcttga     67620
     agtgtaagtt gtgaaataaa gaggtagttg tagttcaaaa ttttgtttgc cgaaacgcaa     67680
     caggagccaa gaaagataaa gcgactacca tggagaagag cccttccacg tcattctcgc     67740
     aattcacgca ggcgcagatc cagcgcatgc gtgatgcttt tcaatttatc gacgacgatg     67800
     gtgatggaaa gatcacgaag aaagatctcg ataaggtata ttccaacctt ggtaagtcgg     67860
     atgtcgctaa gcagatcgag gccatgttgg gagaaaaaga cggggagctg acattcccgg     67920
     agtatttgac agtaatgggt gatagaatgg gcaagctgcc ggacgaggaa gagctcttgg     67980
     acgcgctgcg gacattctgc aagagctcgg gccacgagat gagcattgat gctaaggagc     68040
     tcagggagtt tctggacgat gcggggttca aggactcgca gaagttagat aaaatattct     68100
     cacagttttg cactactcaa ctgtcagggg accaggtttt caaaggccga aagtttctgg     68160
     aaaccctcga gtgagcgacg ccgtccctgt cctggtgtta caactcgcaa gcgatttact     68220
     ataaaaggaa aatgatccgg ctttgagttg atttttactt attgtacatg ctgtggtgct     68280
     tcgtcatggc ctggcctgcg ctgtccgtgt gcgtcgacct acaggtccac aatcaattcc     68340
     tccacactcc aatcctcgaa agagccatct ggtaggtaac gtctaatcac cagcgggatc     68400
     ttcttctccg ctagttcttt catcgcaatg cgcaacgggt cggtttcacc ctccaaatcc     68460
     acgaacacgg gcgcgttcat cgagatctgg agagcgcgcg taccgagaat acgtgcacgt     68520
     tcgtacttcg tcatgtatgg cgtcgtggta cgctcgtctt ttggaatggc tttttctttc     68580
     agggttcttt tgcggttaga ctcgtgttgc tggaagtctt cagcaccagt tccaccagtt     68640
     atgattgttt tccccgattc gtccttggtc tctccatcct tgaactcctc tggagcgtca     68700
     tagacctccg cgtcggagaa gtgctcgtta tcgaaatcct caaagttctc tgggccgtcg     68760
     ttaaatctga agatacattt ttgcgttagt aacgaacttt aaagaagggg gtccattttt     68820
     ggcggccctt aaagagctta aacgtacgct tcctcgtaat cagacatctt ctatcaccta     68880
     tttttgatcc gctatgctta atgctttgaa gaacttaaaa gttttcgatg aggtgaattt     68940
     ttcacttgtt tcgtatgtct ttactgacga aaaatcaaaa agatgctcga ggtaaaatgc     69000
     gatactcatc gatggcatct catctcatct aatcatccgg agttagacta gataccgggc     69060
     cagcgacacg atatctcgac tcgatggaag agtcggagga ccactcaaac ttctgggacg     69120
     ttggtaaact cggaagtgag gacggcctgc ccttggttag gtcggattcg gtcggaagca     69180
     tacaatcgat ttcaagcgct gggtcgacca gctcatcacg ggcaaaaact tgggtttgcg     69240
     agtatgaagg ttgctcaaaa gcattcacgc gaccctcaca gctaacggaa caccaagaga     69300
     cggttcacca agggttgaag cctttcacat gcactgaatg cggccggcag ttcacgcgga     69360
     agacgcatct ggagcgtcat atgttcacgc atacagcgga aaaacccttc cactgctctc     69420
     actgcgggaa aggtgttaca acgcggcagc agcttcggag acacgagatt acacataccc     69480
     gatccttcgt gtgcccgcac gaaggatgcg gagagagctt ctacaaacac cctcaactgc     69540
     gctcgcacgt cctcgcggta cacctccaga aactgaactg tgagttttgt ggcaagaagt     69600
     tccagaggcc ctaccgcctg aaaaaccaca ttgcaaaaca ccacaaccca gatacagtct     69660
     ataagtacca gtgttcgcat gggtcgtgcg tagaagcatt caagacctgg actgccctgc     69720
     agcagcatgt gaaggaggcg catcccaaac tccagtgccc tacctgtggg aaagcttgcg     69780
     tgggcgaaca gggtttgcag atgcacatga gggtccatag cagcatgaca gttatcaaaa     69840
     actggaagtg cgagtcttgt ccagatctct attttgcaaa gaaagcggac ctcgtttcac     69900
     actgcttaga gcatcacaaa gacctcgttt ctactttact gaatgacaac gagcgggagc     69960
     ctgctgagcc ctcggccaca gcctcgccta ataacatacc tcttgaatct ggtgcacgtc     70020
     cttctcgtct gcgcagttca tccactaagc atgattcaga atctgagctg gagtctattc     70080
     aaaccgaggt gaagcttaga aaatactttg attctggtaa atcatcagta tctctactgc     70140
     tcaattctgc tggccgaaaa ctcaaatgcc cttatttggg gtgttacaga tctttcaaga     70200
     ccgaagaaaa atacgaaatg cacattcaaa agcacaagat tcatcagctt aagctaaaaa     70260
     tactgcaaga aaagaaccaa gcaacttccc tggcctcgga agaaaatgag cttgaaagta     70320
     atatggaacg gaaaaacggt aattcacagg atctggaatc tctgtcggca gcagcaaata     70380
     ggtaattcat cattacgttt atatctgtta tattcgaaag agacgaatca ataaagcagc     70440
     atagaagacg cgctgggtgg cgccttgacc cgtggtgaaa cctcatgttt ttgtgtcttt     70500
     aatttaataa taagcttttt gatagaaccc agtctactcg gctttacttg gacaaattca     70560
     tgtcactcat gaaaaagagt aagtcgtcgt cttcttcttg attcaaagaa tcatcctttt     70620
     tggggagagc atcagacacg ttagtctcag gcgaattccc gacaatagcc ttgtgcaatt     70680
     ttgcatgcgc aggcgtggcc attgtggtgg gaccagaaaa gttgctcaaa gacttgaagg     70740
     gtaattggct tttactgaac gagctggaca cactcctcac tgatccaggg gacgttgagc     70800
     ggtttcgaaa atttgttgat gctggattca tagcggatcg gcctaccagt aagtcttctt     70860
     cgtcttcttc gtcttcttcg tcttctgcgt atccttcgtt gctcgatgtg cggcctccta     70920
     gccttcttcc gtcataaaag ctttcattta agtttgagat gattgactta ggtctttctg     70980
     tagagcctct tgcacttgaa agctcaccta aaatttcggg gcgataagaa tctgatcgac     71040
     tctgggaaag ccgcatggga atggaggagt actggatgga aggggagaaa gaggagtttg     71100
     gagagtgaga attcgatctg tttcgtggtt gacttacgct agggcgttct agtgacatgc     71160
     tcatagaaag gtcagtgctt agattattgt ttgtggtacg catgccttgg aacttcaaca     71220
     gagagtttga aatatcaacc ttcgttcctt tgttcttcag cttcaattcc ttccgatcat     71280
     ccagaagctt catgaaatcc agtaagtccc ctgaaggaga ctcgttaagc ttgcttggtt     71340
     tctgtgatct ttcaacgcta tcggaccgcc taacgcttga ctgacgccga agacgcccaa     71400
     aagaagacga atatttggac aaacttccac tgcctatgct agagggctcc aagtgcgatt     71460
     catgtagttg ggaggttggg gcagtgatcg acccattact aggcctttga gctcgtaatg     71520
     cagcagctac agatgttgcg gaagggtttc gactgagcga cccctgctgc acttgtggca     71580
     gggatccact accaacggag cccgctttaa acggctggag ttgtctcgca agaactgtgc     71640
     ccctcttttg tggtgagggc tcggccaagg ggctggggct gattgtggtg ttgggtgaaa     71700
     ttgacattga tctgttgctg ttcattgata ctctcctaag agacggcgta gcaacaggtg     71760
     ctgcactgcg tgagcgtgtt tcctggttaa actgagtgtt gtattcctcg ctgccgttta     71820
     catgaaagtc gcagtccttc ctataagaca ccgaaatcct taatgagcca aatttggtgc     71880
     ggataggtgt tatttttcgt tgttccaaat gcgcaggcaa atttgtttcg ttgatcacat     71940
     tcgaatatgt ggctatcaga ctcttgctaa gccctattct gcccttcgat acgattggtt     72000
     ttgatccatc caagattctt gttcccagct ttaccggagg gggcgcctcg ggtgaaacgc     72060
     ctggcctgat aaggcgggct tgtagctcac ttgctggtag cagacccaca agtgtctcca     72120
     agtagcggaa tagcagtaca agctgccgat ataattctga gacattgtca tcggtatcct     72180
     ccgatccaga agattggagg cttgggctgt cttccccatt atctagctgg atgagccaac     72240
     gttcaagcat gatttccgac ttcttagtgc ccttgcaaac attccaagga ttcccgtcct     72300
     gatctttcaa cgtcacttgc tgggacgggc ttagccgggc cagatcgagg tatgtctcta     72360
     ttaccagtgg gggcaaagac tcgcttccgt caaatgtggt ccatggttta agctcacgct     72420
     ccagtttcgt gtctccaaag gtttcgatgt tgaaccagct gtttgtggtt ggcggcccct     72480
     cgtcagccgc tggagcccct ttccagccct tggagtggca aataaggagc gctgccttta     72540
     aaaagaagtt atctatcagt tcccaaagct gtttatctaa gcttgttgtc attacaactt     72600
     ctgcttcagc atagcattga aagcgtgtac taaaaactgc ttgtaaagtg tgtcagaggt     72660
     taaaaaccac cctttaattt ctggaccaat atgggataaa cttctgatga taatgaaaac     72720
     ctacttgaat ggtgcaggcc ttgcgaatag aaagctcttt aggcctttgg ttcacgattg     72780
     ctgactgttc aagaaaggct tacttgttga gcttcagaat cccttagctt gacgcgcgtt     72840
     tcgtgtatga ctatattatt atttcgttgc tacatagctt tacgttatca aagtctgttg     72900
     agatggagac aaagtaccaa aaatgcggca ttgacaagcc caagcgtgag agcgctgcat     72960
     tttgaattta gccataattc aatgttccca taaatcgtaa aagaaatcca aagtagttgc     73020
     agagctccag gcttgtgtag ggctcgaatc ggagcatagc gcgccgtcct tgttagtgag     73080
     ttctgtcaag ccagcccagg gactgccata gataaaattg cgctggcctt cgaatctgtt     73140
     atacagctgc tggtaaaggt aggaggatgg cttggagctg cctttgcttt ggcagcgcgc     73200
     atcagccgcg agatgaaacc tgtaaaaggc gcgcataaag tagccatagc accacaccca     73260
     ttcagggcct tggtgatagt tcctaccttt cgaggtcgca aaatcggccg aatcctctcc     73320
     attgttatag ttggggcgat agttgtaatc actgggatcg agagtccgca tacccacagg     73380
     accgcgaatt atgcggtcag cgttatcaag cgcctggagc gcaagttcgg gagtgaacag     73440
     ctctggagca acagtcatag caatggcgaa atttggcctt aattggtagt cttcataagg     73500
     ctttccagcc ttgtacaggt ccttgtatat gccccttctg ttgactaaag tttcatcaat     73560
     gtcatactcc gaatcttttg aaggatccga tggtacaaag tattttgctt caaagttctc     73620
     ttgaaccaag ttgttccatt ccttgaaagt gacctggctc ccgtcttcct tttcaacttt     73680
     agtgtattta aagagctttt tctcgtgcaa ttccaagacg aacctcaagg cgctcttcag     73740
     aaggccgcta atttcaacgg cagctccgtc ccttggagta ccgggaactc caaaggagcc     73800
     tgctttttcg ctttctccca ttttatccat ccaggtgcca cagttgtact gggaacctcc     73860
     atgaattaaa cctgtcgacc agtccacatg aatcttgacg tcaaaccctc gatcgctcat     73920
     gactctgtcc agctgagggc cagcattagc ttcccggtaa ctgatgccct tggcatgtct     73980
     ggaaaggatt tcgaaaatga tgtcttcaat actggtttca taagagaaag cacgagggtc     74040
     atccacggtg atataagtat catcgagcgg gaaacgcctt ggaatctttt cacgtaaaat     74100
     ggattctcca tcgggcgcca ttttcacgta atcttggatg gattgtatga aaagccatgt     74160
     ggcatcgcgc gcattgtaac gagggttccg gcctgcatcc aaaaggttgg ggattaagcc     74220
     atgcttcagg gtccttgcaa atgctaagat atgttgctta gcgtcgtcaa atcgagctgt     74280
     cgtgagaagt agacctcgaa gtgatataaa aacatctctg ccccagcacc tcatgtagtc     74340
     agtggaaaaa tgagggagtc ctgcagccat acatggtaca ttcttctcag ggatgagaga     74400
     agtcgaacgc atctcggaca acatctgaac cgaagtcaat gctaagctct gaacaaatct     74460
     tgttgaggac ccaacgttct caggcatatt ttgaatagct ctgaatctgc agcactgata     74520
     cgcaattccg ataaccaatg cgaaataagt tggtaccaaa aatgatggta gcttcttgac     74580
     ccgatcaaac cgagacgcaa gccacgcttg catctcagat attcctggct gctccttgta     74640
     gttttctagc ctttgaacga cataatcaag cgcccagtga ccacttctca aatggttgct     74700
     catggggtga gctagatcat tcgaaaagat tatcttgcgt aacacgctaa cccagccttg     74760
     gaggccgcaa tacgtcagtc gcccaaagtc aggaacatcg taaaccccgg aacttcctgc     74820
     acttatatcg cgctcctctg catcacaccg gtacagtaac ccattgaggg agtaaagatt     74880
     caattgttca gatgccttca aggcaccagt tgtgagaaac ttcagaagtg tttcatcaat     74940
     accattctgt tgcgtcttga atacggctat tgatccctgg ggaaagctgt cagtaatttc     75000
     tatagtagac tctcctaagt cttcgttata gtcgacttta aaccctgata attcttctag     75060
     cttgctagga atgcctttga ttatattttt gtcttcagga actcctccag ctttgagtaa     75120
     agaatatgca aagctgaact cacaacgaga tccggtgaat ttgattttgg gtagcttttg     75180
     ctcacctttc tcaccaaact ttgtccgcgc taccaaaaac cacccgcttc cgtttttggc     75240
     attatttctc tggaaagtga tatattgacc ttcgtggtga acatgcattt cagaatcttc     75300
     aatgtcagcg ctaccttgag caatttcgtc tctaattttg tgcagctgcg ctctagctac     75360
     tgagatgccg tcattggcag tcacgtcgta ggttcttgcc tcgcctacca catccaatag     75420
     gtagggaaag cattcatcat atccataaac agatccgatg gccgatgagc agaaactaac     75480
     taacgcagca tttggtaatg tatcttctaa agtcctcttt tgaaatggcg tctcgttatc     75540
     gtgtgtacag tccataaata gtgcatgagg cggtgtggca gttaaattct ttggaatatt     75600
     gacctccgat acgcgcttgg cgttatggat atggaactct tcaacttgcc tgttcgtggg     75660
     gtaggcaaaa tcatccaaag gcataaactt atatgagcca attggtcttc ctccgtgtct     75720
     atggacaagc cttgacaatt cttcttcaga ccacgcctgc atagcctctc ttatcaaaga     75780
     agatgttcca agtctctcca caaacaagca gtccatggcc tcggacccgg agaacagctc     75840
     tgcagcaaca tataggttgg gtttgtgcct ccttgctaaa tccagataat actcgcccac     75900
     atgtaaaggt gttgaatggc aattgtctat tctgaaccca tcaaacagct tagcacaagt     75960
     ttcaatgtac tcagacattt ttttccacaa aaacggtgag tcttcgggtt tggccccata     76020
     cctaagctta acacagtccc cccaaacaat aacttcgcgc ctcaggtaag cttttgattg     76080
     agaggatgcg aagtcaacta atggatttcc attccaaatc cagccattat tggccaaggc     76140
     gtactcctct ccgtcactgc cattaaaacg ggtaaagtaa ggttcagtaa gcggcgattt     76200
     gtcggtaaca gggccaagtt tggggccatg gtcgtccacc ctcaagtatt tgatccgatt     76260
     gaaaagctgt tcaaggatgt caccaatgtc ttcatcatac tctcggtaca gaggcaaatt     76320
     tatttcatca acaatctttt gcgcttcctc caagacggca tcatttagct cgaaaccata     76380
     tagggttttc aggatagcaa caaacttaga tccttcaagc ctgttcgaga agcgttcacc     76440
     taaatgacca aaattttcac aagaagcgct gtcacgaata aaattcgcca actcaaccaa     76500
     atcgtttttg gcactgtcgg gaatttcaac ttggtcgtga gaagcctgtc tccaatcatt     76560
     ctttaccata tctaaagctt gattggcatc aatgacataa tactcccaca atttcaaaga     76620
     gccaagtaca tgaattttga ttccatccat aattttgaaa agatcatgcg ttgaattcaa     76680
     ttccgtgggg tagccaagct gcctcagttt cccgctgaat tcgagcaatt gcttgtcaag     76740
     ctccattgcc gaaatcaagt gaggggcagt tttgtggttg taaccagagt ccgggtgctc     76800
     tctaagccat ggagagttgt ttgcagtatg gttgaggaca acgtcagtca tggcaagaat     76860
     tccatgttcc ttgtgcaact taagaaccat cttggagaca tcatcaatgt tgttggggaa     76920
     aaaagcagga tcgaactcga gttggtcgta tatcgaatag ggtgaattgg agtcgccacg     76980
     cttttgcaga ggtgtaaaat ggattaaatt ataacctttc gacgcaatct tgccaaaaat     77040
     cttgtcccaa tcactgccca tccactttga gacaacgctt tgcattgtca gtgagtttaa     77100
     gggaatataa cggtcatcaa tgtataagct aggaggaaca acaaagtaaa atcgacgagt     77160
     tgtttcaagc tcgtcgcgat cattacgaaa ggaaaagtag aaacaaaaag gaccgggcct     77220
     aaaaacggga agctccacgt ggtgatcctg gtggaatgtg gccttgatct cttttttgtt     77280
     gaatttgtcg cgaacaaatg gcgttttggc atcgacaggg cagttggtcc atacaagccc     77340
     atcacgggcc actggagaac caccagggat gacaagttta accgtaaaaa gcggcgaact     77400
     ctcatcataa ccatcgtaaa cgggaagcga gggcagtgtg agaacgccct ggccataaga     77460
     gcaactcaca acgggttccc cctttcctga gacccttagt agcaattgcc tctccattct     77520
     gctcgtcgtt tgtggtcaaa tactgtgaag ccccaattgt gtgcactttt gagatccaga     77580
     gtctcttcaa aaccttaagc ccccttttaa gagcgtcagc tgttgaacct acgattagcc     77640
     ttttctcaga ctctagatac agtttgttca acgacgaatt ttcgtgcaat tcgttcgcaa     77700
     gggcgcttta gctatgtctt tagccccttt atcgtaattc ctttgacgac gccgtacgcc     77760
     atctttagtt cgaggacaga aggccttgct ctagcttttt ataccacttt tttaggtgct     77820
     cgatgacttc aacctttttg tgtccctttg actgctagcg ccccttgttt ggcacggacg     77880
     tcggtgatga ttctcttaaa ttggcctatc atgagttaac tcactttgct tcgcagaatc     77940
     agcaaaggtc ttggctggcc gcaactgtga aagaacatga ttccattggc ttttagcggt     78000
     cacattgctt gcctgtatgc ttttccaagg gcctatatgg agggccgaaa cagatgcagg     78060
     cgtgtcgtcc attagaagtt acgctccgcg tctcaatctc agcaccaaga ttttgggtac     78120
     tttcatctat tagacaaatt gtttggaaca atgtctttgt tgggctttca aaaacaagcc     78180
     aggatcagaa tattattcaa ttgcaattga gtttccccgt aacgtgttag gattgaagct     78240
     tcagaaaaat ctccttgaga catcaaataa ctgcttaccc cacgtcgaat agacgtagta     78300
     agtgggtgga gctttgtctg ctggtctttg agtaattctg agtccgtttg tgcggactta     78360
     tgtccgtttg tgcggcctta tgtcaattaa agacggttgc gttccgttct cctcgtttct     78420
     ctctgtcgct gctggtcgca ggataaatta actagtgcca gttcgtgtca aagcgatcgc     78480
     atcgcatact atgtcctata caggcttaga aaactagcga catcagcttg tagaaggcat     78540
     acaaggcaag gatggtccag aagaacaaga aaaggaccag gttgttggca ccgaatttgt     78600
     acacgtacag ctcctgcagt tgctgcaagt attgcacgat caccttccca gaaagcttag     78660
     attcgccctc ggttctgaca ccaaacgaga atggcacttc gccaatagcg ttctgtcttg     78720
     gcaaaggcag cttaacaagc agatccagag cgattttgaa gccctgagcg ttaatctcct     78780
     tggcatctga gttcaacaaa tacttctttt gtaggccgaa aaacccgctc atagggtcag     78840
     aggcagtcgt caatggtctc gccatcatac gggcaccgga ggagatgacg cggcggtaca     78900
     gtggccagtc cttgtcaata ccaacgcctg gtgcgtatct ggtacctaga acaaaagcat     78960
     ggtttctcag aacgtcaaac aattgaggca cgctctctgg aggatgctgc aggtccgcgt     79020
     ccatgcaaat taggtattgg ccctgagccc cgtggaatcc cttcaagaca gcagaagaga     79080
     gacctctttc atcggttcta acaatgattc taacattgta gccctgcttt tgcagcgcat     79140
     cgacttcctc gacggaacca tccttagagt tgtcgtcgac aaaaatcagt tctgtggttt     79200
     tagaaccatc gttacccaga gccgcaaaca gccttgtggt cagtggctta atgtttagtc     79260
     tttcgtggta agcggggaca attacagagt tttcaatcgc cattattctg tctgtgtttg     79320
     tttggtgaaa gaagctcgga tgtttctgtt gacgtgtttc tgcagttgtt ttgtagtccg     79380
     atgtatgtat ttttcacggt gcagaaaaag caccgtttca tgtgaccatc agcctggcgc     79440
     ctgggccgtg tgacttggga tagtagaaaa gagtgactga aaggcctagt ttcgaggcct     79500
     gagcacttaa tgcactaccg gtatcctata gctcgttaaa gaggttgtaa aaacatcaag     79560
     tcttttaaaa tttgcaacac tctatatgga ggcacgaatt tgttgataga agctcgcgag     79620
     cactactttc ttgtagaagg cagctcacag ccggcaagcg cctcgaaaag ctttgatgaa     79680
     cactttaata gaccctgcgc tctgcagttg ttgcttgaaa tttatagcca agacaggcgc     79740
     cgaagtttcg aaatattaaa cttcctagca cctgatgcat ggaatagatg ccacatgact     79800
     gtatattcag tctgcacttg aggagaagcc ctgtccttct ttcttttgcg ttccgtgttg     79860
     aagagaacat actgtttatt gctcagctcc agaattcacc tttatccgct ccatacatac     79920
     tgctaaattt aaataatgat tttgacatga aaacattaaa ctctacacgc cgagcaaaga     79980
     aggaagtagc acaatcacgt attgaaagag ttcgaaatct taaaggttag ccttataaaa     80040
     ctaatagttt gaattaccgt taaaactatt atacagaagt gccagcccgt ttcatatgtg     80100
     tggcaacggc tgcgatttgt ccaacgcccc tggcatctta acattggagt ccaaagtaca     80160
     ttgactttac tagctttgct ggtcaagagt ctgtggttcc tcttcttttt tctgcaggtc     80220
     ttcacctatc cacagcacat tgttacatct aataaagata tcgcctattt tcccttttga     80280
     ctggccttct atgaactcct ctgcctctgt aagttgcaga ttgaagtagt tatctgtaga     80340
     taccagtagg cccttgtact gcgtcttgtt gaacttcagc gtcaccacga tgggcttgtt     80400
     gatgagctct cttaagaaag gtttaggatt cgtcggtgcg agctataaga aaagttagta     80460
     actgtagtcc aacggaattt ctttccaaaa ccagatttgc acatacttct gacattaatg     80520
     tattcgagga tgatgagctt ggggtctttg ccctagtttg gtgagatggt tatttctaac     80580
     actaacaaaa gatgtatcaa tgatgctacg tatgatggga tatactgatg aattaaatag     80640
     cgagcggcga acaaacaagc gcgggcgcta gattggggtc agtttcaagt tcaaattagg     80700
     tttgcctttg tcgtactcga tacgcagcat agcccaaacc aggtccacca ggacagttgc     80760
     caagcctaac gcataaacaa gggaaatggc gtagaagaag ttgctgttac cggagcctaa     80820
     atccacccac aagtggtaga agacgggcga aagtaccgag acatggatga aaagtagggt     80880
     agaaatgact gaatagcgga agtacccgaa caagggccgg aaaaatggta caaaactcag     80940
     gagaaaacct ccctcgccca aggttgggta tgatttagtt agcgttatcc agcacaaaca     81000
     aaggatgaag gcatagaatg gctgtttgtg gaacctgagc gagaaaggga tgatacacga     81060
     cacgataaaa aggttgaaga cagctttgaa gaaggggata aacatttcga atagctccac     81120
     aaagaagtac caccaaagcc ccaagttagg gattatcttg ctgaaggtta tgataacacc     81180
     ataagtagag aaaaggtagt tccagttttc gtcgttaatt ttgtaacttg aaagtaggag     81240
     acccgccagt gtagtaaagg tgatagccac agtcttgaac ctgtcctttg gcagcagggt     81300
     caatatgggg acgagaagca gtagagggta caaggacagg taggctgcaa ctgcaattga     81360
     ggcggcggaa agtacagctt tgccttggag tgcgctcaac agtgcggttg agatggctaa     81420
     gttgctgaat accaccgtag acctcgacac agaggataac aacaccagtg ggtttattac     81480
     gtatagggca cctggaaccc acgcaggtaa atgcaggttt tggaaacact tggccattgc     81540
     aataagctga tatgcgatcg cggagtctgc gcatgtgaac aacagtgaga tcaatgtgtt     81600
     gctgttgaaa gtggacatca acgccaccaa aagcggagcg tggtgcatta cacctcccga     81660
     gtaaagcgga aagtcatttt gtagaagaaa tacaccttct tgtaaacttc tgaaggatgt     81720
     aacaggtgtt gagaattcaa cagaccggtc cagctgctgc tgaagtagcg ggaagaccgc     81780
     tgccgcgccg aatcttgacg ccaggcatgc aaacacaact tgcagttccc tcaagttcat     81840
     cccggatctg cttttgtgtg tatgcggagg tgatccttgc ttattttggc gagaacctca     81900
     tcttgaaagt gtgtttttta tttaacgtac gatgctctca aaatgtcaac acctcaaaag     81960
     aagcctgtga tggcctttgg gctgaagagc gaaaagattt ggatgggact gggtccggga     82020
     tgcgaagtga gggggtagga gcatcgcgtt ttaccaaaag ggggcctgcg gctgctttcc     82080
     acgcattcct gactgcgctc gtacgtatgt atcaaaggga cgaatccgct aagaggctca     82140
     caatgccgac agcagccggc taagaaccca ttcagtggca gccatgactt gtgctttcag     82200
     cgaggacggc gcctgttttt tacgtgggag aacggcccag tgatgcggcg ttgttagaca     82260
     cttggcgaag ctcgcgcttc agggacaggc gcccttcata tgattgcact aattaaaggc     82320
     agcatatttg cgggccaaaa ctcaagatgc atgcgctgaa actcgagagg agcgcgcctt     82380
     ccgacgaagt gcaaattaac ttaaggggcg gttgggcggc ggcgtaagca aaggtttacc     82440
     agtgtttctt tctgtcagtg gcgagcgcga ggccgctaat tggatgggga cagcagaaga     82500
     gccgctagtg gatagtatct gcttattcgc tatgccgggg gtctctgcgt tcggagtctt     82560
     ctcgatggcc cattatgtaa tagcccggct ccgtcgtacg aaggcatgtg ttgcatatgg     82620
     gcctcgcagc ttccgctgcg ccagaagcct catcgcacta cccaggcacc atgcacgtca     82680
     tacgcgccat actactggac cctcaatcgc ctccccgttg tgcgaggaat caggaaactg     82740
     cccgagccat aaaaccaaag gaaaccatct ccattacaag agacatgctt cgaaggggcg     82800
     gccgcaactg gcccagcatg cgccgtcttt gcgtctcgca acgtaaacac tactaaaagg     82860
     cccgaagcta cgaggccaga ttaaattctc tctgatgttt gacatgatat ctaaacgtcc     82920
     cgactgcagt gacgaacact tggactcagt gtctaccgcc tatcgaccga aaatcctgct     82980
     ggcccacatt ctcactccga ggacctacta caactcaccg gcccttttac gtgtctcagg     83040
     tcttctcgtg cggcgctaga atgaggcacc agcggctaat actgtgaaat acaaacatgc     83100
     cagctagagc acgtgagaca ttctagttat cgtcaggaac gaatacgaaa cgtggcattg     83160
     aaagggcctg cttcgcttta tgctctccaa aagacggccc atttggcttg tactttacac     83220
     ggtctagata gcgccgggca attttgctcg gagagtcgcc gcacatacta ggttttctcc     83280
     agaaccctta atagctattg acggcggctt tgtgggctca gaaggggaga ggcaagtggg     83340
     ttggaaaact atataaagag acgcttttga gccaccgagg acgttcctga ggttccctac     83400
     aatactgtgg aaactcatgt acagtacata aagtaaatag tgatcactgc cccgaggaga     83460
     tgcggcttca agtacaaaag cattccagtt gttgagaagc ttgcgctggc aaggtacagc     83520
     gtcgcagcct acatcagcgg aaagatgttt atttggcgct cctgaatggt tttgtggccg     83580
     gcgatgatgc tctggagggt ggactatagg ggatgcgggt tgcggtgctt tttaaaattc     83640
     aacccacctc ggcggctatt tgaaagactg gaaacgctaa ctgcgcaagg tttctcatta     83700
     gagccgactc gtggactact gaactgccgc tccttcccct cacaagcgcg cagctcacta     83760
     cattttacgg ggccgtcaca ttgccgcgcg agcccagcaa gcgcccaggt aaacagagct     83820
     gcaagaattg gacattgagc gctcccgatg gctactgaca agtttccttt cgtcggcgac     83880
     cgccgtggcg aatgcagctg cgctgataac agggaagccc acagctgcgt ttcaacgtcg     83940
     ccgagtgcac tataacggaa ggcctactcg agggctgtgc cccagctcgc agcagaaagc     84000
     tcctgggagc ctatttcgca gcgaagaggg ccctgttctt agcattccgt ggtcccacat     84060
     acgccaactg cagcgtatag aagatctttc tcgacccaga tttcaggttg cgttcaaagt     84120
     gatgcacagg gtggcaaaac gacaaagcat ttttttcaat atcaaaacat acacgtacac     84180
     aacggaacag atcaggagaa aggcgtcaaa aggacccaca taggagccga tagccgcact     84240
     agcactttgt tttgaaccaa cggaagttgt gaaggacaga aataaagctc tttgtgacct     84300
     cagggacagc aattgagact tacaagacgt gcctccacct caaccttcga gaatcatgga     84360
     ctttgagacg aacgaagaca tcaacgggat tcgtttctcc tggaacgttt tcccctctag     84420
     ccgcactgac gccaacaaga atgtggtgcc agtcgggtgc ttgtacacgc cgctgaagag     84480
     caaggaagac ctaatggtca tgtcgtacaa ccccgtggtt tgcggcggtc cccagtgtaa     84540
     agcggttctg aacccatact gtgagatcga cctgcgttcc aatgcgtggg cgtgccctat     84600
     ctgtaactcc aggaatcacc tgcccgcgca ttatgccaac atgagccagg aaaacatgcc     84660
     tgcggagctc agcaacacca ctatcgagta catcaccaac agacccgtcc aggttccccc     84720
     agtctttttg tttgtggtcg acataaccgc cgaggaggag aacttgcagg cgttgaaaga     84780
     gtcgatcatt gcttcgctgt cgctgcttcc ccctaacgcg ctggtgggcc ttatcaccta     84840
     cggaaacgtg gtccatttgc atgacttgtc ttgcgacacc attgacaagt gcaacgtgtt     84900
     cagaggcgac agagagtatc agctgcttca gctgatcgaa atgttgaccg gcgaaaagtc     84960
     cggtgttgca ggtgctgccg gaggcgccgt cggtgcgaac gctgccctca acaaaattac     85020
     ccctttctct ctcaacaggt tcttcttgcc acttgagcaa gttgagttca agctaacgca     85080
     actgcttgag aacctgtctc ctgaccagtg gtccattccc gccggccaca ggcctctacg     85140
     tgccacgggt tccgctctta atattgctac tctggtcctg caaggctgct acaagaatgt     85200
     ggcctccaga atcatcctgt ttgcttcagg tcccggcact ttagcaccag ggttgatcgt     85260
     ttcttcagag ttgaaagatc ccctcagatc ccatcacgat atcgactccg ataacgccaa     85320
     gcattacaag aaagcatcca agttctacag catgttggcc gacaggatcg cccagaacgg     85380
     ccacaccgtg gacatctttg ccggttgtta cgatcaggtc ggtatgtctg aaatgaagta     85440
     cctcacagat accacaggcg gtgtgcttct attgacggac gctttctcca catctatttt     85500
     caagcagtca ttcctgagac tattttcaag cgatgatgaa ggctacttga ccatggcgtt     85560
     taacggcaac atgtctgtga agaccagtag ggacttgaaa gtgcaaggtc tcattggtca     85620
     cgcctcgcca gtcaagaaga cggatgcgac taatatcagt gactcagaga tcggcgtggg     85680
     tggcacatcg acttggaaaa tgtcgtccat tactccaaac cactcttacg ctgtcttctt     85740
     tgagattgca aacaatgctg cggcatctgc cggtgttgtc ggcggtgaca ggccaaaatt     85800
     ggcatacact cagtttgtca cctcctatca gcacgcatcg ggcacaaacc gtgtcagagt     85860
     gaccactgtc gctaaccagc tgttgccatt cggatcccca gctattgccg cctctttcga     85920
     tcaggaagct gctgctgttc tgatggctag aattgctgtt cacaaggcag agtctgatga     85980
     tggtgccgac gttatcagat ggattgatag aactttgatc aagttgtgcc aaaagtacgc     86040
     agactacaac aaagacgacc caaggtcgtt cagactggct ccaaactttt ccttgtatcc     86100
     tcaattcacc tactacttga gaaggtccca atttttgagt gttttcaaca actctccaga     86160
     tgaaactgca ttctacagac acattttcac gagagaggat accactaact ctctgattat     86220
     gattcagccc actctgacgg ctttcttcat ggaagaggag cctcaaccag tactactaga     86280
     ctctgtatcc gtcaagccaa acactatttt gctgttggac acgttcttct acatcttgat     86340
     ctaccatggt gagcaaattg cacagtggag aaaagcaggc taccaagatg atccacagta     86400
     cgctgacttc aagtctttgt tggaggagcc aaagctagag gccgctgaat tgcttgttga     86460
     tagattccca ttgccaaggt tcatcgatac tgaagctggc ggatcacagg cgagattctt     86520
     gctgtccaag cttaacccat ctgacagtta ccaggaccag tccgcgggtg gctcgactat     86580
     tgtcctgacc gatgacgtct cactacagaa cttcatgttg catttacagg aggtgacggt     86640
     tagcggccaa acatgagaag ttgagcattc tcataccacc actctaaaca aagttcagtt     86700
     ctctttcttc ctctctaata aaacgaaaag ggaagcgcag gccttacctc attgtataca     86760
     ttaaaactag aaggatcaat aatagaaccc tcaagtagga aaagcacata ccaagatttt     86820
     tgaaacactt gaccacgtaa agaatttgta ctatatagcc ttcctgccgc tgtgaactgg     86880
     ggtggctgaa cttttgattg cagaggggtg aagccactag agttcgaata tatgcatatc     86940
     taatgatatt ccgtccaaaa caatgaagtt gttgaggggt gactgcttct tgccgagaat     87000
     gtttataacg tcctgcgcga ctgtaccccc aattactgca gatacaggtg caaactctag     87060
     gcccgcttgt tgtgaaaact gttcaacgta ttcttgtttt aggttttcgg aggggagtcc     87120
     aagctgcaca caggcgtcag ttgccctttg ttccagatca tgcctggtca cagcagcgta     87180
     tccatctctg taagaaaaca atgcgaaagt cagaggtact gcgttcgtga gccttttgac     87240
     ctgtcttttt gttagtttgc ctttaagagt tccctctttg agaacttgct cgaatggttt     87300
     gtaggcattc ctagtgacaa ttctctcgta aacttccgac tgttcttcat taagatactc     87360
     tgtgacctca acaacttcac ggttttgtga taaggcgccc aatggcgtct tgactgagct     87420
     ctttagtttc tcatctgttg cgtcgaatcg aatcaagtcc acaaatatga agccagatag     87480
     tccattcaaa ccacatagga agaaaggaac attaaactta cgtgtaagct ggtttactct     87540
     gatcgcttct tccgtggaga catccgtggc aataataaga tcaaactgcc cgtagaagga     87600
     atcaggcttt tgcctgaagt cttcagtatc cacagtcaag gtaacacgtg gattcatatc     87660
     ctgtatccgg ctgattgcag agtcgaggcg tttagtaccg atctcatctt tgctcaagaa     87720
     gaattgtgtg ctgaggtccc cttcactaac atcgtgatta tctaccagcg agagaaaacc     87780
     gaccccgctg aggactaagt ttttagcaat ttctgtacct aaccccccaa ggttaatgag     87840
     aagaactttt gcgcttctca ttctggcctg cgctgccatg ccccacagcc taatctgcct     87900
     gtcatataga gcgatttcgt ctttcaaagc gcctcaatgt cagtaaagct tgaactcaaa     87960
     attgctcata gattccggag ctctaaaaac taaacttaac ttaccatcgc tcaatttggc     88020
     cttctcggtg tccatatccg gcaaggtaat tggtttccta tacaatttat gtcaaagttt     88080
     aagcttcggt aaatcagtga aaaattcgat gccttaaatc ttataaactt cctcgaactc     88140
     acattacctc aaattcatca aagcgaaggg acaggcgcca tggacttagc aaaaatatta     88200
     gatacagctc cggagccagc gatagtggat gcgcagacca tgggcgtttc aggggatgtc     88260
     tccggagact actggttacc agcgccaatg tgcttatatc aaaaagagct gagcgagcag     88320
     atagtatcgc tgcattattc cgatatcttg aagtactatg agacggaaga ctacaacact     88380
     gatgttgtct tacactcgat gcagacaatg tgcctcaata gcgaatacgt tgcaacccac     88440
     ccatatttgc taatcgacca ttgcgtaccg aagtcgctga ttaccaaaga cattcctaat     88500
     catctggctg agacaagcgg caagtttgct gttcttaaag acttgataac cttaatccaa     88560
     gactacgaga ctgaaacagc cattgtgtgt cgatccggcc ggacgatgga cctcctggaa     88620
     gcactattgc tgggcaacag ggttaatatc aaaagataca ggagtccctc aatcaaaaca     88680
     aagcaaaagg ccagaaagca ttcatgcaca tgccacttgt ttccttccga tggcttcgat     88740
     gaaacatctg ggttgccagt cgacccaaag atatactttg atcttcttct ttgtcttgat     88800
     ccaacagtcg atacctctat gccccatatt cagcagattc ttactcaggc gaggccttca     88860
     agcggaccag ggaagcaagc accaatagtg agactaacga ctattaacgc tattgatcat     88920
     tgtgagctct accacagtaa acttctcgat ccaaaaagcc gtgaatatct cgtcagggtt     88980
     agcgctgctg ttgttgtact tcgagacgtt gtcggaactc tccctccaga tttacgtcct     89040
     atttactccc aaggtttaaa gtaccttgta gagtggctgg aagacccaag tattccgtgg     89100
     ccgctacccg acatataccc catcaaaact ttcactccca tggacgtgga aaaatcacta     89160
     ttaactgaag ttcgtttcaa ccaagctaac gaaaaccttg ctcatgtatt caacaacgga     89220
     aaaaagcgcg gccgcaagcc taattcagcg tattcaaagg aaggcgagcc catatcttac     89280
     tatcaatcta aaagattaaa gaacgactac tcaacaaacc cgctcaagca gaacatggca     89340
     cagttgactg ggatcgccac gattaatgat ggagggtctg tcaattatca cctttctggg     89400
     ggccttctca cacacaagct aattcaatca ataggcgagg cttactacaa tcttgacaga     89460
     caatctgctg aactgcagaa ttttgaaaca aaagagcaaa atcaagttca tcgactagag     89520
     cttgtaatga aagagcatga agacataaaa aaccagctag agcccgctat caaagcacaa     89580
     gattataatc gagaagaatc cacgagacta ttggcagtcg tagaagaaga acacaagaaa     89640
     gttgcaagct ctatggaaga actagatact tacacggaga cgctacgaga aaagagtccc     89700
     gacttctcga agttaattga ctgtctattg gagattgcca aagtccagga ggaaattgaa     89760
     aaacaacaaa agctaaaggt ttcgagaaac aatgagcaca catacatgac tgaagaactg     89820
     cgacgggcta atgaggctct ggctggattt caagcggaga aagctcccat agcagaggaa     89880
     acgcagcaac tagaacaaaa aattgaggag aagctggctg aggacagaat ccagtctcaa     89940
     aaatctcaag agagaatcca gaagctgatg gcacaaataa acgacgaaaa agccatattg     90000
     gagacactgg ataagcaagt ggcctctatg acggaacagc tgaagaaaac gccaccgtcg     90060
     aaagttcgct cttctaacaa tgcgcagaga ggtaagcaca gaaagcactc gggcaactct     90120
     tagtttagga attacatact cctagtttcc ataacttcac agacctatcc catccactac     90180
     tgtacaggtg tgaaaaatcg tgcgatatat caattgacat gaccttgtca gtatgccctt     90240
     tcaaagatgc taaccttagc caactatccg atgcgaagac acttacagtt ttatcgtagg     90300
     aacttgaaac caaggttctc ccgctaacct tatcaaattt gacatccgat acaatgttat     90360
     tgtgtgccaa aattgaaaat gggttgccaa cttttcgtat atcccatacc ttcacggtgc     90420
     cgtcggcgct acctgtagca acatgatggc cattaggaga ccaactaacc ccatatatag     90480
     gcttggcatg tccttcaaga atcatcaatg actgccccga ccgcatgtcc cagatgcggc     90540
     ctatggagtc gagccctgca ctacacagca gtgacccatc acactggaaa tctaagcaat     90600
     aaacttcttt tgcatgccct tcttgcagtt gcaactcaac ttgcctctca acgtcccaaa     90660
     gtctccacgt catgtcaaag gatgcgcttg ctacgtacct gtcgctgggg tggaatttga     90720
     ccttcacgac ccttccttcg tggcctttaa gcacggcagt agaatcgttt ggtgaagatg     90780
     gcttccaaac cttgactatt ctgtccgcac cacctgtaac taagagcgtt gagtcagagc     90840
     tccagtccaa gccgccaatc ttatcgtcgt gaatcgcatc gaagctggcc aaaatctcta     90900
     acgtttcgga gtcgatgatt ttgacgtcgc catgccagct tccgcacgcc accgactttt     90960
     gatttggaga cagtaaaacc ccggagactg gtctcgagga cgcaacttga gatccccaca     91020
     gctcatattt agatagctcc gcatttagct ttcgtctctg aacaattgtt gtgctaacat     91080
     cttgcgagtc agcgtggcct ctttcattac gaagcctttc ccgtgctcgc cccaacgaat     91140
     cctgtatcag gaactgccta cactccacta gcgacccact ggccggcgta taaaactctt     91200
     cgtcttcgct ctcacttgcc tcgctaggtc ctgtctccag ggaagggctt ttcgcctggc     91260
     gttcgaggaa ctgggcgcga atatctggat tttggtacag caggtctgaa aggcgatcac     91320
     gcctgtctct gttgctttca ttttccagtg cttcaggctg cccgaggtgt actaagctct     91380
     ctcttacctc tgtatcatca gtggggacta tcgtcagctt ctgctcacga tcaaactcta     91440
     agctctttaa tgtatcatct gctttcttgc ccccatcttc cacgatatag cttgtatcca     91500
     cgcgaatttc atcaaacgag atagtgcctt ggccattcat agagctatgc ttggggaggc     91560
     gtttctgttg ttaagttata ttcggtgatc ttattacttc tgatcagctt tctaatatca     91620
     tgaagaacag cagcgatggc ggacttgaaa ctgaacaaag aaagccatgt tagctacatt     91680
     aagtcactag attctaagcg acaagattat gaatactggc tgtcggaaca ccttcgcttg     91740
     aacggtgtgt actggggctt gactgccttg tgcctcttgg acgccaagaa tacattcaat     91800
     aaacaggaga ttattgagtt tgtaagaagt tgctgggacg ccaagaccgg tggattcagc     91860
     gcctttcctg ggcatgatgc acatatccac actacactct caggtattca gattctggcc     91920
     acttataacg cactggacga ggtcttagag ggtgaagcac tgaaacagtg catctctttt     91980
     attaaagaca accagctgcc cgacggatct tttcaaggtg accgattcgg agaggtggat     92040
     gctcgatttg tgtattcggc actgaacgcg ctgtcaattc taggggagtt gactccagaa     92100
     gtggtggacc ccgccgtagc tttcatcaag cgttgttaca acttcgatgg tgggtttggg     92160
     ctatgtccag gagctgagag ccatgcggcc atggcattca cttgcatcgg agcgctggct     92220
     attgttggaa agctgggcga actttccgcg gaccagtttg agaatatcgg atggtggttg     92280
     tgcgagcggc aggtgccgga aggaggcctc aacgggcgtc ccagcaaaca accggatgtg     92340
     tgctacagtt ggtgggtcct ttcatcgctg gctatcatcg gaaaactgga atggataagc     92400
     ttcgaaaagc tacgcgagtt tatattgaag tctcaagacc ccaagtccgg aggcataagc     92460
     gatcggcctg acaatgaggt cgatgtcttt cacacgatat ttggccttgc agggctaagc     92520
     ctcatggggt atgatggcct tattgaaatc gaccccgtat attgcatgcc aacctctgtg     92580
     actaagacct tcaagaaata tccgtattaa aatgctatta tatctaatag aggttaaaag     92640
     taaacctctt ctcgaactac ttttctagag gaaggtcgat actcaacata tctcgctctc     92700
     cttttatata gaaaacttcc aacgttgaca gacttgcagc cattataagt aacttcgaac     92760
     tgtgaggccg tagtatcaca gataaccata agactaggaa tgggcgtgag atgtaaagtg     92820
     tgatcgagat tccatattac aggcctggta gaactgacaa atggggatat gtgtccttgg     92880
     tcaaggatgg tttttaccaa tcttcgtgat tcttgaacgc tggcagctaa ttgatcttgg     92940
     gacttgacca gttggtcaat tccttcgtag ttgtcattta actcaggcat taaggcatct     93000
     tgtgcaaggg cagaatcagc aacttcgcct ccgtactctt catcatccat tatggcggga     93060
     aatgcaatat tgtgacgctt gaacctaccg ttaatatcat ccctcactaa aatcagttct     93120
     tgagagaggt aggcaacccg tgtaggatta gagccccagt ggatcttttt gcacactcta     93180
     ttgatacgtt gagcgaaaat tccgggaata ggtttctgag gccacacgcc agcagttcct     93240
     aagctcacag tggaagacca ggggtcattg ttcccgggta taaagacaaa tgttgtctca     93300
     tttataagtc gctcgaagtt caaaagtagc agtgctaatg cgtcgaaatt gtttttgtag     93360
     gccgatgtgg cgctgatatt tttgctgctc attactggga aaaggggagc agaactgaaa     93420
     gaaccctgaa ggaccatcat cgttggcggg tccccctcta acttggcgaa gaccttgcgt     93480
     agtgcttcta gaatttgagg ttgatccaag aaaaggtcac cgccgagaaa ggcaaatcta     93540
     tggtctgtca attccctttc caagaggtgc atccgaatct taagatcctt gtcgattctt     93600
     gatatgtaat tggggctcga ctgctgatga acccccagca ggtccaagtt gccaatggcg     93660
     tccatagttg cttcccttct ttcaccaggt ggatgcgcca gtgatgcgac gtgaaactta     93720
     tgcccagctg agaaatagat tccctctgcc aacagtatac atcctgaaac gtaaaatgta     93780
     cctaccgtag ggatggcttg ggacaaatca acttccacag aaccggaggg atcttctaaa     93840
     gaccatccac ctttgtagtt cggtctgagg aggcccaaca acaaaaagct tctgccgtct     93900
     cttccaagca ggtttttgat ttgagtgata gtcatgtttt gggaagagaa actacctggc     93960
     ccactgctca ttggccctgc aattgatgaa agaggattga aagtgtcgcc atgcccttga     94020
     aagagatcat tcctcattac ccgatctttg accacatggt atcgattcgc aaacatcgct     94080
     acgttcgatt cggcctgggg tatcaccttt ctagcccgct gccctttgag gcggtactgt     94140
     cttgtcgtgt ggtcataaat aaagttttgc tgtgcgaaag cgtcgataat tttgaagtga     94200
     tcttgccagt caaggtctcc ggagtcagta ggcaaggcag gttcgtcaac ttccattctc     94260
     tgtgcttcct ctgtgacatc tgtaacatct tgatcaacgt ccggagctac cagagaactt     94320
     ggcaagatgt tctgctctgc tgctgagggc tggcggtttg ccaaaaagtt gtcgagagtc     94380
     ttcggcctca cagaagactg tgattcctct ccagcaacct ttttcggaat ttgactagct     94440
     ttggaccgct ctttaacttc tttgatgacc tcctcaactc cgaccctgtc aatgaaaagc     94500
     cctctctctt gctgatccca aatcgcagca aactgctcta ggaatttgaa tgttccgcta     94560
     tccttcctcc agttcatgcc gaacctgttt cctatgtagt ctgccaaagc tgctagccca     94620
     tcggatttga tattcaatcc atactttttg gataaaacgc gatacgcgag cggtctcagc     94680
     agcccaggct gaatcttcac tggcagtgcc acgaccggat ccattgctaa atctcagaag     94740
     tctctcaaga ctctgttttt atcgatgacg cgtaaccttg ttcatcaact aatttttgat     94800
     atacatcata tactcacgcg tgcgcatctc ttgacaacta acatagaaca acaaacacac     94860
     gtgaagataa acagccagct aacataggct atctctgaac acttcaggcg ttgtgaatta     94920
     ttacagacgg gcttcattga tatctttgag tgcttcgtgt gatattcgag tgctcattaa     94980
     agccgaacgt cgagcacaat ggaagcagca aagaattact tcaagagctg gttcaacgca     95040
     gacgagccgc gcaaggttga gcgcggctcg ttagacaagt ggcgcaaacg gtcacaaatg     95100
     cttgatgggt tgggtggccg cggcgcgcga agaggtcgaa cttcggtcac gttgaggaat     95160
     aagacgacgg gcaaaagcct gaggcccaag agaacagcgc ccgggatctg gaacctggta     95220
     aagggcgtgt tttccagaga ggaccaggat ctacgcgaga tgaagaatgc atacacagcc     95280
     cttaagcttc gcagcaataa tcgcggcatg cagacccggt ctcaggttca aaggcggatc     95340
     gcatccagcg cagctctgaa acgcaagctg ctcgaaaaac aatacgatga aaaacgcctc     95400
     gatgagctgc ggcggggccg caaaccgggc cccagggcag ttgcccttga gcctcgaaac     95460
     atttctcagc ccaattttga cactgaccga gtaatcttgt tgcagcacaa ggtggacgca     95520
     ctcaaagaac aactgaatga ggtagagcgc gagcttcact tgactcgcaa gaggctcaaa     95580
     ttcactcagg agaagaacgc acttttggag ggccttctca acgatgccaa tgtcgatgac     95640
     gactacttaa aatcgagaag gcgcatcacc aacctacaaa gggaggacct aaaacccgaa     95700
     tacgatgcgc tgccaccgtc gccgcatcgc gctatcagtc cgttggtcac ctcaagtcct     95760
     agaaaggtag agctcccgca agacgacttt tatgagagat accgctcaat tccaaccgca     95820
     gaactactta gaagagaccc tgaaagctct ctgtccccaa ttagagtaga tttatcgaaa     95880
     tactcatcct ctagggctcc ttagaggtca aaacagtgcg tggttgagcc aagactcgag     95940
     agccagtgat gaggttaccc ggatgtatct caaactagtc cagaactgcc acatgataag     96000
     gagaagttga gcaagaacca ggaagtaata ggttaggttc ttgacaacag taaaggagca     96060
     cgccgtggcc caagacctga atgctcaaag gttacaatag gacccaaaaa ccatcttact     96120
     agtttgaagt ttcaagtgtg cataattgat gagtacgggc gattttctga cgaaaggaat     96180
     tgggttgatc caaaaggcta ttgatctaga cacagcgacc cagtatgagg aggcatacac     96240
     cgcatattac aatgggctgg actaccttat gctagctctg aaatacgaga aaaaccccaa     96300
     gtctaaggac ctcattagaa ctaaattcac tgaatacctc aaccgcgctg agcaacttaa     96360
     ggaacacctg gaggcaaaag aggatacaca aaagagcaag aaagactccc cggcaaaaaa     96420
     gaccagtgca aactccaatg atgacgacgc cgacgacaag aagctgagag gtgctctttc     96480
     gggcgcaatt ctgaccgaaa agcctaacgt tcggtgggaa gatattgctg ggctcgaagg     96540
     agctaaagct gctttgaaag aagctgtgat tcttcctgtt aagttccctc acttgttcac     96600
     aggaaaccgt aaacccacgt ccggtatttt acttttcggt ccccccggaa ccggtaagtc     96660
     gtacttggct aaagcagttg caacagaggc caactctacg tttttcagca taagttctag     96720
     tgatttagtg tcgaagtgga tgggtgagtc tgagagactg gtaaagcagc tttttgcaat     96780
     ggctagggaa aacaagccct ccatcatttt catagacgaa gtggacgcgc tgactggcca     96840
     gcgaggcgag ggcgaaagcg aagctagcag aagaatcaag accgagctcc tagtacaaat     96900
     gaacggtgtc ggaaacgact ctcaaggcgt tctcgtgctt ggcgctacca acatcccatg     96960
     gcagcttgat agcgccatca ggagaagatt tgagaaaaga atatatattt cgctgccaga     97020
     cttagccgct cgcaccagga tgttcgaact caacattggc gaaactccct gcagccttac     97080
     caaggaggat tacaggacgc tggcgcagct cacagaaggt tactctggta gcgatatagc     97140
     agttgtggtc aaagacgcgt taatgcagcc tattcgtaag attcaaaacg ccactcactt     97200
     caaaaatgtg tctgaggatc ccgagcatcg caaactgacc ccttgctccc caggagacaa     97260
     ggacgctatc gagatgagct gggttgacat cgaagcggat gagctacagg agccagagct     97320
     caacatcaaa gacttcctca aagccatcaa gacaacaaga cccactgtca acgaggaaga     97380
     tctgcggaaa cagatcgagt tcactcgaga cttcggccag gaaggcgatt gacgggtcac     97440
     tcgcgataac tcatagactc aaattaatgt cataatacat aaagcggggt ttaacaatac     97500
     aatatttagc gcataccagc gtacgaaaac tttcctcgac gtcggacgct ttagtcgtag     97560
     aagctagtgt tgttttcacg gtcggatact tttgcgctct cgagcctcac cttgaccacg     97620
     gccacgttct ggcctttggt gtatacgccc gcgtcaggat tagctttgag aagcgcttct     97680
     tcgtagtatc tgaattcctc actggatggg tcgacagctt ccgcgcgccc cctcaaagtt     97740
     gcgctcatct gcgaaagctc ggactggttc aattcctgaa gcaggttgag cagtctgcta     97800
     gggtggtctg ggttttgggc ggcagcggct gccgcggcgc tctggggctc tggtgttggc     97860
     gtgttggaca tgctgctttt acgcaaagac agctttttgg cggtgaccca gtcgtgaatc     97920
     aacacggaca cctccgggtt ctgagcaatg ttctcatact tctctgtgtc tctttgcgtc     97980
     gccataatga tgtagtggcg tctttcgccc gttgcacctt tctccttgtc tgcaacaaac     98040
     accttctctg gcgagatgta agtgtagttc atcaaagaaa ctgaaggaat gcactccggc     98100
     ttggagcaag tggccaaatg aagatatttg gaagtcttca acaggctcaa aacatgttct     98160
     ggcaggctat cagggcacga cattttactg tttgaggctt tggatagaaa ttgtactctt     98220
     tgccagtttg cgcagaacga ccaaaccctt tttaagctta ataaataccc ggcatcattt     98280
     tctgatgagc aaaagtgacc agggaccgct gtaaatcatg ggttcgaaac ctcaagggga     98340
     cgttaattct tgaatatcta aaacgacttt taagaagctt ggtgcttcta gagagcgcat     98400
     gctgctaccg cggattttgt aatgcattgt tagaagccag ccagatccgt taagtatcgc     98460
     ggcgctggtt gagtttgtcc ttttttaatt ctgctatgac gggagaccag ctggccagga     98520
     tgtcattgca ttcccggtgg aactcggcaa ggttatcgtc attggtaatg accttgagca     98580
     gtttgtgcag tttgctgtgc ttcagggcct cgaagtcgaa gaactgtgga ttggccagcg     98640
     tgttttcggt gatttttcca agaagcttgt gggactcttt gatctcgtca gggccaggtg     98700
     gaagctcgcg ctgcaccagg ttccgctgga gcttgcagcg aaatagcagt gagatctcta     98760
     cacgcttggc atggtctagg cgcgatagtt ttttgaccgc agagggcgac tcgggcatcg     98820
     agcgcgactt gagggaagcg gagcttgatt tggtaccaat gctgccatcg gcgctgccac     98880
     tggcagctct gcgtgctttc gggtaaccgc gcggcggcga tgcggatgca gagctctttc     98940
     tgagcttggc tccgccggcc ttgaggccag cgggccggcc ctcgaatggg tcttgccctg     99000
     cctcgacctt ggtgtccgcc tcagcgctct tctcccactc ctctatcctg ttctcttcct     99060
     ccagcctctg cattacaaac tcgtgcagcg aagtgtagtc ccgagcttct tcgtaggccc     99120
     ctacaagtcc tgggtcctct gtggcggggg cgtcttccag aaaccgctca atcgtgctct     99180
     tcgtcagccg cttcaacctc gcaggcttgt cccagtagta cgtctcatcg ttgaagaaac     99240
     aaactgctac gcactcagcc ctgcgtcgcc tgtacacgtc cttgcgcagc agtcgttgtg     99300
     ggaagaccac cgcgggccac ggcgcaaaag agcccacttt gcacagcact aagtcgcctg     99360
     tagttagttt ctgctccata gagttgctgc taaaacacct agccaaacgc cgctcgacct     99420
     gccgaacctg tgtttacact tgttctctgg ctacttttct cattggttaa gagcctaatg     99480
     tcaatattta attcaaagat tcgggtaaca agctagcggt gaagctcatc gcgcgtttag     99540
     aataagcgaa gaggacgcgc acgggcgctc attacgatcc aagcagcagg gaacgccagc     99600
     cgccagtgtt gggctgattg gttcaaaggt ccttcttgca gtacattaac tacttttagt     99660
     taactttcct tggcgatctg catgtggctc tcaggcctcg aagagacgtg ccgaccgttc     99720
     gtaccggccg ctctgggcga tcggccaccc gttttcaact ctgcggtaca agcgctgctc     99780
     aggaaactgt cgaggcctag cgcgtcgcct gctggcgtgc gcgcaacgtc ttacagcaga     99840
     cctttcctaa cgcgcgcgca aagtaggcgt actggagaag cacgatagtg cactacatca     99900
     cgcatctgga atgctcacgc gttatcgaaa gggtgggttt cgatgttttg ttgatgcacc     99960
     tgtactagcg acgcatgacc atgttcgcga tttaatgcgc ggtctcgttt gggtgcgctc    100020
     gttctttacg cgatctgcgg tagttctccg cgcagctgcc cggcctggtt taatcgaaag    100080
     gtcacctcgg cgggtccgag ataacggtgc acctggcaat atgtgctgtc taagcaactg    100140
     gtcatggaaa cttgtcaatt tttcaactgc tcatcgctag ggaaagagtc atcaaaatga    100200
     cctctcgcgg gacctggaca aaatacaccg acaatgcacc gcatatgccg ggccatagca    100260
     gcaagtatta aagccaagcc tccgcgcgca gtaaggatgc caagaaagac atccagaaag    100320
     ccaaaacgca gacttttaag cgatctgaaa aaggcgtgat tatataatat tcgacaagat    100380
     tatgtcagaa gctaagctcg aggcgctcgc gaccgttggg accagcgaaa aggcttcgac    100440
     tgtgagcgtg accagcagga gatcatataa cggcgatgag ctttcggaaa tacagcagga    100500
     cctcgcgcag aagcacggtg tgaagcagcg gaaattggaa tggaaaattg acatatgtgt    100560
     ggtgccagcg ctggttctcc tgtactttgc agcgttcctt gaccggatca atatttcaaa    100620
     tgccaggctt tatggaatgg aagaagatct gggacttcac ggcaaccagt tcaatgtggc    100680
     gctgacagtg ttcttcgttc cctacattgt tttcgaactg gttgctaatt acctggccaa    100740
     gctgttcaag cctcattggt gcttctcggt aagcatgttc atgtttgggt gttcgaccat    100800
     tgggtgtggt ttcgtcaagt cgtttggtgg gctcatcact gtacgtgtat tccttggggt    100860
     cgccgagtct gccaccttcg gcctaatatt ttacattcta tcgtcctatt acaccccaag    100920
     gcaggcccag aggagattct catgcttctt tagttctgtg actttggcag gcgcggctgg    100980
     cgggtccatc gcgcgtcaaa tttacacagg tatcggcaac aagcaccttg ccaactggag    101040
     atggatcttc attattgagg gcgcggccac ggtctttatt gcgttcctcc tgtttttcat    101100
     cacccccgac ttcccagaaa cagccaaatt cctcaagccc aacgaaaagg catttttgaa    101160
     ggaaaaattg caactatact ccagggtgga atctgggttt gaagtcaagt tcaactggcg    101220
     cgattatttg ccgcttttca aggagcccat tttctacgct aatgcactag catatttagg    101280
     gctccttgtt ccaagttatg gctatgctta ttttgcaact tccatcatca agcttcttgg    101340
     ttacactgcg gtcagcgccc aacaacattc cgtatatcca tggcttgcgg ctttcggata    101400
     cattaatatt gttgcctatc tctccgaccg cctccaaaac cgttggtgtt tttctgtttc    101460
     ttcgagcatt attggaattg ccggtcttgc aatggtttta ggatcatctg caccccatgt    101520
     aagatatggt ggttgcttcg tggcttctct ggggctttat ggcgctactc cggtggttgt    101580
     gtgctggact tctattaatt taggcgggca tttgaggaag tcttttggca cagccttcca    101640
     agttgggctt ggaaatatcg gcgggatcat cgcaacgttt ttgtttctac aaaaagatga    101700
     gcccaaatac acttctgggc ttagcgtttc tatcgggttt gtgggccttt caattatcag    101760
     tcaacttttt attgttttct actgcagctt catgaacaag aaaaagatga cactaacgta    101820
     cattgagagg tttgaagagc ttcctatcga agatcgcgtc ctcaagggtg atctgaaccc    101880
     aaatttcaaa tacctgttat aatgttgtaa cgtttatcac ttaattagta attttacatt    101940
     ttgatctaaa tattgaagtt taagttttaa ctcctttagg gagctttctt ttagggccac    102000
     gagctctgga ctttgttgga tgattaagtt gattgtcccc atctgatgcc cgcggtctcg    102060
     agatatcagt ctccgatgcc gggcgcaaca ttttggctat tttatcatta tcgagttgcg    102120
     ccatgaatgg aattgcttgt ggcaaatgag ctctatttga aagttctgga gctgttcggc    102180
     ttttaccctt attcgcaagt tgcttggcgg caataagggc tgccaattca ctttctgggg    102240
     ctttttggtt gtttgcttcg gttttcgctt tcaaaggtga acctttggat tctacagtag    102300
     gctcgagttt ttgaggtggt ttctcggaga cttcagtgcc ctcgaactgg ctcaattttt    102360
     tagccttgat agcttcaaga cgcttcatag cctcaggcat cgaaactttg cgagatggtt    102420
     ttggtggggg tttgctgaga ctctctcttt tattcacagc ttcgggcgtt gacaccttgc    102480
     gagccggttt aggtggtgct ttgctgaggc tttccctctt tgaaagcgct tcaagagcag    102540
     agactttgcg gggaggctta ggaggtgctt tattcaagct ttctcttttc gaaagagcct    102600
     ccggtgtgga tattttgcgt gctggtttcg gaggcgcttt agcaagactc tctcttttag    102660
     aaagagcctc aggagtagat actttgcgtt ctggcttagg aggggcaaca ttcaaccttt    102720
     gccgctgaga tgcggtttcc gaagcggagc catttccctc aattgagcga gggacagact    102780
     ttagtgattc ttgtccatca aattgagcac tatcatcctg aacctttggt ctcctcaact    102840
     ttggtataac caacttttgt tcatcgcttc taaagccagg ctcacgggcg tcagattttt    102900
     taaaactctg cgcgggtttc aagcttgatc tcaatgaaag gaagcttact tcagcttttt    102960
     catcgctttc tggtactggt tctttttgag gagatttacg ctttggcggg ataacaaagg    103020
     gtttcggact ttgtgccgaa gagtcttgta gcggtcgaga actttctgtt ttgagtacag    103080
     aattcataaa catctggggt gtgtgctgag gcttcgcaat tggagaggga gacttgggct    103140
     ctcggactgg tgtcgaaacc gtgactttat ttttctgaag ggagtccaaa taggatgttg    103200
     gcttgctttg aatcgaaggc ttgctttgaa tcgaaggctt gcttggttta tccagggacg    103260
     ccgtagttag tttgttgttc tcgagcgact ccaagtaaga ggctgacttt ttcagcgtct    103320
     cgggcttagg cggaactggc ttctttgcac gatcgcttag gatttttatg aatccatcgg    103380
     ccttcgaggc ctctgtcaag gaggcaggct tcctaggagg cggttttttg ggtactaagg    103440
     aatccctgtt atcaattgag actgccgtat ttttctgaag cggggtagaa ggctttgtcc    103500
     ccgtttcaac aaccggtgac gcgggcgcag cgcttttcaa ccgcattgaa agatctggca    103560
     cccgcgcagg cttggcgggt gcgacgcttt tcgatggcac tgaaaggccc agcggccgtg    103620
     cgggtttggt tggcgtgcta tcttcttcgc gatccggagg aggaagtact ggcgatgcgg    103680
     cccgtctcgt aggcaaagga ggcggaattt catcattgtc atcgccgtcg tccgcgagcg    103740
     tcacggtcct gacgacccga ttttctcgag gccggccgcg cgaagggaga gcgctgacca    103800
     gagggtcgcc caccgcttca cgtttcagct tctgcagcaa aaggtaatct tgctctgaca    103860
     cagtgtagcg gcgagtgcca tccggggaac tatcaagacc gagcgcaggg gccgagcccg    103920
     catcactccg cctgggcgac ccggcgcctc ttttcggcga gaatgtcctc tcgtagttgt    103980
     acgccgaacg gtatgcaatc tgtggaaccg atccagagta cttcgtgggg gaggttccgg    104040
     agtcatagcc cgtgtagtca ccgtccagca gcctctgggc tctttccaag tcctcaggcc    104100
     gatacttggg cctctgatca tgtgcatccg gcgagcgccg gctgccattt ctcgcgctgt    104160
     ccagccgctc cacccgcgcc aaatagtcct caagctctgg gtccctgaga ctagacgcct    104220
     ctcgctccat gtggtcaata actgatgcta gaaatgcttg tctacacctt ctccgcccgc    104280
     gtccccagga ctcggatcta gcgatttcgt ggtgtctttg aatggaagtg ttgatgtcat    104340
     ctatcacgaa acatatcgtg gattgatggt tttactatac agttacactt tatggaaacg    104400
     aagattgact tgacggactg gttcaacgta gttcaatcgc gggcttcttc ttgccgagcc    104460
     aaatctggga cccacaaaac acgaagaata ctgcgtagac gagcacggcc ataaaaactg    104520
     tgcgtgcaac cctagaaatt gtagttagta ttgaagcgaa tcgtttgaag cggtcgggag    104580
     gccgctccgg agttgggcgt ggaatgcagg gggacatacg ctggtccatc ctcggggtcg    104640
     ttgatggacc cgacgaaaga ctcgtggttg gtgttgaata ggtgagcgat caccgaaagg    104700
     atcacgacac cgaacgccga aattacggtg cagaaccaag ctttaccgga ctgtaaagaa    104760
     ggggagggtg gttagtatgg ggggccagag agaacggtgc acggctggcg cggcacaagc    104820
     tgcagagtgc gagctatcgc gagagagcat actgatacca ctggcttcat tgcgtgtgtg    104880
     tgtgtgtgtg gattcttggg ggagtagttt ctaaaggtag tggaacgagt aaggtgatct    104940
     ttatgtgaaa gttgttctga gggactggca cgtgtactgt tacgatggat agatttttaa    105000
     aaatctcacg ggcatccaac aaggtctctt ggcccagttg gttaaggcac cgtgctaata    105060
     acgcggggat cagcggttcg atcccgctag agaccattct tttatttttt gcttcatgga    105120
     tataggcgct ctgagtgggg aatgcctgct aagaatgcca actacgcaca tgtggtgggg    105180
     acgctagcgg gcgccctccg gcagtggcag tagtaaacct gtaatatgtt cgtttacgcg    105240
     attatattat gtgacaacaa cgggaaaatg tacaaaattt tacagaggtg ttatttactc    105300
     gtcgtcttcc aaggtctggg cggcgatacg gtccaagtct ctctggccgt tctcggagat    105360
     tcttctacca ccctttggag agatctcgac aatgccgatc ttctccaaag cctgtaggac    105420
     ctttctgttg acggagccgg aggcgtcgac gtgcttggaa ggtctggagc ctctgttctt    105480
     ggcgttaccg tacaacttgt tcaacttgcc gacaccgacc tgctttctca tgtagatgtg    105540
     tctggcaacg gaggcggcac gcatgtagaa ccaaccttcg gagtcctgtg gaggcatctc    105600
     gttaccggcg gaggtcttga caatgtcaac gtaacctggc acctccaact taccttgtct    105660
     ttgcaagaaa gaagcgtaag cggtgatgaa gtcttgggct ggaacgtctc tgtacataca    105720
     gttagtaggg ggttcttttg gtaacgcaaa catgcgcaga aagcaggagc ggaacgggcg    105780
     acacaaaacg gcggacactg tgtgcctgga gagcgcagag tgcgcccatg cacagctagt    105840
     ctctgcgctc tctcgtttgt cctcgtctgg taccgggacc accacacgtt aagactggcc    105900
     gcacggaccg ggcctttccg agtagatgat gccgtggcgg gtctcatttc gatattcaac    105960
     ctctggaaac ctctggaaat gctcgcatcg tttgtttcgc ctgttgtcca cctctgcttc    106020
     cccgctgtct agcgattcca caagttcacg tacctaacgg aaacacctgg catctttatc    106080
     ctgttgatct ctggttgact gtgacctata ctcaaatttg ccaaaatgct tatatctttc    106140
     cgtattcgat acaccggtag caggcgaagg ctgagcggcg agagtgcgac acggactggc    106200
     tgcggtgctc cagacaggcc cgcctggagc ccggcgggcg cgggccgggg acctcaagca    106260
     tcgtaggcag gagcgtctgc aagcgtctgc ctggaagctg ggcaggggcc agacggattc    106320
     ccgcgagagg cccctgggct agcagggcaa ggcgtctgcc cacgacatgt gtggacaccc    106380
     acgcaaatat aaaatgggat aaaatttcaa gcggttattt tcagcacact tggtgtacgg    106440
     atgcaagtca aacacaatca gcactaagta cgacagtaac gtgagcacat gatcatggtt    106500
     atgggaggat cattacatat gaagaacact aggaagaaca ggacggagcc tggcagatgc    106560
     gggccagagt ttcgactttt gaatcgcaca gatgtgtgtt tctggtcaac aagcgtgtga    106620
     caggtcatac cgggtggaat tcttcgataa cgcgctctac ggcaggagaa ctcctctcgc    106680
     gtagcatccg agctcgagat ctcttctgcc atctgtctac gaaggtcacg tgcgcagatc    106740
     gttgagcggc tgttcctgcg cgaagcaggc gcagcgcggc aaccccggag actaacgaga    106800
     cgtcgacatc tattataata caagggggtc agcgcgcgac ctcgttctgg tttgcacaca    106860
     gctgttgtcc ttagattggg atttatgtag tttgcaggta gtagtgctat gtaaattaca    106920
     ccttgaaacc tctagatctc cgtctacctc tagccttctc gaacttgcgg cccttagaca    106980
     tgattcttgg agccttgtgc ttgtgaggac cagcaccgaa gtgtctgacg gcctctctgg    107040
     agtttcttgg gcctctaacg atcaaggtgt tctgaccctt tggagctctg acggccaact    107100
     ggtccaaggt gatgcactca ccaccagcct tcaagatggt ggctctggcg ccggcggtga    107160
     atctcaaagc ggcaacggtg gcctttggga actcgaagat tctgttgtcg tcagtgacgg    107220
     taccgacaac gacaacggtc ttgttggcag cgccctgctg gttcaaagcc ttgccgattc    107280
     tggaaacgga gacaggaggt ctgttgatct tggacaagaa caaagatctc aagacaacct    107340
     tgttgaatgg agcatcagta cgacctgcgg aatattagtt agtaccacgg agaaggcgag    107400
     aataaaggtc taggttctgc tcacttgcag ttcgcacggg tgggcctgcc tgctgtgcgc    107460
     tggcgcgcca gagtctggca ctgcaggtcc ccgtactcgc agaacgagtc tcaagccaaa    107520
     gtatccaaaa caataaagaa aacagtctac cgccgcgcac cggagcccca cagcgttccg    107580
     cagccacggc cggcctagct tgagccacgc agaaacgtcg tttccgcagt gagccagccc    107640
     aatcccttac tttccatgag gtttaaactt tcaacatacg agccaagaaa gtgtacagct    107700
     tcaccaaaag cttcaagtac acattgtcag actttggagc ggttctgtga ccggatctct    107760
     tgtgctgctt agtagtgtga tcgataccca ttgtgcagtt ccttgatgtt ccgagacact    107820
     atggagcaag atgctggatg agctcgctta acattttttt acaggttctg tcccgtggaa    107880
     gcttcgccat ccaagctgcg tgggtcgagg aggtcagctg atcagaattc acatctgcga    107940
     aaagctcgaa aaaagcagac aagaaagttt tgaaaataca aaatgcatgg gtggaacagt    108000
     caaaagttgt ttcatgggaa agtccagttt ttcaggttag cgatgcgctc gctgagagcc    108060
     ctaacggccg gagttttggt atggtgggtg ctcttcaagt gatcaaggga taccgggcat    108120
     ctgtaacgcg gtgaaagagc actgtatgct ggattagcag actggttctc aggggattag    108180
     atagggaatt cctagaaact ttggtaactc acatggcgag ttggaggggg gcggtcactg    108240
     ggtctcacca gctatttcaa acttgagcag tgttttctgg ttgttccgtg tgcgcacttc    108300
     tcctcggctg ggcgattcac ttgctggcgc acctttagca ggacatagct gcagcttgtg    108360
     cttcatgaca ctggcatctg aataatggac atgtgatcga tctatttcta tttcgcacac    108420
     cttagcgtcc cgctctgcag ctacggtctg agaaacaaat ctggaaacaa accaggaaac    108480
     atgtgggaaa catattggaa atgggcgaca gacgtgcggg aaacgtgcgg agacatgctg    108540
     taaaggcgga tctgggacag gaaagcgaat gtgtgtcccg cttcagatga tctggccggc    108600
     tatcttcgag cgctcggatt aggtcatcgc ataattctcg ttactgtcat atatcatata    108660
     taagatatgt gtcacgctag catgggtcgg tgccgcttcc agtgctagca cggcaggcaa    108720
     tcgtgcgtgg gctaaacctt gcaaatcctc acacccgcgc acaggaacct cgctacagcg    108780
     tagctcaggc ctcccgccag catgaggcac gtggagaaga tgataaactt gttgtagtcc    108840
     gacaccgagc ccctgccaat gatggtacca gcgatgggga tggtgggcag ggtcatcatc    108900
     gcattcagta ggtatgcagt agagtagcgc ttgccaaagt cgcgggtttt ggagatctgg    108960
     ccgatgcaca ccgcggttag cgagaagatg gaccctgaaa agaagccgta cagtaggtag    109020
     taggcccaca gcgctttggg gttgccgccg aacggcagcc agatggcgaa attgaccacg    109080
     accgccatga gcgtcatgac aatgacgacg ttgaaacggc ctgcgtaccg gtccgaaatg    109140
     tagccaggga cgtagcggcc taggatctgc atggcgttgc ctgcggtgat gagcgtgaag    109200
     gagctgccct cgctattgcc gcgggccatt gcgtaggacg caatgtaggt gctggtggcc    109260
     agaatggagt tttccgcgag cgagaagccc agcgtcgtga acacatactt ggcgtcgcag    109320
     aagtatttcc agttgaagct cccaagcacg taaaacttgg ccatctcatg cttactggaa    109380
     aacgcctgcg gcttctgctt gacgcgctcg cgcgcgaaaa ggcacgcgaa tgacagacaa    109440
     gccagacaca cgaatgccag aatccgcagg gcccatggaa agccgacttc gacgtagagc    109500
     ttcttgagca tgagcgggaa gatgatcccg cccagagacc cgccgatcgt ggcacagctc    109560
     gttgccatgg cgcgcttgcg cgagaaccag gtggccacgc agctcaccag cggcgtagtg    109620
     aggatgccgt tggccaggcc gcccaggacg gagaatgcca ggataaattg ccaaatggtg    109680
     tggcagtttg ccgtggccac caaactggtc acgaagagca cagtgccgac aacaatggcg    109740
     ccgaagccgc cgttgcggtc gaaatacgcg cccgtaagaa cgcagctagc gctcacgatc    109800
     gcaaggtaga gcgcaaaaat ccacgatacg cttgaggacg agtctgacgc cagctggtgc    109860
     ttcgagatgt agccttcgag ggcaccgagc gagttgatca cgccccacgc cggcagaagg    109920
     cccataaaag agcccagcag cgccaggtaa gcggccacgc cgccgtcggg aaactcagat    109980
     tcgtcttcgt cgtccgtgga ccctgtgtgc gacagttggt ccagcgttga ctcacgcaca    110040
     tggtcgtcag agtcgcggcc cgtgccgccg ctctgaggtt tgaagccgga agcgtgcgct    110100
     tcgaagcgtg tgtgaggact gaggatgagc tgctgaggcc gcttggggag tattgaaacc    110160
     atgtcgtata gcgcgaacga tggtgaattg cagagaagcg aagtgtggcc ccagagggca    110220
     aagttttaaa gctttggaag cagcggaata ataatggctt tataaagaac tgcgtggcgc    110280
     gtgagtcacg aagacacgcg acccgcgcgt tgcacacagg gtactacata caaacgaaag    110340
     cgcaggagcg agctcgtgct gcgcttacaa agacttcaga acgttctcgg cggaggaaac    110400
     gttgacgccg gtcttgtctg gctcctcgaa ggtggagacg accttaccgt cctcaacgac    110460
     gacagcgtaa cggtagttac gcttgttgcc gaacacttcc tcggagtcaa acagggtgtc    110520
     accggacttg gcgaactcgc ccttggtgtc agcgacgatg tgcacctgct ctggggtctt    110580
     gagcgactca gcccacgcct tggtcacgaa ggcgtcgttc acgcaggtca cgaacacgtc    110640
     ctgcacgccc ttggcctgca agtcggaaag gtgcgcgatg tagccgggaa cgtggctagc    110700
     ggagcacgct ggagagaacg cggctgggac accgacgatg atgtgcttgc ccttgctgac    110760
     caacttgccg aggtcaatgg agttgcttgg agcgttctcc tgcacgccgg cgaggccggt    110820
     cttgataacg tcacctactt ggaacatttg tgtacgagtt gtgttgtgga aaaaacggag    110880
     gcctgaagct gatgctggtc tgatagctga acggattccg tgaagcatta tggttgtagc    110940
     caacggtggc gattgagcgc tactgagcac gcttatatag gggggattta aggtgcgccg    111000
     tacaaacgta catggagtcg gggtgacgtg ctttgctata acgtagacaa acgtaagctt    111060
     gacgaaatag gcgcggcgtc gcgttgtaga cggcacgaga cggcgcactg gcgcgcgaga    111120
     cagaggcgtg gggtgctggc gtggccaccg gaggcaggcc agagtggcaa tgggccccga    111180
     cgatccatgc cacgtgacac gatcaatatt atcaagaaga tcattatcca cgacaccacg    111240
     tgaccgcgat ttaatggact atcacgtgat ctgctggctt ttccactccc ttagagaaac    111300
     tgtgttagcc tgcgatgccc cagatcgggc atcgctggct ataactgcaa gtgttccgcg    111360
     atgactggcg acgacgcggg ctacggcgac ttcgcggcat ccgaggatga gaactacgac    111420
     gactttatgg cgtccgacga ggacgtaagc atcgagatgg aggacgagac cgaggacgag    111480
     gccgagaacg agggcgctgc cgagaacgag accggaagca agaccagaca gggctcggca    111540
     agccgcaggg atgatagcgg cgccgaaaat ggcgctggaa aaccccaggt ggagagcgga    111600
     gccgcggtca tggcttcggc tgcgctgcaa gaggcgagac gcatggtgca ggaacagcgc    111660
     tggtacgagg cccggtccgc cttggacggc gtgctacaga gctcgacact cgacccggat    111720
     cgcgcctttg gagcgcggct cgagctggtt cggtgctgct acttaagctg ggtctcgcgc    111780
     caggaaaacg ccgcgggccc cgcggagcta accgagcact ccgagctcca agaagcctgc    111840
     ggccacctgc agcagctgca agcgtatgtc gactggctcg agccggaagt tctggattct    111900
     gctgtctcgc gactactgga cctcttcgcg ccgccgctaa agtccaagct gctctttgaa    111960
     gggcctgccg cctctggttt ggggcctcga gcagcggtca cacttcttga gtgctgcgcg    112020
     cctcttgcaa ggcacgaatc cgcccaggat ctacgatcgc gcgtcctgca gcaccggctc    112080
     ggctttaatg accccccggg cgggtcccag cgccgccaga tgctcgacga gctggccacc    112140
     atctctggcg gccggctgga ctcccttgag ttcctcataa cgacacacgt gcagcaattc    112200
     ctggcagacc cacaaggcct cgacgttccc cagctccaaa gcctagtgtc gcatgcgtcg    112260
     gcgctgctgc agaggtctct cacacagccc cttcgcctgc tttccctgct aagcttctgc    112320
     gaagcgatca tcgccctcaa caactactgc tcgccccacg accacgccaa gcgcctctct    112380
     gagtgccaga cggccttttg gaactgctac aagcacctcg aagagcttgg agaccactcg    112440
     cgcttccggg acctcactct ttgtgccttc gtgctctcca gcatgctcct aacaggccaa    112500
     gcggccaacg cgcatcaagc catcacgccc ttcgagctcg aacagatcaa ggtcatcgag    112560
     tcgacaccac tggtgcaaga cttgaagcac atttactcgg attttgtagg ctacaacttg    112620
     agcggattcg ccgactctct gcgcaaaatc aagcaattcc acctccagtt ggctgggctt    112680
     gttgacgccc tcatacacct gctgcaaacg cgcatgctct ggaaccgcgt cgccaggcta    112740
     tactcctgca tctcgctgtc ggacatccgc gcgcagctgc agatagggga ctctccgcag    112800
     ctgtcgcgca acgatttgct cactattctg atgaagagta tcatgaacga caccgcgcaa    112860
     gtctacttca agctggacct tacgcacgac cttgtctact tcggaaaaga gaatcgtagg    112920
     cccttatgcc ctctttccaa gcacttgtac ctttctgcga agtccgatgc tgttacaaag    112980
     tcccctaata caccatcctg taattccttg aaagaatggg ttgacaacat tggcgtcttc    113040
     gaaacaaagc cccgcaggct gaaggacatg agtgctgtgc agtttgtcca cgagctgcag    113100
     cagtctcgag agtgtactgc tgtggcggac tcaagtgatc aagcgaagcc tttgaagtac    113160
     tctcagcttc ttcagtgcgt ccgcgatgcg cttagctaaa cgcgaaaccg ccgtggaccg    113220
     ctgaaccgcg aaaaacgagc cacgcttccc cggtagtctt taatctagcg ggccagaccc    113280
     cagttggcag ggacaaagcc ctgcttattg tctactattg tttttgccgt gcatgaaatt    113340
     ttgtttgttt tttttttcgc gtttcgcgtt gttacgcgaa aatacgttga tcttcaaatg    113400
     ccaagatcgt cgaaattgga tcaaaaaaac tgaacagacc ccgagcgtgc acgaaaagtc    113460
     tggtctgggc gcctcgcaac gcgaaatatg gtttctcctc taccgccaaa cgctgcgcgg    113520
     cttactgcga acacacaatt tgcctgctgt taagctacgg ttcgcccact gttcccactg    113580
     caaacgtact ttcgggtgaa aagttctcat ttcgtttcgc ggccgttctc ttcgcgggct    113640
     ccctgcccaa catgtataaa agggcttcta gtcatgcacc cttagttgaa tgattatcga    113700
     tctttcttta cacttttcat ttccccatcg accgaccaac tcgcaatact ttccctctag    113760
     atacaaaaaa tgaaattctc tatcgctgcc tccgttttcg ctgccgctgg cgtcgcctct    113820
     gcaaccatcg ccgctgtttc tcagatcggc gatggccaga tccaggccac tgtcccaggt    113880
     gcttctacct cggccgctac cactacaact acttcagtcg ctactccagc ctctactcca    113940
     gccactgtgg tgtccgcttc gacctctgcc accaccgagt ctgcttccgc caccaccttc    114000
     accactactt tcggcggctc ctccatctct tccccagtgg ccagctctca acgctcctct    114060
     gatgacatca cttacgtcga catcactacc acccctgagg tcaccacttc ccaggtgaag    114120
     actgagaagt ccacatctac cccttactca tacacaactc tggccactca gaactccacc    114180
     gctaccggta gcggcagctc ttcttccgtc agcctgagtg tgttcgaggc cggtgcgcaa    114240
     aacatcgctg ctggtgctgg tatcggcgct ctggctgccg gtgcgctcat cgctttattg    114300
     taaacctgaa ggacttccag cctacgctaa taatagggaa gccctctagc aaaattgcct    114360
     gcgaccagct cgctgctctt atgtaccata aatatcgtca tacgctagtt tagatcaaag    114420
     gaatgcattg attgctgatc ataccagctt gaggccattt gcctacttaa ctgcgaacaa    114480
     ttttcgaaaa cagttcacat gcccatcaat tcacatagcc caaagtacta acgcccaagg    114540
     tttctcgccg ttgtatatat ggatgacgtt tcacctttga ttgctcgcat ctccggcctg    114600
     gagagtcaga tcgcaatgta tgagaaactc ttccagaccc taagtgcgaa gctagatcat    114660
     catttcaaga aatacgacac tgtagttaac gcacaacagc aacagatcaa ttctcttacc    114720
     gatgttttgt tcactttact caacgatcga tgccgctatg cagatataca acgtgaaaaa    114780
     ctgggaaaca cgctcgctgg cgtcgcatct accggcgcat ctttgagcgg ggttgtagcc    114840
     accgcgggcc ttgggagaca gccgaagcag gccacaggcc cccaaacttc atcccgacat    114900
     gtttcgggct tgcaaagcga ccatcaatca gctagtttgt acgctgaaga taccccctca    114960
     cgtcgcgagg atgagcggcg tagcagcgac agctattaca gcgacaacag cgttactagc    115020
     gcagaaagtg acgagagcga ggatcgagaa aactcggagc tcaggccaga gctacatgag    115080
     tccgcagacg cagcacacaa gaagcgcaag cttttcgaca gaaagttccg tttcttagct    115140
     tctccacagt ccgtggcaga ggtttggaaa gaatataccg aaggtctagc aggccagcct    115200
     tcgctcaaag aaatggaatc tacataccgc tcgagctggc gacgcgatgc ggcggttagc    115260
     cggaagtttt atcgccgcaa agtgctttgt cgagccattg agaccggctt ggctagaggc    115320
     tacgcattag aggaaataat tgacatgctc gagagtcaca gacaacagag agaaggaaga    115380
     caagataagc tgccgattgg ctggctatgc cgccgcagta acctaccaag cattttcaag    115440
     tgagtcgggc actcacgagt gaatgttcaa aatttcaagc gaggacgctg aaggacatat    115500
     tcgtgagtag attttttatg ttgtaaaatc tttacctgaa aaacttgttc aataagtcat    115560
     cgccaaggtt aaaaagagca gaagtcgtga gagttggagc cacaagacgc gtaccggcgt    115620
     cctagtatag tgaaattttc gaaaaaagag ggctaacatt gtaatgggag cgaaagaagc    115680
     gagcaaaaac gagcgtgctg gaccgaaatc cagttcgaaa agcaaaccgc tcaagaacaa    115740
     tcagcggcgg accaagagac tccggaagtc atcgctaagc aaggcccaac gcaactttgc    115800
     cgtgttcaac aaggacggtg cccacattaa caagtacgag aaccttgagc tggacaatat    115860
     tgagtccgag ggcgatgacg gaagcgagag aacgcaagaa tcgagcgagg cgcccaccac    115920
     cgaggcaacg ccagagagtg aggaacctca aaaagagcag gcccaggata atgcgctgga    115980
     tgataaccag gattacattt cgctcagcat gagctctgaa gaggaacagg aaagcgaaga    116040
     agaggcccca gatgaggctg gcggcgaaca ccccggcggc gacgccgcac agccaaggac    116100
     gcttaacact gactacccct ggatcctcaa ccacgaccac tctaaacagc gtgaaattgc    116160
     cgactggctc acgcttgaaa tcaaagactt cgtcgcgtac atatcgccta gtcaagagga    116220
     gatccgcgtg agaaactcga ccatctctaa aatccgtaat gctgttaagg atctatggcc    116280
     ggacgccgac ctgcacgttt tcgggtcctt cgctactgat ttgtaccttc ccgggtcgga    116340
     tattgactgc gtgatcaaca gtagtagtgg cgacaaggaa aacaggaact gcctgtactc    116400
     gctggcgagc ttcttgaagc gccggaagct agcgacccag gtcgaggtca tttctaaagc    116460
     ccgagtccct atcatcaaat tcgtggaacc aatttctcag attcacatcg atatctcttt    116520
     cgaaagagtc aacggactgg aagccgcccg tgtcattcgt ggctggttga aagagacccc    116580
     aggattgcgt gagctcgtgt tgatcgtgaa acagtttctt gccgcaagga gactcaatat    116640
     ggtgcacacc ggcggtctcg gtggtttcag cattatctgt ttagtatacg cctttctgca    116700
     gctgcatcca agggtaataa gctcagacat cgatagcatg gaaaacttgg gtatactgct    116760
     gatcgacttt ttcgaactct acggtaagaa ctttgggtac gatcacgtag ccatttctgt    116820
     taccgacagc ggtgctcgtt acttgtctaa ggaactctac ggcagcctgc aaaatcctag    116880
     gacttccttc gcacttgcta ttcaggaccc cggagacaag gataacaaca tcagtcgtgg    116940
     gtctttcaac atacgagaca tcaaaaaagc cttcgctggt gcttttgatc tactaacaaa    117000
     ccgctgtttt gagctggatg ccgctacctt caaggacagg gtgggcaaaa gcattttagg    117060
     caacgttatc aagtaccgtg ggaaacagag ggacttcaag gatgaaagaa atctggttgt    117120
     taacaaggca atagcagaga atgagacgta ccatcgcaag cgtggtcgga tcgttcatga    117180
     ggaagtgttt acggacgtaa gcgatggcga gaaagaagac gacatataca cggtggaaga    117240
     gccggctaag aagaagccaa aaaaggcaaa aaaagcgaag aaagccaaga aggaaaccaa    117300
     ggccagcagt agtagcgtgg acactctgat gggcctcgac actcaagatg acgccgacga    117360
     agacggctac gacccttcca atgaagcccc ctcgacgcta gctttagaag acgcgagatc    117420
     tgacatcaga aaaaaatcgg tcgacgcaca aacaaaacgg gattattggc tcagcaaggg    117480
     ccaggcgcta taaatcgttg tcgccacacg taggacgagg atatgtggtt ttttgcattg    117540
     tattatagat aagttataca ttgagctgca gagcaagcaa acacgcgaaa gggcggtttc    117600
     agtaatccgt tactttccgc cgtagcttct tcttatcgct tttgattttc ttaccctcca    117660
     gtctttgctg gctggtcttg cggcgtatcg cgctccacct ctgcagatcc tccggctgtg    117720
     cctctttcgg aaaccaacat gtggtcttga gctcactgac cagcttctcg aggcaaatct    117780
     gccggttggt ttctctgctg cgcgactggt cagactggat caccacgcag tcccttgagg    117840
     aagaaagata gcgaaacctt ctttgcacca gctggtcgcg aacttcctgt ggtatccagt    117900
     cgcatttcga aaacgcatga atagtgagcg tgcatttgct gttgaccttg ttcacgttct    117960
     ggccgccggg gccgctcgat ctgtcaaagt tgtaggagaa cgctttctcc gggagcgcgc    118020
     gaacagtgag agagtccacc cattgctgcg ctggcaagga agtcttggca gaatactgcc    118080
     tgactatggg cagcagtcct gccactgacc tcatgaagaa cagcgagggc aaccttgaac    118140
     ggcacccgaa cctcatcgca gcaccgcttg cagtggaaac aatatacgaa acccaatcac    118200
     gtgcgtatag tgatacctgc gacacttagc gatcctctgt gagcaagggc aaaccacagt    118260
     tttcgtctat ggctgtatga tcaacctcaa taaggcccaa cagaggtccc ttcggtgcgt    118320
     ggtttgcccg caaatatctc gacaacaaag acgccttcaa ggaaccgaaa acaagcctcc    118380
     gatagcttta acttcgcaca gcaagcaggg gctggttctt tcaagtaaaa ccaacaggtt    118440
     ggtgttaatt catttggttt agtgtagcgg ttttcggtcc gatttatgga atttggatta    118500
     acttaaatta ttaccggagt cctttattcg ttttccgcga caattgtcga gctaccacca    118560
     aaatttttta agtgttatat cgaatcaatt atgtttcaac agtcgtaagt ttcgaatcga    118620
     aatcgaagtt gagtaggagc aattgcagcg gtgtcaaaag ctagcaaagc atgtcactct    118680
     cagctgcagc gaacaagatc tcggagaatg atttccaaaa cattggcccg gccccacggc    118740
     cacctggagc cgcgttcaac aagacgcaac ccataacaag ttacctcaac cagctggacc    118800
     tgcaagacaa gaggaacgag cagcgcggag caggcaacgg caatcgaaaa agcggctggg    118860
     tctcgtacaa ggacgacggg atcttgtcgt ttctatggca gaaacggtac atggtattga    118920
     gcgactcgta cttgacgctt tacaagaatg agcctcgagc aggcagcgac gacgcggtgc    118980
     tacagatccc gctaaccacg atagtgagcg tcagccgcac acagctcaag cagaactgct    119040
     tcgaggtcgt acgcagcagc gaccgcaact cgtcggcgtc ggggtcatcg gtgggcagct    119100
     ctggaaacgg cagtggaggc tcggacggga gccgcaagac catgtatatt gctactaaaa    119160
     cggagataga cctacattcg tggctggatg cgatcttcgc taaatgcccc cttttgagcg    119220
     gggtatcgtc acccaccaat ttcacacata aggtccacgt tggcttcgat cccgagacag    119280
     gaagctttgt cggcatgccc tcgaactggg agaagctgct caagcattct cggataacgg    119340
     gggaagactg gaacaacaac tctgccgcgg ttatccaggt cttacaattc taccaagagt    119400
     acaatggcgc aggtaccgcc acagctagta ataactcatc tactacttcg ttgcccaagg    119460
     cctccatcaa ccagggtcag tacggtggcc agcagtctag acagaattca catgatatgc    119520
     tgccgcagag gaagcctccc acaccacctt ccgtacagca tcgcccaaag ttgcaggttt    119580
     ctacctctca ccaaaactac caaacttcgc aacagagccc atatcagtcg ttcaacaaca    119640
     aatatgcatc tccattgcag aacaaaccac ttaattcaca tctgccatcg cctccagcgc    119700
     acaagttgcc ttatcctcaa caggttcaag ggcagaattc gagtcagctc aagcagcatc    119760
     gtcaaaacgg ttatgcacag gatgcttctc ggtttaagca taacatgcag aacccatatc    119820
     tgaccagtac cccgccttcc tcatcacctt catcctcgaa ggaacaagtt tctcaaagac    119880
     atgcgccaca acaacgtcca cctgtcaata attctccata ttccaactca tcaacacctc    119940
     cgccacaaag gcttcatcct caaagagcag cgcctgctgt tcttaaacct ccagcacagc    120000
     ctgctccaag cacagcagcg gcggcagccg ccatgaacca gagtagacca gaggcgggtc    120060
     ctaaatttct gcagcctaac agagaagcac caaagaagcc agatgcacat cctaaaaagg    120120
     acgttggagt caccaagcag aggaagccca caaagcctac aatgtcaaat gccgagatta    120180
     tggctaaatt gaaaagcgtg actttcaaca cagatcctac ccccttcttc caaatggttg    120240
     aaaaggcggg tcaaggtgca agtggctctg tatatctagc gcagaggacg cagctcccag    120300
     actatggcga aggcgatctc aacgagcaga taggggagca acacattggt gacaaggtcg    120360
     ccatcaagca gatgattctt tccaagcaac caagaaaaga gcttatcgtg aatgagattc    120420
     tggtaatgaa ggactcgcag cacaaaaata tagtcaactt cctcgaagcc tatctgaaaa    120480
     cagaagacga tctctgggta gttatggaat atatggaggg tggatcactg acagatttaa    120540
     tcgaaaacag tccaactaat ggaagtaatc acgccccact gacggaaccc cagattgcct    120600
     acatagtcag ggagacttgt cagggcctta aatttctaca cgataagcac attattcata    120660
     gagacatcaa gtctgataat gtgctgttag atcatagggc tagggttaag attaccgatt    120720
     ttgggttttg cgcaaagtta acagacaaaa gaagcaagag agcaaccatg gttggcaccc    120780
     cttactggat ggcgccagag gttgtaaagc agcgggagta tgacgaaaaa gtcgatgtat    120840
     ggtccctggg tatcatgaca atcgagatgt tagagggcga gcccccatat ctgaatgagg    120900
     atccgctcaa agcactttac ctgatcgcaa ccaatggaac tcccaaactc aaacaacccg    120960
     aagtcctttc gctcaagatc aagcggttct tgagtgtttg cttatgtgtt gatgtaaaat    121020
     accgtgcatc gactgaagag ttgcttcatc atagcttctt tgacatgagc tgcgacccaa    121080
     gggatcttac ttctttgtta gaatggaaga aataatagag cactcagtaa gtgcaggtgc    121140
     agggggtttg aaatagaact atctatacaa tgaacgtaaa cggtaaggaa tatctgttta    121200
     gtgcaatagt ttagtgaagt ctaaagaaac ttcttgaacg atagtttcaa gaccgctgac    121260
     cttttgtgat accggtattg cccgcaaaat gagaggataa agaacttgaa ggtctcgaat    121320
     agctttatcg caggccacct tgcccttggc ctttgatatg taatctagaa cttttctcag    121380
     tccgctcaat accaatgcca cctccatgct tctatccttc gcaatggggg cacgattcaa    121440
     aagtatagcg tcagaaacgt accttctcag actgaaggca tatcgggcaa ccaagaatgg    121500
     cagacaaact gctctcagct tatcaaaacc tggcccttca aacatcatgt agttggtcaa    121560
     gtcctggagg cacaaagtcg ctgttttata cttgcttaaa agtttctgac ctcgcgtgga    121620
     ctctagaact tcatcgaaag gaaagaccgc cagcttttga gcaacctcct caaggctctc    121680
     gctgcttttg ataatttcat cttcaatgtc atcaacttcg tgaaaaaagg aagcagacca    121740
     aaccgaagac acaaacttct tgagatgttt ggctttcaaa gattccaagt tcaattgttg    121800
     aagtagtttt tctcggaaat gctgaaattc ttcaatgtca tcaatctcag taagcaagtc    121860
     tgtttcagag tcgagccttt tgagagggac tactgcaact tcaacaaaca tatcgaaaaa    121920
     tgcatctcgc acttcttctg gaatgtggtc aacttcttca taatgaaaaa cgtcgagaat    121980
     tttctcagct aacgagaaga aacaacggga ggaaagagtc cagagaacag cagaattatt    122040
     catgtctcct ttgattaatg atttgttgat aataggaata ctgagacttt ttaaaatttt    122100
     aagaagccgc ttagagctga caaagctctg attgaggtca tttatacccg acaagcgttg    122160
     tgaaaagcag ctgcatgctt cgtaactcat agcctcgaat gatgggattc tctttctgga    122220
     tgaactactg agcttgggtc ccaatttcat ttgaatgcgg gttcttgtat caaaaggaag    122280
     tgccattatt gtgctaatct ggtccaacat tagtagctca acatcaagtt gctgtccaag    122340
     ttcgaaagtc tttatagatt tgaggacagc attctgcaga gtagaaggtt tctgattgtc    122400
     cgtcgagaat tcagggagca aaggataacg agctgcagaa ttcagaatta acaatatgtt    122460
     ttcgactttt tcagcatcta gtaggccctg gcttcccatc agttgatgca aaaaaggata    122520
     gcaaaggaga agttcctcta cgcaatcata gtttgtcttg cgcttgagct cagaagattt    122580
     tgcaggatca gcgtaaatga cgttatatcc gcaccacctc tggtatattt cactcgttat    122640
     tctggctgga aagtcttgga tctttaaaac ggcttgaaga agttctctta ggttactaag    122700
     tacaatgaag gaaatttcga aagaaggcaa gataaccaga tctgccatgt aacaaacaag    122760
     taatgaccat gcttcagtaa aatccgaagt atgtgagaac tttgccaaat agagcgcaaa    122820
     catatggatc aaacccttca aggtcaggtt aacatattca ccgctttcta ggtactcctc    122880
     gaaattggaa cgctgctgaa gcaaaggttt tataacttcg tgtactataa gctcccatgg    122940
     tgggaacgag cttgaatgtg aatcaatgat cctaaaaaag gtttgaatag ccccattctt    123000
     gacctcgacc ctttcatcat tagtacactc gacaagtttt tttagcagat agagccacaa    123060
     accatagtaa aggccacaag gttcggtatt ttggtcggat atcatgctga taagctggcc    123120
     atcttcgatt ttcttggcga acgctagttt ttgggagtcg gtaaattcac tgggcacttt    123180
     tgaaacacag gttctcagat aatctccaat aagccaaaac tggctgattg aagaaaaaga    123240
     tatattcaag tccctatctt gcctaacaaa attaagcaat gtgtcaatca cgttcttaac    123300
     aacatctaga ggaagtgtct gcaaaaaatc atcaaaaatg agcttaaaga cctcgaagga    123360
     taatttgatt acgccattgt gctttgagct tatggtttcc agaatggagc tgtcttcttc    123420
     gtgatctgag agctcagtaa tagagctttc agacataata acaaaaggac aatttataat    123480
     cttgaagaca acatcccacg ccccctgtaa cgagtcccca aaaatgtcta aaagcccctt    123540
     caaggtgcgc aagacctgaa acaaaatatc atactcagtc tcaacagcac cattgcggac    123600
     atcgtctctt gttcttttta aactcataat gctgtttatc atctgcatca gggctgttaa    123660
     aagccggctt tgagcagctt cagtatctgt tttttggggt atttcaggat cgcttgagac    123720
     aattgctgcc cttgaaatta tgttattaaa aacatcaaca gcactcaacc gaagtttctc    123780
     attggcaatt tctcgacttg ccgcaacctc aacaaggtaa ctaatcacca agtcccaact    123840
     tggccgccat ttgctttcat tcaccaaccg ccagatattt atttgactca gctccctcag    123900
     ttgagcgatg aagaagtccc tgttgaagat acatgtattc agcattttac taccatcaac    123960
     gggcgagtgg ccctcaggag cataattgga tgttattagc tcagcgcatt cttttgattg    124020
     ctgaattacg cttgagacca tgacgttgaa gctggaactg gagtagtgct gtgtgctttc    124080
     atatagcttg atgatgctga actttgcagc gctgatatca gacgaagatg ctcgagggtt    124140
     ttgggctgtc ttgaagccat gcgttgaatg atcggagtct ctagatggac cctcaaggta    124200
     gtatgacatc cattgccaag tctttaaaac ttctttccaa ctatctgagc tgaaaacaga    124260
     gcctaaagat aaggacagtg acattaacgc tctgaaaaca cttatcgtcc tttgatgaat    124320
     agcgcgcgag tgttgaaggt ttgcttcaaa gctcccttta gcattagatg agttccctat    124380
     cagtgattcg ctgatagtgt ttataacagt actggcagtg gtcaggctcc ggtcagactc    124440
     gttatcttca ggggcctcgc ccattatatg acagctttcg actgtagcta tcccaaacaa    124500
     gcgcaggcac ttgtttagct tattctcgca ttccagtacg ccagcagagt gtgatagctt    124560
     ttggaaggcc ctcaccactg aatgaaacaa cggagtgtct aaagttgaag cgtacaaaaa    124620
     cattttgtgg ataaaaaaga ggtcatcgaa aagttcactg tacataagct tcaacgactt    124680
     aacctcttct tctttcgctt gcttttggta taacgatact gcctgtgacc ccattccgtc    124740
     cgatatggaa ttggttacag ctagcaccag atatacgaca tatgtttggt cgacaagagg    124800
     cgcgcttgcc ttgtccagca agtcaataaa tgggatcttg gccactgaat attcttgtga    124860
     aactataggg gtgtcccctc gagttagcac atggaggact ttcaagtatt cgtgatactc    124920
     tttttggctc agaatgcctt taagagtact caaaaggctc ttgagaatct gtctgcgatc    124980
     agggtgaaca tcataagatt tgaagatgcc ccaaaccaat gcaaagtttt tgcacacaag    125040
     ctgaaagagc tcaagggata tgatcttctt ccaaattggt gattcgattt catttgacaa    125100
     gatgttgatc aaaagaaata aaattatttc aagttcgagc tctaaaattg ccagaaactc    125160
     ttcttgtatc agcaatgtca ggcaccttgc gctccttaca acaatcggga aactctttga    125220
     cgatgaaata gaacgcagaa gtagaggtac agcccttgtt ctaagaacga actgtaaatc    125280
     ggggcaggct gcaaaaagtt tccggtgatt ccttagtaca ctttcgagaa cctcaagccc    125340
     atagtcttct ggtatgcttt cgacgttcag aatgcaatct ttaggactgt aagacgcatt    125400
     ctttaggttg cacaagtcgt taaaaaggcg gttagcatca tggcgaaatg agccgacttc    125460
     aatgaattct atattgttta ctgccacttt gcaagtcctg ctttcttgat cgatagtcgc    125520
     tctctctaaa atgtcgttta tcagttgctg gagcgttgca ctcgcagttc cgaaaacgac    125580
     gggcgccttg tttggtatct ggatgagact tgagcagcat aaaagcagtt tggagcatag    125640
     ctttccaaca acaacctggc tatatgtctt gaaaaagagc ggaatgattt gtaggacctt    125700
     gagctgtatt tctgcggcta ggtgggttga atctatgaat gcatcgagca cgtcctcaat    125760
     tctgtcctca ggtatgcaat tgaccgatga catcttttgt aggcattgca ctgagacgct    125820
     tgtgagctta gcgtttttgg aggcacacga aaggacgaaa ggcgttacaa agtctggatg    125880
     ccttggaagg tcttcgaatt catgaacagt tttcaagatc tctattgact tgtcacttgc    125940
     atgcctcacc tcagagctgc gccgcttaga ctccgccgaa agtgcgtgca attctgtgaa    126000
     gagctcatca ctaaatttgc ggaacgaaag tttcgtcgac atttcttggc ttttgatagc    126060
     taccggcact gctcttctga gagcttagtg tcccttttaa ctcgttagaa tgatctactt    126120
     gagatctgag aactaaataa gacgttagcg ttgttgatgt cattatatac gcaaactcaa    126180
     cgcggccatg acagttggca acttttacat tgagtttaca taagttttac acccgaaatt    126240
     tcaatatcag aatcccgatt aacccaagta ccgtcagagc gtcgatgaga gatgaaatgg    126300
     ggctggattt tagggctcct gattacagtt gattgaaagt taatctaact tccgtatata    126360
     atgattttta atgatcaagc gattacaacc ttttagagat gagcctagtt ctcaaatctg    126420
     atccttatct cgataacatg agaggctatg ttcagaaatc tagcccacct ttataatgga    126480
     aagtttcaga cactgaacag aactaatgct ttgtgggaaa gatgcagctg tatgcgcctt    126540
     tgcagtacgg atgccaacgc agcagaaaag tctaaggagg aagaagaaga agttgaagtt    126600
     gccacgaaag agaacggcaa gaaagatgga ggagattgga atggatccaa cgcttacagt    126660
     tgtggacgcc cttcccgcaa gtctggtaaa ggtgtttatc tggttcccaa ggtgcactct    126720
     acagatcaca tcaaacaaga tgaaattcat acggaagggc tgttcgcagg aaacaaacct    126780
     ctgtttttag gggagctttc tctgagcttt aagcgaccga gtggtgctct tgatggcatt    126840
     tttgggactt tgaccaagat aaaaagagcg acagatgacg gcggagacca agaaatagat    126900
     gttcaaggta ttataaatga ccttcagaca ggggacaagg atatctcctc tggagagaaa    126960
     agcgcagcaa aaaggcccgt cattccgtgg gatgcttcga tcagtggtat ggtctataac    127020
     gatcagccct tcaaacaagt gccgcgaggg gttgtgaata agctgaagcc ctttaagtta    127080
     ttgaaaatag agcggaagaa taagtctgga aattctcaag accatgaatt ggtaaagatg    127140
     agggttcaca attctaaagt taatgacgag ctgcaactag tagatcttaa cagggaagct    127200
     accaggagac ctcctacttt agagctgaac gactccgcgg ggaaagcgaa aaggttctat    127260
     actgatgaat caaagtcgct tacgcagttc aagttcatca ggagtgacca gcacgtcttc    127320
     aagacggatg ttgacaagct gaacaatttg ctggtcaaag agtttttgaa gagaacaaag    127380
     ctgaaaattg actctgagtt cagggacaac cagctgccgc tttacatcta tatcaataag    127440
     actttatcat cgaacgcttt gctacagcgg tttatcagaa agcgtgtcac ggatcatata    127500
     tccccactct tcacaacaat actttcatca tatgagagag aggacgaagc caagaagttt    127560
     gagaaaagaa tccaactgag agtcaactca ctcgtcgagg accttgccga atatttcccg    127620
     tccgtgtttt tcgcgggtga tatagtagat tgtgttcacc acccgagtcc cgtcccagga    127680
     tatgggagac tttactggct gaagccagga aaacgacaca aagccatttg gggcaggaac    127740
     tctgagagtg atttcgtgtt caacttaagc aacacatacc gcataacacg tagtggtgtg    127800
     cgttatatga aatatcctat taacattcat tatagaactt tccatcaagc attcacggaa    127860
     tgggaatatc gtaaatagtc taaactcata ttattaactg tttatatgtc tactactttc    127920
     atccaaccgg taagaaaaca tctctagcct gctagggaaa atctctttcc tcatcaacac    127980
     ttgaaccttg attgctttcg gcctcatctt cgtctgagtc aaatacaacg tctctcgtag    128040
     cgtaaacata cacttcgtta ggcctatcta gtccaattct cctccggact ttggccttcc    128100
     tttttctgtg atcatcgctg ctgcttttag agtgtatgct caatgttttt attaccaatc    128160
     ctttgacgat gaaatggtcg gtgtagtata tcattccgtc ccaaatcctg ctgcacttct    128220
     cgagaataac gttcttgaga ggttgaggct cgttaaactc aaccttgttg gtgtctcttg    128280
     gaggggtatc gtcgccgtat tgccaccgaa ctctctgctc ctccgtgccg ctattagccg    128340
     tgtcattccg acttccgatt tctccagttt cgctatctcg cgatatggcg tcctgcacct    128400
     ttaaagcgta ttttgcaaag tggtaatctt cctggtcgtc ttcgtaaact ggacgcccta    128460
     aaacgctctg agcctgcacc ttccgttcga ggatgagtat gtggtccacc cattcccaca    128520
     cgataaccgc agaacccaca tagcaagtgg tattgaagat ttcgctgagg tcatcgaccc    128580
     agatattagc aacatctgcg acaaagaacc ctggctgtaa aagtacaatg atgagagcta    128640
     gcaaagttag aatcatcatt cgctgatata gaaagcagag gtgcctttta ttgaacatgt    128700
     tgaaacagat aatgcacgcg taagaagctg cgagcgctat gcggaacagg tacacaaatg    128760
     gcgacagtag cgtcaagcca tccgcatcgt aggagaggcc tgaaaaatta tcattaatag    128820
     actgtgccag agttggaatg gcccatagaa cctgcgagat gatggagaga gtaaccccca    128880
     ccaggaacac agttcttttt tctttgacgc gagagaaaag gcgcattatg atctgaactt    128940
     gacatagctg gcatataaga acaaccaata agtctaggca cgtgaaagtg agatccatcc    129000
     agagcaggtc tagcaccctt tccgtggaga ccaccccctt gtagatgtgg tcttggtgta    129060
     ggaccttgag agctttgctt atgaagatag caaggttcac agacgcaagg gtactcccga    129120
     gtttcagcaa attggatgcg ccgcggtgcg gcttttgtcg gatagtgatg aaaactatga    129180
     ccgtcaggaa aagagttatc acgaaatttg ttgtgaatga catgattatt gcatatatgc    129240
     tgtatttgaa aggcccccga tcattcccgc tggtgatgaa agtatgccaa tccctttgga    129300
     gcgcttttga gtaaggaaag gatagtctat ttcgtttcag tgacgaatat actgggtttc    129360
     cttcatcgca gtagcttgtg aaacgcacgc tgtcgaagta ggccacgggt tgccacttgt    129420
     ttttccatat gagaacacca ttccctaaat caataccccc gcagctctgg tattctttcg    129480
     gcacctggct gtacctccaa gaagtctttt tcaccatatt tgcagagggt atgctcctgc    129540
     gatgagttca agtatagagc tacttgttga ttttaacatc acccgtattt tttgacagga    129600
     cgactaagca ataaggttga gcatagaacc agattagccc caattcccat ctgtttgcca    129660
     ttcataagcg tgtaggctct agttgactca ctgtagggta tataacaaga agcttggcac    129720
     cgccttcacg gctgactcat ttcttgggcc tcttgggacg aaatagaaca tcgtgaaata    129780
     taatgacatt ttttaaaata tgatcttgaa actgcttgac cggcgcaggt ggtggaattg    129840
     accgattggc aggcggttta gtccctcatt tgtattaatg actaaactct ctgatgtcca    129900
     tgattatgga agctccaaga ctaaatctag aaacggtggc cttagtggat acttggcaag    129960
     caagtcgccg tcggtcccaa atcttacaca gacctttaca acacgatcga tgaaagaaac    130020
     ctcgcctgaa agagcgggtt atcaacaatt tgggtcgccc ttggttgagg aacccactaa    130080
     cctcagtgtg atcgacctct atggcgatga ggacgacgag gacgccgatg atgacgagga    130140
     cgccgatgat gacgaggcag agggatctca gagcacatct ggcgtgatag cagacctgcc    130200
     tgtgagttcg accgaatctc cctctctgga agcacccaac gcgttcgggg cggccaagga    130260
     tctgtctcag tacgatcgat atggcttcaa aaagcaaaca gctcatgtca gtcaagaaga    130320
     gtaccatatg tggtgggatc aatactccag atattgcatt cgccggaaac gcaagtggca    130380
     ggatcttctg gagaaaagtg gactggcccc aagtaatgac gttcctgacc gcttccctcc    130440
     tcgaagcgag aagttaaaaa gatacgtaag aaagggaatc ccagcagaat ggagaggcca    130500
     ggcgtggtgg tatttcgctc gagggcagga aaagctcaat aagaacgctg gcgtgtacga    130560
     caagttgttg gagggactga ataacaagaa agataagaat aactgtaaag acttagaggt    130620
     aattgagaga gatttgcata gaacatttcc agaaaacatt cattttcaaa aggaccccaa    130680
     ggagggccaa gagccgctca tgattcagtc attgcgcaga gtgctgttgg cattctcggt    130740
     ttataatcct aagattggct actgccagtc catgaatttc cttgcaggac tgttattgct    130800
     attcctggat gaggaaaagt ctttttggat gttggtgatt ataacatcta gatacctgcc    130860
     tggtgtccac aacgtgaacc tagaaggtgt caacgttgac cagggtgtgc tcatgctgtg    130920
     tgtcaaggaa tacttgcccg atttctggca aagaataatc ccaaaggaac aaagccgaag    130980
     caacgagttt ctgtacaagc tccctcctat tactctctgc acggcgagtt ggtttatgag    131040
     ctgttttgtc ggcgtcgttc caattgagac aacattgcgt atttgggatt gtctcttcta    131100
     tgaggaatcg catgtccttt tcaaaatatc gctttccata atcaaaattt gtgagcaaga    131160
     attggcgggc agtcgccttg ctcaccgcgg gctgcgggcc aggacacatg gtagggacga    131220
     tgatgatata gaagtatttc aagtcattca gaccgtaccg aagaagcttc ttgaccccca    131280
     ggacatcttc gaccggatca tattcaaaag gcgagtcccg cttaacaacc ttaaccaaga    131340
     ggagattgac cgctgccgga agtacgtcac atctcagaga ttgaagttca aaaactgcgc    131400
     agaaattatg ggcgacagaa caagcgccaa agcaagtgca aagagggatt tggaaatagg    131460
     gccagatttt gtaaacaacg ctttgtcatc ggaagtttac ggttttagaa gaagtcttac    131520
     gggcgcccac tggaacaata gcataaagga aaaggtgcgg cagatacgaa ggaaataatt    131580
     tatagttgac aaatagtata taactagtgt taatcaaggt ctgccaaatc ccacccgcgt    131640
     tggaggcgct gcaacacagc cgtggcttct tgaggatcag ccatttcgtt tttcaacagc    131700
     tgttcgattt tgacccaggg aacttgaaca gatcttggtg caatttcttc agcgtctatg    131760
     gaagcattgg cagagtcacc tgctgatgtg ccttgtgatg cggcgttttc taacttggag    131820
     accatcacca ccaaatcgac cttgtcgctc tttaagtcag acagcaatat gttgtcatgc    131880
     aagactttac cttttagcag aactttaagc tgtgaagtct catgaataga gtcttctttc    131940
     tggattagaa actctttaac ctggtagatg gtctcggatt ggtcgaactc ttgtgagtac    132000
     acgaattttg gcgcccttat ggatttgaga ttcagctgga tccgagcaga tccagaaccg    132060
     ttcccaccgt tccgcttcaa cctcttgtga tcgtatttgt atttcaaagg tgggagcgca    132120
     acgccaaggt tggtgatatt ctccattggc gttttaaagt ccgacttcaa cactataggt    132180
     tgctgtgcaa ccaatgaaag aaacttgctg ataaactctt tctcaggtag ggacatgctg    132240
     gctcttttct gcttttttat tcctataggt aatggcagtt ctttatgatc aattgggtat    132300
     ttcttggttg cacagttagc tttttgaaaa ttgaatttaa tcaaagacat gccgactaat    132360
     caatgaatag cgccctgacc agctcaaact ctaagcatgt ggttccagat gattccgatc    132420
     agccaaaggc cttgttcttc aattatcacg agttttctgt aacagattac gccgaaatcg    132480
     gcaaggaatg tagcgaacat gaagaagagc tcgctctgtg tattacgcac ttccctaaca    132540
     catatgcacc tctagactct atcagattta agcagacacg aattgtgcgg attcccaggc    132600
     gatatgaaga caatcttgac tggccggtgt tttgtacgct gctccctgga cacgagcccg    132660
     cggcccttgt gaaccaagat ggcagtttgc agttcgtgcc ttacggtttc tacgaaaacc    132720
     agatctatgg cctgtcttct gttagccctt taagctccta tcttagcccc gaggagttca    132780
     aagatatcgt tgaaaccgta aacatgtatt tacgacaggg ctacgatccg aacacatggc    132840
     gcaatatcat atctgctact tttgatgtgc taactttcaa tctatggaac tgtctaatga    132900
     tccgacttgt ttcaagtccc ttgctcaagc tggagaacta cgttgaaacg ctgaacaaat    132960
     ctaaactttt caaaaacaaa aacataaggc taatttcccc gagaaggtcg ggatttctct    133020
     cggtatgtta aaccagtggg aaacattgca tgaagaccga actttgaaga catttactaa    133080
     caacttcttc gtcttaaagc tggactttga gatacccacc ccatcgctgt gaacgaaagt    133140
     gaatatttta aagaactgac gagctcatcg cgttagcatc gagaagaact tcacaaatca    133200
     gcgaaacgtc catgaacgga atcttcgcta ttgaaaagcc tagcggcata tcatcaagtc    133260
     aattcctttt gaagctacaa aatgtgctaa tgaacagctc cgtattttcc agagagattc    133320
     agcgggcaac cgcagagaga atgcagcagt atcagcgcga aaccgggaag aagccaagca    133380
     aaaggaagct ccgcaaggtg tcgaaagtaa agatggggca cggcggtacc ttggatccct    133440
     tggcatcggg agtcttggtg gtcggagttg gtacaggcac caagaaactt tcgcagtatc    133500
     tgtctggaac agttaaagtg tatgaaagtg aggcgttgtt cggtgtgtct accacatccg    133560
     gtgatgttga aggtgagata ctatccatgc attcggtgtc tcatttgaag atggacgact    133620
     tgaagagtgt ggaaaagaaa atggtgggct cgttaaaaca gaccccgccg atctttgctg    133680
     cactgaaaat gaacggcaaa cctctccatg aatatgcgcg ggaaggaatt cctttaccca    133740
     gggccattga accgcggcaa gtcgagattt acgatttaga ggttttccca gaatcattaa    133800
     ccagagatca cacttacaag ctgttgcgtc ctgccacgga cgcagacaaa gaagttgttt    133860
     ctgaactaag tcatcaagga aacctactca cagataagct tttcttctct aaacagtttt    133920
     gcgagtctca aggctgggag tctgaggagg caaaagtgga tccgccgatt gcattaagtg    133980
     aagaggaaat gcagcaactt ctggccgagg gggacaacta tagagctcca ctccttcact    134040
     ttaaagcaaa ggtgtcctcg gggacgtata tcagatcatt gattagtgat atcggcaagg    134100
     ccatgagatc ttcctgttac atggtcaagc ttgtgcgctg ccagcagcag gagtgggcat    134160
     tggacaaaag aaatgtgttc agaatggagg acttcaccga gaacgatgaa gccgtatgga    134220
     ccaaggtatt agagcaagta cttgagcaag gctcctcggt cgacatcatg caggaattgg    134280
     cagatgccca agacgccttc aaaaaacaga aagaagattt agagcagcaa ttaaagagtg    134340
     agttgcaaag ttgctcttct gctgaggttg ctgaagtcga cggatccgct aatcctgcta    134400
     agagaccatt ggacgaggat gactcaaaca gtgaggcgaa atcttagcta tttagaatat    134460
     gtaagttcct cgaatttcca acgtaattac aggtgtggaa gtcattttct tcccaaacgc    134520
     tgtaacttag atacaatagc tccgaatgcg atgttttgct aggacaagaa aattgaaaat    134580
     caggcggaca gtcggctgca agattgtagc acatatcaat acatggcagg atctcataat    134640
     aatcatgtat tggttggatt tgctgattaa gaaagtcatt ccggttctgc gttttgtccc    134700
     gatggatgta gtaagaggag ttctccgtag tgcagcgcgg tatagtgaca gcgcacaacc    134760
     aatttctata tgagtttgcg caatcgttgc aagttcgcaa gggggaaaag cgtgcatctt    134820
     tttcagtatc acagggaatc atttgtaaag ctttgctgaa attgctgtat agtgagctag    134880
     caattccgtc ataaatcaaa ctggtgacgg ttttgttggt tccagcggac ttggcagttg    134940
     gcacagaata tgcaactccg tcacaaaagt ccaacccaaa tatcaaagag caggaatcat    135000
     ccgccattgt tgtaaaggtg gcctttgaga ataatatgcc acctgagtca ctcaacactt    135060
     ctgtattatc ggagatcttt ttggtaagat agactccata agttgtggaa tgatttaaac    135120
     ctgtaatgta aaactgctct ttcaccgatc ctccccggac tgtgagggat ttgactattt    135180
     ctggcgtgct ggaattcgac agctctattt taacagcgct attgttgacc gaggatgcta    135240
     agtaaggccc gtcctggaca gcacgtaagg agtgcggcag ggctttatca aaggcgatta    135300
     gttcatcgta ggagtaaaga taaagctcat aaaggcccac gtcataaagt gaagagttcg    135360
     ctgaagtcgt ggttaaagaa gtgacattgc ccgttaccaa aagtgcagaa tctgcgtcag    135420
     agtctacgag ctctacccag gaacgtacgt cccactgaaa caccaaatcg tactgagaaa    135480
     caccgatagt gtaattccag gacaggtctt gtgttgtgga ggtgagctga agcggagaat    135540
     tcgatgtcac attataggct tcgatcacca ggtagaggtt ggaatactcc gtgagattgc    135600
     catcctggtc ctcaagtggc gtggcggcca gcgcctccat gtacccggca gagaaaagtg    135660
     cgcggctgcc cttggatgtg tccgatgtga cctcctggtc gaaggagtac caaacggcta    135720
     gttgcaactc agtagagttg gaaagccgcg cggactccga gtggagattt ccgctgataa    135780
     aaaccagcat gtcgagcttg gacatggtat gagcgtatgt ggagttgatc tggaaagtaa    135840
     agtagtcgcg cttgcctgca gtaatcacgg actcgattgg tgtccattct tggatcaggt    135900
     tggagttcag cagcgaagct ctttgaacct cttcatcgga gaccgaaaag tctctgtagc    135960
     cttgaaccgt tcccagaaac gctgctatcc atgtgattgc ccacaaaccc caatacatct    136020
     catttgtcat gaaagactct tgaaattatg cactttccag ggcccttgaa caaaacacca    136080
     caggactgca ctcagtgaaa attcagcaag cgttaaaact ctcaaattaa gcgcaatcgc    136140
     gaaggttgca aagaacaaat ttctcctgtc gtcgttgcta gtctgtgacc ttgagagatt    136200
     ctcgttcgaa atccaattcg agcgccagta cctaaatata catgggttcc ccatcgcacg    136260
     aagatagtca aaaaatttgg caaaaaataa cgtcacagac aggattcgaa cctgcgcagg    136320
     taaaacccaa tgcctaactc gctttcgaac tgtcgaatag cagggcatcg ccttaaccac    136380
     tcggccactg ggacgcttgg tgatggaaga gtggaaatgg ctctgagata acagaataaa    136440
     ggtttaaggt tattctcagt ttcaggcaag ttcatgcggc aaatgccttc agtatgctgg    136500
     gatcaagagg aagggaccta caggcttctg ggccaaggat ccttgcacca cttttacgct    136560
     taatagccag aagagaactg gcttgtaacg accgtcaggt tagtgcggat agtttcctga    136620
     agagacaata tcatcaggcg tttggccacg ttgatacatt tcagccccac ttgggagcat    136680
     atatgacata gaaagacagt tgttggcgaa agtctgctgt gtgctcagtt tcagttctca    136740
     gttcgacatg cgttgagctc tccggccggc gtgtataaag ttctttaatt gagaacccgg    136800
     ccaaacagtg aggaacttgt ttgtagtagc agtatcctcg gaccaggtgt ttttgtctgg    136860
     acactcgacg actctccgag atggcgagaa aagcgcagcc ccgagatggt agggatggtg    136920
     actagaaccg gccacagcat tgtactattt ttttttaaat ggtcaagttc ggccgtgcgt    136980
     gacctccatc aaccgcgagc tactgtcttg cggccaggaa tcgcccagcg tcatcgcgtt    137040
     gatttatgtt gaagaagttc agagttgcct ctgaaagcag cactaagact gtgccaacgc    137100
     catcaagtac agtacagcga attgcctcgt ataagacgaa acagggctct taagatccca    137160
     ttgattgacc aggcgtttcg aattgtctcc cgctgtttac aatataatct tgttaaacaa    137220
     cttaattatc gtgattgaaa attacaagtc tctaacccag taacccagaa gagcaagatc    137280
     ctaatgaata gaagcgctga gaacctccca tggattgaga agtacaggcc ccagaccttg    137340
     gacgatgttt atggccaaag agagattgtt ggcacggtcc gcaagtttgt gaaggaagga    137400
     aggctgccac atttattatt ctacggccct ccaggaacgg gtaaaacgtc gatgatcgtg    137460
     gcgttgtccc gtgaaattta cggaactaac taccggaata tggtccttga gttgaacgcg    137520
     tccgatgata gaggtattga tgttgtgaga aaccagatca aagaattcgc gtctacacgc    137580
     caaatattct ccaaaggctt caagctgatt atcctggatg aggcggatgc gatgaccaac    137640
     gcagcacaga atgccctgag aagaatcata gaaaagtata caaagaatac cagattctgc    137700
     attttggcca attacgcaca caagttgaca ccagcgctcc ttagtcgatg cactaggttc    137760
     aggttccagc cgcttcctac cgacgctatc gaaaagcgcg tcaacaaggt tctcatcttg    137820
     gagaatctga aactttctcg cgaagcattc acagccctgc taaggctttc caagggcgat    137880
     atgagaagag cgctgaacgt tttgcaagca agcaaggcca ctttggacga tccagacgcc    137940
     gaggtcacag aagataccat ctacgagtgc ataggcgcac cacacccaca agacattgag    138000
     acagcacttg agtcgatgct caaagacgac tggagtactg ctttcttcac cgtaaataaa    138060
     atccgcaccc tcaaaggtct ggctctgatc gacctcgtcg agggtatagt tgagaccttg    138120
     gaggggtatg agttgaagcc agagacaagg gtagagctgc tttgcaagct ctcggatatt    138180
     gagtatgcta tgtcgaaggg tggtaacgat aaagttcaaa gcagcgctgt catcggtgtt    138240
     gtcaaatcta gtttcgaatt agaggcgtaa atgggcacat tccatttgaa actccgcgag    138300
     cccttgctaa gaaggtattc atgtgttatt ttgtccggat atctctcaag aatcttgcat    138360
     taaatgatta ttatatacac gtacctagtt agataccata gcgttcaaag ccctttgttt    138420
     ctgtgttgtc ttcgatacgc gcttcaagct catcgctctt tctggaactc ttttcgtcaa    138480
     catcttccaa agcgacggcg ttctcgagcc tgtgatctct caagaagaag gccgacaata    138540
     gaagcgtcac acagaaacat aggccgacaa ttgataaaat cctttgaaca acccggtatg    138600
     cagcaacaac ttccattctt tcaggagtgc cccaaaggta ttcttcaatg aaaacaaacg    138660
     gggacccata tgcgagggtg taagtggcca catccgtgat tctcttgcgc agctctcgag    138720
     gcagaatgtt ggtccagatg gcgcctgaaa tggacgcgcc cagagcagag ccaatattgt    138780
     agtgtgacaa gtatagtgcg gtaatgactg ccatatcttg gtgggatttg gtagaggctt    138840
     gaatcgaagt ttgggtagta taggtgaaga agcccgcgcc aaacccaagc aagcaaaggg    138900
     acccgacgat gcctgagtgc gaggaagagt cgccacgata gtgtactaaa agaccaaagg    138960
     cgacaaacca gcaagcaatc ccgaacaaga tgaatttctt ggtcctcctt gcgtagacta    139020
     tcactccgcc aagcaagaac cctgtaatca ctgacacaaa cgagtacaaa gaggttattc    139080
     tcgcggcaga tttggcggtc tcattgacag caaccatgag cacggtgtac atgtagtcgc    139140
     cctgcatgta ccacacgaag ttaatgtgga tggcgatgat caaggcggac catatgcctc    139200
     tgtccttgac gaggctccaa ggaaccaagg ggtgccttga gtacttacct tcccatagca    139260
     agaacagcgg caacgcgacg caccaaccaa tgacctcggg aacgatgatc tcagcccgct    139320
     tccatttgct ctgcagactt ccggccagtg tgaaaggcac taggatacaa ccgaagacaa    139380
     cgcacaccaa aagcaagcca agcaggtcaa gtctccagaa gaaaacttcg accaggtact    139440
     gagaccaagg catatgcttg tagagcagga cctcgctctc taattgatct ttagcatttt    139500
     tgtgcgccag gaaacgcatg tggaggatac aagcgaatag tgggacacac gacaggggca    139560
     caatgaacgc ccacattccg attccccatt tccagttcat cccaagcgcc tctagcgcgt    139620
     taccggagat ccaggtgttg atgatgaatg ggagcgcagg gacaaaagac gccatcagcc    139680
     tccagttcaa attggaaaag tccatggcaa tgatctcgag gatcaggatg atgccggtgt    139740
     agcccagctg gtagatacac gcgcccgcgg catatctcgt gatgttcgtg gcctgcgagt    139800
     caatgatagt gcccaccgcg tacagaacca ccgccagcgc caggatggtc attctgccga    139860
     agatgtcgga cgctctggca aagcagattt ggccggctgc ggcgattacc gccttcacac    139920
     agttgatcgt tgcgagcagc gagtggctcc catatgagct tgtggcgtaa gcctgcaaac    139980
     tggaccgcac cattccatcg agtccgtatg catatgctac caggaacaat gagaagaaaa    140040
     gcgcaacacg gtacgcaaag tgtgagtact gcgcagcgta cacttcaatg ttgttgacac    140100
     ccgcatcctt tctgcgggcc aggatctgct ccgcgtggtc tttggcgtcc ttggcaggat    140160
     ggccttcaag actcattttc tttagcttat tacgcgagtt cttgcccgaa tggagaagaa    140220
     tggagaaact aaccattgta cgtttcctga gagggaagca gtcaatttaa cagtgtcggg    140280
     gctcatccct acagccgtat agacgcatcg cgttggcgtg atgggtttat taaaatagca    140340
     tgtacaccca tgttcttagg tgcaatcaag ttttttctgg gcagatgccg cagcagccgt    140400
     ggccgtcatc ccaattgttc tctagtcgac gcccaacggc atcgtgcaga gcagttgcga    140460
     tggtgaagag cgcgaactga ggcgtttcga aggctaacgc agggttgctc gctgaaacta    140520
     aagtactggt gatcagggcc atgcagatga gcgtgcggag aaacttggcc ctggatcgaa    140580
     ccacagaggt gggccagaaa gcactggtgc tctgctaacg agcagttacc accagatacg    140640
     cagaggcagc ggcgtagcag cggcgtagca ctgctctcga aggagcgagg tagtgtaaca    140700
     gcacgtgatg ttctggcacg tgacactggt gtaaagcacg tgcttttatt gatgtcacat    140760
     gtggtatttc ttacgcgggc agggcccgca ggaaaggcct ttcggcgcca ggcgccaggc    140820
     gcggtggagc cgtcggccag cgacgcactc gcgaaaaccg ccaaaacgtt aagctcacta    140880
     gtggacacgc ataccgcccc cggaaagtca tttcttccac gccaaaaaca tctcagcgac    140940
     gggaaaacaa cgtgcgtacc gcgccactga acagattgcc cgcttgggct atatgctcga    141000
     tcgcatcata ttcgcgcgcc gacgtcttct gtaacgcctc cttggcgacg agcacgcgga    141060
     ttcccccttt gggcaaggca gctttcgtga atcctggccc gatgtcgtga gttgattatc    141120
     aacggtcgcg aaaattgaag atgtgcggta gaaggaagcg aaaagtgaaa gttcaccgga    141180
     ggctgtaacc gcgaaaccgc gaaaaaaagg tttagtcgag aggatcaaca agcgcgaaga    141240
     gatggagtag cggaagcgca gcgtaacggg caggaagtgt atataagaat gcgtagatgc    141300
     ggaatgtggg ccggtggagc atgcggggga caatcaacat taagcataac agcctcaaac    141360
     gagaattctg tcaagatgag cgacaccaag gtgctcaaga tcctattcaa atcgccagta    141420
     acggacgaca tgatccggta cctgaccaac accacgctga gcgtattgcc ctgcgcgcgg    141480
     gagccccgcc aggcgtaccc ctcgccgccc tcgagtcccg gtgctgcgtc caagcgcgcg    141540
     ctgccctctc taatgacgtt catcacgcgg ctggtccgct acacaaacgt gtacacgtcc    141600
     acgctgctga ccgcgacgtg ctacctggag aagctgcggc ggctactgcc gcgcgacgcg    141660
     cacggactgc cctccacggg ccaccggatc ttcctggcgt gtctgatcct gagcgcgaag    141720
     taccacaacg actcgtcgcc gcagaacaag cactgggccg cgtacacgga cgggcttttc    141780
     tgtctggatg acgtgaacct tatggagcgc cagctgctgc agctactgga ctgggatcta    141840
     cgcgtggaag agcaggagct gtgcgacgcg ctagaaccgc tgctagagcc cattcgccac    141900
     gacctggcgc gctcccgtaa ggccatggcc cgcaactact accatcaaag aaatatgagc    141960
     acgtgctcaa gcacgagcac actagtctcg acgccgagcc taccatcgct ggcgagcatg    142020
     aaatcgctga cagccatgaa gtcgctgccg tcgctgccgc ggctaccaag caaggcctcg    142080
     ctctacgcgc cgctgtactc gcagtgcgac tacagcagcg cgacactagt atagacgtat    142140
     atatgggatt aaaggatatg gtttgaaaga tacaaagcag cggacgcggg ctccgatccc    142200
     cgcgcgcgca attcgactcg cgctgcatgc ggagttcagt ttccacctgc gcggcctgga    142260
     caccgcctgc ggtcgatcac gtgaacgtcg cgtgccactc gcgtcaagtg ccctcgtctc    142320
     gtccgcccgg cggcggcacc atggatattc gggtaacccc atcttccaaa ataatataaa    142380
     aagctcccac cactctgtcg tatttacaaa cctccaatac ctttgtctac cagtggcttt    142440
     gaagtcaaag acgtcaagct gcaacgcaga ccccctgcaa gcgtatgcgt gcgcgcatgc    142500
     gcgtcgcgaa tacccacctc cataagcgta tggattgccg gattcgcgtt ttcgtagcga    142560
     tctccaagtg atgagtgaaa tgctgtgcac cagtctgaaa ggaccacatg tactcgtggt    142620
     ccgttgaagc attaagtaaa cctatattat ctgatggagc gtaaattctt gacacatagt    142680
     attcccgccc gcgatagtga acgactcagt tcatacgcaa cggttccagg ccctgcccga    142740
     gtcagcgttt ctctggggcc agagctcgct cgcgaatctg tttcaaagac cgtttcagat    142800
     tggcttggtg catcccgccc cggaggctgc gccgctgcac tcgtatccca ggcccttcct    142860
     cggcccacgc aatacactgc attgtgcgga acgtgcggca cgccgcgcgc gctggatccg    142920
     cctcgccatt atcggccctt agttatgcag tcgcgccctc caacgggcgc acccgcgcag    142980
     gtgcctcggc gacgccgcag ccgtaacacg cgtctgcgtc tctaaatccg atacctgatc    143040
     aagttttcga tactcaatca agttcccgat tcttcaacat tctctgcgct gtacaggcac    143100
     gcgtcatgtt atgtaaggtc gcgccgcgag ctcggtcctc tgcgcaggcc tctaggtgca    143160
     cgcgttgccg cccagcctcg cgatacatac cgcatacaag gtttgaaccg tccactcgcg    143220
     aaaacgaaac gcggcggatc aaacttcgag acccggcggg gccgaaatca gggcggcgct    143280
     aaacgtgtcg aggaggcagt atttaaaacc agcgattgtg cgtcccttcg cggcgtcggg    143340
     taggcactct ctctttcact cttctcctga tctgtaccac ggacgcaaga ccgaatcgcc    143400
     ggctcttcct cacatcttcg ttccttcctt tcattccaga gccatgaccg aacaaagtac    143460
     cccgctgtgg ttgcaggacc gcgacgcagt gattgcacag acgcccgcgc acatgtggcg    143520
     cctgggcaag cccacataca agttcacaga cagaaggctc aaccgcgagc gccaggtgca    143580
     cttcgagccc ggcagcctgg gggacctggt gaccaacctg gcgcgtgtgt tcgagatgga    143640
     ggccaccaac aaggcgaacc ccgacgactg gatctcggtg gaccctcgcg tgttcaggat    143700
     gaccgtcaac ggcagccgcg agtacacggt gcaggatatc gtgaccaagg gaggctacaa    143760
     cgtgtttctc ggcgacctgc ccaactacaa ggcgtccgag agcgactacg cgaagtccga    143820
     ggacgcgttc cacaaggcct tccgcaccgg gtttctgtgg gagatcctga cgctggaggc    143880
     cgagctgccg gtcgcgacgt tcacgtggcg ccactggggg cagcagaacg gcgtgttcaa    143940
     cgggcacaag ggcgacggca gcgtgctgga catcaagggc accacgcgcg ccaccctcaa    144000
     cgacaagctg cagctggtgc gcctcgagca caccttcgac gccccgggca tgatcgacac    144060
     gctgtcgggc gtgtgcccaa tggctcactg agtgcggctg tatttatcgc tgtgggcggc    144120
     tatgcgcgcc gcgtgtgcgc gcccacgagc cacctatgca gacttacgta atacactgta    144180
     acccacacat gcgtctattt ttagcatgag tcacgtgccg attgccggcg cccgttattg    144240
     tcacgtggct cggatcgggc gaaagcagcc gcgttcgtca cgtgccgctc caagccctcg    144300
     ccgccgccgc gagacgtagg gtcccgcgtc ccgcggccac caccgcgcgc tgttcctacg    144360
     cccaggctgg ggcaagctct gcggcagctc tgagcgcgtc cgtgtcacac gattatatcc    144420
     agccctgctc cgcctccatc gggcccgtgc ccctgcgggg ccttctagct ggctggccca    144480
     ccgctttgtg cagtttgtta tgccactacc gttctcaagt atttttactg tttttttttt    144540
     tttttctttc cgcctcttca gccttctctc ctctaccgca ggactgttta ccgctcaggc    144600
     gcttcaaggg ggccccacga accgtctggg caaccgcgta gatgaggcga gcaagcgatg    144660
     gcgctcgcgc aaaaacgcaa atgtatataa acagcatagg aaatccaggg gagccaagat    144720
     ctgctatctc tcgagattcc ctcttcacta ttatagcaag ttgcaagccc acgcatcgtt    144780
     agctttatct acatattagt acatatcccc cgatgtccga gtcgctagaa cacaaggctg    144840
     aacaagctca gcaagccgct gctgtgaacg cggagcacgc gcaggccaag gtcgccgagg    144900
     ttggcgacaa cgccgagcgc tccgcgcagg agactcaaga gaaggctgtg gcggctgccg    144960
     aggagcaggc gcaggaggcc aagaaggagg ccaacaaagt tgaggagtcc gccaagaagg    145020
     aggccgaggg tgtgaaggag tctgcccagg acaaggttga tgaggtcaag aagaccaccg    145080
     cggccgagaa gtccgagacc gctgcggccg agggcgagaa ggtctcgcca tggaagcgtt    145140
     tcgtcgccaa gctcaagaag ctcttgaact aagcgagcga gcgcgcgggc actcgaggcc    145200
     cgctcttctc cctccccgat atacctacga tttaataata agtaattgag atccctaata    145260
     ataccgataa taatacagac tggagattag acttcgcggg cgcgaaaatc gcagcgggcg    145320
     cggcggcgtg ggagcgatgt acacacgtga tagtcgcgtg accgtgaggc gacggcgatg    145380
     tgccgttgtt cgtgctacgt ggtcacgtgc ccgcgtcagt atccgttccc cgtgacaaac    145440
     gcgctcacag ctaatttcca cacacttggc tcccgcatcg caagatcttt agagctcttc    145500
     ggtccgcaga ctgactccac ctcattgcaa ccacagcttc gcatgttcgc aaaccccgcc    145560
     gccgctcccg cagcgtcgct tggcttcgcg ccctcacagc agcctcagca gtcccagcaa    145620
     ccgcagcacg cccagcaagc ccagcaagcc caacaggccc agcaagctca gcagcccgga    145680
     tccactgctg ccgccgccgc cgccaaggcc aacctccacg cgcttgacga ccccaatgtc    145740
     taccactgga tctgccagct cacctacggc cccaacaagg agcaggcgct gctcgagctc    145800
     ggccgcaaac gcgagcagta cgaagacctc gccgtcgtgc tgtggtcctc gttcggcgtc    145860
     atcaccgcgc tgctcaacga gatcacctcc gtctacccca tgctctcgcc ccccgtgctc    145920
     tccaatcagc tcagcaaccg cgtgtgcaac gcgctggtgc tcctccagtg cgtcgcgtcc    145980
     cacccggaaa ccaagaatct tttcctgcag gcccacattc cgctgctgct cttccccttc    146040
     ctcaacacca cctccagaca gcgcaccttc gagtacctgc gtctgacctc gctcggcgtc    146100
     attggcgctc tcgtcaagat cgactccgcg gaagtcatcg cctttctgtt gaggaccgac    146160
     atcatcccgc tctgtcttcg catcatggag tcctcctccg agctctccaa aactgtcgcc    146220
     atcttcatcc tgcaaaagat cctgctggat gacgctggcc tgcaatatat atgtgctacc    146280
     ccggagcgct tcctcgcggt ttcccaggtg ctgacataca tggttgagca gctaacactt    146340
     cagcagacgc ccgggcgtct cctcaagcac gttgtgagat gctatctgcg cctgagtgac    146400
     aacctcgagg ccagaagact cctaaagcag gtcttgcccc gccagctcaa ggacaacaca    146460
     tttggagagg tcctcagaga cgacctcggc accaagcgct gcctcgcaca gcttctgctc    146520
     acgctcaatg aggactaaaa gcatgctgca gggtgggccg cgctgcgccc accggactgc    146580
     cccgggcccc catctcccgc cctcctgtat aataatctct aaaccttcca tcacagatca    146640
     cgtgtgatcg gtacttcatg ctcgcggtca cgtttgccct tgtttgatct tttcgtacga    146700
     gtgtatgggc caaaaaaaat gcacacttca gtatcacata tggaatcgtg gcaaaacata    146760
     caacttcctt tcaaaagctg ttcgaccagc aaccggactg agactcgata gcatcaattg    146820
     aataggctct gtgccgctct cgaccctctc taatgtctac ccacacttat aagaagtttg    146880
     aggaggccga ctcgggcatc ttgcccgaca aaatgacaat ctaccaggac tgtctaaacg    146940
     cctttaatga gtctcccgtc aacgctaagc gttgccgact cctgatttct cgtttattgc    147000
     agctgctagc gcagggccaa accttcccac gcacagaggc cacggctctc ttcttcgcca    147060
     tttccaagct tttccagcac cctaatgact ctctgagaca agccgtgtat ctggccatca    147120
     aagagctgag cgcagtctcc gacgacgtcc ttatggcgac atcatccatc atgaaggacg    147180
     tgcagaacgg gtccgacatg atcaagccca atgcaatccg ttctttgacc cgcgttcttg    147240
     acgagtcgac tgccttctca gccgagcggt tgttcaagtc cgcagtggtc agcaagcacc    147300
     cttctatctc gtcagcagca ctcgtgagct cttaccacct tcttccggtg gccgaaagta    147360
     cggttaagag gtacgccaac gagacccagg aagcagtttc agacctgaaa acctacccct    147420
     accaaagcgg gacctctgag cactacccaa actctacgta catcgcgcag taccatgctt    147480
     tgggcttgct gtatctgctg agaaaacatg ataaagttgc gctcatgaag ttggtccagc    147540
     agttttctgc cggcaatctt ctcaagaacc agcttgctca agtccaattg gtcaagctcg    147600
     ttgggagtct tttacagaaa gacccacagc tggtcacgca gttcactcct ctgctgctga    147660
     gctggctttc aaacaagtat gagtctgttc agcttgaaga cgctaagctg atcacctccc    147720
     taccagaccg cttcgtttcc ccagagatat ttgcgtctgc agtgcagact ctgcaaggcc    147780
     ttctcacagt gccacgcgtc actaccaggt ttgccgctgt aagagtgctg aacagaattt    147840
     ccatggtcgc ccctgagaag attgtcgtgt gcaaccctga gttggaatct cttatcaacg    147900
     atagcaacag aaatgtttcc acttatgcca ttacctcgct actcaaaact ggcacatcca    147960
     ataatattgc atctttgatc aaaactatta ccaactttat tcacgagatt tcggatgact    148020
     tcaagattat catcatcgat gccgttcgta ccatggcgct gaagttccct gaggagtgga    148080
     agtccatttt gaacttctta atcaatgttt tgaagcaagg cgaaggagga ttcgagttca    148140
     agaacagtat agttgaagct ttgttcgacc tggttcagtt tgtgccacaa tctagagagc    148200
     tcgcctttga aaacctgtgc gacttcattg aggattgcga atacaacgaa attttggtga    148260
     gaattcttca tattttgggt aaagagggtc caagtatgaa aattccttct ctctacgtca    148320
     gacatatcta caacagagtt gtcttggaga actcaatagt gagatcagcg gctgttgtag    148380
     ccttatcaaa atttgcgttg gtcaagaacg accctactct cgtagaatct attgaaatcc    148440
     tattgagaag aatttcaaac gatgctgacg atgaggttag agaccgtgca acaatttccc    148500
     ttgaattcat cgaatcgatt aagtccaaag agggtgctag ctcttctgca gcagaagatc    148560
     tccttcaatc caagtattcg tacgacttgg tttctctgga gtctaagcta agtcagtaca    148620
     tgtccgccaa gcaggaatcg ttcaaggcac cattcgattc ttcctcggtt catcgctaca    148680
     ctgaggacga aagaaaagct atcgacctca agagaaagca agaacaactg ttctcagccc    148740
     tgccttccgc tggtaaaagc aagcgcgccg cttcatcaag tcaagatgcc gagaagagga    148800
     acgggtccta cgcaggtccc gcttctaatg aggtcgacca ggacttgcaa tccacgaagt    148860
     tcgttgagga actggaatcc atcgaagagc tcaagtcttt gggtcctatc ataaacactt    148920
     ctaaggaggt tccattgact gaaacggagg ccgagtttgt tgtgtcaggc gtaaagcacc    148980
     ttttcaaaaa ccatgtggtg ctccaattcc acatcacaaa taccttaact gacgtggctc    149040
     tcgacaatgt ttctgttggc tgtacaatgg agcaggaaga ttccaccgca ctacaggaaa    149100
     cctcaactat ccctgttgat agaattatgc cctccgagac cttcgcgtgt tatgttgtgt    149160
     atgaaaagtc ggaagaggtc gttacagaag gcttcttgaa cacattgtac ttcaccacaa    149220
     gagaattgga tgccactact cacgagccat tcgctggtga cgaaggattc caagacgaat    149280
     atgagattga ttctcttttc ctcaccgcag gcgattatat caaaggctct ttcgtgggca    149340
     acttctcagc atgcttcgat gaacttccac actctgaagt cgctgtttac aacattaagg    149400
     aaaacatatc actgcaggaa gttgtggaca aactggttgt gaacaccagc tgtttaactc    149460
     tggacaacac gcagtttgcc cctacagatt ctaactctca cacacttaag ttgtttggaa    149520
     aaagcgtctt gaacggcgct agggtcgccc tggtggttcg tatgatcaag agctccaaag    149580
     gcattgcttt gaagggagag attagatctg atgacgccaa cctatgtaat gatgttgtcg    149640
     atggcttgat ttagaatttt gcctatgtta gatgtgtata gcaagtgaac aattactgaa    149700
     atccaaagca gtagctgaac tgccttgtca cttcatataa gagcgtttac aagttggcgt    149760
     atctttcatg tttagttttt gtcacctcct agatttcatg tttgatcagc ttgtcgaaac    149820
     atttacttta ttcaatatca tatccaaatg aacacaatat ggatgaggaa gaattgcaat    149880
     tgaagaagga gctcagagaa aagaaggcac aggagttggc aagacgcaag cgcgccagag    149940
     acaacactga aaggaaggag gacaccaaaa ggccactaaa aaattgcgca atctacatct    150000
     cccatctacc tttagaggta acaaaagacg aagtaataga agagttcacg aagtatggag    150060
     ttattaggaa ggacttgaaa tccagtgagc ccaagtgcaa gttctattat ggtgttgatg    150120
     ggagctttga gggtgccgct ttgattgtgt acatgcgacc tgaaagtgtg cgaatggcag    150180
     ttgatttaat ggatgggtac agctttatgg gtaataaatt aaaagtagag gaggccacat    150240
     tcaagaagga gccaaaggat gataagaaaa gccccaatgc ctcccaagaa ggttcgcgtg    150300
     atgtttctgc tgaacctaaa ctaaataaca tacatgccaa gcttaatgaa caggaacgcg    150360
     aactccaaga ctgggacgac accacagacg aaaaaactac cccacgggag gaaggaagtg    150420
     aggtcgatag cataccagat gaatcggaaa atgcttcttc ccgcactgtt gttctcgcga    150480
     atgttttaga tctgtacgcg aatctcgcac cgcaacagat agccgaggta gctgctgatc    150540
     ttaaagaagg ttgcgaagcc ataggaagcg tttcatcttt cgagtttgac gaagtgttgg    150600
     ggcaagctaa agtagagtac aagtccagcg aaatagctca aaaatgttgc cagttgatga    150660
     atgggcgata cttcgatgga agaaagcttg ttgcttacaa cctggaacaa ggtgaagaag    150720
     aggaagaaga cgaggttgcg gaatggtgaa agaagcgttt ggtaaaagaa acgcttacag    150780
     aaagcctttg gggcctgaaa tattaagctc tacagtcatg gcggcgcagg attagaattc    150840
     gatttgctgc attgctggcg ctttgcctac tatagcgcaa tccactttaa atgtgtagat    150900
     taagcccgct tcgaaccttc ctttgacaag gacaaggact atccgaagcc aaatgaggtt    150960
     cttttagttc tgtgaaatca atttccccag gcccaaaaca ccgaaggggg ctgcaacctt    151020
     ttgccctcga ccaacatagc agcggccaaa tactgcgtaa tcgccacatc tcccatacgc    151080
     cctcaggaaa acgtatggct gacctgtaag aaaacattcg agcaacctct cgtagtgtta    151140
     attttgaaaa agaaatacgt ttctataaga agaggctttt acaaatgctt tattgaaggc    151200
     tggcgaacgt tgaacgatgc ttaaggatag aatgttaagt atcttaaaat aacgatttta    151260
     gccctgctat tcttgctaaa ctaacgacct cgggtatcag tgccgcacct ttgttataaa    151320
     ggtaaaatca aaaaaaaatt gagcggtacg agaatcgaac ccgtgtcccc accttggaag    151380
     ggtgggatga taaccactac actaaccgcc cagtgcttga gaatagggtc tccatacctc    151440
     aatctatcta ctcataacta gttttgcata atgtcataaa acaataaagg aacaaggata    151500
     ttctgagaca acgaaggaac aacatcagag ataatgagga acactagaga taatgaggct    151560
     tgcactaggt ctccggatct ataactataa gtactattgc atccaaggct cagtatgaga    151620
     ttaagtagaa gaaaggaaga aggatcctcg aatggaagaa taatcgcgac cgtatagagg    151680
     ctattaaccg ccaacttcat cataatccag aggctcataa taacatacga cacataatga    151740
     cagacccggc aagctaattc tggccgacat tgttaaagtt ctcttatacg cgtcgtattg    151800
     caccacttag gtatcgagag cgctaatttc tcaagagtcg aacggtcaac gtgcttactc    151860
     ccaccagcta cttagtgacc ccctagcaat gccgaacctc cagtagaact cagtagccat    151920
     atgtttagca gcgtatttat tgacttcatc acgtgaacat acaccgacgt gggatgggca    151980
     ttcccaaatg taggcgccta gtacggagta accggcgagg ctgtagtgga gctactagcg    152040
     ccgcaaaaga ataggctctt atagcttcat ggctatgaga gaaactctca tttgtgaatt    152100
     tttagaaagc acgtgacaga ttccaagatt tcagttgaac ccgcttgaaa aaaacgctgc    152160
     gaggacctga aggttaatga agagctagcc agaaccatcg tctgaccctc gcagcccagt    152220
     gcttagtaca tagcgctccg tcagaaatta gtgattaccg ttgtatttgc tccgttgaag    152280
     gtgacatcct tccaatagca tatgacgttc ataaaagaaa aattttcaga ttgagcctga    152340
     gggactctta gaatgaattt tcatgaaaaa aagtccacca gctaactacc aacttacatt    152400
     tgagcaattc tgattcttgt tcaaaaatct tctcttgatt tctaactaaa ctcaaatcca    152460
     gagtagtaat aaagaccaaa aatgccacca aagaagcagg tagaagagaa aaaggtcctt    152520
     ctaggccgtc caggtaacaa cttgaaggct ggtatcgtcg gtcttgccaa cgtcggtaag    152580
     tcgaccttct tccaggccat taccagatgt ccgctcggaa accccgccaa ctacccattt    152640
     gctacaattg accctgaaga ggctcgtgtc attgtgcctt ctccaagatt tgacgcgctg    152700
     tgtgacatct acaagccagc gtccaaggtt ccagcgcatc tgacagttta cgatatcgcc    152760
     ggtttgacca agggtgcctc cgccggtgag ggtctcggaa atgcgttttt gtcgcacatc    152820
     agagcggtgg actccatcta ccaggtcgtg cgttgctttg acgacgccga gattatccac    152880
     atcgagggtg acgtcgaccc agtacgtgac ttggacatca tcagcaccga gctaagactc    152940
     aaagatattg agtttgctga aaagcacttg gagaacgttc acaagattac caagagagga    153000
     ggtcagtcct tggaagtcaa gcagaagaag gaggaagcta ttttggtcga gaagatcatc    153060
     gagctgctaa aatctggcca gagagttgct aaccagaact ggaccacaaa ggaagtcgag    153120
     gtgatcaact ccatgttctt gctgaccgct aagccttcca tctacttgat caacttgtct    153180
     gagagagact tcatcagaaa gaagaacaag cacctgatga gaatcaaaga atggattgac    153240
     aagtactcta ctggtgactt ggtcatccca ttctccgtgt gcctggaaga aagactatcc    153300
     cacatgtctc ctgaggaggc tgaggaggag ttgaagaact tgaaggtcga gtcagctctg    153360
     ccaaagatcg tcaccaccat gagacaaaag ttggacttga tttccttttt cacttctggt    153420
     gccgacgagg tccgcgaatg gactattaga agaggcacaa aggctccaca agcagctggt    153480
     gtcatccata atgatctgat gaacaccttt atccttgctc aagtgatgaa gtacgaagac    153540
     gtcgttgagt acaaggatga agtcgctatc aaggctgccg gtaagatgca acagaagggt    153600
     aaggaatacg tcgttgaaga tggcgatgtc atctacttca gagccggtgc aggcaagaac    153660
     tgagtactga cctgaagtct cttccaaaac ctgcattcat gaatcaccgt cgacgtgtat    153720
     aacttcaacc gcgtaaactt cgtttaataa ctatatacaa gaagcgtgat atataatcat    153780
     gccagacccg aaggtgtagc agcagcacct tctagttgaa gaggaaagaa taccattttt    153840
     ctttacgctt ttcacgttgc tctcttggca catacgcttt gacatgctcc tctatcttcg    153900
     cgacgccggt ctccgcgtca tactgccttc ctaacgcatc gataaattgg ccctcggggt    153960
     ccattaaata gaagaagatc gaatgatcga ccaagtaatc ttgtccaggc ttcaaagatg    154020
     gtggggtcga gaagtaaacg cggtattgtt tacaagcgtt tttgatgtca ttgtactcgc    154080
     cagtgaggcc aatcaagtcg ggatgaaact cgctcaagta ttctttcaaa acgtgagggg    154140
     ggtctctagc tgggtcacag gtaataaaaa taggctgaag ctcgattccc tttttcttga    154200
     gcccatccaa ccactcactg agcttgtcga gttcgtcagg gcagatatca ggacagtgtg    154260
     aaaacccgaa gtagataata gaaaacttgc cgagcaagtt tttctcagtg aactcattgc    154320
     cgttgaaatc cacgagcttg aaaggccctc caacaagcgg cttcccatac cctctattgg    154380
     cttctgcctc tttttcgatc tcaagtcttc gtttctcttt ggagaaaaag tagtacaagg    154440
     tccctccgag ggtaagtacc aaggctgcag ccttccatgt cgcgaactca atagagccgc    154500
     tcgtggcttt ctgtgatttg gtctcggtac cgccaatcgc gattctgctg agaggcttac    154560
     gcttggggtc tgcatcttca aaagttgtac tcttaggagg tgtgttcccg gagaatgcgc    154620
     tctgatcaga tggatctgta gaggaggagg ccccagaagg cgcgcctccg cgcggcgtca    154680
     ccctcgacct tgatgtcccc tgatcttcta cgcgaagaca actgcgcgta gatagaggcc    154740
     ttagtgcata ccctgataag cgagtggacc ttttcaaaac agtaaaaacc ccagtccttg    154800
     acaacataat ccagataatc cagcttcccg ctctcgaagt tggatactga tatcaaagtt    154860
     tcattagttt aaattcatct taatatgctc attcattttg gatattttct ctccgagggc    154920
     acttggaaaa ttctataatt ccgagggtca acaatcaaga tgggaaaata gctttcgggc    154980
     atattaacaa tgatgacaga ccgagttcaa gttccatttg tgatgccagc aagcgtgaaa    155040
     accgacgccg tcagcttatt cctcaggaga tgcccggaat tttactagct caattctaaa    155100
     ttaagggtcg catgccccct ttagtggaca ctaaagatga atagggtttt cgcaaagctt    155160
     tgcaggggca gcctccgaac aaacgacgtg ctcgaggaag gcgcggcttg aaacgggccc    155220
     acaaattacc ggggttgctt ctagactcga taccgatggc tttgcgtaaa gcacatcgaa    155280
     attacataat ctacaggata cagacagctt gttgatgatt ttccacttta ggacatataa    155340
     cggcagtgtg cgggaccaaa caatagacat aaaagaagca ggccctgttt caatgctccc    155400
     aaccttcgct aggagtaagt gcattgggcg atggactaca atccgtttgt cgtcgacacg    155460
     aacaacgcgt cccctgtcag gtcgcctcaa cgggcggcca ggaggggaga atcgccctgg    155520
     agatcccaat actctgctaa ctcttccaat gaaaatgacc tgtcaactgc attccaaggg    155580
     ttcccgcaag ctgcacaggt tcagcctcaa tcgccctcta aggctgctgc aaaatactct    155640
     ccccaacgaa gaaacatctt tgctcgcgac agcgcgccca gcagcccgct gcgccaagac    155700
     cgctacacag ctaacatgag agagtctccc cataggaacg cccgcgcagt gattgaaatt    155760
     gacgaggcct ctgacgatga cgaggagcag gatctatatg atatttatgc gcaacaggcc    155820
     gacggctctc cttcaagagc agcgtcccgt gccactagat ccacctactc tttcgaaagc    155880
     taccggaagt ctctagatga tgatagcacc atatactccg gggacacgtt cgagcaaacg    155940
     caattccagg ttaaccaccc tcaaaagaac tacatcagac gcggtaagtc cgaagtcaga    156000
     aggctaccgg ctccgacctc taagaaaaac atcttaaaac tagacaaccc aattccaaga    156060
     gggctgctcg agatcttacc acgccgcgac tctcttgagt tcaccgaaat gagatacacg    156120
     gcttgtacat ctgagcccga caactatgtc aatgaaggtt attctctaag atttgcggaa    156180
     atgaacagag agtgtcagat agccatctgt gtcacaatgt acaatgaaga caaatttgcc    156240
     ttatctagca ctctgcactc cattatgaga aacatcacac acatgtgcaa gcgcaaaagg    156300
     tcccatgtat ggggtcctca aggctggaag aaaatccagg ttatcattgt cagcgacggt    156360
     agaaacaata ttaacaaagg atccttggat tacttgagtg cactaggtgt ctatcaggaa    156420
     gacatggcga aatccacagt taacggtgag cctgtgaagg cccatatttt cgaactcacc    156480
     acccaagttt caatcgattc ccacctggat tacgtgagta aagatatcgt acctgtgcag    156540
     gtagtgtttt gcttgaagga ggaaaaccag aaaaaaatca actctcatcg ttggttgttc    156600
     aacgctttct gcccgatatt agatcccact gtcgttgttc tggtcgatgt cgggacaaag    156660
     ctaaatgact cagccatcta tcacttgtgg aaagcctttg acagggactc caacgttgct    156720
     ggagctgcag gtcaaatcaa aactatgaag ggaaaatggg gtagaaaact gttgaatccg    156780
     ctagttgcct ctcagaattt tgaatacaaa atgtccaata ttcttgacaa gcctttagaa    156840
     agtgtgttcg gatacatttc cgttcttcca ggtgcattgt ccgcctatcg ttaccgtgct    156900
     ctcaaaaacc atgcggacgg aactggtcct ctaaattcgt atttcttggg cgaaacgcaa    156960
     gagggccggc agcacgatgt gttcactgct aacatgtact tagccgaaga tagaatcctt    157020
     tgctgggaac tagttgctaa aagagacgcc aaatgggtct tgaaatacgt taaggaagct    157080
     accggagaga ctgatgtgcc ggaagagcca ccagagttca tttctcagag aagacgttgg    157140
     ctgaacggtg ctatgtttgc tgcactttat gctcaactgc attttactca aatttggaaa    157200
     acaaaacatt cggctactcg aaagatattt ttccacttag agttcttcta ccaatttgtt    157260
     caaatgctct tttcatggtt ctctatatcg aacttctttt tgacgttcta ttttttggcc    157320
     ggatcaatga acaaactaat gaaacatgga gacgtgcttt tcactttctt caaatacctg    157380
     gtcatctgtg acttagccgc tctctttatc atatccatgg gcaacagacc ccaaggtgcc    157440
     aaccatttgt ttatcatatc gatgattata ctttccattt gctcaactta cgcactagtt    157500
     tgtggccttg tcttttccat caaaactttg caaaaccccg gagaaagcag catggtattc    157560
     gtgaatatag ttgtttcctt actttcgact tacggcctat acgcgttcac ttccatcatg    157620
     taccttgatc cttggcatct catcacatca tttgtgcagt atcttctcat gcttccgtca    157680
     tttatttgta cgctacaaat ctttgccttt tgcaacacgc atgatgtttc ctggggcaca    157740
     aagggctcaa ctcaggacgt aaagccaaaa tccgaagcta ccgttaaaca gggtcctaat    157800
     gggcagcaaa tcgtggaggg tactgaatgg ccgcaagaag tcgataagaa atacgcagag    157860
     attaagagta gattaaagga acaagagatc attgaaccaa aaattgacga agctcagaag    157920
     aacaacgatt attatcgtga cataaggaca cgtattgtaa tgttgtggat gctttcgaac    157980
     cttgttctga tgatgattgt tacccaggtc tatgggcccg aagacacagc gaagaacaag    158040
     tacctgacgt ttattttatg gtcagttgcg atcctggccc ttttcagagc tttaggatca    158100
     atggctttct tatttttgaa aagcttgcgt gcgattgtta gcttcaagca caaagcagag    158160
     gacagcggct ctctcaatat acctagtgct aaaaacttgt ttagcaagcc aagcaaaatg    158220
     taaattaaag atataaaatg ttaaatagag atggataata ttttttgcat tcgatgaact    158280
     tttttggagt gtcactgtat ttgcaatgta tttatgtggg gctgaaaatt gcttaacact    158340
     agcgatttag tagcctctga tagctctatg attatcgtag ttcacaatgg cctgtaacag    158400
     caccttgaaa ccgttttcga cttcttcggc tgacgaatac tcatagaagt tatgagaaag    158460
     cccgtctttt gaaggaataa agatcatcga ggttggaaca tgcaatgctg tttgacagga    158520
     atcatggccg gcacctgacc atatttgacg aaccttagag gctggaaact gagctagcgc    158580
     agatcttgac acgcattcaa tacaaacttc gttgaagttt acggctggcg agacctgcaa    158640
     gacttctaga tcataggtta gggcgcctgc aacgttgtct tttacaataa ggtcaaattg    158700
     tgcatgaact tcggagaaaa tctttgctac gacctcatca gaaggatgtc tgatatcaat    158760
     agtgaaggag acttcaccag ggatgatgtt cactgagtat ggcttggcat caatgacacc    158820
     acatgtcatg agaccttggt gttttttggc aatttcggat gcggcgacga tcattttcga    158880
     ggatgccagc agcgcgtctt ttctgcacct ccagggtgta gtacctgcgt gtgcgccaac    158940
     accaaatact gtgcatttct cccagcggta agcttggacg ccggtgacaa ttccaatttc    159000
     tttcttctca tcctcaagga ttggtccttg ttcgatgtga agttcgaagt gcgcgtcaat    159060
     ggcgttctct tgatatgaag cggacacttc gccaatgtag ccaatcttgc tcagagattc    159120
     gtacacgctt tctgggatgc tttcgccgat cgacatgagt tcataggcat ccttcagagg    159180
     caaatcgtga gaccagacac tagacccagt gcaagaccgc gcgaaccgag caccttcttc    159240
     attgaaccac actacgacgc agacgtcgta attaggagtg taattgttct ctttgaaagt    159300
     tctcaggact tctagcccag ctaaaacccc gagaattccg tcgtacttgc ccgcttcagg    159360
     ctgcgtgtca aggtgagagc ctgttgcagt tggattaccc ccgttcttcc ccgggaagat    159420
     agcgaagatg tttccaattt ggtcaacttt gattttacat ccgagtccct cgcattcctt    159480
     tatgaaccag cctctcattt tgccatcttc ttcggtgccc gccaaccttc tcattccgaa    159540
     ctcgtgttct tgcgaccccc atctcgcgac acctccgtaa gcagtgccgg tttccaatat    159600
     ggtttgattt agccttcctg ggtttatggc caggggagca gcggctggga tgttaaggat    159660
     tccagactcg catgtaagat ctgttgtggt agtacttttt gttgacatga tgaagagata    159720
     agttttggaa aatgacagtt atcgctggca acactggaca gacttaacta aaccagatgg    159780
     tccagtgctc ttgcccatca ttatatattc cgtcctctca gcttcatcac ctgctcaaca    159840
     agataagata ggtaatcaat ttttgatctc gtgctgatag gaaaacaatg tgctaagatg    159900
     gaaacaaacg cgagaaattt gaagtccggc atcccgagaa ctctcagata gcattaggtt    159960
     gctctagaga cggttcttga cactttaatc ggaaaggctt tctctcgagg ccactctcgt    160020
     gcagaggacg ccagacgtct tatcgacagt acagctccat gtggcgctta attgcatgct    160080
     tacggaagca ttacaggaac gattaacgat aaaaagatcc tgagtcgcca gcacagggac    160140
     cagcgatcgg cttcacgcgc cgcttgcgta taattctgag cgcccatgcc tcactagatt    160200
     tcatatcacg actcctaatt taagcgaggc tcttaaccaa aacggctcac tggagcccaa    160260
     agaatgctat aggactttgg cgtcacaatc agctaactgc ggcacgtaga cagctagttt    160320
     actcagaata tagcccacgt tgcccagatc ttgatatcac gtgacggggc ttggcaagcg    160380
     gtaaaaacat gcggcgcctc ttttagattg tcaagctcaa gttggtaacc cgctactggt    160440
     ttcttggcat acttaagttg ggcctcttct ttatttagga tagtggggct tgtgtagcga    160500
     ctactacttt atttaagctc tgtcgtgatc ttgtgactcg ctgaatagta cgttgggcgc    160560
     acgagcggga tgaagttcaa gattaaagaa aggttgtcct atccgtttcg cagctcgaat    160620
     ctgagaaaac tcgaatttta ggaggtcttg gagccctaac gctcgaatgc tcacgatctt    160680
     cataaggata gctgtttcaa tccccagaac caattcgaga agcctaggta tgtgatgacc    160740
     aactagatca catgctatca aaagattcca ctgctgtgag tgtcattaca tcttttcctg    160800
     tcgctggcat attcaattgt cacaatatgg actgtcgcat acaggaaaaa aattctcgaa    160860
     acagaaatag atcaaggccg atgtgttctc ttttgaagag tggtgcatcg ggtgctgagg    160920
     atcaatggtg gccgaagacg actattacgc attcgataac gagtctcttc tacgctccag    160980
     aaccggtgcg tctggagtgc agcatggaga ctcgctagtg aggcgagaca gaaacgattt    161040
     cgcggaccct ggcaacccgc atcactacta tgcccaaaaa gcacaggagc agcgacaaaa    161100
     gggccatgta caagtccagg agtccattcc gctccaggac atgtccgaca ggccgcaaaa    161160
     ggcggctcag gctaagaaag ctaattcgct ctcgttgtgg cagctatact gctatgtgat    161220
     cacattctgg gcgccagcgc cactcctttc gctgttcgga atgaccaaaa aggagcgcca    161280
     atttgcatgg agagagaaaa tagctctcct ctcggttata gtctacgccg gtgcgtttgt    161340
     tgcgtaccta accttcggat ttacgcggac tgtctgcagt ggctccattc tcagactaag    161400
     gaacaatgag gtttcgacgg gctacttgat tataaacggc aagtcttact ctctagactc    161460
     ttcttcgcac ccagaagcag cggggatcga ggatggcacc aacgtcctct acccaccaat    161520
     caatgccggc gggatggatg cgtctttcct ctttcaaaat gtcaacggca actgcaaggg    161580
     cctcattact ccaaaagaca actgctcgat cccgtactcg gatgacagtc ttgcctggta    161640
     cttcccttgc aagcttttct ctcaggatgg ttccacgcag cccaacttta ccaaaagcga    161700
     atactatgat ggctgggctt gccacacctc agaaaccgct cgtgaggcat actattctct    161760
     atctgccgct gcagatgttt acttcacttg ggacgatatc aagaactcta caagaaacct    161820
     ggttgtgtac aatggccatg ttcttgactt ggacttactt aactggttgc agacagatga    161880
     cttagactac ccccctttat ttgaccagtt gagagactcc aagttacaag gctatgacat    161940
     atcgttggtg ttatcagact cattcgagag gagagctgct cggtgtttgt cggaaataat    162000
     taaggttggc gagatagact cttcaacaat tggttgcttg gcttctcaag tcgtacttta    162060
     catttcgctt gttttcatcc tgtctgttgt ggttttaaag ttcctgattg catgctactt    162120
     caggtggttt gtagctaaaa agcaaggtgc atttaacgac gacaacaaaa ccatgaatca    162180
     gcatgccaaa cagattgaag actggtctgg agatatgaat gctcagggtc ccataagaaa    162240
     aatggagcct tactcaaggc caggagacca gcgcagactt tccacattag atcttattaa    162300
     gcggaactct cggatgcttc tcaatgatac tgttgatgtt acggataaat ttcatggtat    162360
     gacaactatg accacccagt cctatctgaa agcaaacaca ccagacatta atctcgacaa    162420
     aaacgctttc cagtctccct tcacaaatga tttgatatcg tcttcccagg cccaggaaac    162480
     tttggaccct acaatcattc accctgaagt tgtcacacaa cctccagctg actatatgcc    162540
     ttcatcttac ccattgatac ataccgtgtg ttttgtgacc tgttattccg aggatgaaga    162600
     agggctacgg acaactttag actcactatc gaccactgac tacccgaact cgcacaaact    162660
     tatcatggtg gtttgcgatg gtatcattaa aggttccgga aatgaccgca ccacccccga    162720
     gatcgcgtta agtatggttg aggatttcgt ggttcctcca gaagaggtgg agcctcactc    162780
     atatgttgct gttgcttcag gttcgaagag acataatatg gcgaaggttt atgcaggatt    162840
     ttacaagtac aacgacgcta cgatcccctc tgaacttcaa caacgtgtac caatggtcgt    162900
     tgttgtaaag tgtggaactc cggacgaaca aggttctatg aaacctggta atagaggtaa    162960
     gcgtgattcc caagtgatac tcatgtcgtt tttgcagaga ttgacttttg atgaaagaat    163020
     gacagccttt gaatatcaac ttctgaaaaa tatctggcaa attactggct tgatggctga    163080
     attttacgag ctggttttga tggtcgatgc cgacactaag gttttcccag attctttaac    163140
     taatatggcc gctgaaatgg tgaaggaccc tgaaattatg ggcttatgtg gcgaaacaaa    163200
     aattgcgaat aaaggcacat cttgggttac gtggatccag gtatttgagt attatatttc    163260
     gcatcaccaa gctaaggctt ttgagtctgt atttggaagt gttacatgtt tacctggctg    163320
     cttttctatc tataggatta aggctccaaa gggaaaagac ggctactggg tacccatctt    163380
     agcgaatcca gacattgttg aaaggtattc tgataatgac acgggtacat tacacaaaaa    163440
     gaatcttctt ttgctgggtg aggacagatt tctttcctct cttatgctga aaaccttccc    163500
     aaaaagaaaa caggtcttcg tccccaaagc agcttgcaaa actattgtcc cagacaagtt    163560
     taaagtcctc ttatcacagc gccgtagatg gatcaactcg acagttcaca atctgatgga    163620
     actcgttctt gttaaggatt tgtgcggtag tttttgcttt tccatgcaat tcgtcatcgg    163680
     aatggaactg attggtacga tggttttgcc attggctatc tgcttttcga tttacgtggt    163740
     tatatttgct attgtttccc acccaacacc catcgttacc ctcgtattgc tggctattat    163800
     attgggtctt cccggattgc tgattgttgt taccgcaacc cgtatatcct acttggggtg    163860
     gatgttcatt taccttttag ccttaccaat ctggaatttc gtgttgccag tttatgctta    163920
     ctggaaattt gacgatttta gttggggcga cacaaggaca attgcaggtg ggaataaatc    163980
     cgcacatgaa gaagaagaag gtgaattcga tcattctaag atcagaatga gaacctggag    164040
     agaatttcaa aaggaggagc actccaatga cgatgaccgg ggtcaacatt caaggttgaa    164100
     ttccattttg aacctggacc tgctgccaga aagcagcaac tttcatagat gatctcgcta    164160
     catgaaaact tacgtgaaca gtaggtggcc tatcaagatt ccgagcattt tttgcattaa    164220
     aaaaatttca ttcattcact tatttaaagc tctccccact cgtgcttgta caaatcgaaa    164280
     tgagctattt gcatatccca aatatctatt atattcatag tacgtaaacc gtaaatgaaa    164340
     gggaactttg ctcagccagc agctgttcag ttttgggcca gggaactcca aaaattccac    164400
     tgttaatttg aggcatttcg agtttgtaat ccgcaacagg caccttcagc ttgtccttaa    164460
     atctctgaat atacttacgt gaaaacgagt cgatttcacc gccagagcct gtatcactaa    164520
     agattttaat gcgcatgtct tctagtgctt gcttagtgta acttagaata ctatcacctg    164580
     tcccctgttg cgatccacca aacgatgcag tgaagagaca gccaatgagt aacgttgagt    164640
     ccgtgtagct tggaattaaa acgaacttac ccagcaagct tgacccgaac ttttcgcaca    164700
     gttcaatgta gtccccttca gcttttggaa acttcgcccc taattggtat gctattcctc    164760
     cgccccatga cccgttgcag ttacacgaat gaatcaaaat ccttggatga gagatggacg    164820
     cagctaggca gttacctcta acataacgaa catttgaaac gcccatagca gttcttgtgt    164880
     atttcgcaat tacacacaga tattttggtt atgggaactt gagcaatgaa gttttgttat    164940
     tctcatcgta tgatattcca agcgtatgtt aagaacatag aatgattaca gaggcagcgt    165000
     ttattattta ttatgtaaaa gcactgctga catatttgta cagaagtctc ttatatgttg    165060
     tctatgatgg tcactccttc ttcatcttgc ccatgatcat cttccctaat tttgtctgtt    165120
     tcaatgaaaa gcttctgaca tggaaaatgt aatacaaaac tgccatcgcg aagatattga    165180
     agcaaatgta cacccagaaa aatccaaaat ttctccataa gtagctgtac ttgacgctaa    165240
     tctggctcag gtaatcgtca ccaacctcga aaacacagta tccacagttt tcagtatcat    165300
     tcgggttgtt gatataacca gcagccgtct tcaaaaacgc ggacatatat tctccgcaag    165360
     tttgtcctgc aggagggttg acatatgaca tttcgttttt cttgcaacgt actggcttct    165420
     tgtgcagaac taaactaatt gcgttttgca caaagtaggt gtagggagac gctttccaca    165480
     taaaggtcca aaaacccggc attagacttg caggttgtac aacaccgcag aaagaaatca    165540
     aaaaggacaa acacaaactc agtaaaacac cagcggaagg caagtttgga gcagcataca    165600
     gcagcattaa acctagtccc acaagataga gctggaacat gatacagtag ttcaagaaga    165660
     aaacgccgga ataggttgca gcaaagtgaa ccctaagtgg gaaatagaac gccacgaaaa    165720
     atagtgtcga gaacacgaga tggtaaggga tctcacacag gtactgggta agcaacaaaa    165780
     atatccagtg gaatgtgttc gattttgact ccctgacctc aaacaattca cgcgatgcaa    165840
     tagcacgagc ttgaatttgg ttcatagctg gtgctgacac gatcaaagcc atgaaagcag    165900
     caaacatagt gttctgcaga ccacggtaac ttgttcctac attgtagaag gtaaaaccaa    165960
     taaacaaacc agcgctaatg taaagcatca ttttagcaat caaatattca gaatttctcc    166020
     agaatatggt ggctgttctt tgaagcacat atctgaactg ataagagtaa gatgtcgcat    166080
     atttggagat cttctcattc ttatcggccg gtggggagtt ttgttttgag tctctgagat    166140
     agttttcaat ttcttcatta gcctcgttga actgagggga gtttgtccaa atttcatgcc    166200
     agtcttcctt cacggatgcc gtagcacctg caccgatagc ttccaagatg tactcagcag    166260
     gattttctgt gtgttcacat ttgcgtgcgc catttccctc gaagtaattt agcaaggtac    166320
     gagagttttt cccgatagga ccaaaatata cggtctgtcc gcctttcttt aacaatagaa    166380
     gtctgtcaaa ctgctcgaaa agggtagcag aaggttggtg gattgtgcat agaatagatt    166440
     gaccggcttc cgctagtctt ctcatcaatt gcacaatagc ccatgatgac tgcgaatcaa    166500
     gaccggaagt tggctcatcc aagaacagca gtaaatcagg cttggcggcc aactcgacac    166560
     caatggatac cttctttctt tgctcgacat tgagaccgta tccaacgtca ccgacaagcg    166620
     cgtctgcgta ttcctccata tccaaaattt caattatatc ttcgacgtat gccattttct    166680
     ccgcttcagg gacagactga ggtctacgca tcctagctgc aaactgtaga gactctctga    166740
     ctgtcatctc tttgacatgc acatcctgct gctgaacata acccgtgcgt ctttcgaaac    166800
     tagcgtcaat gtgattaccg ttcacaagca tgtcacctgt gatgatacca acgttccttt    166860
     gagccaaagt attcaacaag gttgttttac ccgcgcctga ctcacccatt agtgctgtta    166920
     atgtccccgg cgcacagtaa ccgctcacgt tgtccagcag ccgacgggtt gaacccctgt    166980
     aagggatagt gtaacaaacg tttctccaga taaagattcc cgtacttttt agtccctgaa    167040
     gagcctcggc agagctaccg ctagtggagg cattagagtc caagtttttc ttcgcctcgg    167100
     acatagtgag cgatttctct ctactttcct catctgacga gggactaact ctctttgccc    167160
     ccttcttgaa cactaatgta tcgcccgatc ccatcgatgt agtgttcaat tctgtaatca    167220
     aacactttaa agcgacataa accgccaaga aagcgaacag aaatcctagg tttctccagg    167280
     tatgatcata cttgtagcca taattggcct taatgtaatc atcgccatta acgtaatctt    167340
     ggcccggctt cgagcccaca aaagcacaaa cctggttttc agtggctacg ttagcgtaag    167400
     caggaccagc ggggatgata cttcccgtgc agtccatctt tctggcgtgg aactccgaat    167460
     tcagcatact ttcaaatgtg tatctgatag gaatacaata tgaaatccat ttgaaccagg    167520
     ggtgcatgga ctctagttgg atcatgtagg ttgagtacag aaccagcgcc ataagactgg    167580
     tacctgcaat cgaattagcc tgagcaaccg atgaactgaa agctgtaatc aactcaaaga    167640
     aggcattgat ggactcagaa cataaaatga ggaacaggaa agaggtgaag aatctgttcg    167700
     cttctcttgt caggccagaa aggaagtaga tgataatgta gaagcatgtt tgactcaaaa    167760
     atctaaatgg aaattccgaa agtgaagttg caagcgcttc tgccgctgga tggtatagag    167820
     agtatgactt gtgtttctga acgacaggtc tgccatctaa actgattttt gcaagcccca    167880
     tcaaggagac atacaagata gagaaataga agacaccacc tcttgaaaat gcgcctgata    167940
     caccggaggg taagttgtaa tacagggaac cagacaccaa actttgaatg atcgaggcaa    168000
     tcaagttggt gatggtgtat gctttatcac cgtatatcct ttggacgcca cgcttggtac    168060
     aaagcttgac ttgttcggca aaagatacag tgtatttgga ctttttgcga tttaatttgg    168120
     atttctcttg ggccagagat gctgaaaaga gttcctttgt tttttctgct tctgtttctc    168180
     ttttgtagtt gtcaatgtcc ttgagaaggt cctggtattc ttgagactct agccacagct    168240
     tctcaaactc atctgcggtt ctgggaactt tgttctcaaa ccctggcacg tattcatgga    168300
     gaccgttggg gtctgttagt gctgtgagaa actctgcgga ggcctgtctc gctgggcaca    168360
     agaaacccaa tttcttgaag tatgccttgg catcctctac gtggccgtaa tagatctgtc    168420
     taccatcaaa caggacagtg actttgtcga aacattcgta gatgttttca ctggcctggt    168480
     agattgtgac gaacgcgaca gacttctgga ggttggtcat gattctgatg gcttgggcga    168540
     attccaaggc agtggaggcg tcaagacctc tggtcgcgtt gtcccaacag tagatagaac    168600
     cccttgaagc gagtgcttcg gcgatggaaa cacgcttacg ctcaccacca gaaacacctc    168660
     tgacaaagtc gtttccgacc ttggtgttgt aggtgtgcct cagaccgaaa atggtaccgt    168720
     agagctcgcg catggcggtg atgtattcgg acctggacgc gttgtccagc ctcttctgcg    168780
     gcgtggtgca cgaaagcgca aagtcgagtg tttgctggac cgtcaagtgc gggaagtgca    168840
     cgtcggtctc gccgttgtag atcacgtcgg ttttgaactt ggccatcatt tccttctggg    168900
     aaatcccgtc gtagctgatt tctccgcgca cctcttcgaa gttgtcaacc tcacctgaga    168960
     ccgtctttaa aaaggacgag cagccagcgc cgggtctgcc gagcaccagg atcatttccc    169020
     cgggccgtgc gagtatgttg gcatttctca caatgtctct ggtcttgcgg ttcttagcct    169080
     cgcggatgcc acggaagatg gtccggggca acagcagtat atcttcgaat gtctgtgcct    169140
     cgactgaaga gcagtccttg cctactacgg tgaagttctc accgattacg cctgcgcgac    169200
     gcaggtggat gccctgctcc tcgctgccgc gcacgtgcgc gcggatgata gcctctgcgt    169260
     cgaagtcatc ggggtcaacc tgcagcacgc cgttccgcat cctgtggctg gaaagcgtgc    169320
     gcgccagtgt ctccacgcgc gacagaacct ctgggtcgag gtcctcctct tcgccgacgg    169380
     agctggttct gcgtgccatc aggcgcacaa tgtggtctct tgccgcctgg ccatcgctct    169440
     gccgcgcgtc ctggaattcc tccttggtcc cgggccctgt gtacgcggcc tcgtgctccg    169500
     cctcgctgcg gctcgatgct gcgcccgacc ttggctctgc gccggactta gcctgcacgt    169560
     ctgcgctcat ggtctgttta agcctctgtc gtgagatcga gttgctaaaa agtcagcaca    169620
     atatatttgt agctgtggtg ctgcttgcaa gtctctagtc tctagtctcg agtctcgagt    169680
     caaaacggta tcctgaatga gccctatcga ccgttttagt ggaatgcgct cgagagtttg    169740
     cttgttggcc tctgactact tttgctgcgt tggcccgccg gcctctcatt atttatattt    169800
     tctttcatct ttctttctcg tattgcacta ctaccaattt acgctctaaa cccgtcgtaa    169860
     acacggattc tgaacgcctc tagcgcggct gttagaaatc accatcaact acaaaatcat    169920
     gacaaataca tgcacatttt tagccaacat tgggaggggc acagagctgt gcgaatgcat    169980
     gtgtttttct cttggaaatt tgtcgcttag aatcacgagc atcagagctg atggggaaga    170040
     aaatgcagca tggaactgcg taaaagcccc ggttgccggg gcgataaagg atttttccga    170100
     gaaagcttcc gcttccgaca aggacctcag ggatctccgc tgctgaaaag aactttctaa    170160
     acccgaaaaa taaaggtccc ggttgccgaa agctttcggc aacttgcact ttctgcccac    170220
     gtgataacgg cctgacgcct aatggaggcg ttgcacatta ggaaccgagc acactggatc    170280
     tttgttcggc atgtggtgga agccaaaccc ggatagcgaa gacacgaagc tcaggctacg    170340
     aagctcggaa gaggctgcga tagccgcgcc ccctacaaga tacgcaggtc tagggcgcag    170400
     aatttaccag ccgtctcgca gagctgcagt tgcatggttt tgaagcccca gttctaaatc    170460
     atcggccggc agttgctttg gtcagcgatt ctctttgcta gcggctctct tcatcgtgcg    170520
     gcgtgcccgc taaaatttta gggtggtggt gtacattgtt agctaagcag ggtggcgagc    170580
     ccgcagggta ccggagcgga ggcgaaagtc atcggagcgg aaacctcctc cttaggcacg    170640
     gccgtaggca cggatgtggc tgtagtcggg ccgacgttac ggccgaatcg acggccgtgt    170700
     ttgtggaggt gcatgggtgc ccatgcggcg acgttgtcag atggtcagcg aagaattgcg    170760
     cccgcatcgg tggaaaccgt tcaactcgaa tcctcttgcg ggtttaagat ggccacacat    170820
     gtttcaccgc acccagatcc ttctggctcc gctttccttc aagcgcccta ggtttgctgc    170880
     cagctctgtg gcctttgtgg gtccctttct catgtagtcc tgaacggagc ctctctctgg    170940
     tttcgtacgg cgtttcgatg cccattggag tccggttttt ttctaaaaaa aaattaagat    171000
     tatgtaatag tacctgtgct aggcctgttt tgattagagc gccggcctgc cagcgctgcc    171060
     cgacgctggt catatctcga atagacagct gccctgtgca ggctttgaaa tgaacactgc    171120
     ctcgcgcagt tcctctgaag gcatgtttct gaatcttttg cggtagtact ggttcgcaag    171180
     agcgctccgg acttgctccg cgttgtctct cgtaaccaag tggacagtac agccgcccca    171240
     gccggcgcct gtgagcctcg acccgtacgc gccattggcc ttggctatgc ggcagagctc    171300
     gtcggtctcg ggacacgaac atccgtacag cgtgtcacat gacttttggg actcgttcat    171360
     cagatcacca aaagattcca aaaaccgctg gtcaccctcg gacttcctgc ttgtcagtag    171420
     cttcaaggct agcagcacgc gcagtgcctc ggagaacaca tgcttggctc tctggtatag    171480
     cttcagcgcc tcgaaccgga ccggaaaatt ggtaaggtaa tctctcgcaa actcctgctg    171540
     ggagcattgc agcgccgtcg ccgcgtcttg gaccgagtat ccttcctgtt gcgtcagtga    171600
     cttctcgaca acatgcagca tttcggtcaa cctgatgatt ccgtcttctg cgttgccgtc    171660
     ccagggttcc gacacgccgt ggtatcgcga atagtaagcg tccatgaact ctcgcagtgt    171720
     acccttctcc agattccccg tcctttgtaa cgcgaccttg aatttagatg ccagaacgtt    171780
     ggctgccact gtaacttcaa caactcgtaa gttgtaatta gtgggtgcgg tttcaacctt    171840
     atttgagact accattgtgt tggcgatgat gaactggatt tctgagtttt gcagctcggg    171900
     gaatttgaaa ggcgtggcct tcaattgcgg ctgaaactcc acatacagcg cgtgttctga    171960
     ctcaccgcag acagatgcag cctggtccat tcctccattg ttgaccccaa catagtgctc    172020
     ggctttaact gttatctgtg tgagcacctg cttggatact ttgtagttgc tactggtatt    172080
     cgagcgaatt acagccaggg caactgcgca tatgaatgcc gcagaagagg aaagccctcc    172140
     tccggtaggc acgttaccgc tcacgtacat ctccattccc gccaggggcg cttcttggaa    172200
     tttttgagga aattgcgttt taaggtgttg ttgcgcaaca aggagtccgc atttgaagta    172260
     attcgaccaa tctgataccg atgggtcaat cgaaatatca gatccgtcca ggggaaggtc    172320
     gaacttgcgc tgcgcaaact ttggatcttc atttattaaa gtaatagatg gaatgtcttc    172380
     tgtcgataaa acgcctaccg cgcacagcaa gtcggcatcg atggccatgg gaagtaccga    172440
     aaaatcgacg tagtcaatgt ggtcgcctat aaggtttact cttcctggcg acctgctaac    172500
     gaaatgcggc gtttggccat acactgattg gaagtcgttg actatgcggc tcacccgagg    172560
     cctaagtcca gcgggcaggc ctttagtgtc aaaagaatgg actgacatgg gaagtttgag    172620
     agacgtgagc tcgttggaca aaatcatgat gcgtgtagga gcggttactc ttggtttttt    172680
     atacgctaaa tttaatctgg ggttgatttt cgattttcat gtttgtttaa agtttgcggg    172740
     gtaccatctt ccgaattttt cgggcgacag tgctccgaag cattgatgat ataaaaacga    172800
     atcggacaac agtatcccgc aattcaagag acattggtac atggtcatgg cataaataga    172860
     agtggagtgc ggcggatctg ctgctttaga aactggcttg aactcaaatc tgcgaaaagc    172920
     tgtatcaaaa atgacaggtc taaaacagga caaagatgga tgggtcctag taacaggtgg    172980
     cgccggttac attggatcgc atgcggtagc tgaattgatt gaaagtggct atagatgtat    173040
     agtcgtggac aactttagta actcatgcta cgagccgatc gccaggttaa aagtgctgct    173100
     tgaaactgaa atcccttttt ttaaagtcga cctgacagac gcagacggac ttgagaaggt    173160
     gtttcgaaaa ttcaagattg attctgttat tcactttgca gggcttaaag cagttggaga    173220
     atccactaaa atacctctga gttactatta caataacatt acagggacct tggtactcct    173280
     agatattatg aagaagtacg ggactgagat gctagtgttt tcttcatcag cgacagtata    173340
     cggtgacgcc acaaggtttc cggatatgat tcccatccca gaagaatgcc caacaggtcc    173400
     cacaaatccc tacggaaaaa ccaagctagc aatagaagaa attttagagg acctacacgc    173460
     tagcgaacca gaaaaatgga gatttgcagt ccttcggtat ttcaacccta ttggagcgca    173520
     cccttcgggt ctcatcggtg aagaccccct cggcattcca aataacttgc tgccatacat    173580
     ggctcaggtg gcggtaaaaa gaagagaaaa actatttgtc ttcggtaaca actatagctc    173640
     acgcgacggt accccaataa gggactatat ccatgtggta gacttggcaa aaggccatat    173700
     tgccgccttg aagtacctta atgagataaa agggggacag gggctgtgcc gtgcttggaa    173760
     tttaggatct ggaacaggat caacagttct cgaggtttat aaagcgttct gccactcctg    173820
     tggcattgaa ctaccttatg agatagtggg gcgtcgggcg ggcgatgttc tgaacctcac    173880
     tgcgaagcca gatagagcca caagggagct gaagtggacc acaaatctga aagtttcaga    173940
     tgcatgtgca gatctttgga aatggactac aaaaaatcct tatgggtatc agcttcttgg    174000
     tgttgttgat acgtttttta accaaccagg tgagtacgaa tcgcgcctta tcacgctcgg    174060
     gagaggatcc gggttcgaag tgtcactcag caacatcggg gctactatcg ttgatttaag    174120
     agttgacggg aaacccgttg tcctgggcct aaccagcgag gcggaatatc ttgacagctc    174180
     taatccatat ttaggggcca ctattggccg ctacgcaaac cgtttgcgtg atggcaagtt    174240
     taatgttaag ggagttgatt accttctaga tcttaatgaa cagtggtcaa cagtccacag    174300
     ctcctcacag tcataccata ggcgtcgttt tctcggtccc ttgatcctca accctatgaa    174360
     gcaccagtat tttgctaaat acgttctttt ggattctaat acccagtttc caggagaggt    174420
     tttggccagc gtgacataca gcttagatgt cagagcaaag gagttacaaa tccaatacga    174480
     aggacgcctt ttaaatggcg ataccaccat catgaaccta acgaatcaca gctacttcaa    174540
     tcttaatgtg tttcaaaatg cttcttacaa tggcacagag atccaactat tctctgatca    174600
     agctgttgag cttgatgatg ctaaatgtcc atccggccgt attgttaagg tctcaggccc    174660
     ttcatcgttc actttggatg aatgcgaacc tccgtttgat acttgttttg ttactgggac    174720
     tgttccctgc atcgatactc gtgcaaatga gcttaaacct gtcctcaaag cccagcaccc    174780
     cgagtctgga ctcaaactga taatatctac gacggagcca agtttccaat tttacactgg    174840
     aggacctggt atcctgaagg gctacggaaa gaaatcaggg ttttgctgtg agcctggaag    174900
     attcatcaac gctgcaaatg ttcccgagtg gaaagaggca gtcactctcg aaagcagtgc    174960
     ggtttatggc tctaaaacat cgtacaattt tggctgagtc caacttcaaa gaaaccacag    175020
     ttgttttgaa aactgccata ccacaaagga tgcgcgtttc atacttctgt ggttgcgcct    175080
     ttccaaggat cttccttcaa atttatcgac aatatagcaa taagttatat aatatagtgt    175140
     tagttgcttg atatcatgac tgtcatattt ttaaacagca attattcgag caccactgaa    175200
     taagcatgag ccctggagtt tctaaaattt caaccttttg caactgaaat aaagccaaga    175260
     gctattgaag ttctgattgc gttttattac ttgactttga ttgaggaaac ctcaggttat    175320
     atttgaattc atcagctaat ctgtttttcg tggctgtagc ttcaatattt ttctctcttc    175380
     attaaacctc aatgttgttc ggggtcctgt cgtccggagt actgttgtcc gacaaaaaaa    175440
     aaagctgagg agctcgcatc atagtcgtcc gaaggttcac gatacttaag gagggcataa    175500
     attccgacag ctggcactta tgaaatgtga tgaatcaaaa tgagagaagt ccaaattgtc    175560
     acggattact gacatgacag ttaattctgg taattttgat tttacagaca actcacacag    175620
     gagatttaat cccttaacga attcatgggt gcttgtatcg ccgcacagag caaagcgacc    175680
     atggatgggc caacaagagg tcccgttcag tccgaacgag ccagagttcg atgctaaatg    175740
     ctatttatgc ccaggtaata cgagggcctc gggtgaaata aatcctcaat atccgtcaac    175800
     ctttatattt cccaacgact tccctgctgt gaagctgaac caacctaatt ttattgatga    175860
     tggaaaagaa atgactctca aggatagatt catgagggcg cagcaagtgg agggaaagtg    175920
     cttcgtcatt tgttttagcc ccaaacacaa cttaactatt cctcgtatga aaatcggcga    175980
     attgaaaaac gtcgttgatg cttgggctaa actttatttg gaactggaag cagaagctag    176040
     aacgaaggcc actccataca aatatttgca aatatttgaa aacaaaggaa ctgcaatggg    176100
     gtgctcgaac ttgcacccac acggtcaggc gtggtgtttg agcaccattc cagatgaggt    176160
     cgataaagaa tttaggtcat tcgccaagta ctcgaaagag cactcaagtt gtttgttagg    176220
     ggattatatt gcacttgaac ttgaagagcg cgacaggatt gtcttgcaaa acgattcgtt    176280
     cctagtcgtg gtcccgtatt gggctgtttg gcctttcgag acgctattaa tgagtaagca    176340
     gcatctgtgc tctctcgcag attttaatga tcagcagaaa ttggagttag cttcaataat    176400
     taagaaattg acaacaaaat atgacaatct gttcgaaact agttttccgt actcaatggg    176460
     cttacaccag gctccgttaa atgcaataca gcaagcgaac aacagttctt ggttccacat    176520
     gcatttttat cctcccctcc tgaggtccgc aactgtgcgg aagttcctgg ttggtttcga    176580
     gttgttgggg gagccacaga gggacctaac cgcagaacaa gccgccaaac gtctcgcaga    176640
     tctggaagaa gaagtacatt ttactgagat ccggtgattg agtaaacttc atatagtaaa    176700
     gctaatgttc ggattttaag caattgatga ctttaatctg tattgcagaa ttcaaaaagc    176760
     ggcaatatgt acacaactgg ttgaagttga gcatctataa taaaattaat gaattttcag    176820
     agttactaga aagttcgtgg gtctccaaca tgagcaatgc tgcatgtgct ttgatgatag    176880
     cctacttcgt ggtatagaaa aaaacgatta aatatcaatc aaaaggttgt gtgaatttac    176940
     tcagttcaac tgacactttt aagttaaagc cacagatgag ccgataaatg tcctgaacac    177000
     ttgcgagaaa atcatcgcga aaaggcaacg tcaatcaata caaaatcgat atagaagcat    177060
     tcccccaaaa gaggcaaacc agcagcttct tacctgagta atgaaagcgt acgttttcac    177120
     gtgtttcata agaagcggat ttagctcaga tgggagagcg ccagactgaa gataacttcg    177180
     gtcattgata tctggaggtc ctgtgttcga tccacagaat tcgcatttat tttttttcga    177240
     aaattgttca gccttttggc ggaaatacag agtaagtctg tatcaacagc cattttaggc    177300
     ctgctatcgt aatacagcta tcttgtactt aagctataac gtgaaagtga gacctaccct    177360
     tatttatacc atcacaaaca attctttcaa tctcctctgg atcactagtg atacctgtta    177420
     ggttttcgca cccgtcagca gtaaccaaga cgtcatcttc aatacgaacc ccgccgacat    177480
     acatgtattt ctccatgatt tcttcattca caacttcttt tctctttgga tacttgatta    177540
     aaaactcttc aatcaagaac ggattgaaat aaacacctgg ttcgtttgtg actaccatat    177600
     tctcctctag gggtctgcgt agtctcagaa attttagcag tggattggag tcttcatagt    177660
     tcgcgcgtcc tccgacatcg tgggtgtcca ttcccaataa atggccaagg ccatgtggga    177720
     aaaagcacaa ggaagctttt ctatctagga tctcttcttc tgagtaccct gatttgaaga    177780
     ttccaaggtt caaaaagctt cggataagta ctcggtgtgc caagatatgg agcttttccc    177840
     attcaacgcc tggcttgatt ctgtccataa cttcggtttg catctttaaa actgtgtcgt    177900
     atatctcgcg gtgctccttt gtaaattttc cattcaacgg gaagcaccta gtaacatcag    177960
     cagtataatt ttcccattca gcgcccgcgt ccatcagtac tgactgcttg ttttcaagac    178020
     tttcatcgtt cttgacatag tgtagagtgc tacagttggg ccctgagcag caaatagggt    178080
     cgtaaccttg atgcttagaa ccctggcgaa ttgcatggta agtaaattca gcatggaaat    178140
     ggccctcatt tttctctatg ggcaatgcag acatgacaga gagatggcag ttgtctgtaa    178200
     tcttggctgc gcgtctaaga agccctattt catactcgtc ttttgtgagc ctcgattcgt    178260
     ctagcgcata aaacaagtct ggatcacttg gtacaagcat ttcggcgaca ttgggatcat    178320
     ggacattgtc taaatccgtt gtgtagatgc agctgctttc aaatttactt agaaaagaag    178380
     gcaacttctt tgcgtacaac acctcgtcca catcaaactt ttcataggct gcctccacgc    178440
     tcaaggggag gccgctccac atcacatcgt cgctgtcaac atcaggcagg aaaagagtga    178500
     gcttttcgct tttgaaatcg aagaacgctg ccgaaccagg tatgtttaca cctgtcaggt    178560
     agaaaaagta cctgttttgt ctaaattcct tggtctgatc gcagtatttg attggctcta    178620
     tctctcctcc tgcaacaaat agcgtagatt cagtttgttc ttcgcctttt ttcgataaga    178680
     agttcttctt gattttaagt gcatgctttt tggctgggta cttccctttg ggcaaatctg    178740
     agtccgaagg gctcatcttc tgttgtggcc ggcttgagaa agtaaattct aatgagtctc    178800
     tgccgagctg atatgcaagg aaagctagac tgaaggtaag cagctgatct gcgaatggca    178860
     tttgagcttt gcgcttacga gcccgtgttg attagttgga tttgaaagat agctttttat    178920
     atgtgtgctt aatgacgttg ggccgtagct gtgaacggcc atgtgcaata ttgtttatca    178980
     gaattgaaaa ccaaaacata aaaaagatat catggcgcca agtcgcacaa ttgaaatgga    179040
     gaagagagcg cgtagcccaa gccagagctc cgacggcact ccttccaaga aaatcagttt    179100
     agctggagcc caagttcaac cctaccttga aacggttgac gtgagaaagc tcgattttga    179160
     tctcgagaaa ctatgctcag taaccctttc accattaaat gtctactgct gcttggtgtg    179220
     cgggaggtat ctccaaggac gcggtgaaaa gacagtcgct ttcctacact cgatccaaga    179280
     ggaccaccac gtctttatta actttgtttc attgaaaaca tatctgcttc ctgagaatcg    179340
     tgaagttcag ggtgtgcagc ttttggaaac gataaagttt gcaatctcac ccaagtacac    179400
     tcaagaagac ttattgcagt ttcctcggat gtgcttcgac aaatcgaata ctccgtacat    179460
     aaatggtttt attggtctaa atgacctggg cgacaataca caccttagcg ttattattca    179520
     aatgatggcg cacataactc ccattcgaga cttctttctc cttgaatctc agagcaaaat    179580
     cgacgatgaa ttaatcaagc gtcttgcctt actgataaag aagttgtggt ccccgcatat    179640
     actaaaggct catttatctc catacgagct actccaacaa ctgtcgcggg tgaataaaaa    179700
     cgtgaactct gacaatagaa ttaaagaccc caagagcttt atgttatggc tcattaatta    179760
     tatgattgcg aaagcacatc cacttaagaa ggttttgaca cgtaatatgc gcggcgaagt    179820
     cgaggtccgc tcaatagttg tgagagaaaa aggcacgaca ggagaaaaaa atctcgagtt    179880
     ttttgaagac gaggctacca agactattgt tcttccaaag ttttggagtc taaccctcga    179940
     tttgccgcct gtatcccttt tcaacgaggg ttcagacaca aacagcattc cacaagtaac    180000
     gttagactcc ctgcttggta aattcagtgg ccacaaaaaa attcccacga gagaaggtat    180060
     gaaacaatac aaaattgtga agtatcctcg ctttctggcg attaactttg ataggttcaa    180120
     ctgggacgcc gccatgccaa tccgcaaccg gaacaggacc ttggtaaagt ttgccgatgc    180180
     actgcgtttt gaaaataaag attacaggct tattgcaaat gtaacgctgt acccagttgg    180240
     acatagcagg agcggcgacg aggacgttga tgacgaagcc aggtggaaaa ttcagctttc    180300
     taacccgaag aatgcagaat ggtttgagat tgatggaaaa aacgtaacgg caaaggaaaa    180360
     ggaactactc tttttggatg aagtatatat ccaagtttgg gagatggagc aaaacaagag    180420
     ctagaatgtt gaatttcaat tcgccaataa ttttaatttg aataaaatta cttaatgtac    180480
     agatatgaat gcaactcatt tgattgcgac agagttaacg cctgccgtaa gcactgacat    180540
     gatgttttct tcgaggaccc cctcagcggt atcggccagg tgtttcttag ggtcctgctt    180600
     accaacgtag cgagttttca gctcttcctc cgtcaaatct ttctcttcct ctatcctttt    180660
     ggaatataac tctgcaattt tgagcatctt ttgcgtggct tgcaaattgt tatgctcctt    180720
     ctctttgtaa tcgttcatct ttaaacctga ctgccattgc tccttgtgca agtttagaag    180780
     catgtttgtc tccgcaacag tcttgtggta gtcaatattc aacgagtaat aatgcctgtt    180840
     gaggccgtga attaaagcct gaatgtttgg cttattgagt aggccagcat ttgacgttgt    180900
     ttgtctgggt tcttgattcc tcattatcat gttcgtgtct atcaacctaa aagcatccac    180960
     aaccacctta ccctttacag actgtattgg atccacgaca acggctacgg ctctgctgtt    181020
     taattgctca aacgactttt gggtgttaac atccactgac gagagccagc agccaaaacc    181080
     tggatgggaa tggtaccacc ccaccaccat ttgatctctg cctgtttgct ttagcatgtc    181140
     catcatcttg gcttggaaca catcgtcaac agcttcaaca gaaacccctg ttccagattg    181200
     aggcatggcg aagacgtcaa caacattaac tgtgtaatca tcaacaaact cgccgagcat    181260
     aaggcccata acctccatgg gaacgccgtg tctgccgtgc ttcaacatct tcagcaaagc    181320
     taaagaagaa atgtataccg tttccttagt gtcatccata ggggtctcag cagcggcggc    181380
     gccgcccatt acaccagctc tttggttcat catcaatctt tgaagccttt ccatcttaga    181440
     atgaatgtgt ttcaatcaaa agaagggcag caatcctgat cttctaacta atatgccctt    181500
     tatctgtacc atttgccacc gaattccaaa tattcataac cttctaagca cattattttg    181560
     taaatacttc tgtacggttg taactcagta ggttgccatg ctatagcagg aagcagtgct    181620
     tgataccctg aatattatac actcaaacgt tatcctagag ctaatataaa atgcgggcag    181680
     gcaagaatgc agggagcagc agaacacgcg ccctcgactc aactactact tctacagtac    181740
     aggagtcggc ccccgttttg caacttcgag ggtctcctaa tgatcagcgg gaaggggcaa    181800
     cccacactcc ggcagcaact ggtagccagg agaagaggga ggtgcgatgg aaagaagatg    181860
     tagttgacaa tgagcacatg aacaaaaaga aatccaaagt ttgctgcatt tttcaccccc    181920
     agcaaaattt cgaggacatg gacgatgagt gcgatcactg cggccatagc gactcatcgt    181980
     cctcgtcgtc atcctcgtca tcatcttcag agtcagagtc tgaaaaagac ttggataggg    182040
     agagcaggca caacgcaaga aaagaaagac ggaagcgaaa gctcgcacaa aagagatcta    182100
     caagcccaaa tgcctatgag attcagccag attacagtca aaacaaagac aagcaaacga    182160
     acaatcaata gaattaggac gcggaaataa gttcatgtgg ctaaaatctg agtgcagtac    182220
     aaatttataa atggacttct aagttaatta acacactgta tgtttcccgg ggcattttgt    182280
     attgaatcat gccagcgtat atcatacagc ttttggctaa tctccttaga gctcttattt    182340
     gctggtcctt tgatgcagaa tgatattcac tctggttcaa ctgcgcaaca atgttagaca    182400
     cgcaggtcat ggtaatgatc agcaagtttg gaatgttctt ggcaatttca ggactcaaac    182460
     ttgaaaactc ttgagccttg cgcctggagg aaacttcatc aataaacggt ataacgtcaa    182520
     tatcttcaac tttagaaagg gcttcctgcc agttttgcga gtagaatgat cttctaatat    182580
     caaccacctt taacaagagc agacatgtct ctttgttctt cgaagagact ttgcgagaaa    182640
     tttccatgtt attgacatag acattgataa gtttcttcgc aataagaact ggactagtct    182700
     cgttgttatc atctaaattc agtaatggtt ggttgagatc cgtgttgctg agtaagtcac    182760
     tcaaaagctt gttgacgata cgaataacaa tgtcatattc gtcagcaagc tggtagagca    182820
     gtaagctatc aaaaaccctg ccatcttcat cagccctccg cgctgcttgt tctgtgatcc    182880
     tgtgtaagaa gtcttgctcg tcgcttaaaa acagaagaga atgcctttct tcaataacac    182940
     cagggatcct tgatccatct ctgttaacct ttcccagcag aatggtgaat tctttagttt    183000
     ctaaaacgag ttctcgtaac gattcatgac aaacttctat ctgatctttg ttcccgttaa    183060
     gcgctatcaa aatgaggtat tcaacagcga ttctagggtc agaaaacttg aatgacttcg    183120
     tgtaattacc aagtagcttt gcaaaattga tctcaaatct gccatcttct tctgaaagga    183180
     gatttgaatc atgttcagat ttatagtgtg atatgtttaa cttcttgtga taggctaaag    183240
     ctatcgcaag gtgcacagca tcaatttcat tgatcgaagt tgcgtgttga actgccagct    183300
     cataaagacc gcttagtaga agcacgtgga gataggtgct gctgaaccta gagatgccat    183360
     acgaagtgac tattgtttga aaatctttca aatcgtattt ttcgtaaact gggtcatcat    183420
     cagaaacatc ttgtttgatt agcataaaat gaaaccacag ccaatcctca atactaaggg    183480
     ttatcgacga tatattcttt ctggttaaat cacatcttcc aacaatctta taaacagcga    183540
     gtctgaatgg atcgccatct aaggcgtttt tgatgtgctg gttatattcc gtgtgcaatc    183600
     ttgaaacaaa ttcattgggt aacctctgat ctttagaagt ggcataagct ttgaaatatg    183660
     ttaggaagga ctgctcaact tttttgaaac tcaacttgtt agcgatcgca acttcaagag    183720
     cttccttggt caagccagct ctcagaaggt agaaaataaa tgcccaaata ggcacaccat    183780
     taactattgt caagtttccg tatttccacg tgttgtttgg gtttttgagt ttgtagtcaa    183840
     tgaatgactt cactttgttg acgttagtag ggaggccttc atttaagttc ttcttgtata    183900
     ggttatcaac atagtttaag aattgctttt caagaaaggt tcgggatgac ataacaacgt    183960
     cagttgaatt ctgagcgtgt tcgataatac tccacgcctc cggaagttgt cgacctgctt    184020
     gctctgccga actggaaaag gtttcggaga tttcctttgc cagcgaaaat tcgtatccgc    184080
     tctgcctggc attgttgaaa ccatttatta tcttggcgta cctttcgaac ttggtccttg    184140
     ttgcaaaatt ctcattcaca tttaaccttg agtcaccatc caaaatgccg cgccctgatt    184200
     tgccccaaga aggataatct ggatgaggta gtgaatcctt tccgtaatcg ttgccccttc    184260
     tcttctttag tataataccg aagttttccc ttacctcgtc ttttctttgt tcccagtcga    184320
     ggttgaaagt ctgattgacg aaattgtcaa aatcctttgc tgctgatgtg agggactgtt    184380
     caatggaaga taaaatgttc tcgtctttct tagtgcgaag ataggtgtca aggtccccgt    184440
     cagtctccct atttgttaca ttatgttcaa tcaactgtct cgacttcaga ttattcaaag    184500
     acagctcgac gtcctgaata gccaatccac tgcctgctag gaggtaatgt gctcttgtgt    184560
     gatcaccctt tggtttggcc ttctttctca ggtcgtgtgc tctctttttg atttcattta    184620
     cgcttaataa aattgttcct aattcagaag atgtagttgg caagttcttc gaagtctcaa    184680
     taaggttgcc aaatgtcttc gcagagcctt tcaggacacc ctcgttattg gcataagtgt    184740
     ccatcgaaac gggtttgtct gagtgcattg ctattctctt ttagagtata gccatgaatt    184800
     ggcactattg atggccaaaa tttttttctc tattatatta taggattagt gtcaaggaaa    184860
     acatcgccaa agcgaatgct cgaatataga aaccaatgaa cacaaccctt tatttagtat    184920
     tatacatgtt ccccatacat attgaaagaa gctaagctcc cttgttcgcg tcaacactta    184980
     gatctgccga gatcacactt tgacatatta aaagtgctaa tcaaagcttt tgatcattac    185040
     tcttcatcac tgctatcacc atataatggt ccttgtgaaa agcgtagtct ggttgctgcc    185100
     cttcaaaaat catcagtggc ctctggttga tgcttgttct tttaaaatta tctcttaaag    185160
     aagcatcatc ctcagtcgcg tgagtaattg ttgttcgcgc ctccattctt gaaaggccta    185220
     taggactcta agtttcaaca gaacaaggcc ttagatggca aattactata catttttttt    185280
     gatgaactgc aaagaaactg atgagaaaat aagttaggct tgggtttcgt tctagaaact    185340
     tgtctttagc ctaaacattg atagaagagg tttcaagcaa aagacacagt tttcttcttt    185400
     ggcccaacat cattggatgc agcagcaggc gctttactct cattgtactg atctctttta    185460
     tttttcctac gcagtgttct agccacagat gctttctttt ttagctcgtc tttcttggag    185520
     tctaacttat cctttttggc atcttctttc ctctctattt cctgcctctt aagctctctt    185580
     atctcttcta gccttctggc tttttccagc ttactttcag taagttgttc ttgcttatct    185640
     ccaatagtac ttattagcct gctgtaaaga agctcatcat gatcgccaac aaacttttta    185700
     cccttctttc cgcgcttaaa tttaacgcca gggatcaccg cgcggttcaa acttggaata    185760
     tttagctctt tctcggaata cgccttaacc tttttgttct tagaaccata taacctcgca    185820
     agagcttgct ccttgctgac cttcaacttg cttggttttc tcgaagctga cttctctgtg    185880
     agttttggag cgctcgataa ttgatttctc gcttgagagt cttgaaaaac ctcaggattt    185940
     acctctcttt tcccattctg tttgttggat ctttttgcag tcttggtttg cttcccggcc    186000
     atggcgaaat ctcaagtaac cggtgagtct gtatgaagga actccaaggt cactaacgaa    186060
     taagatgaag ctttgtttta aaagttttcc actaagctgt gtccaaagcg atgaggttac    186120
     cctgccatac gtaagaggaa gcgctggcac gtatgactga ctagttcagg aaataagctc    186180
     cagacaatag gatctctact gtcaaaaaaa caatatacat ggctgctagg taaacacttt    186240
     tcaacacatg ctaactggcg ctacactgta cactgtcgtt tatgacttgt tgtgtgatta    186300
     actgcgctct taatgattcc atgtacgctc tttccctaat taactttcac cctacaaaaa    186360
     tcctaagctg caaatattta aatattttcg gaagccacta acacatattt ttatagtagc    186420
     aaaagcaaaa atgttattac ttttatagat aaagtttaaa ttcaaaagag aaagtaatat    186480
     atatatataa aatgcactca ggtctatcag gtgaccagaa ctgcttaata taaaatcttt    186540
     actatttagt tttttatttt tttagaaggc tgcgtattgt cgagatcttc atgtctcttg    186600
     aaccttaaac tggcaagtat agaatcatac tcttctttga tggagagaaa agccgtttgc    186660
     aacttgtcgt ttcttgtcgg agtatctaga tcagctagta agtcgtaatt tttctcgtaa    186720
     agtctctttt taacctgtaa tctaaaattt ggagaacata tatgaagcaa tagcatttca    186780
     atcagccttt gaaactgcct tttttctatt ttgaaaatag accgctgggc ctcaatccat    186840
     tcgtttttta taggaagctc tcgtgggatt tcgctggcaa taccgctcgc gtaaagcctc    186900
     ttcaaatcat tcctatctct caaagaatca aaatcctcgt tgggatcctc cacagtgatt    186960
     tcgatgactt tagtatctgc aagccagtca ttgatgatag cgttataaag ttcagatcca    187020
     tggcccactc cttggtatgg tgggaataca agaaactgtg agattttccc agtctgaaat    187080
     gttttatcag tgctgtcaaa attccttgct cccatatact tccagtactt gtaggtagta    187140
     ctataaccta cacattgctt attcccagtg ttgaatgaca tgtaaagctc ccaaccttcg    187200
     tcaccttcgt caatgtatga ggctgattcg ataaggaata aagtgaatat ctgcatgcga    187260
     cgatgaagct ttttcacgtt atcatcatgt agatcgacct tgtacacagc aaaattatgg    187320
     ccctcacgac tatagctagc gactttcttg ctttcatctg gcagagtaaa actctccctc    187380
     tccttgttaa aagtgtcaac ccaagctatc tcgtccttca caattacgtc gccatccggg    187440
     agatatttta acaacttatc ttggacatta tcgtcggtat ccgctagctt tgctccaaac    187500
     ttcacgttgc aaaagggctt gaaagttact gaatcaaaag caagtagaat ctgaagatct    187560
     tgataaccga aaatttgttc tgaatcccca tatatgggat atgtaaatgt gggcgtgaat    187620
     tggacagctc cttcttcatc gacaaaggaa agcttcacag cagtgttcga tgaaacagtc    187680
     caagcttcag gtctcagatc acttgcgtct gccatagcgg gtcccacctt tgatctttaa    187740
     attaatatta ttcacgacta tgcgaaagtt ttattttttc tacctaaaac aaatgcacgc    187800
     tactcaaact tacctccacc ctctcttgag ctaagggagg gccgcctggg aaggatgaaa    187860
     catggtttgg cagcgttcaa ctccgatcaa cataatcgtt acagtactac agcaagtatt    187920
     ttgagcaagc aagacagaga gttagatgag cagcttaatg tatttcaaca acgactggtc    187980
     gagtttgcca aggttcacaa taaagagctg agagagagcc cagaattcag aatgaagttc    188040
     atcaggatgt gcgcatcaat aggcgttgat ccgatatctt tgtttgacaa agaacgccat    188100
     ctcttcgatg tgaacgactt cttttatgag atctgtgtca agatcataga gatttgccgt    188160
     aaaaccaaga acctaaatgg cggggttatt tcgtttgatg agttacacaa aggctatttt    188220
     gagcaattca aagtgcaact gaacgatctt caaaaagcgg tagagatgtt agaaaccctt    188280
     gacggtgggt ttgaagtttt ttgtattaga ggcaaaaagt ttctaagaag cgttcctaac    188340
     gagctaacaa acgaccaggc aaggattttg gaggtttgtt ctatcctcgg gtacgccagt    188400
     atatcattac tgcggctcaa tctcgagtgg gaacctgttc gaagcgacgc catcttgaaa    188460
     gagatggtcg caaatgggtt attgtggatt gacagtcaag ctcaaggtga aacattatac    188520
     tgggaccctg cttggattgt tcgctctaac ttcgcttgag tggcgaaccc aaagtgtatt    188580
     caggttgtgg tcatacggtt cctcttcttt gcggccttct tctctctgaa tttctgattc    188640
     actgactcca cggattccat cacacccctc tctagcatct tttgatacac agcaacaact    188700
     ttccctttgc cgtctcccag gttgatccgc gttctgccct gaatttcgga tgttgtgacg    188760
     cagagcgttt cccgaaaaat gttggcgaca gtggatttca agttataatc tagtgataag    188820
     gcgtacactc ggcggtctga ttgcaacgat ttaaaattgt tagaatctac cgttttccac    188880
     tccatctctg ggaatttgca gtcgaacaaa atcagaggta tatcactagc catatcgtaa    188940
     atcggttttt gcttaaccct tgcgacgtcc ataagatcct tgagtaaagt tgtatcttcg    189000
     agcccctgcc caatcaaaaa aagattcgcc atcatgcagc gtacctggtg ccaaagaaat    189060
     gctgagccta taaggtccag gcagtaaata tcttcgctca gcgatattat tcgagatctt    189120
     tcgatgtttc ttttgtaatt gttaatttgt ttcgaaccgt caagcttaca aaagtttctg    189180
     aaatcatgct ccccctcata catccgagcg gcttcttcca ttttcttaat atccaatcca    189240
     tctttgtgaa agaggtacct ataatggcga tactggcaac taaacctggc gtcgaaattt    189300
     gttggcggac gtagacagac agcagatatt cttatgtcgt caggaagtaa ctggtttagt    189360
     atatggatgt agtcaatttc ccgtccatca ttttcttcat cctgctgttc ctctcttgtt    189420
     aaattggatc tcacatgcaa tgaaataact tggttcattg cactgacacc tttatcagtc    189480
     ctcccgcatc gactgaagtt gtaatcttgc gggaccattg aaggaaccaa tttacaagca    189540
     ttcatagctt ccaaaatagt gccttccaca gttggcaacg gagtaggctc tttctgaatg    189600
     gcaagcccgt tgtaattcca acccaagtag gcaaatttga acgcaacaaa ccttgtgtcg    189660
     tattttgaaa agtcgaaagg cttgtccttt ttctttctct ttcttttttc agggaggtcg    189720
     tccctcttag cctttttggt cttactttcg gagcgatctc cttcatcttc tgctttgcgc    189780
     ttgttctcgg cttcaagctc cataaccttg cgcacaagat cttctttcga ccattttgca    189840
     tattcgcatt gttcaggaag cgatttgctt gcgtttctgc caaacctcag aagctttgaa    189900
     atgaggctca tgccagcgtt taacactaag ttcagttttc ctgtaaaagt ctgcgatgat    189960
     gttttgatcg cttttttaaa ttaatggaat tgaaaataag agtatgaaaa atttaacgaa    190020
     gtctaatccc agcatgaagc tcatcgcaga gaccttcttg aaaaaaaatc ggcggtatgg    190080
     ccaggtcgct atcatgggat aatctaaagt atgaacttca gccatggatc cgcactgcga    190140
     tagatgcaat ggggtttgaa attatgaccc cagttcaggc ctctactatt ccgatgttct    190200
     ctgggaacaa ggacgttgtt gtggaatctg taacaggctc tggtaaaaca atagctttta    190260
     ctattccaat ccttgaaaag gtcgtcaagg aggttttatc aggctctccg ttgaagagag    190320
     ggcatttcta ttcactaatt atatcaccta caagagaact atcaaagcaa atccaggacg    190380
     ttgtggaagc gtttttggca tattatccca gtgaatcgtg tcccataaaa tcacaactta    190440
     ttgtgggaac tagctcgtgc tctgttagag acgacgtcag taagttcttg gaaaacgcgc    190500
     cacaaatttt aattggcacc ccaggaagag tactggactt tatgaaagca tctactgtca    190560
     aaactagctc ttgtggtgtt gttgttttgg atgaggcaga cagattacta gatgtcagct    190620
     tcgaaaagga tgtggaaagc atacttggca tgctgcccaa gcaaagaagg acagggctct    190680
     tttcagcaac cataagcagt gcgggcaacc agatttacag gactggtatg cgcaatccag    190740
     ttaaaattgc tgtaaagtca aaagttcaga acccagaatc attacaaatt aactatattg    190800
     tcgtgaaacc cgaagaaaaa ctgcatcatc ttctcaatat tattaataat atgaggtaca    190860
     gaaaatgcat cgtttatttt ccaacttgtc aggctgtgac atacttttac tcatttctca    190920
     agcacctttc tgacatcagc aaaacgcggg atgacttaga agtttattct ttgcatggaa    190980
     agctacagac aaactccaga attggaacgc tagctaaatt ttctacaagt ttgaacatag    191040
     ccgttctctt gacaacagac gtggctgcaa gaggcattga tattccggag gttgacttgg    191100
     tacttcaatt tgatcctccc acaaacgcag aaatgttttt gcatagatgc ggaagaacgg    191160
     gtcgagccaa tcgagccgga aaggccatca ctttcataaa ctgtggaagg gaagaggact    191220
     atatcgattt ccttggagtc aaaaacataa gtcttggaga gctcgaaatt agtttcaggc    191280
     cggtcgacga attgggtgta atttttaaaa gttgggtgct acaagacagg gcaaggtttg    191340
     agcatggcat taaagcttac gcggctttta tccgctatta ttcgaaacac tctgcgtcgt    191400
     ccatttttcg cctacaatca cttgactacg ttggtctagc aaaattatac ggtttaattc    191460
     gcttacctcg tatgccagag ataacgaagt acatgagcgc agatgccaca ccctctgagg    191520
     gttggctcat tgatccgccc ctcgacttgg atcatttctc ctatctcaac aaacaaatgg    191580
     aaagggcgag gcaggaagaa ttgaaaaaga caaaggaaat aagcgacaaa aagaagttga    191640
     agagtgagtt gaagaagaaa aatgcagcat ggtctaataa aacaacttcg aaagagacac    191700
     ggaaagagag gaaggttaaa ttagccgaaa aacgaaaagc cattgagcaa aaaatcgcag    191760
     aggctggcag cgaggatgaa agtgacggag aggaggattg gaaagatttg gtgcggagaa    191820
     acaagaaggc gaaaacatgc tctcaaatac aaggtgactt ttcggatttg tagttcttgg    191880
     ttattaaaaa cgctcgtcta attataatca taatatcggc ttatagtttt actctatata    191940
     cttggccagc cttcccatca taaatcaagg tgttttccag cggaacgaat tgatgggtta    192000
     aaatttttac agcttcttgt gctactatac ctgccaataa tgaacatgtt ggatagtatc    192060
     gaagctcatc tcggctttcg acaaacgatg gtctaatcgt ctctaactca tgttttgatt    192120
     ttaccaattt ccttaaaata gctgctgctg caggagttat ttgtttgaca gtccggcaat    192180
     cttgttctgt gggaatgtga cttgctggca ccacacctct tacattttgg acattactgc    192240
     agaagttttt tatttgactt aaggggacac tagcattatg cgaggtgact atatctgcaa    192300
     atgtgttcag attcttagaa gcacatcgca gataggcttc ctgaatagca ttgtacatct    192360
     cggagctaga ctccatatcc ggaatcagcc ctgataatgg aagctgatgc tcactagaag    192420
     ggtgcttgag ataatccttt agcgacgaaa tcatgtccgt gaacattgaa ttgaaaggaa    192480
     caacacactc agaagacgca aggctgaagc atttgagcag attgtctgga attatctctg    192540
     aatcttgcag ccccaggtaa agatagcgct ctgcttctat gaaattgagg cattcggggc    192600
     caggtagcgt tttctcatgc agtcttcgga tttcaattcg gagagaagag cggtcaatct    192660
     ttgtgcaatt ttccttgagc gatttcaaag cgtggtagat tatcacagca aaaggcaaat    192720
     cgttaagctg ttcttggctc agctggctgg gctttatgct ttcgtaaaag ttgagtaaag    192780
     gctgcggcgg cttgtctatt ctcaaatctg gagacttgtg ctgccgatgg cattcagtta    192840
     caaaatgagg ctcctgtgat acaaaacaag cgtacccgtg atattcacgc cagttacaag    192900
     ccagcatggg aggcatcggg aggcatctta tactttcaat caccgacaca tccctcgtag    192960
     taaggattat gagatcgaag taccgccaat attcctgatt ccccatcaga tgagcattcc    193020
     aggtttcctc gttgaactct gcatgctcat taatactttt taggtcttca acgtcgagaa    193080
     agcagtcgga cttaacatag cttgtttctt tgatcaaatg aaatttcgtc gccccaggca    193140
     aaactaaatt cttcaagatc tcactcgcaa gcaacgtatt accgataatg catatgtgag    193200
     ctttagaaag ctcgagctgg ccatgctttc cccacagacg aagctgtcta tcaaacttat    193260
     ccatgctttt agatgagatg tgaagtaata attgctattt gttacccggc agtttatcgt    193320
     catatccttt tagagcaaaa ggatgcgggt ccagcaactt tttatcacgg agaacatata    193380
     taaatgggtt aggggatttt tcgctgcagg ttgaggtgaa atgagagcac cataaatccg    193440
     gttaccaaaa aaatgcacag aacttattca ttgagagctc agagagcacc aacagcttcg    193500
     caattgcaga gccccgctcc tcctccatcg tccactagat ccaaattctt cggtaaagcc    193560
     tcaatctcaa gcacgttccg caagaacgca gcggggaact tcggccctga cttggctaga    193620
     aagctatcgc aactcgtcaa gactgagaag ggcgttttga gagctttgga aattgtcgcc    193680
     attgagcgcc gcgctgctgc caaacagctt tcgctctggg gtctagacaa cgacgacgac    193740
     gtttcggatg tgaccgataa attgggcgtc cttatctacg aacttggcga gctgcaagac    193800
     cagtttatcg acaagtacga ccagtaccgt ctaactttga agggcatcag aaacattgag    193860
     gcctccgtcc agccatctag agaccgtaaa cagaagatta cggatgacat tgcccgcctc    193920
     aagtacaaag agccaaactc cacaaagatt ccggtcttgg agcaggaatt ggttcgtgcc    193980
     gaggctgaat cgctggtcgc tgaagcccag ctctctaaca tcaccagaga aaagctaaag    194040
     gctgctttca actaccaatt cgattctatt cgtgaattgg ctgagaagtt tgctcttatt    194100
     gccggttatg gtaaggccct gttggagttg ctagacgact cccctgtcac tccaggtgag    194160
     actagacttg cttacgatgg ctatgacgca tcgagacaaa tcatcatgga tgcagaaact    194220
     gctttagaag gctggactct cgactccgcc gctgttaagc caagcttgtc tttccaccaa    194280
     accgtcgacg acgtttacga agaagatgat gaggaagagg gcgaggccgc tgccgcggaa    194340
     gaggagtggg cgggtgagca cgaaggcggt gaggaagagg ttgagagtac cagagtttaa    194400
     ttaattccta acctttcctg cagttcacgg actgctgtgc tttcttaatg cgaaactcag    194460
     actgcagtcc tgcagccttc agcgctctcc gaaactccta caagcgttca tttgtaactt    194520
     tatcaaattt ttaagtaatc aaaattatgt caacctgtag gaatgaaaat aagctattct    194580
     taatttcata ttttagactc aaacgaacta atttgagtat ctgtaactca aataaaaaca    194640
     aaataacaat tacacgtaag ctctacatta tgcccctgtg gcgaagttct tctttcagag    194700
     cgcggtacct atcgtgagcg tagggtattc gcttagccat tgcattttga atggcaagga    194760
     atcttatcct attcttatac ttaacttttt tggcggacgc ttcaggtgag gtatcatgta    194820
     tgaaatgcgt tgttttcgct ttaactgtag ttgggataca acccagatat cggaaaactt    194880
     tccgctggga ttgttcgctt tctctccagc acttccacct cagccccttt gaagtccaaa    194940
     gggcgctgtc cagaagagat ttggcttttt caatatcacc ttcagtgact tgatgcttca    195000
     tgttaaactt caccatcgaa tgagctttag acagccagta actaaatatc tgcactcctc    195060
     tggcatatcg cctccttttc ctcgagaggt actcaaaaac tatcggaaag ttttgagtgt    195120
     aaccgttcct caccaaagcc ttgaatagca tgtcgaaaga gtgcagatta cctgatatct    195180
     ggtagcgctt gcaagcggtg ttgaaagtta gaagcgccaa atcgagtcgt cctgattccg    195240
     cgaaacgtct caaaaatgcg ttcaagcttt cgtggtccaa attgaaatca gcgtttttgt    195300
     gagcgtgatc cacaaacgcc caagccgcct cgtatttttc ttcactgaga agctttttaa    195360
     tacagaaatt gaagagcttt gagttgaggg gtacggaata ctctgaaaga aatttcaatg    195420
     cttgcgaaga attcaaggga ttagagctca agactgccaa cacaagctga ggggttatag    195480
     gcacattact ctttatcatg ttttccaaaa atacgtccct cgacatatct tcaagaagta    195540
     ggttgaaaca ggtgacccag gttactgcat ccgccttgat ctcatgatgc tgcatctgcc    195600
     tcaagtaata cacagcatca tgaagtgggt gtctcgactt tcgaatatgt gagtttttta    195660
     aagcgttacg aagcatgaga ttgaaggtct ttgtgtttgg ctttacaccc tctagcttca    195720
     tctgagaaaa tagctccctg caggtagcat agtcagattt ctcactgaaa aagaatatta    195780
     catcattgaa aacaccgaca tcccggaatt gcatagtttt catattcgaa ggatgcaata    195840
     tgttgcgaag tatttttggt ataacgccat ttagaaatga tgactttttg taataaaact    195900
     tcgaatgcgt cagaagagtc acatagtttg caaaactttc tgcgttttga gtgaagtcaa    195960
     ttatcgatgg tatttcttca aaaacttcac tgcgaaagtt tctcttagca tgacctgtcg    196020
     acacttcttg aggagtcaac gcaacaagca ggggtatcat ttccccaacg tactgctgcg    196080
     aactactgaa caaaagtgtt tctgagtttt tagatgactt cagcttcttc aatgctgtga    196140
     agtttgctct cgcgcggtct tcattgtagg cgcatggtaa tttgtgtcta gcaaattgat    196200
     gcgacgtgaa ggggctcaga tagtcttgaa cagcggatct ctcgaagttc gatcctttac    196260
     caaccacatg aatgttccgc aatacgtatt cattcttcaa ctttgttggt tgtacgccgc    196320
     cttgtcgatc aactttcagg tctaccccac aacgagcctt agtaggtact gcacgaaatg    196380
     acttttctgc aacgacagat ggctctctga taccattctt cgctatccca cttcctaatg    196440
     ttgcaagaag tcccatttca gaccaacatt ggggaccggg tctttggtat tcccaagagt    196500
     gtaattataa caagagcttt catttcaggt tttctttcat acaagtttcg aagaaaaaaa    196560
     cctaaacttc attttcctga aaaaacaatc aatacacaca caatacatac acacttcaat    196620
     aaccgttgaa agaagctagg gaatggcctt aaaaacacct tcttagtttc tgttgaggaa    196680
     cgttcttctt gcccacgccc tgcttccaat tcatagacgc cctgatggca gtacattttt    196740
     ttcttgtttt aaagcgacat tagctcaaaa gatcacaaac ttcagtcttc tagctccact    196800
     tccgagtccg cgtagctctt cccacctacc aaagatagag cagctggtag aaaaaataat    196860
     gcatgcgcac aagaagcgat tatcaaaatg aaccacatcc taaaataaaa cacttgaaag    196920
     atcttggaat gggtaaaagc caaaatggaa accccaataa atttagttag tgtaatgcct    196980
     tgaaagaccg agcccccaac agtttcgatg gcatggacca ttctagagtc acgatctgtc    197040
     ttgatattgc tcggaactat agtgaaggct cttgctatat gcacacaaaa ctcaaccgcg    197100
     attccaacgc atatgattag gttgactaag ctgacggcat tcagtgatat tcctaagaag    197160
     aacatgagcg ctccaatgtc tgtcagaatc atcgcgacgg taagccccac taaggccgct    197220
     gtttttaagg aacccaaaaa catccaggat accaagagga cgagcaggac ggaagaagct    197280
     agcagcttca atgacagtga taccagtgat ccatactgca cgaagaaaat gtaaaacggg    197340
     gagtatgcga agacgtctag ttcaaaaagg gatttactaa ttctttccgc atctttgtag    197400
     gcttcgatga agtcttgttg tgatttgagc ggtttgtgtg cacttcggaa tgttgatgat    197460
     ttgatactag ttttattgta ggtgatggca gaagaatagg gcgcctttcc ccctagagga    197520
     caagggtcgc tgggcgagtt gatccaaata ttgaagtaat gcatgaactc atcacctgta    197580
     ggaaaaccac tcatgtcata gaaccactca gactcagaaa aacacgtttc acatcttcta    197640
     cttgggaagg acggaggaca cacatcttct gttcctttct tcaacctgca acaagtgtct    197700
     aattggggat tcaggaacat cataaaatcg tcaaaccagt ttgtcacagg ttcaacaact    197760
     gttgaccttt ttcgttcttg ctcaagagtg tttgccaaag ataggtcgtc gcatgttgtg    197820
     aacttcccgc aaaccttctt ttgattactt cgactggtta gatccaagtt tttcaccacg    197880
     aaaaacaccg gcggtcccac attcaaatac ttgtagatat cacggaaata gtcaacaaga    197940
     tatgaatcct gagggactgc caaagtttga tcaagaccga tttcgatgta aggaatgaaa    198000
     aagagagaaa ataaagtcag agaaacgaaa attcccacaa ttttccgctt cttggtaagt    198060
     agctcaacgt aggcagactt cagcttagat ggcgtggact cggaggacac tgtattttca    198120
     gtagcagaga aagttctctc atatagcgtt aaaattgaaa cgtaggctga cagttgcaat    198180
     aagacgttga aaaccagaga aactgctgag tagatagcaa aattccgtac tgctggcata    198240
     ctcacgaagg ttgcaattaa gaagcaacaa agctgacaca acagagaaag tagtatcgaa    198300
     ggagaaattt tttgcaatgc ttttttcatt atgtgttcga cctcaagtgt ctgttcacct    198360
     tccgagattc tatcaaactc gtgagttatc aagtaaatgt tgtcaattcc aatggctaaa    198420
     atgaggaatg gtatgacttc tgcgataata agtgtcgact tgaggcccaa aatactgagt    198480
     acgccagttg cggatgatac tgagctgagg acaatcaaaa taccagagaa acctaggaga    198540
     agtctactgc ctcccccctt ctttctcagt gcccatgaag cgtaagcgaa cattagcaaa    198600
     tatgacacta agacaatata aatgtcgttg tttcggttca gctctttttc tagtgacatc    198660
     tcagtattga agctcaacct caaaccatga ggtaaatcca aatttaacag ataatcttct    198720
     agctgcttct cccataataa agcagaattg gaatggttgc taagtaggag tgtcaccact    198780
     aacgcgttcg acttaaaaac gtcattgtcg ctgaaaagga ggttgggttt cagcggttgt    198840
     tggaaggaag gcaaacagtt tacgggcgac tctgtgcaag atttgagtct attttcccaa    198900
     tcgccttcct ttggaaggtc ttggttgaag tactgcgtca ctgactcgac cacacaagtg    198960
     gaatcctcag ttggcctgaa acacaagtct tggtacgttt ggtattcttc agaccggagg    199020
     acctcagtta tgtaactttc aacaccaaac caccactcta agttaggata ggagagtacg    199080
     gggccagttt cattcacaat aaagatttgt tctgttctgt aaaaagggcc aaagttttca    199140
     tcaaaaaact ccttttcctt atacttcgga gagctcttgc ttacccaaag gtttatcggg    199200
     tctgtttcaa gatctccaaa tatccaagct aggactgtaa gcaacacaac aacaacccct    199260
     gttgctagaa tgacaagttt agggtgtctg tacgaaaagc cagaaatttg gccaagcacg    199320
     ctcgccacct tctcgtcaaa gctgtacgct ttatatgcgt gttcctgaaa tatgcggtca    199380
     ttatttgcaa ccgcgtagct gtcttctatg tcttgctcaa aaatgattgg ctccttccta    199440
     tttttaaagt agtagatgtg ccaccctaaa atgagaacaa aaaggctcac gtataccatt    199500
     aatatcacaa aagaaaagca tggtagacca gctaccttgc agtggttgcg tctcaaaggt    199560
     ttaagctttg ggcatgactt atcacagtcc gtacaggcgc acttgtatgt ctcatcatcg    199620
     cacgaataaa ctgtttcgtt gaagagctcg ataccagagt tttgagagtc atatatgtag    199680
     ttaatttgga atggtgaccc acccagcaaa ggtttttcgt cccctaagaa cttcaaaaat    199740
     tgttcataat tcttcgctcc tccgccaatg agatccattg cgtacccatt ggttgcacca    199800
     aatttaacat tcttacagga atcatagaac tcagatgccc aatgcgagtc gaggaagaca    199860
     ttcatagacg ccactatttc tcttccgtct gtggaacttt gggtttccgt cacattagtg    199920
     aaaactcttt gttggggaga gcatgtgaag tggcaaaaca agctcttaaa gtttttgtcg    199980
     caggcaggac acgaagcaat caagttttca gctttcttta agttctttcg caggttttcg    200040
     atttgtgctc cgttgcagca cacttggttg acatccttcc attcttcccc gcaaaggtct    200100
     actaaacttt ctcgttcagc ttctgatagg gggtcgggaa cgaaatcctc agtaacgggg    200160
     cagggcagtt cgcctccgaa gagggatttc ttgccacaac tgccataaat ggaacacgat    200220
     gcaggtttcg agttagcaaa agatatccca aagaaggaat cgcctgctag cactgcattg    200280
     gaaacgatga ctggaaccaa aagacacctt gccaccttca taacgcgctt ctcgtggtgc    200340
     gttgtcgctt aggggtgctt gaattctcca aactttttga acagcgattt ttgaagattg    200400
     atatttcaca cgaagacaaa agacgtgttt gttaaatgga tgtagtagcg gaaggtaaat    200460
     gaagttgctc aaagacctag cagtagcgag aaaggaactt gcagactgga ctgaaaatct    200520
     cacgtgggct cacgatggta ctctgtactt aactaccgtc ccagatatta cagtgtgtgt    200580
     tcctgtttac agtgaagcca ctaacagcag caaggattta tttcacatca aggagtaccc    200640
     tttgcccctt gtaaataaat ttgagtatga cctggcgcaa aaaaatgtca tgataaattc    200700
     ggtacctgag agctctatca aaatttgcca ggcatcccct gtatcagatt cacttgctgt    200760
     actgacaaac aatgcaaatg cttgtatcta cagtgggcga gggctagtgg cacaacttga    200820
     ccaaccagaa agggctctag aagagcgatc atatcactcg ctagcatgga atgttgaagg    200880
     caacatgatt gcagttggta acgaggcttg tgaggttata gtattttctg tgaatgaaaa    200940
     tttcgaaggt gcggagttca tttaccatcg tacaatcaaa atcaacgatg atgcaacgag    201000
     ttgggtcacc aggttagaat ggtatgaaga agggatcata gtttccctca gtaataactc    201060
     agttcatctt gttcgggaag acgatgggcc taagcagatt aagtgctctt ctcggttcaa    201120
     gaattcggac ttgaaaggaa tgaaaggtaa catcataata acatccgcgg gatctgttca    201180
     caggtacgaa ataggaagtg gcactttgga gtcgcttgac ttgggggctt gtgatgactt    201240
     ttacgtcgtt ccgctacctg attataacac ggctctgtta atttcaaaca agacttcctg    201300
     tcttttgagt ttaggtcatg aattgcgttt acagaatgat gttatcatat cgccgcatat    201360
     agaggcgaaa ttcaagaagt ggaacaacta ctttaacgaa ttcaataatt acgagactaa    201420
     ttttttgatt catggtttag caacttcacc ggatggcgca tgtttggctt tggcatacag    201480
     ccttgatcgt ctttcgataa ggtatcgtat agtgtccgag cagcagtaca gaatatgctt    201540
     gtttccgttg gggaaagctt gggagatcaa gcaaggatcg acgggattga cgtggtatca    201600
     gaattatcaa atctataaca agcagcttcc gcgcaacttt gaaacagacg aaggctgttt    201660
     ggatctcgac actacactga gcttcaaatc ctaccttcaa gaattgatga acaataaaag    201720
     aatgaacaat ttgaggtttt ctaattttct agaacaagaa aaagataaca atctttacaa    201780
     aagggcagtc tacgattacg ctgttgctca caaagacgaa gtcgttaacc ctctcgataa    201840
     agcttgcgtg caatcaatag cagacttgtt ggctcttgag agccctgttg tacctgaaat    201900
     ctacaccatg aagggagagt ttatagagga gactttcagt tctcccgctt ctccaaacac    201960
     agatgtggtt caatctgagg agggccacat ttggaaaagg tgtcgcgcca catttctacc    202020
     tctccttacc tcgaaagtta aggtgtgccc agtgagtaat taccgcatca ttgatataaa    202080
     gcacgacgct cgtaacgatt atggttggct tactcggaca attctacaat tttccaacaa    202140
     ccaaagcatt tatagtggaa cacggatgct ttaaatcaaa ttctctcgtg gagttttcgt    202200
     ttcttgatat gcacagtttc aactttgttg caatctagtg gaccgaatca gcggtcatcc    202260
     tgggccttgt tcgcgtacca ttttgcgctt ttctcgaaca agtcatcgag cgaggtggtg    202320
     tgccgaatcc gcttagccac ccaattcgag agcttggtct gaacctgaat ggagctgtat    202380
     cttttatcaa ccaaataaat atttgcgtag tcttgcgcgt gcctaatggc cctcccaatg    202440
     ctttgattta cagctttcat acagatgttc tcgtaaaact ctcgcgtagc tctctttgcg    202500
     tcttgactgc tgccatttgc tttaagcacc ttttgctcga ggtgcttcct ttttataatg    202560
     agttctccac taaataaatt tgggtaaggt aggcctacca tcaccactgc cctcgctaat    202620
     tcgttctgaa aattgatgcc ctcggagaga cgccctccaa ctaccgcaaa aagtatagcg    202680
     cctccagtca attttcgaac ttcctcagcg tactttgcaa agacgtctgc tttatccgct    202740
     gactcgtaaa atattttctt atttcctatg cacgccccaa ctttgcaggt gctgttccag    202800
     aaacgcataa gagattcaag aaacttatag ctaggaagaa ataccactac accgtcgggg    202860
     acaattttca ctagccggga gaaaaaatca tataaatcgc ttaaagttct cgaatcttct    202920
     cgcttgtcgt atgtgaattc aaacccttca gtaacaatga atgtgttaag gttgttgtca    202980
     gggataacat gattacatgc gaatttattg atttggtttt catcaacaaa gggtataagg    203040
     tctctggtga agtctgagat cggctccata gtaccgcccg caagtagtac gcatctagcg    203100
     gcatgaacta tggatttgaa gctgttgctg ggctccaaca acatgtattt catcactttg    203160
     cccttttcaa aaaaaaactg accctctaag gaaggatttg agagggtttt caaaaaggag    203220
     gcaactttaa agagaacagg ctgcctttcc actgcagccg tttccgcact ctcattttgg    203280
     cttttaatat agctatcgat tttgtatgca atctttgtgg ttttcatata ttgttccagc    203340
     ttgtgaatat tcaaaacgtc ggcattcgtt ccctcaaaaa cttcgtgact ttcaaactcc    203400
     ttaccgtttt tgtagttttg ttgaagaaat acgattagaa cctcaaccaa agtgagcaat    203460
     cttttcaagt tcactcgatt gtgagggctc aagcgttttg cgaacttgtt ttcatacatt    203520
     gtaataccaa gcttactgct ttgaaggtcc gccaagctaa cctctgctga gttgacagcg    203580
     tttatagtat caatgaggtt atgggcctca tcaataatta ctattgaatc tttgagatcg    203640
     acgcccaaag cttcgcgcgt gctttcaaca agaaggtgct gatagggtag tgttacaact    203700
     tcaactccat catgcagtaa ctcccttaaa gcataatacg gacacgtact ggtggcgcgt    203760
     cctaatgaga ccatgtcctc gatatcgtga atagcataaa atgcatggtc tctaaatgcg    203820
     tgtagaattt ctggatcctt agacctagta tagggaacgc attccttctt gctgactgca    203880
     tctctgcagt agtcgttgat cacttggctc gatgtctttg agactttagg attgatacac    203940
     agttgcttgc gcgacgccaa tggaacaaac ttcacccttt catgctccat tgattcaaat    204000
     gatggaggaa aatttggtag tctcaattgt gaggccagct ggcccagctg tgaatgagtt    204060
     cttgaggcat agaaaatttt tatgggacac ggcagtgcgg tttgcgttgc ctcgtcaata    204120
     ctttctgcct cctgatccag cttaccaagc aaagcgttaa cttcattgat cagcttcttt    204180
     ttcttgtcat catgaacatc ggagtacttt ttacaaccag tacttgggct tgaattttca    204240
     tcaggtaaaa actcgttctc ctcaaaaccg actgttgtgt gcggtaagtt gcgcttcctt    204300
     ttgaccttgg gactatcttc agacagataa atacttgaat atttagcttt gaatgcctta    204360
     gaacccaaat atttctcgta ttcgtcgaga gctcggactt tctccttgat tactgattct    204420
     gcgaaagcct ccttcaccca tgaaggttct tcgtcgcttt catcatcact cttagtcagg    204480
     ttcccatcaa cggagcttga ggtttctttg ctcttcccca tataatgagc tttattcctc    204540
     ctgagccagg ttactgttgg gcaaatcagt gacagcgtct ttccggtacc ggttggactc    204600
     tcgaagatcc ctattttttt accactttcg agcgtgttgt acacttgatg catgagctga    204660
     agctggatgt cataaggctg gaaagggtga ccgtaatttt cttccccatt catggccttc    204720
     tggtctcaaa ggacaaccct gcgtgagcga atgtgtcagc tccccatctg tgaatttttt    204780
     tcgcacaata cgatatcgag cccttctcga attttttctg ttataagccg tttgaagcaa    204840
     taagcggtta aaatctgctt gttcgaattt tgaaaagtcc cagatattca ggttattata    204900
     gtaacattca tcttggaccc ttgggtacaa gatcggtaag aaacgcttga aagcaagaga    204960
     gatcaaaggc tcaagcttgg tggttaggct atattaaacg taccatggcg tccccgatct    205020
     tcctttctcg gcctcattca ggattttcat ggaacgcgtt cgaagtgggt ctaaggcttg    205080
     ctgtatggtc attgcaccgt ttcgcaagca gctttactga tttctgtagc agagagcgcc    205140
     acgccctatt gaaagtgtgc gcgctgacac ttgcaacaag gttagttgta ttctctctgc    205200
     ggcaggtgat ggatcacttt ccactcatgt cactcgcggc cgactccatg gatctccttc    205260
     ttgcctgcta cggactgtcg cgtttcgcgt accctgagtt caaaagagca ttctggtcaa    205320
     gttttcactc gaatttcaat gattttgaga acaaaaagct tcattcagag ccagggccca    205380
     gtctttactg catgctgttt tctttattca gaagcaattt tatgtggctc ataagtctcc    205440
     ttctactgtc tgattttatg gttacgtccg cgcaagtggg aaagccggaa gctttaacgg    205500
     ctgtgtcgaa aactgtcata agcattatgc ttttaacgct ctggacttcc catatgtcgc    205560
     ctgctttggg ttctcttgcg tcgctggcgg ttggcggagc cctgacagca tctctagccc    205620
     ccttttcaaa tttggcgctt cttttgcgct tatggcagct ccagttttta gtcgagtacc    205680
     taatggttcc ttacgtgtcg caggcccgat tttcgcctac cgagtatgcg atgtggctca    205740
     aggtgcgggg cggggtgata tgcggctttt caacattcgt ttacgttctc ctgtcactat    205800
     gcggacctaa cctaatgtca cctctgcttg tctacatcct cgcccctctt ttcgcgaatc    205860
     ttatgtcgaa aattgccgag cctgtacccg cgaacatcat tttcggaacc aaggcttatt    205920
     caagatggtg tgctaggcag atcttgtgga tagagcgtaa gcgttgcctg caggcacggt    205980
     aggctgaagc tcgatttacc gttcaacgca gtctgctcac tctggggaag cagagaagga    206040
     tcctcggcgc aatatgaaat aagcacacat aattacacgc acacgcagaa tgcgacgcat    206100
     gttcaagtgc gcatgaggac gcgtgcctgt gcatccctca ctggtgccta agacataaga    206160
     tcacctagaa ggggacgcta attgctgctt cgaatcttcc atgcgtcagg tgcggccggc    206220
     gagcgtcagc agtgacggtt aggaacggtt tacttcgttc aaaaaaaaaa agaacgcgta    206280
     acagcttgaa ttaccccgac tcggacatct ttttcgtata ccctcctgat gtatcaaaac    206340
     ggctataaag acgtggactt tgccagccgg agtattagca atcatagggt gaagcggtat    206400
     ccggatacaa ccttaagcaa taaacagttt ttgcggtagt taactgatcg gagattagca    206460
     catagtatcc tttgcaacac tttttcagtg ttttgcgttc attttaaaaa acgttcaaag    206520
     tatctcggaa cggttttacc taaggggaac cagtgccaaa acacggaatt acttgaatcg    206580
     agcggataag ccttcaagaa agttcaggat agaccaaaga ctaccacaaa atgctcctcg    206640
     aaagatttca aagtaaacta cacggctctc ggctgtcaag gcactccaac tcaaagtcta    206700
     ggagcaagtg cgatgccgac gcgcagcctg tgcagaacat agctgatgac ctgatgactg    206760
     gcgacgggat gtcagacagc gacgcctacg cgagcatgag agagcttcag atcagcaccc    206820
     agttgtgcga gccgcggagt ggaacgccac tcaacggcgt ctcaacgcct gtgatgcagc    206880
     ctataatgcc ttacatgtac ggcaaccaga aaaggcagga tagtgtggct tcgttcgcaa    206940
     gctctatatc tgacatgcca gggcccgccc gtaccgccac tacacccttg ccaacgacct    207000
     tttccactca attcgtcaaa atgctcatgg aggtgtacca agacatatgc tcagatccaa    207060
     ctgcaacacc gtttgacgcc tcgaaccctc cttctgggat actgaataga actgcgaagg    207120
     tggctgtaga aagagcagag caaaagggcg tagatatggg tcgcgaaaaa aacgcgttgc    207180
     tggtcaactc cgttaagcag cggctacttc aagagcttcg ccgcgacgcg tacctatcac    207240
     gcaacagctc aattgtttca ttgcctccca tgccgcagtt caacacttct gatatagctc    207300
     ccactgcttg tgtggactac ttcagcacac acgcggaggc gtcctccaat ggccaacttt    207360
     ctactccttt ccaaatgccg acttctagtt taggcagcag tcagcctctg cagacgccgt    207420
     tcgaccagag acctcaggtg ccgaaactct cacaccgctc ccgaaacgac agtttcatta    207480
     gcgcggcagg aagaagcaga agtggttcaa gtcacatgtt tccttcccaa cagcagcaac    207540
     agcagcctca gccttcagcg gcccttcagc ctagcagctt catagagaca acaactgcgc    207600
     cgagagcaca gtttgaaggc aacggatact tcgtcttgac gcccacaaac tcgatgctag    207660
     gggagccgca gcagcctttc attgctcgag aacggagcaa cgcatctagc gcgtttgaag    207720
     atatgatgag cggcgagttg tcaaggcata gacagaattc ttttaggatc gaaaagggaa    207780
     gtgccactgg ctctctcgca atggacttct aacgggttat tgggtcaatg taaataggtg    207840
     taactataat ttgaaagcaa agggcggctt atggtatttg atgtgcccac tgatacaaaa    207900
     tgactaaacc gcgaatatat acaagatagc gacgacttat aattttattc caagacttca    207960
     cgtttgggca ggacaacggt acggcttgtc gtgtaagttt tcccccaatc tgaacccaaa    208020
     atgttgcatt tttttaacag cttcgtgaca gtttcgctag gctgagcgcc aaccccaacc    208080
     cagtacttgg tcctggcgaa gtccaattgt acatcctttg ttggtattgc cccgcttttg    208140
     gtttctcttt tcgatagtgg ctttggtatt gggttgtaag ttcccaaaac ctcaataggt    208200
     gtcttgtccc tagccttgga tgcgtttgca accactatgt tatataaagg ggagtgtctg    208260
     cgaccaaatc tggctagtct tatcctcacc aggcccttcg acatgttggt ttattggcgg    208320
     caaagagaat agcgtagtgt atcaaggctt gaacatttca aagattccaa aatttgctta    208380
     ttcgttaaac gggatcatga gctggggcat ccatttcttg aaaaattttt agtaaccttt    208440
     cggagcgcat ctaatctcat ctcatctcat ctcatctcat ctcatcttca aactaagtag    208500
     tggatcagct aaatactcgt cttaaaacca tgaatcaaga cgaaattgca accctgcttc    208560
     agctagaaga caaattaggc cagatcaggc aacaaattaa ttctaaacta gagaaccaga    208620
     agcatgtggc gatcatctta tccgccgtgg aagagaacat ggatgagcaa caagttgctg    208680
     ctaaaaacat tgtaaactat ttgatttcac tcatgtccct tctggaccaa gccatcaatc    208740
     cggaaaccca cgaaattgtt gagcttcaga tatcgacttc tgtggcttac ctcttggaca    208800
     ttgtactgaa atacactcca aaacagctac tgagatcgaa gttcgctgat atactcacaa    208860
     agtttgcacc atgcattacc gatgaaaaag cggaggcgcc gttaatacgg tctgctgtgg    208920
     ggtgtttaga aactcttctt gttgcacaag atgcccagtc ctggaacaat acccacaatc    208980
     tcagtatcgc ccccagtaga ggtttgaacg gtttgctaga gctctctttg gatccaagac    209040
     cgaaggttag aaagagagct caggaggccg ttggcaatat aatgtcaaat ccaccagcat    209100
     cgccaaccgc agagcatgtc gcggcgcctc tcgtggcaga attctccatc agtgcactcg    209160
     cgtctgctgt ggaggaagtt agctctactt cgaacaaaaa gattcgtgct caaggcgggt    209220
     taaaggagct caatgcaaaa gccatccata ttctcaagct aataaacact gttttgtcca    209280
     gtaatcaatg gccttcttca agatttgatg tactctgcga tcttctgcta gaaatgtcca    209340
     ggtctgctga tcagtttatg gtatcaaatg cattccagtg ttttgaggct ctctttcaat    209400
     caatcgcaga gtcagctgcc gctttcggct tggcagaaaa caagttttca aaggttttgg    209460
     acataatttt ctccttaaaa ccttcgaaca gtgacacgca cctggtggga gcgtggattg    209520
     ccgttgtcgc aaaaggcatg accacttttg gatcatgtag ccctctatca tgtctagaga    209580
     aaattcccga agtcatcaat gttctgagtt tgtatctctc tagcgaggtg cctgaagttt    209640
     acactagcgc ttctcaatgt gtggaagctt tattaactgg atgcatccaa gacgatttgc    209700
     tgctattgcc accacaagtg aacgaaaacg tatatgagaa ggttgatgag acaatttctt    209760
     atcttgctgg agccttcagc gactttcttt ccatcaaata tgcgcactgt gcgaaagaaa    209820
     ttctacagaa tctcaccact gctttcaaaa aacttagaat cagatcaaac cctgatcttc    209880
     tacctccgtt agaaattgtt gggggatggc ggacgaatga agacaacttt ttggaaatga    209940
     gggccgaaat agagacagta ataggtgctg ctgtatctgc tattggtcct gatgctgtct    210000
     tgggttgcct tcccctaaat ctaacggacg cgtctggcag taagcctggc cgtgcttgga    210060
     tgatacctct tataagagat aatacttgca atagtagact cgcgatattt gtgcaagaat    210120
     ttcttccttt aattcaattt tttgacgaaa aggttactgc gcttccaagt gattcagttc    210180
     agagcaaggt ttttgaaaca gtgtctggtc agctatggtc tactctgccc aactttgcta    210240
     accttcctac tgatttgaga gactctttta gcgatcaatt tgcggctgat ctttcgtctc    210300
     tactatacag caaagtggac ttgaggccta taatttgtca cgcaatcaaa aaccttgttg    210360
     agagcaacgt gcaacatgca agtttgctgg acgacaatga caagctcttg gagcaacatt    210420
     tccctaagag tgagtcccag aagaacttgg agtatctatc aacaaaagca tctaatctat    210480
     tagctgtgct tttcaacgtc tacacacaaa cagctcccaa tgccaggagt tacatcctgg    210540
     aaaccattat tgcagtgctg aagattacct caccagagga cttgaccaag acttttaaca    210600
     acgtttgcgc gctattaaag aaatcttttg acgaagaacc ggctgacgcc aaatcaaaga    210660
     cctcgccagt caaggtgagc gccacacttc tggatttagt agttgttatg gccagctatg    210720
     tccctgaatc gtgttacggg gctttgtttt caattttcaa caccacagtc aactcgagcg    210780
     atgctttgac tcaaaagcgt gcttacagaa ttatcactaa actttcagag gtggacaaga    210840
     gctcagagtc agttttgaag tatgtcgctg agatcgagca aatactgatc cagagcagca    210900
     aggttgttca cacttctgct agagcatcga gactcagtgc gatcaaggtc ttagttgatc    210960
     tgctaccatt aggtcactta gattttgtca ttcaaattgt gccagaagtc atcctctcca    211020
     ctaaagataa caatgaaaaa tctagagaag gggcatttga aacgctaatt gcaatgactc    211080
     acaaaatgaa cactcctgga tcagtcatga aactttcaaa ggttcctggg tatgatgcac    211140
     agacgccaga tcaacccacc agtgtcgcag agttcttcaa gattatttca gcaggtttga    211200
     ttggtgaatc ccaacatatg gtgagcgcta ctatcactgc atattcctgt ttagtctttg    211260
     aattcaaaga ttatgtttca acaggtgttt tgattgaaat ctacgacacc atcgagcttt    211320
     acctgacctc taactctagg gagattgtta aaagcgcgat tggctttgct aaagtctgtt    211380
     gtttagcttt gccagaggaa ttgatgaaat ctaaaattcc gtcccttctt cccaagctct    211440
     tgaggtggtc tcatgagcat actggtcact ttaaagcgag agtcaaacac ataatagaga    211500
     gattgattag aaaattcggg tatgagtaca ttgagcagaa cttccctgag gaggacaaca    211560
     gattgcttgt taacatcaga aaaactcgca acagaaacaa gaaaaaggca gcagaaagca    211620
     tggaaactgc acctaaactc agcgaggcga gcaaaaaagg ttcaagattt atgtccgcac    211680
     ttgatgaggc tctgtacgaa tcatcagatg ctgagaacag cgcggacgat gaaactgcac    211740
     caaagagggg gaaagccagt cgctttattg tcgaatctaa agaaaatcct ttggacttgc    211800
     tcgactctca aacgttagct cacatatctt ccacaaggcc acgtaaattc gacgcggcat    211860
     ccaggaagaa aggcagagac catgttttca gtttcgatgc tgacggtaaa ttacttgtga    211920
     aagacgagaa aaagccatca gaaagcgatg acgtatttga ctcatcatct agcggtatta    211980
     atgcttactt agaagcagtc aagcacggcc ctgtgagagg acaaaaaaac aagctcaagt    212040
     tcaaaaaggg tactagagct ggcgataacg acttcagcga tgacgaaggt gcaaataaat    212100
     cattcaaacc taacatgaat ggcaaaaagg ttcagaagaa aaaaggcggg cccaaattta    212160
     ggtctaatag aaagctctaa gcagagcaag ctcggtttta aattcatact caactgaatt    212220
     atgtacagta tcaaataagc agttgtaatc agcttggatt gaacccgccg cggtaaaaaa    212280
     cgcaactatc aaagaaaaaa ggttgcctgt tccgtctcgg atgcaaagcc ttggcaggga    212340
     ttgggtgcaa ccattcttga aaaatgtcca gcattcgcaa accgcgactt ccaatgattg    212400
     caggtgcccc gactcggccg ccttagcgac cttgctattt tgtcctttta tctcagtaag    212460
     tattgaagtc gaattcgtgg ccttgaaata cttcgtctcc aaactccaaa gaatctcttc    212520
     tttggaaggt atcgttcaaa ttttcggctt ctgcaagttg caaattgttt tctgacccca    212580
     gcgtgagatt catactattt tccatttgct caaaagctgc catatcttcg tttaggtcat    212640
     tatcatcaaa gttaacatca tttaaatcta tgtcatcatg gctcacgtcg acgtcttctt    212700
     cttcgaatga caacctaata ttgtcgagcc tgttgtcctt ctgatgagcc gccagcttcg    212760
     taattagagc cttttctttg agagcctttt cgtcactttc tgtttcttga ggctcaggtg    212820
     gcattatttc gctgttatca aagcgacggt ctctacaaaa gatcgaagac cgtaagccgg    212880
     ggacaggcgg caggctcttt atgtccttga cttctctacc ggagatcttt cttgcgtgca    212940
     tgagttgttg tctgcgaatc ataaaacgtg tccaatcact catgtcaccg ctgcggacaa    213000
     gttgttcgac aatgtcattg tcttgcccgc tatctactct atcctttgcg gagcctttgt    213060
     ctagctgatt gatgtattca ggaatcatag aaagtggctt tgacaattta tctttgggtc    213120
     gaagtaattc cgaagtaggg gtcgctaccg ctcgcgcttc tttcggtatg gggctcagaa    213180
     gacaccattc cttgaacttt tgcatgccta tgtcgctgac aaggttaggg ttctcatcgt    213240
     aaacatcgag agtactcatc ggttttagaa gcccaacatt caaaagggcc tgggatatat    213300
     cttgcaatgc aatatcctca tactcatcca ttctgcttcg agaaagtttc atcacttcca    213360
     gcaccaaaag ctgcaagaat cgcacatata gatccgtgaa tgcatcaact gtagatggct    213420
     gagccttatc aaagccatgg cttttgagca gctggatcat cgaaattctc aaaagcccga    213480
     agtgaaactc cttgttggag gttgacatcg tcgaaggact ttggtgggtg ccgacttgat    213540
     actcctttct atgacgctat tagatgccat agtcgagatg atggtagaat ttcgtgactt    213600
     tattttgtta cccggtattc ttacaagaag gccctctcgc ttttcgtagt ttgaacaaat    213660
     aagtcaaatc ttcaaacaaa tcaagtcgca aattaaaggg ccgcaacaac ttcatcgcga    213720
     atactaaggg tccaatggca gagctttcgc tttactcggt tgaggcggta cttttgctgg    213780
     ataatgaagg gaacagaatc tacactaaat actaccacag cccccacgaa aaatctgatt    213840
     ctcatatcac taagagggcg atagatggaa tgagcagttc cagcaaacag cagactgagt    213900
     atgaaagcag gcttttcaag aaaacgcaca agcagaactc tgagatccta atttttgagg    213960
     attgtttggt tttgtacaag gaatatgtgg acgtgtcgtt atacctcgtg ggatcaatcg    214020
     acgagaacga gctggtgctt cagcaggcgt tttctgctat caaagactcg ttagagttaa    214080
     ttttggcgac tgggattgat aaaaagaata ttattgagca tttcgatatg gtggccttag    214140
     caatcgatga gtctatcgac gacggtataa tcttggagac agatccagct accattgctt    214200
     ccagggtgac gaagccacct tctaaggacg cacctatcaa tatagagcta agcgaaaagg    214260
     gtttgttgag cgcatggggg ttcgccaaga gcaagctcgc cgagagacta caacaaggct    214320
     tgtaataaca agtgtcacag cgcgttaaat aactatataa cataaagcta atgtaaaggc    214380
     tactttaggg catcattttt tccccttttt cttcccttta ctactgggag ttcccttggt    214440
     tttactcttc acttcgtttt ggcctgggat agtaatctta agcttatctg tgtatagtat    214500
     agaaacgagg tctagttcct tcaatttctt gatgagctcg tgctcgcaag gccagtcgag    214560
     ctctttatca ctttccgttt catcaacttt ccttttagag aaatatgtta atatctcgtt    214620
     caaagactta gtcttcttgg cattaccagg ctggacttta accttgtact tgtactttgt    214680
     taatgcaggc catggagcgt aaactggaac tatatcacga actttgcttt tatcgtcaac    214740
     aacagggctg atttcgctga aaatcttcgc gtagttgacg ttgactttct gctctgagcc    214800
     aaacatcaaa gactgctgtt ttttctgtct ttcgcgtctg aatttttttt gttcccgctc    214860
     ctttagtttt gccgcttcct cttcagcctt ttgctgttgt ctctcggagc ccttcaaggt    214920
     tcctagtaca gcaagcctca tcaaccgctc ttcctcgtct tgatccgcat atttcttttg    214980
     cattttcttc attttgcctt ttttgccgcg gacatttttc ttgatggttt ctttgttaga    215040
     acctgattta tctgagaaag cactcccatt ttctgaattg ttgttggttt cgctctgctc    215100
     gcttggctct ttatcagcct gaacatcact gtcagaattt gatatcttgg gatacagacc    215160
     tgtggttact ggcacctcat cgctgtcact tttttccttg acggacttta agtctgtgga    215220
     cttggtaggt gactgatgct ccttcacacc ctccattttc tttcctatca cgaatccttc    215280
     atcgattctt cgattttcgt ctttgctaat ttcaagttca tcgtctttac cttgtacttg    215340
     ccctggcacc gcatcctcgt ctaacacgct cttctctttt tgtgcttctt cgtcatcctg    215400
     gtcctcatca tcggccccat cttcctcctc ttcctcatcg gagtctttcg tcttccataa    215460
     aagtgcaaat cccattacca actgcgaggg aggtaaaaac gactttttct tttcgtcttt    215520
     gagtcggaaa gtgccagctg gcaaaacttc accaccatag ttatcgaatt tgctaagttc    215580
     tttggcgaaa caccaccacg ctgatgattg aatttttttg gaccaagcag gagatgctga    215640
     catgcacatg atgcccgcct gcattagcgt attaggcgga acttcggttt catctgggtt    215700
     ttttatccat acgtgcgtgt cgaagctgtt agagacaaag acatcattat cgtggatgta    215760
     cttgccgtat atttgatcag attccattcc gcttttgccc atcagcacca aaaatccttc    215820
     acttgagacg aaccaatgga atttctcgaa gaaatatggc ttcctggtct tattgagcac    215880
     gtcatgcgac tctttcaatt tcttcttcaa atctttttct atcctttgct cgatattctt    215940
     cagtgccttt tgcgcattct tttccacctt tttctgcttc tcaacattag atttcttaat    216000
     attgaaataa ttggaggcgt tggcataagc tgatagcgtt aaatcaattg ttgcgtctat    216060
     cgagggtttc tccttttttt tgttatcgtt tctatctttt tttatattag aaacgctcgt    216120
     taactcatct tcatcattat catcagcttc gaagtcggac aaagaactat cagaactgtc    216180
     ggaactagat gtctcatctt cagaggaagt tagattgtcc tcttcttcgt ccgaattatc    216240
     gctttctatt tcatcattgc gaggcagact caaggtgaat ttattgtttt taagatctag    216300
     cggaagcttg attaggcgcg caatcctatt attctttttt tgctcgtttg aaatcaaaac    216360
     ctcaattgtt ttccagtcca tttgctgttc aacaagcgct ttgatggcat tctgcgcttc    216420
     ttctacgaga tctgccgcgg ctattattgc atgtcccctt acctcatttt gggtttgcac    216480
     atcgattaaa gcctgtatcc tcttctcgtt atcgagcttc gcgctttcca gtctgttttt    216540
     ggcttggaat tcttggtttt gaattcgtaa cgcgtacttg gaagattcaa tagtagagaa    216600
     gaagtcatcg acggttttgt tgtattgccc agggacttca attatcttgg tatacccctt    216660
     ttcgtcctca gacaaatgag gcggaaatgg atggaactgt tcataaacaa actcgagatt    216720
     tgcatcacct ttttcgctat catagtgagg atttttttta gcaataatat atccaagctt    216780
     gcaaccatct ctgagaagct cgttgacttc tgattctgtc gcgtccaaca agtcaactat    216840
     ttcgtcgatt ttgtctaaaa agttgagaca aggcgaattt ggggcaatgc ctctggattt    216900
     aagatttcta gaaatgagat ctgacgagag ctgaggctct cgtaaaaaca aaagcttgtg    216960
     aatggaaagc acctttgcgc cttttccggt ttttgccttc acagatgaat cagcaaagtc    217020
     cttcgcttcc ttgatccatc cgtttacttc gtcagcagaa tgaactttgg acttgggggg    217080
     ctcaatgcgc gtgttttcga ggaagctacc atcgaacatg ttgtaaatgt ggccaacttt    217140
     gttttcgtgt tcatggacga tcctctgcag aacaatgatc ttacgatccg agtctaacag    217200
     gataacattg cccgcgctga agaattccaa gaccaaaaag aattgaccat cattgaagct    217260
     aaggaccagg attctatcat ttgccactct ttttactgtt gtaaggcgct ttgatttcag    217320
     atgtttgcgt aatttcacca caaatccaga gggcgttgcc gggacgggcc gcgtgaaatc    217380
     agtcaggtgg acacgcagcc cacagtcaat aatagcatta agctttgagt ctggcttgtt    217440
     gaattttaat aaaaactgcc ggctcgattc tgcaatgttg tagatgttag acaatctgta    217500
     gccctcaagt tgcgatttta gctctctgta gagaagctct agatctaacg agctaattct    217560
     ttgcttcatt agtttaatgg aagaaagaac ggcctgagtt gctcttgttt gaagccctcc    217620
     gaaatgcagt ggcgctaatt tgtagttttc ttaaatacta agatttttta ttgccataga    217680
     gttgctaccc gcacaggttt gcatttcaag aacttcagca tacaagtcag cgctaaaatc    217740
     ttgccgctgt gtgctgcgct cgtttgttat ccagttatgg acactgtgct ttgattgttg    217800
     tgtatgaaca acagcacaaa gtctgatacg tgctttatga agtcgtcaag cacaaagtat    217860
     ggcgaccgag ctccgtttaa atgctgtagg acaaactctg cataatgcgt cgcattatat    217920
     tggatttgaa ttgaagcatc aactcacaac tcaacctaat cctttaagaa tacgtgtgca    217980
     ctgtcataaa acaataatgg aacaaggata ttctgagaca acgaaggaac aacatcagag    218040
     ataatgagga acactagaga taatgaggct tgcactaggt ctccggatct ataactataa    218100
     gtactactgc atccaaggct cagtatgaga ttaagtagaa gaaaggaaga aggatcctcg    218160
     aatggaagaa taatcgcgac cgtatagagg ctattaaccg ccaacttcat cataatccag    218220
     aggctcataa taacctacga catgcacagt agagcccgga tgctaacatg taattgacaa    218280
     atgcggccat cagtatcaaa ggacttcgtg gccaagctgg ttaaggcgtg cgactgttaa    218340
     tcgcaagatc gtgagttcaa tcctcaccga ggtcgaattt aattttttgg aaaagttgat    218400
     gttcttcatt tgattaaagt tgtgattgcg tcatcgaatt taatggactg ctacatacca    218460
     gagcacttaa cttcttagca tcatttgaag caggactctc atcttgcgtg gagatttgtt    218520
     ccactgagaa aggacaaagt ttttggccac atttatggta ctattcaaag gactataaat    218580
     acggtaacga gtaccttcca acagctaagc gtcggtgttg ggtttttagt tattggccaa    218640
     aatatagtac gaatgactgc gctcgctctc gaaagtatta aggcagtttt taattgcaac    218700
     cttagacttt gactgcatta tttgtctctt gtcttatact tatatttgaa atatattcta    218760
     atgggacctc cacaacttaa tatatcgaat actgcatctt aggagcggcg ttcgcctcat    218820
     caatatgtgt tggttttctc caaccacgcc cctgcatgcc ttattatcaa atcaggcggg    218880
     agcaatttcg aaccattaaa taaacataac agctttgcca ataacttcca gctcaccttg    218940
     ttcgagtaaa gcttttgaaa ttaaccatgc gcaaaccttc ttgatattcc ctggtaaacc    219000
     tagtagctta aaggagtgcc caatttgaac agcaataccg agtacctgct tgagtacctg    219060
     cctagatatt ccccacaatt gaatttttaa aaaagttgta tcaagatttg taactctgaa    219120
     ccccgtaaag ataaagtttc cagcaacagt ctggctcagt atctttcaca gtgttttgca    219180
     agatacaaga ctcagtatga aggacaacaa agataccgca atcaaaaaga ttgcaaaact    219240
     gatcagcgat aaacctaatt caaaagttgt tttcttagtc ggcgctggta tatccacctc    219300
     atgtgggatc cccgatttca gatcgcctgg cacaggttta tatgataact tggccaaact    219360
     taacttaccg tttgctgagg cagtatttga tatcgagtat tttgagcaaa accccaaacc    219420
     tttttacaca cttgccaaag aactttatcc tggcaactac aagccctcaa agttccacca    219480
     attaatgaga gttttccagg ataaaggaaa gttgcataga gtatttacac aaaacattga    219540
     tacccttgaa agagcagctg gaattcatcc ggatttgctc gtagaggccc acggctcctt    219600
     cgcacacaac cactgcatca gctgcaaaaa agaataccct cagaatgtct tcaaagacaa    219660
     gatgttagtc ggtaaaaatt tcgctaattg cgaggaatgc aaaggtctca taaagccaca    219720
     aatcgtgttt tttggcgaaa atctcccgcg caagtttttt tcgacctggg ataaagatgt    219780
     tacagaactc gacgacgaaa gcattgttgt tgtcgctggg acctcactag cagtttatcc    219840
     cttcgcgtcc ttaccagaag aagtgccgac aacgaccact cgcgctctaa ttaatttaga    219900
     aagagttggc gattttaaaa caactcccag gaacagtgat gttttttaca agggttcagc    219960
     ggacgcagcg gctactgagc tagccaaaga acttggatgg ttaagtgagc ttgagttctt    220020
     atcaggtctc ttagataatg acaaaagttc ttcaaagacc gttgacgaag gccatgaaga    220080
     tgaagctgca aaggttgaca gtataacaaa agatttggaa aaattgggat tgaaagagaa    220140
     taagtagttc aatcgtttag ttcgtacttt cgagcaatgc ttcgggctgt atctctatag    220200
     gcgttcttga ctcaagcctt caaagtgtta aaacatcaac ctatcgtttt caatgctatg    220260
     caatgttcaa ataagagcct tggtaacact accacattca cttgaaaaag acccgcaatc    220320
     tgcgacagct ccatgataat aaaaaccatc atactcgatc cacctaaaaa attcagactt    220380
     ttccaatcaa catcatttgg aaattatcgc aactgtgatc tgccactgaa accgatttta    220440
     tctatgcgaa taactcccta atcctgcacg catcacactt tataaatcat aaccaaatag    220500
     aagagtttca gcctggtgtt aatagcctca cagtacgtat agggccataa ggctaagtcc    220560
     tcacgttttt gcaagatctt cattaatatg ctatggcaaa tttagacctt ggttcggcaa    220620
     attgtaagcg tccaaaagta ttactcttat caggactcag tcccctgaaa ggatgagatg    220680
     cccaatgtat ggccgcattc tgttggcgtc atcatgattg taagacagcg gaagttcttt    220740
     gctcaaataa agagcattga cgcacacgta aatgccgcaa tcaaaaccgt tgggctgttg    220800
     agggcattgt tcatgaatca actcaaaatc acgtccgatt ttcccgctgc tctcctctaa    220860
     taggtattct tgcaagactt tcagaatagc gtgccccata gtagaagggc cgctagacaa    220920
     agagtcaata taacttatcg tctttttatc aatattgata aagccgagag cccaatgaga    220980
     ttgatttaag ttgattggaa caaatatttt gctcagcttt tcgacttgaa ccttcttttt    221040
     cttcatccac cttctaacgc cttgataacc tctttgcgaa agtgttgtat aaaagaacga    221100
     gttgaatgca acgcagtgtt cagttgtaat ttcaacatgc ttcatgaaaa attcgacaat    221160
     aatgtcattg agccaccttt tgggtgctag tgttttaaaa tcgtaaactt ttatctcgat    221220
     gttgtttttg ttcataagaa caccattatc tgttctactc aatgctttct tgacataaac    221280
     gacatcttcg tttgttaact tgggtacaag ttctcgtttt ttttgacgct tttccctcac    221340
     ttcggtctgt attcttcttc tttcctcaat cagcctcttg taacttttaa actcttcctc    221400
     gaaggttagt actgaagtgt caaatctgag cttctgaaag ccagtacgat gcttgagagg    221460
     gttttcatgc tcaggaagtc tgcgctcctt tattataata agatcatcgg ggctttccct    221520
     ttttcccaga ttctcggcta gaactgcttt gaacctctct gtcaggctag caaccgaatt    221580
     tttgaatgtg gacttaagcc cctccctttc ttgctctctc agctttagct gtgtatccct    221640
     ttgctcttca ataagtgccg gtgccctata ttctccattg aagatcattc tcaaatatga    221700
     gagttcttct gacggtttcc taatggtcaa tgacctagag tcttctggct tttgagctct    221760
     actagctttt cttctgtaaa acgagctccc gtaaggaact tggtgtgcag gtgctggtga    221820
     aagagaaatc tcactagagt cccatccgaa cgggtctttc tttgtggcga aggcaaagct    221880
     gccgtttttc tcaggggtaa tgcagttgtc tagtttttgg gtcaagtcgt ctgatttttt    221940
     gcctggcagc tccttctgag tcggtacact tagccgagca tctactccag gcgatgatct    222000
     gggtcgcttg catggggcac tggaagtttg cagagcattt cttttcaaag agcggccaga    222060
     ctgttcagta ctctcggcta ctggccgcga accttgcaag tctttttgcg tattggagtc    222120
     gcctgtgctt ccaatcaaac ctttgaaagc gcgacttgcg taaaaaaagg ctcctttgat    222180
     atcttgtaca attcctgggg tttgattttc aggcccattg agtcgggcgg acattcttag    222240
     aggtccttca gttgtgtact cggtggtgca agaatgaaag ggggctgttc ttcttcgcgg    222300
     gctgaatacg gtggggccat taacaaagct aaaagttgct atgtgtgagt gcgttggcgc    222360
     gaagtagttt tctgtgcgtt tccttttgga accagtcttt gtttcgagat taggcatcaa    222420
     cgtcaagccg ctttaagagt gtattctatc tgtttggttt tcttattgtt ttaatctaat    222480
     tttcgacatc aatgaggaat acagtttttc ctttaagcgg ccctgggaag ttaaagcaga    222540
     gaaacagctc ccaccaaatg gcacattaaa ccttctcatc accaaggttt accatccaag    222600
     taaatgaaga aatagaaatg catcatctat gacaccacgt tttctttaag tttggatcgc    222660
     aagaaagtca ttaaagaatt gaggtcctcg taattataga gagaaccaca agataacccg    222720
     ctttcagaca cattccgctt actagccata tcttttctgg agttaattgg gcaactcttg    222780
     gctttctcta tcctgcaaat cttatagtac ttatatgtag ctgcattatg tatttatggt    222840
     tgctccgggc taaatcatct ctcactgtga gagatttggg ctttttgttc tacttgatgg    222900
     attttgactc cagtaactcc tcgctattac ggacaactta agttcctgct acgctttttg    222960
     tgtcctatga ccaatgctca aagcggtcaa ttttggaacc tactaggctt tttgcatcaa    223020
     aaaagtgaga gaatgtgaca acaagtttca gttgagcaat tacttagctt ttagctcaaa    223080
     tattctgtta tgctatcgtg ataggtcatt gcataacctg ggttttgagt cagtatgttc    223140
     tcctcatttg cttttaacac agttttatgt acagagctga ggcgacattt acaatgatac    223200
     tgttttgaac acacacagac taatcacctc ccgactaaaa gcacaaaaac agtatgagta    223260
     gtctacaaaa atattcaatt ctatctaaat tcaagtgtca catactttgt gggggtctat    223320
     ttcacgaagc ggatagagta ggggctattg gtcaaaggat catcatcatg gttcactggc    223380
     gccgatggct ttaaacacta acctttcgat aaacctggca aagacaggta gttgctcagc    223440
     atcgtttaag gacatcgagg aaccctcggt cctttcttta caagcagctt ctttgaatgc    223500
     aataacgaag ttgacaacta gggtgaaaac tacgacgagc gcaaccatca atggaccaaa    223560
     gggcgcatcc aaatgctgcc cgcttctcgc tttaatgacg ttaagtctct tgatataagt    223620
     cctgtaagcc cacagccctg tgaagattgt gatacaaaaa taagcgtagg cgaggaatgt    223680
     ggccaattgc ggaaattcag ctcttctaac agagttgtat atggtgaagg ttagcacact    223740
     cattaaactc gttagggata gccatctatt gaaagttctt tcatttgcca accaaacttt    223800
     ggcctcaact ttcactggcc ctgcattctt gaggtaagaa gttggcttct taacaccagg    223860
     gggtaatgta atttcctcat cttctgagtc aacaccagtc aatttggcat ttctgccaac    223920
     caaaacattg aggaaattgg ggttctgttt tcttttcctt gttctgctgt gatgctctgt    223980
     ggcctcatcg tccgaagatt caggatcttc taagtctgca tctctttcct cagcctttgg    224040
     agaccctgct cctgactgtt gagatgatgg ggtgccagag ccattgccgc ttccttgaac    224100
     aacagaaagt ctcttgatct ttgcaagacg ggcctgattg gctttttgct cctccagctt    224160
     cttcttttcc tcctcatacg cctgtttggg gtctttcctt atgtcggtct ctaagtcagg    224220
     caaccaaaat ggaagcatat caagattttc atcatctccg tacagcgatg cgacaccttg    224280
     tgcgtacttg gaaaagttgg caacttcctt cactaagtgc gagtttgtga gctcctcaac    224340
     ccactgtgca tgttttcctg ggagctggga gcgcatgctg tctttgacac ctcctttatc    224400
     accaataggg tttctgatac gtatgtccaa aacagcatac gggaatttga cgtattctcc    224460
     aggcctcaaa aacttgagcg ggttaggaat atcagcgtca atatcagatc tatgccaatt    224520
     tttgggatct cttattgggt tttctttgtc aaaagaatcc tcgcgaatgt acattaaatc    224580
     agagtcaatg ctgattctga tgcgatcatc accaggaatc tggaaagcgg tacgtgtgta    224640
     catggctctc aagacaggtt gtagctcgtt ttcaagcacg aattgctgaa tggtattgaa    224700
     attgttgctc aacttactaa tttcattgtc aacggtaccg cgatctttca gcttctttaa    224760
     agtcttctct ttgtaatcat tatctccgtt gaaaatgaat ccgttaataa attttggttt    224820
     gagcttgatt ctcgtctcat caaagtcaga tgcgccagtg ttgcgatctt caaccagcat    224880
     tctcttttct aagaagatgt caggtttatc ggcaagcttc cctgtccatc tcagtctgag    224940
     ggttgggtta aagctggact tcaaaagctt gtcattgtaa agctcaaaag cttcgttgtc    225000
     aagatagatg gtcctaataa ctgggtcgta acctttgttc cccaaggaag cactgtctga    225060
     agcactgcta ctaggagcgg cagggaagga tacgtctgag ttcatgacag tggactcaac    225120
     tctgcctatg aggtcgtcgt tttcgctggg cggggctgcg tacactaaga ctggcaggtg    225180
     tctcaaaatc ctcgtcttga cttccattag attgtcaggg tgaatccaaa atgtatagct    225240
     cctgaaggac gactcctcat ggttgtgaac acttgataat ttcgaggagt tggccagaga    225300
     cttggaaaca gtggaagagt tggttctcag aatattgtaa agaaaagaaa tcttgtacaa    225360
     aaggggagag tactcttcgg aattgaaagg taactccttg agtctaactt gaagtagcga    225420
     cttcaccgag gggtagcgag ggtggagctt atcgtgcttc ttcactatct taatgaagcc    225480
     cgtgtagtta actctgcaga agttatcaag ctcttgtgcc tcgctcagcg cttcctcaag    225540
     aacttgctgg aagtgtttaa aatccaagtg tttgattgct tcctcatcgt ctgtcttccg    225600
     ttccagccgt acaagcttct ccatgattga gttgaacttt gtgctttgaa aactgtaaac    225660
     tttctcaagc tccgcatcaa gaactgccac aaagtttgac tcatctttct cgctccacaa    225720
     atcaccttta ttttgctgtg acttccggcc tttgaatttg gaatcttcaa tgattgactc    225780
     cttcaacagt tttttcaatc tctcatattc aatgtaagaa tccttccaag gagggtacat    225840
     ctggttagcc aacctgacac caaacaacat ttttgtattt gcttgcgctt atgttcagag    225900
     ctcggagttt gctgaaaggg ttgttttggt gttcaatgaa taagatgatg aaaagcgatt    225960
     ggactaagct tcctttacag aaaatgaaaa aagaaggcta atcgaaatat acccttgagc    226020
     gccttgtaca gtcttatcca ccctcactct tcttcctgac ttcttgttac acggtggaga    226080
     gcactttagt tttcaggata cttttatatg atttactcca agtaacccac gtgcgttttc    226140
     ggaaattgat acacagggta tggcacttcc accacgggtg gccagccctg taatttgata    226200
     gtagtctgcg aatgggtttg ccaagaagca ctagttacac ggatcctatt gggcatgatc    226260
     gtgagtctca gatgctatac cgtaaagatg atttgttaca gttacataaa gcttaacaac    226320
     agttggactt tgagttattg cccgcggctc cgacattgac gctaccgtcg cgaccagtgt    226380
     tacccaccaa cttctcgcta tcaattttct cttgaatgag tttggccaga agaaagaaga    226440
     tatcattgac gttagtatcg tccttcgcac tcgcctcaac gaaaggaatg ccgagctctt    226500
     tagcgagcgc ctcgccctga tctgtgctca ccgcgcgtgt gtccatgtca cttttgtttc    226560
     cgactaacaa aagctgtgcc tcgtcgttgg cgtgctggtt gacagtactg aaccattgtt    226620
     tgatgttaga gaacgttctt tcatccgtta cgtcgtacac caatattatg cccatcgccc    226680
     cacgatagta agcggtcgtg attgttctaa accgctcctg acccgccgtg tcccacaact    226740
     gcaatttgac tttcttccca ttgatgtcca ccgttttgat cttaaaatca attccgatcg    226800
     tggtaataaa tgaggggctg aatttgtcct ctacgaacct gactagtaag caggactttc    226860
     ccacaccaga gtctccgacc aaaagaatct tcatgattga atcatagctt ttggcattgg    226920
     ccgaagatga cgacactgtt cttactccag acatctccaa acttctgctt gatcatgtag    226980
     gtaattcgtt atatttcgtt tgaacaggac aatttcaacc aatagatcat aacatcacta    227040
     cttacgtaag taaggtgcct tattaccctg cttcgatctg tgcgtacagt gttcatttct    227100
     tcgccgcggc ttgccggtaa aggatcgtaa gtaaagttga agctcgccag cagcgggtgt    227160
     ggcatctgta gtcttgagcg cgatcagtct ttcagttcaa gtactgaggt caaaaccatt    227220
     agctaaaaaa ttgtaaaaac cctgatctgt agtctgaggg cttctatttc aacgcctgct    227280
     gcattctgtg tcgacaggtt cagcattgac atgctaccag aaattgcggt ggacaaagca    227340
     agcggttcgc ggccaaattt ctaactaggg gtggaattac gcaggaaatt agcctcgaaa    227400
     gaaaaatctg tttgtagctc tggcaagaac aaagtgcgtt ctacactcct aaaccggtct    227460
     tattataata ttaatatcct agtctatttc aaagcagtgt ttgttagaac gcccgcatag    227520
     aggtaatact aacttagtaa caccagaaat tagcggtgca catgctgtat agaggtacca    227580
     gtcacttgtt ggttttacag aattgtcttt ggcctggcga catattctag tattttttaa    227640
     gcgctatgct tgctcttctc ttgtatccgg ccattttcga caagagggag ctgatattag    227700
     cgttgaatga ttatcaggca catgcccagt cagcggtctt tttatagaat agtcttgtta    227760
     cactgcttta aaggtgtact gttgcaatct gaagggagcc gttttcggac tttcaacact    227820
     ttacttgacg ctataaaggc ggggcatgat gatatctagt ctaagcgtag taacttctcc    227880
     acaagacccc ttcaaggtct tctagctcat catagctaaa ttgctcacgg tccaaatgcc    227940
     atgtgtcagc cctaactttt ttgaaatcac ttatgatttc cttggcagct gttcctgaca    228000
     taccactagt gcgagcccat gaggatagac tacttagctt gctgggaatc cattgtggaa    228060
     gcggggagac gtacggaaat gctgaaatga tagcaccaag gcctattacg cagctatgga    228120
     tctgtgagtt cgtcttcgaa agcttttttt tatttgcaaa cgaatgattt ccaagaccat    228180
     tggcaaactc atcaataagt ttgttgggta tttctgtatc gctcaaagtg tggatgatcc    228240
     cggacagcac ctcagcggcg cggagacgaa cctcgacgaa gtgccgatta taaatctggt    228300
     taacgacaaa acgtaaaatg gactgtttct ggtccataga gagctgcagc atgtttttag    228360
     agtagaagtt ttcggcaaat acaagttgaa ctcttatctc atgagatgtc tgcatatcca    228420
     tgttttctat gacccgcatc atgatggaaa tgtactcctt ccttaaaggc cagaatgaaa    228480
     tagcaatgta acacgtagta ggctcgagat tagccaagtt acaaacgtcc ttcattctta    228540
     tcagattcat caaaaatgga gccagatatt tttccatgta cagtaccaat attacgctgt    228600
     tttgaccctt catcaactcc gtaatccaat tcaacattgt tgcagtcata taatagtacc    228660
     tagttttcag cacttcttga gcaggaaggt ttgtaatagc accacgttcc ttctctattt    228720
     cattgaacgt gtcttttagt ttgtcatcaa acgcacgagg aatatttcta atcatacgcc    228780
     ccagccccgt ctcattgctt gtaaatttca cgagcttgct ggtcgaggag aaacatgggc    228840
     ttatctggct ttgtaaaagc gtagacagta gcttcgagat tgattgtcga acttggtcgt    228900
     atggatgatc aatagttaag aaaggaatta gttcttcagc cacaggagtt ttgaagtcca    228960
     ggctcaacat catatttctt aacaaggaaa ttttagatgc ttgatcagca gatgaatcag    229020
     atgcagtgtc taaaacattc ttgattttga aaagctttcg ataaagagga gcgcatcttc    229080
     ttatatcgac cgacgttggg agccaccagc aaacaataga ccatatatct acagcatcct    229140
     ggttaagttc atggtccagg cattcgtcaa aaaacccaac caaaaagcta tctctttttt    229200
     caaggtcgtt cgaggatgtt atttttgaag caacgataag accagccatt atctcaacgc    229260
     tcatgatcat tgatgcttta tcactcttgt catatagagt ccggcacaag ttgagcaggt    229320
     cctcatactt cagtgcggtg caggagttag taatcaatga tacaagtagc tcgaaaaact    229380
     cgatgtttgc gttgctaaag actcctttgt tttcattatc ttgaattaaa actttggcaa    229440
     tctgaagaac ccattcctta tctatgagtt ggccgaaaag gttcaagcag tttatttctt    229500
     tctccttgag gttgaacttc gtttcgtttg aacttttgat cactttcaga cttcttcccc    229560
     aagcgatgta cccaacatag gctttagaat caataaaaaa gttggggttt gcgaagtttt    229620
     tcatttcagt tttgaaatag ctattgaagt tggcagtatc ggtcttgatt agctcaatgt    229680
     tgtttttcat gaagtcaaaa tcaaaagcgt tcctgatttc gtaattaaat tctcccaagg    229740
     agatgatttt gttgcacatt cctaaaaggg tcttgattgc aaggtggacc ataacggggt    229800
     gctttgtctt tgtcatttcg taaagacaag ggagaacatt ttcacttgga ggtagttcaa    229860
     ggtttgattg gagtctataa gtcagcttca ttatgaatac cggtatcttc catccaaggt    229920
     ctgacccaga agagagtgtg ttaatcaagg aatcctgaag atgagagaga agtgaaatat    229980
     agctgtatct ctttttgtct ttcgctttct tgacagcatc tacttgttgg cctatcgatt    230040
     tgtctgccgg cctgagagct tcgattgtct tcatgtcaag taaacataca ctggaaggaa    230100
     ctttcaaaga tagcgcgata tctgtcagaa tgctgtcagc atattttgaa acattgaaat    230160
     cttttacacg gcaagctctt atcagcaagt tgacaatctc ttccaagttt ttgtaatccg    230220
     acatgatctt cctatggatt tttttcaaaa gcaaaacttc aagcatcact tccacttttt    230280
     tataacttcc ttcattcatt gcagactcca atgacgttaa tagaaatttc attatcattg    230340
     aataagagcc aatcagttgt ttcattgcat gggccaagca cccttgagct ggcttgaaaa    230400
     ttgtggggta aagagatgta gataatctta gaacatcatt caaaagcact ttttcaagct    230460
     tagaaggagt tctgttcgta gaatgtagca aaactctcat ttcgtgtaac gcatgcgctt    230520
     ttgcagcaaa acacgttctc gtgtatggat catcaacatg cgacaggttt tgaatatttt    230580
     caacgaactc gagatccaaa aacgacgtgg gttcttcatc aaaaatcgtc tcttggccaa    230640
     tatcagtaaa ccagaccttt ataccatgca atagaatttt gaacaaaata gtattgtcct    230700
     cgaaattagc ggagaaaaac ttgaatagtt tgtgaaaaag agaaccaatt ttggatctta    230760
     ttgagtgaat ttttaggtat gtgaagtttt ccattttctt atttttgtca gatccaaaga    230820
     aatagttgca acccataata tccagatctc tcatagccaa agtactgttt attgctgatt    230880
     caacgccgta ggtgtggtga cgtgaccctg gctcaggagt tgcaatgcct gagggagcag    230940
     ctgaagaaac tccatcgaat aacgtatttc ccccgagtga accttcgcca ccttcagtaa    231000
     attgtatttc atccagacca tcttcagaga ggtcaatcga gctttcggct tcagaatcag    231060
     ctttagtatc atttctaatt tgttcaatgt ccatattcag ctcttgagaa tcacatattt    231120
     tgtctcgaac gctcttcaaa agcaaaagct tagccttgta agagtccaca ggtaaaattt    231180
     cagttttgtt tttgctgtag tcggcatcaa acaataggct tgcgcctgat aacgcgtgtg    231240
     tgacaattaa aatgtacttt ttcattttgt cgctgtaagc tgaatctgta tgcggagatc    231300
     tcatcatctc tgatatgttc gtggaacagt aatcagtaaa attttcaagg agctcagtac    231360
     caaactcaac ttcgagtttg gagggaacat gccacttaaa agtcatcatt tctttcgaaa    231420
     atcttttcga atcaaattgc aatcctcccc acctttcatc tcgaggcatg ctgcatttct    231480
     ctggatagag tctgtaatcg atgacctctg tagatgaaag actagtcaaa acgttatgaa    231540
     ggaccaatga tgtatgaaca tctagcggag gatttgttat attatcaaaa atgaagaaca    231600
     gtatgtcttt gagctcttca cgataactta gcattgatga gtgagcttgt ctgagaatgt    231660
     cgctaagagc agttaggtaa gtaagcagtt tgacatcccg atgttgaatt tccgatgaac    231720
     tacgaactga gccagctcct ttcgctatct ggtcctttat gttcacacaa agggtcgaaa    231780
     aaagttttgc cccgattgcc ggctcccttc ttgcagcagc accaagtgga atcgtaatca    231840
     gttcgtagtt tggatgcttt tctttgaaat agtcgttttc ccaaaacgtc ctttccaaca    231900
     cacccgaaaa gtacttgaac atagggtctg gcattgactc catcataatc atagtagtct    231960
     gattaacctt gctaataaaa ccttcttcta agtcgctgtc aactaattga atcactttgt    232020
     tgagataaat ttttaaaaca tcttcaaaaa ttgtggtcga ggctttgaat gcagcgacta    232080
     gttcagattt atcgtactca aaactatcaa gctccttgtt gtatttgaga aagaagacat    232140
     gtttctcaat gaacggagca gcgtgtgacg tgaaactaag gtggtcatct tcagaaacca    232200
     agttatcgat aggcacaaac gaagctatgg aaacaataca attaataata ttgctggtaa    232260
     gcaatatgtc attataatcg atttttgaaa ccagcataaa caggatgttt gtgatgtgga    232320
     cgcgaaagat gtggtcctca atcataaatc tagcaacttt agtgaactgc ttgagtgaag    232380
     aaacaagccg gtgaaccgag tgaacatata aatcacccaa agaatcgtaa agatccaata    232440
     cgaccttact gaagaccaag tctttgtttc ctggattgat gtctagcaga tatgcgagac    232500
     aagaaatgta ataatttgcc atttcggaat ttttattctg agctcccaaa aaaataacct    232560
     cctggaaaat attgacaact cgggtatggc acgcagaatt gagcttcaga tggcacctat    232620
     gattggcttt gggatttttc tccattttga ctctttcatg atacatttta ataaatccat    232680
     gaacgaactt agctattact ttcgtccacg gcccattatt agatggatga gcgaaggttt    232740
     ctattgattt aacaaggcct tgcagtttgt ctaaaaattc atggttccga gacccgttca    232800
     tcgagaagac aagaggcctc actgttcgac taaaagaaac aacctggaaa tcatttctca    232860
     aatgattttg aactctgttg aaaataaagt taatctggtc ttccgttagg agaccaaact    232920
     ccctgaacga aacattgcct agcacttgta aatggggtgc tttctcatgc aaaagtttat    232980
     taagtgcatc ttccgcaatg caaccgatga agtcataaaa gtgtgtgtcg aaccctacag    233040
     aaggagttgt agtggtccat aaggtgaaaa tgagcggaaa gtagtcggta atgctggcgc    233100
     tcttttgata gcgatatgga acgaaagacg ttattatagg gaatacgcag taagcagtag    233160
     tgggagacaa gcttgaaata taatggtcca tagtatcctt caaaacgcta tcatcgttaa    233220
     ggccataaaa aggttttgcg gcatgagcaa gtttaagaag aagtcgaaag agttgattgt    233280
     cagacttgct ggagatttca taacgggtac aggtcgaatc tggaggcggc aaaaactcat    233340
     ctaaaaactt tttcattggc ctatagtcaa gctcaagacc ctccccgaga agaagctctg    233400
     tgaagttagt ttgctcatca tcagtgctaa ctaatgcttc aaaaatatta acatgcatca    233460
     ctctgtagac tttctgacct tgcactaacg ataaggaata aaaggttgag gctaacactt    233520
     ttcttagctt aagggggaac tcaaaatgca aacagttttt tagctcatta gcccagtgat    233580
     tgacattaac aatagtggcg gacttggcag ttatttttcc tgtggcagtg aattgtgggc    233640
     catcaaaatc taccatctct tcgtcctcct catcttcgtc ctcgtcttca tcgtagttgt    233700
     ttatatcatt gaatgaggcc tcgtcatctg tggaaagccg gaacaagtcg gtatttaaag    233760
     ccaattcatc gatttctgct tttagatccg ctagatcctt actcgatatg gaaataaggc    233820
     cttgtatatc aagggagcat atcgcgatat aaaggtttac tagaacatga cagaggtact    233880
     ttgcttgttc cgtgtggctc tcgattttgt aaggcaggca gttttcgatt acaaatttcg    233940
     gcttaatgtc gcgacaaaac catttggact ttgggtcgta aatttccttc aaatgcgctt    234000
     cttgatcatc aatgtaatct aggccgtagt gatttagccg ttcccttagg atgctgtcgg    234060
     agctactttc atcataagaa acttgagaac tgagtggcgt tgtggatctc ggacgtcttg    234120
     atggtgacat ggaactctta agcgcgccag ataaaaactt cgccttttta gactttgaca    234180
     aatcagaacc agagttcgat ctggctgttt tcatgtcttt taagcttaag cttcgatttt    234240
     gatacggctt gaggggcgat ggcgcttgaa taaaatgttc catattttct gaaaatttta    234300
     ggtaaacttg gggatttcaa ccacgatatg tttaaggccg gcgactccct atgagtttat    234360
     tctagattac tcaaaagctg gctaagaaga ctggaggatg gtttgatagc ttcagacttc    234420
     aagccatggc actaatgcag aatgattctt gtcatcaaca tactttatca ggtgaccggg    234480
     taccccaacg aatgacctga agttgattga aaccgttatg aggcaccctt tgttgtgcgc    234540
     gtaaatttta gttgcacatt ttctagctat attatctaat tcttatgaat gggtgtttta    234600
     gggtatgcat gctgagccaa gttatgaact gaaagccacc cctattaatt gacctgctag    234660
     agacttcgta ggcgctgagg gccagtttta tcggtcgtac attgttcaaa acaagtaaag    234720
     tttcagtcct cataattttc gagattcagt gtcagcgctc tggatgtgtt gtcccgttgc    234780
     tgcctaaaga ctccaactag ggcctgtgac ttttcaaaca ttgtgttttt taatgagata    234840
     acaataaatt gcaagttcga aagcgccctt tgtcgaatat aggttgctat cctctccaca    234900
     ttcaaaatat ctaatgcagc gtcaacttca tcaagaacaa agaaaggact tggttggaaa    234960
     gagttaattg caaaaagaag cgcaagagca gcaatagttt tctcaccacc cgaaagaaat    235020
     tccatgtctt tgaagcgctt ggtaggcggt gtagcatgat accttatccc agcaagatac    235080
     ggctcgtctt catcctccaa agtaagagaa gcattcccac ctgccagctc agcggtggaa    235140
     tgcgggtccc tagtaagctc tctgtataca tcatcgatag cattgctaac atgatcaaaa    235200
     gcgctttcaa acgcatcttt ccttaacctc cgaattttag caaactgctc attgactttc    235260
     ttttctttcg tcttgcattt ctctgtttcc ttgaaaatgc tttcgtactt gaccttggcc    235320
     tcctcgtacc gcccagccgc ttttgaatta ggttgcagga ctgtgaggag ctcattcaac    235380
     tcatctatag acctttggag ttcattccca gtttcagctt cgccgctctg cttgagcctt    235440
     ctattcaacc tcgtgaaatt cacaaagact gcattagctg cttcaattgt tgcgtcactc    235500
     accccatcaa gaggtactct ttcaagcgag gatgatccat caggtaactt aatattgagc    235560
     attttgcagt tcttgaggac attggctttt tctaaagaat ttttgtcaat atcttcagca    235620
     agagcctcat gcatgcgctt ggcggactgc aagtgttcgg tagcttcctg aattgtttct    235680
     tctgaagagt tgagctctac taaatcctta ttaatttcgt tctgtaggtt atccaaacgt    235740
     gtctgttcct cattgatggt gagctccaca ccctgtattt catccgttat tctttgctcg    235800
     tcagagttca aggcttccag cttgattttc gctttttcaa tgtcaacctg tactctttgt    235860
     tgacgctctt gcgtggattg caggcgctcg gtttcaaact caagcttttt ttctatgcct    235920
     gcaatctgca tttgcagctt cctcaagtct tctaactgcc tcctcatcat ttctcctgag    235980
     tgcttctcat attgcgaaac cttgaacccg atgtctcctt cgaagtcagc atagacagag    236040
     tctaataagc gatctttttc ttcctcaaac ctagctgtcg ttttggcgtg cgcagtcatc    236100
     gcctctttta atgattgaat tttgggctca aactcacctt ttattagctc ttgctggtac    236160
     tgaatctcag tttccttttc gtttagcgat ctttttactt ggttaagctg agttctcaag    236220
     ctcatgacat ccgaatttaa aaaggagagt tcgttttcag tactccttat tctctcagaa    236280
     tctattgtgt ttgcagaaga taattctgat atttcaccta gcagggtatc tttcaaagac    236340
     attaagccct ggtattcctc tttatcccac ctatttccgg agcttttagt tgttcctcca    236400
     gtcatgaggc cagccttgtg cacgattgat ccatccagac tcacaagttt tgctctgaca    236460
     ttacgtctcc acttgagatc ctttgctata gccaacgaat cgcaaatgat ggagtccgag    236520
     caaacatatt gcattgccct ctccaagtca cgctcgtaat cgatcgcatc aatagcaagt    236580
     gtacaccctt ttgtatcgag ggccatcatg gaaactttat tcacatcaat agtatccagc    236640
     ggaatgaatg ataagatacc agagcgttgc tttttgagga atgaaacgca ttgttgggca    236700
     acagagaaat gatccacaat aacagcgtcg aaactctttc caagaattgt tgatacagca    236760
     acggtatatt tctctttttt cggacgacat aactcgtgga ccaagccacg cactccagga    236820
     aaaagccttc ttaggataga tacgttttcc ctaagttttc tttcttttgc agtctccctt    236880
     tgagtagcgt tcatgtcgtc tagcttagtg agagtttcct tcagtttgaa actgacctca    236940
     tactctctgt tgttgttgta ttctgctctt gactggagct cttttaactt tttaacggca    237000
     gctgatacct gagatgtttt cccactcagt tctttggtaa gctcggaaac ttcattctct    237060
     aaagcctctt tctcagcgcc aagctcctcg ttcactttca accttgaggc atctaattgc    237120
     ctagagtaca gttcaatttc atcagaaatc tcttgcgact catttttctc taaaagaagt    237180
     ttgtcttcta attctgaacc acctgaactc agaaatgttt cttttaaatc ctcatatctt    237240
     ttgagattag cctcattgag tttgaagtcc ccactagatt tagcagattc gtcaatttca    237300
     gcttgaaagt ttgtctttgc cttgttcaca accttcaatt gatgctcgta ttgttttacc    237360
     aatgactcct gccggtcaat gtccctttgt aaggattcta tttttgtcac agcagccgat    237420
     agtcttttat caatgctctc ttttgaactc tttatgggta gcagagaaga agtaagatga    237480
     tcaactttct tggttttatc tgatagcctc gttctttgct tagcagcgag cgtctgtttc    237540
     ttcgcgtaag atagcttttt tttagccact atttgttcct cgctattaag ctcggagtct    237600
     aagctttgga gctctctttg tgaagatttt aagctctctg ttaaactatc tcttttggct    237660
     tgtaaatgaa agagctgcca aacaataagc tgttgttgga gcttattgcg ttcctcgaga    237720
     tgtttgcgat actcctcgtc tttgttaact ccttctttga aacttttgag accaatgttt    237780
     gcgcgctttc ttgattgaat cagctcagaa gtggcagatc ttgccttttc caattcttct    237840
     cttagtcgat catactcttg tttatattga atcgatccag agacttgctc aaaaagagtt    237900
     gtgagctcac gaggtttctg tgaagcaact tgctcaacat ctccttgaaa aactaagaag    237960
     ttgcgtgcct tgataaggat gttctcactc tccagaaaat cgcagtattt tttatggctc    238020
     accgtctcgc catttaattt gtacgtgctt tcttgtgata acgtgatagt ccttgttagc    238080
     tccgcaacat cattttcctg tccacttggg ctgtagaaag ctttcacata tgccgatgat    238140
     gggttattct cattgtcatg cgtctcagaa tatccgctgt cggcatcacc gtcctgtaaa    238200
     gttcctctgt atataagatc agccagtgta tgtgagcgca aatgaatgct tttcatccct    238260
     aacacaaaag atatggcgtc catcaagttt gatttccccg atccattggg gccaataaca    238320
     ctagtaaaat tagactctcc aaacccgata ctgaccttcc ccttgtatga cttgaaatta    238380
     tatagctcga tgcccagtaa ccggcccatc ttgaatgtaa ttcagattga gcagaaatat    238440
     tgggattata agtgctgccc ttgactagtc aattatatgg tgcgggagtt ctcagttcgc    238500
     gtatcaaact ttcaatatcc ttacgcgttt cagctattcg tatatattga ctataaacaa    238560
     gagaaggcgt gatcacagca cttccacaca acaggctcag atgcaggttt gaaatatgct    238620
     acaagttcag aatatcgatg taatgttaac gaagtattta aattagtgta caaacagtct    238680
     aggcgcgctg ctccatttca aagctttctt gcgccggcaa cctatcatat ggaccactcg    238740
     aaaagtaaga tacaactttc cgaaagaacc ataaattgaa cttgttcagg aggtaaatag    238800
     caccagcgct aagtacgata tagctagctt tccgtgtcat tcccgccctg tcctctggca    238860
     cgattgtacg atactgaatg acgatgttca cgcctagaag aaacatggca acagccgata    238920
     atgcaattga gcatgcacta atgaagacac ccaatgtcga gacaggctgg ttttggacct    238980
     tcagcagctt ggacttgaac ctggggccga agactctttc ttcagaagtt ttgcccgagc    239040
     gagccacatt cctgtttctc aggagcccag aagaagagcc atcgttttcc ataactcgga    239100
     actttagcag aaaaagcttg tttttttggt tgaaaagctt gatggtacta cgatgtggct    239160
     actctttctc ttttaaaatt gatcgaaatt cggctgcagc aatgaggtgc gcacccagaa    239220
     aaatcaaatt gatgttctat cacgtgaaca ctgaagtatg taatctgggc aatggttcgc    239280
     taactacggg tcatacaacc gagtagcgcg gcttccgaga gtagcatact cggcatcttc    239340
     tctatcttct gaagaatagg gtagattttc aacatttgcc tcctgctccg gcttcccaaa    239400
     gtcgagaaac tcaacaaagc tgcgcccgtc cctctcaaca gcagctacaa gccttctatt    239460
     gtcgaattta acggaccaaa tctgatctgc atcgctcagt aagtctgagt gaatcaattt    239520
     tccgcttcta aggttgtaga cattgaattg tccctctgag ccgcttacga gaatattgtc    239580
     gttgacgtag aatgtcgtga ttgcactgag gtctttgtgg tggtaagcga attgtcggga    239640
     gtagttatct gaatcccaac cacgtaaagt accgtcggcc gcagcgctca ctaaaaattt    239700
     gtctgatagc cccaaaagcc caactagagc tgtgtggcct tgaagcgtca aaacagagcc    239760
     tgttaccttg gtgcagggat tgctggtgga gttgatcgtt gtgcagtgcc catttttttg    239820
     aatattttgc aagtcccaaa ccttaatggt ggagtccatt cctgcggata tgcaccgatt    239880
     ccttgtgtaa tcgtagatgg tggagtaaat acggtcagtg tggcccgtta ggacatacag    239940
     gcatttcatt ttagcgatat cccagaccat taagttgaag tcgtacgaac cacttattac    240000
     gatattccca tgcccagaca ccgtccgcac agctgccatg tggccccgaa gtacccccac    240060
     aaagtacggg ttcgtatctg tggtgttgaa gatttcgcag acctcaggat cataattttc    240120
     ggaatggcaa tttggaagcc tccaaacatg tagtgtgtga tctctagaac cagttattat    240180
     gaatttcccg ccgttgtgct caacgatatc caggcatcta acagttgacg tgtgcccttt    240240
     gaaaacatga gtgcacttgc ctgttttgat gttccaaact cgcacgcttc tgtcagttga    240300
     cccgctaaca agtatcccat cctggccata tttcaaggcc catacaccgc catcatggcc    240360
     actaagttgg gcaagaaagc gcccgctttt gacgtcgtaa acccgtatca ttttatcatc    240420
     agctccagta atcacgtagt catcctcaaa ctgtaaacag gttactatct tcatggtgtg    240480
     tcctctaagt gttgttctgt gcggtttaaa acgcccattg taccaatttt tcaaatatga    240540
     ctggtttttc agaaagtgta cacgaaagag gtccccatct tgggactcat catttgactt    240600
     ttctggtgtc tcattagaat actttttgaa ctcctcctgt gatatgaaac cctcggttac    240660
     catcagcttc ctccataggt aagaggtgtt gtttataagg ctgttccacg tcctgtttac    240720
     cgacaagcat cttgatatat cttcaaaacc caagttcgtt aaaatattca tcgaaacttc    240780
     aagcgggagt gagcttatga ggtctcgctt caagttgtct ttaactaatg tgcccaagtc    240840
     tgaaagctca cttcttgtga gcttgctgac aagctgaaaa acgaggtttt gataagctga    240900
     aggtgacagt ctagagtgtg cggtagacgc tactaggtcc aaatagtctt gttgagaaat    240960
     agcgtccctg ggcgaacatg gcgccccaga cgacgagcag cttggtgatg ctatagggga    241020
     caacggaagc ccttcttcgt tttgtgcact aactaaggga ttagttccat tgccgttggt    241080
     gactgagttg ttgtttgcaa caatcgcggg ggtgtcgtcg accggcgtgc agttattaca    241140
     ttgtgtcgac tgctggttat actgggggtc gcactttcca ttccaaagcc cttcttttgt    241200
     accttcaagt aacaaagggc tgttatttct gtgtggggta ctcttgtgtc tactattggt    241260
     ggagaaggat ggctcttgag tcgaagtggg gacaatgtct tcggcaaagt ttgagtttcc    241320
     gggaatgatg gagcgctgag gagatttgca gttccctctt agccgcttgc tatcaaagct    241380
     ggcctcattt tctccttcac gggccctttt ggaactgttt ttcgctggtt catcgcacag    241440
     cagtaagtcc atctcttcaa ctacgttatc gccactctcc cggacttggt aacggaaagg    241500
     tatcggaata cccataagag gatattcagt ggaatctgat gtcatcgcag cacctgtagg    241560
     atcggttttt tctcttttaa ataggcttaa agagagtttc aaaggaatat attcccacaa    241620
     gacagtacaa tttctttaca cgaagatcaa taatttcaac taatacgata tgaaaagcat    241680
     taacaaagtt aaagttcatc aggagtagcc tgttcatgta tgcttcagtc gttgctatga    241740
     gtgaattcct tgatagtaat cgacctagtg ttagaatata acttgaggct tgagttacag    241800
     gggcaacggt gcatagatta atccatcagg gcgtgcccca aatagattgg aaacagacgg    241860
     atcctggtgc gtcaagtaca aagccaagag aaagagaaat ttacaactag atccattctc    241920
     ttaaaaacta acgcacctgt catttgctat tatgtcatcg gctcagcagg aaatcaaaca    241980
     tggcagaagt attaacattt tgatctttcc aaagccattc gagtcaggtc tctgcgtgaa    242040
     gtatttcatc tatctgtttg ttcacttgcc tcgctgctag gatacaacag ccaacgcttt    242100
     ttgtctactt cgtcccctgc acgttccaag ttgtttaagc ttgtgtgatt cttcctggag    242160
     agattttcta agctcagaaa aatagcaagc gtcaaaatcc aaagttcacg attcacactg    242220
     tgagagctta cggttgtatt atggtataag tttcgctgct aacgagacta tcaacgggaa    242280
     gtctgcatcg ggttttgacc tctcgctcca attttattac tggttgctcg aatactagag    242340
     tgttagcgcg tgaagaggaa atctgagaag tccacttggt atttcaaagc agctcgctac    242400
     gatgcaatgt attcagaact acgccgatta tttcatttgg cgaatctttc gagacctgtg    242460
     tgtcaggcta cttattcggc gtttcccgat gtaccacctt gctccatggc gcgaatatga    242520
     tgaattactg agagactcat tgggggaaat tattacgctg ttcattttcc aggaatcacg    242580
     cataaactac aaatggcccc tgcttttgtt ctcgaaataa cagagaagct tagtgttata    242640
     gattttccta ttatggtcga cgccgtttcc tcaaaagctt gattctacat cgaatgtaac    242700
     cataggcttg tttttttatt tcatattgaa agactccatt caaagtactc aatgaggtca    242760
     tcgcagcaac catatttgtt gtgttttgac gagcggttat tttaattatc cgtcgatagt    242820
     gatacgttcg acaggggccg gacaatagtc tccggtgcgc agcttatcaa cgaaaagtgc    242880
     gcaaatgctt ccgggtatct caacagaggt agtagcaggc tctaagatgg cagacttggt    242940
     tattgccggt agcggtgtaa tcggcctcag cgtcgcgttc gagctccttc agtcaccggg    243000
     cttacagccg gcaagaattc acatcatcgc tcaacacttt cccggagaag agccgataag    243060
     tcatgaattt acatcgccat gggctggcgc acacttcaga ccattccctc atcgtcctga    243120
     aagcttcggt gcagatagaa gggaatctgg gtatacgaga gtgacttaca agcgcatgaa    243180
     aacaatagcg gcagaacatc cggagtctac gatcgagttc atgaagggag cagattactt    243240
     ggagcaacct cccagtgaat atgatggcat gagtccaggc tataataaag atagtctcga    243300
     aaactttcga gagatcccga aaggggagct gcctcccaat gtcaagtcgg gatttgaata    243360
     caccacttac tgtctcaatg ctccggagta tctcgggttc ctccaaagac aggtgacagc    243420
     gctctgcaaa gccaaagggg tagaactgtg tttcaagaga atgactcttc gctctttggc    243480
     acaagtttat gaggttgttc ccagctgcga tgtaattttt aactgcacag gacttgggct    243540
     ccaattggat ggtagctatg acccttcatg cttcgcaata agaggtcaaa ctttactttt    243600
     ggatgttcct cataaaacca aattcgcggc ggcaacagta acccatcagg gtcgtgacgg    243660
     caattggaca tttgtgataa agaggcctcc agttggaggc aagcctgctc agtatatttt    243720
     aggcggtacc aagcagccgg gcgacaactg tgttacgcca cgtgacatgg attctcatgc    243780
     cataatggaa agagccaggg cgctttatcc cgagttactg tgtgaatctg aattctccgt    243840
     agcacgcgtg aatgttggct tcaggcctgc gcgaaatgga ggaagccgtg tggagctgga    243900
     aagcgcttcg cctggtcccg ttattcatgc ttacggcctt ggcggtatgg gctacgaaac    243960
     ctcacttggt gtagcagaac actgcttacg catttataga ggtttgaaat gccaacggag    244020
     caaagccaag ctctgataaa ggactaaatg ttaatagaag agaacacaat cgccgcgtct    244080
     atttcaacac aattgacggt atgttcgact agtattatcc ctccacagca acgtaaaagc    244140
     aatgaccatg taccaaacct ccataggtta cgtaggatct ggcatgttca aaggaaaaac    244200
     gcagctcgag tttgcccttc ttcggagctt tagaccgctc ttcaagctct aaagcagcat    244260
     cttggtataa tggcattgtc gaaagcctaa cgtcaagtag ctgaaagagc aggaccggat    244320
     cggctcacat gtgatagcag cacctagact aatgtttatc ttataaacga gcttcaagaa    244380
     cttcgccata aaaggttagg attctttttt caaggatgaa ccctaaaccg gtttcagcca    244440
     aaattaactg ctcaatctga gagccattca gcccgaacta aagtgagcct cgttaaaaca    244500
     ttgtgttggg ctttgggtat ctgaaccttc gcaactgagg actccattgt taatgtttta    244560
     ctaaaaccct cgtaatggag atgtactctc ggaaaattct catccgctct catgggatga    244620
     ccgtttaatg gctttagcta aggtaatcgg cttccctctc gaaccccttt acatcgtttt    244680
     atcaggcggt tttctcaggt tacgagatag ctagtcatat gctcttccaa aaatcatcag    244740
     gaattggatt cgtgccggtc gtattatggt attagtagaa atattaatta ggatgaggga    244800
     gatatgaaca agtactctgt cagggtggca atatctacat aaaatatctc agccacttat    244860
     tccgattcaa gctgttacag ttttgattac gtcttttcat ttcgctgagc ttttagaagg    244920
     acttgatctt tgaagatggg gcattctaaa agtaatccac caaaagtacc aaatggttgg    244980
     aaagcagtct ttgacgaaga atatcggaca tacttcttcg tcgacctatc caatgggaaa    245040
     tcgcaatggg aagagcctaa aggcacaact tggaacgcgg agtcaccgcc cccttatcaa    245100
     gaacagaggc ctgcaggtgc gccaagtgca gtaaaggggg ataggaaaac cccagccacg    245160
     gaacagcgta gcggataccc acagcaagct tacccgcaac agccatattc acaacaggcc    245220
     tatccgcagc agggatatgg tcagcaagcc tatccgcagc aaggctaccc tcagcagggc    245280
     taccctcagc aaggttacta cccccaggct taccctcaac aaccttacta tccacaggca    245340
     tatcctcaac agcagtatcc ccagcagcag caaggccgca agaagttcgg aggtgctatg    245400
     actggtggtt tgcttggtgt gggtggtggt cttttagctg gttcccttct gggctcagcc    245460
     ctttcaccac acgaaacaat cgtcgagaat aactactatg atgataatgg tggaggtgac    245520
     tatggcggcg gagattttgg aggtggtgac tttggtggcg gagattttgg aggtggtgat    245580
     ttctagcgta gcatcactaa catatacgac gcgctgtcct ctttgtgtct gttaagtaca    245640
     gcgtctaaga tatggcctcc cggtaaaccg agccagcagt acatttcaag gcccagcatc    245700
     ccaatatttt aaaacgagta ttggttatga tctcgaatca tcaccaccgt tgcaagtgag    245760
     catataaagt taaataatat agagccaaac ttcagcgcag gtagcccagc tatacgatct    245820
     ttatattcaa ctgccaacgg ttaaaatggg caatcgggtc tacgatccca tccatgatgt    245880
     ttttcaaaac aaatctgagc aggaggatgt acctccaaat gagaagcttg ctggggcgga    245940
     ggccccatac cccgaggaag aagacggaga ttcaacacaa agtgacgaca acgcaactcc    246000
     tatgaacgag agcgggccac acaaacggag gacgaaagag cctagtaagt atatgcgcca    246060
     cttgaaaaag ccagatggag agtttttcac gcgcaaagac attcagtttg agtttttaca    246120
     tgaactctgc tccgacagga gggccctttt caccaacagg tatcaagatt tcttcacgat    246180
     agcgccaact gaagagtctg agcctttgaa tgtcactgac gagtcgtatg tggcgcgtaa    246240
     gtttataaaa aacgagaagc tcacgttttc tgagtactat cttctgacga ttgcttcatc    246300
     caccaaatgc tccaagatac tgcgtgacaa gctcttattc gatcgcaatg tggcattctc    246360
     tacatgcgcc ctatcgcttt tggtgaatac aggccgtctg aacacgacga tcaacttttt    246420
     cttggaaatg acttctcaac tgcggacgtt tcattctata ccgtgtctcc agcgggatgc    246480
     ccgggacccg aagtcactgc aagacacccc aaggcttaag tcgattttga aaaatctgcc    246540
     tttggggaac gaaaacctgc cgttgacgga atattatgaa gccccagttg cggggaaaag    246600
     gcttgattcg aaccctgtga atttgatgtt tcatctatgc gacaatgttg cgcttgttaa    246660
     cctaaagttc atccaagagt acatatctgg tgcgtctgat ctttcatttt tcgacatttt    246720
     ggaaaacccc gattatgacc cctcgcagcg cgcgcaaatc ctcctctggc tagtctacgt    246780
     acacttggaa acggacatga ctgacagcgc cattgagaaa tcgctggaat tgtttgaggt    246840
     tgacggaaaa tttaaactcg aatcagctcc ggagaacgta gacatcgaca ccccagaaga    246900
     agttgaattc ggtgagtcac agaagactaa gcggagggag tttctagtaa agaacaacag    246960
     actagcacat gacggttata ggaggtctga cgcgaatagg ccgctaatgg aacagacgag    247020
     attggacaac agctccgccg aagatgtcga gagcatcgac gaggacaaat cgtttacgga    247080
     gaagacgccg tcaagagccg tgcaaagggc gaaccaaagg gcgagtagaa gaacgggcca    247140
     aaagccgggg cccaagcccg gtgctaaggc cgctgcgagg gctttggcgc ccaagaggca    247200
     gtctcgcaag cacgcaaggg agcaggcgaa cgattcaatg gaagaagaac atatgcccga    247260
     aacaacttcc aagcttgaag acgaggattt tttggcagag gaggagccaa agctacaagt    247320
     tcagctgcaa tcacagtctc agccagacga cccggaggcc ctgcaggcgc cggccaagaa    247380
     gaagcagaaa agaaaaaccg ggccagcagc tccagcatca caggttcagc ggaatgaagc    247440
     gcttgatgag aagaaaaaag acgagatgga ggcgctgata gaattcgaca agagcgagga    247500
     ggtcgcgcag catcggaccc aggacgcgct catgcaggag ctggagcggg cgcaggcact    247560
     gacgaggcgc aagcgcgagg agctcggact ggtgaagatg ttttacgagt tcgaggacgt    247620
     cacgatggcc acggtgatcg gtgtacgggg caagaagcgg aagaagttca aggacgggct    247680
     tctggggttc gagacggact tcatccgcac gatcagcggc gcaaagcgcg cgatgctaac    247740
     agcccagcat gacgccaacg aggatatata cgagttcaag taggattatt aaacgctatt    247800
     gatttgaatg gcccagtgtg gcggcagagt cacgagagca cggcgcggag gaactcttgt    247860
     aggccgtgcc gcaggccgta ttcttggatg agcgcgttgc agacgtggtt ggcatgtggg    247920
     accgtggaag ggccgttaaa gagctccacg gagagcagtg actgcggaag gggtacgctc    247980
     tcaaaatcga tacggtagtg cacgaacact gcaagcgagg gcgcggtcgc ggccgcggcc    248040
     gcaggcgccg gaagcgagga cacacgcaga cagctttcgg accgctgctg gaccagccag    248100
     cggcggctgg cgcgcgcaat ctcttgccag aggtcgctgc gtgccgcgtg cagccgcgag    248160
     tattcgtagc atcccagtag caggtaagat acgttgaggg cgcgctcgca gtgagtaact    248220
     agagggcgca gggcaagctt ggcctgcggt ggcgacacct ctagcacgcg caggctcgtg    248280
     acgcgcgcgg actgcgtggc ccattccaga gtcagttgta gttgtgtccc gaacgagacg    248340
     acagtggcag gtggccccag cgagcgcacc tggaggagcg gcaggaactc ttgtagacag    248400
     ctcagccggg agccagggtc gagcagggga agcgcgtgga acctgtggga agcgggcagc    248460
     gatgcgggtg cggacgcgga ggcatcgcga gcgagaaggt gaagcagttc ttgtgcgtgg    248520
     cctgcagggc tcggggcttg cggctctgtg gccgactgac tgccgagctg ttcttccagg    248580
     gcgcgcacgc gcagccgcag cgcgtcgcgc tcgcggaggg cgtgcccggc gtgctcacca    248640
     agcgcgccag gctcgactgg ctcagttggc tcagctggtt cgcctggctc tcggggtcct    248700
     tttggaattt cgtgcattgc agaaaaaagt acgtaaaagc tagctagcag agggccgcga    248760
     cgcagaggcc gcggctctta attttcgtaa cgcgtaaaag ccaaagaaat atgcggggga    248820
     ggctgtcaaa gaggtgcgat cgaacataaa cgaagatcag aaagaagaca tgaacagggg    248880
     gcgcggcgcg cgcgtcccat gcagagcacc gcggcgctca ggccacgtgc gcgcttagtt    248940
     cttctcaccg ccgtgcaagg acgagctgac gtactcagcg gcatcgttca gcttggcctt    249000
     ggcggcgtcc acgtactcac cggcctgctc ggtcatagac ttgccagtgg cctcgctctt    249060
     acccttgtgg gcagcgtcgt tgacgccctg gaaggcgccc ttctcctgct ctggctgcat    249120
     cttaccggcg accttgtcgg cctggtcggt gacgaactcc ttgccctgct cggcgtagct    249180
     cttctggctg tctggcttaa ccttctcggc ggctttgtcg gaaaagtctt ttctgtaaga    249240
     gtcggacatt gttgatgtat aagtgtttgt tggttggggt ttgattctag tggagtagaa    249300
     atctgatgag ggagtaaaag aacaaaagaa ctgctaggag agataccgaa tccccaccat    249360
     ttgccgcccc ttttatacct gttgagccgc ccccaacctc cccaaaaccc agcaaaacca    249420
     gccctagccc gtttctcggt ccgggccgcg cccgccatga tccgcccctg tttcgagtcc    249480
     ataccgcgta gagattgcca caagcaagcc gaagcaagcc gaaacaagct actaaaacga    249540
     gctgaagcaa gccaaagcaa gctgaagaat cctaacaggt gtcgtttctg gtgcgtttcg    249600
     atccgcgccg taggggacgt tctacgcagc gccgccggac agggaccacc cacagcaaag    249660
     cttccaggat tgctctggtg gatggtgacg cacggccgcg cggccccgtc tgcggattgc    249720
     ggagaggcgg ttgccgtggg caacggaaca ggggcgagga cacgacagcg catcgggacc    249780
     cgcgcgtcag cacttgcggc gcaggggaag ggattgctct tggcgggcgg gcggcggcgg    249840
     cggcggagcc ggagccggga atggggtgtg ggtggagcgg gtgagtgcgg cgcgaggggg    249900
     tcgaacggcg gcggggcggg tcacggcccg ggtcacggcg cgagtcaaag cgcgagtcat    249960
     ttggtcacgt gagtttacag tcgcgtgatc cgtgaagtat gataccacgt gtcatgtgac    250020
     ctgagtacca gtcacatgcc cgcgctctcg tcgcttcccg aaattccacg agcttccttc    250080
     ctctgctcct cgtccgctgc gctaaaaatc gaacgcattg ctcatctcgc gccccgcgca    250140
     acgcaacccg acttcacctc cccaccacca ccgaccaccg cagctcaatt ccacccccac    250200
     cacacgcaac tttcccacac atgtaccgtc gcacactact gcgtctgagc aacccccggg    250260
     cgctcgcgcc ccggctcgcc accggcccca gcgccaggct tttccacgcg tccacgcgcc    250320
     tgctcgacga gctcaaggat ccctacgcga ccctgggtgt cagcaagtcc gctagcgggt    250380
     ccgagatcaa aaaagcctac tacaagctcg ccaagaagta ccaccccgac atcaacaagg    250440
     ccgaggacgc ccagaaaaag ttccacgacc tgcaaaacgc ctacgaaatc ctctcggatg    250500
     actccaagcg ccagcagtgg gaccagttcg ggcccgcggc cttctcgcag ggcggtgccg    250560
     gcgcgcccgg cggcggcgct ggcggcgccg gtgctgaggg cttcggcggc tttggcggct    250620
     tcggaggcgc gggcttcggc ggcatcaact tcgaagacct cttcggcgcg gcgttcggcg    250680
     gcggcgcggg cgccggcggc gccggcgcgc gctcccgcgg ctccatgttc cgcgagtacc    250740
     aaggcagccc catcgagctc acgcatcgca tctccttcaa ggactccgtg ttcggcacca    250800
     agaacgtgaa cctcaagttc agcgcctacg acccctgcgg cacctgcgac ggctccggcc    250860
     tcaagcccgg cgcctccagg accacctgcc ccggctgctc cggcacgggc acccgcgtgc    250920
     acattcgcgc cggcttccag atggcctcca cctgcaacca gtgcggcggc gagggctctg    250980
     tcgtgcgcga ctctgacacc tgcgccacct gccacggcga gggcgccagc ctgaacaagg    251040
     accacgcgat caaggtcgac ctgccccacg gcctacagga cggcgacgtg atccgcatct    251100
     cgggccaggg ctcgtaccct aacatcgccg tggatccagc catgaaggac accgtgcgtc    251160
     tctcgagagg cgacgtgctg ctgcgcatcc gcgtcgacaa ggacccgcgc ttccaaatca    251220
     agaacaaata cgacatctgg ctcactcagg acatccccat caccactgcg gccctgggcg    251280
     gcatcgtcac ggtccccacc gtggacggcg agcaggtcag gctcaaggtc gcgccgggga    251340
     cacagcacaa cgacgtcgtg tcgatctccc aaaagggtgt gcccaggggc gccttcggct    251400
     ctcgtggaga catgaaggtc cagtacaaga tctccatcaa gaaaccccag tcgcaagccg    251460
     aacggtgtct ctgggaggcg cttgccgatg taaccggcga taccctcgcc aggagatcgg    251520
     ttctgtcgtc gcagccgcag cagtcttcgc acactgacaa ccctgatgca cccggcgccc    251580
     ttggcaaact cgaaaacttt atttcgaaca ccttcaagaa gatcaagggc gataagaagt    251640
     gatgtgcagg atcgcttcac gcaacaacaa taataacacc tctagataaa gacgaaattt    251700
     cctgtaaata actacaccag ggcatgtact cctccttact ctgtaaatag cggggacaag    251760
     tgctcaagac cgctgacatt ctgccaggtt ccaaaagccg cgcgctccac gccattgtgc    251820
     gggtgcgtga tccgtgtttg tattctctac agtaaaatta aacgattcct tcaaatacat    251880
     taaaatctaa ggcacatttg tgcagaggaa cgacagctca aactcacgaa cgtccgcaaa    251940
     atgctctcca atggcttgca gaagttctac tactactact tcattataca catcttcaca    252000
     acgatactga tagactcgtc ggtgattctt ccggcaaagt tccaattcac gcagccgctg    252060
     gtagaatggc acatcgcaca aaacaatgac ttcctgctat tcgaaaaacc agattggctc    252120
     tggtacttcg tgctaatcga gtgtgtgggc caactacccg gcttcttttg gttcgctggc    252180
     aagttcaggc agctgtggtc cctaaaggaa agtcagacca aggccgacaa gatggccatt    252240
     cgcgattgcg aaaagtcgct ttcgaagtgg ctcagggtct acggctggaa tgcttccgtc    252300
     accactctca tctgtctgtg gaccgtttgg acaagaggat attacccaag cggcgagttc    252360
     ttgcccatga acgtgcagga caaaatcaag ctcatggcta tttacgtgcc ctacgtactc    252420
     atacccctga ggttgtgcct cgcttaaggc cttccccggt aacttttcac cggcgtgccg    252480
     tggtcgaatg agcagctctt cgccaacgta ccatgataaa attatacaaa atagtttgcc    252540
     tcgagcagaa ggtcaacccc gtctggcgac tgccacgggc cggaaccgcg tttcttggcg    252600
     gtcagccgtg ctcagccttt ttccggtgtt cagctcgtat ttttcgccca tgcatgctat    252660
     gtacaagtaa ttaagacaaa ttcagtatat attttgtcca tcatcatcaa caaaaccgtg    252720
     gagttctcaa cccgacacgc tcgagcacac tcttctgtgc ttggcaggtt aacggaggaa    252780
     caaggctcat ggacggccca agatacgtgg caccttcgca gcggctgtac cgcgcccgtc    252840
     acaaaattac gcgaaaagac ttgtggaagt cttatacggt ggacgacctg accctttctg    252900
     tggacgaacc ggctcttctg gacttctcag ttccggtgct tgacttcaaa aagcctccta    252960
     agaagactgt gagcagctcg gaaaggtcct cgtcgatttt ctctcaacca tgcggggctg    253020
     gttcggagta cggatcgcag gacgatctgg gttctacggc aaatggagag cttcagaacc    253080
     tgatgtttcg caactattct ctcgactcaa tgatattaca aaacaagaag cgcattacgg    253140
     accacgagaa caatgtctcg ctcctgaagg ccgtctcgga gacgtcggca gcgaacaaca    253200
     agaattacag gacctgctct cggccctcct ctctaccacc gaaactatcg aaagaaaagg    253260
     tactgcatga aaatgccatc gaagagcttg ttcggcatgc tgagcgactg gaacatcggg    253320
     atgcgagggt tctcaagtac actaatagaa agcttttacg cagggaagca cacgcgcaaa    253380
     aacagtgggc agagattggg caaaagaaaa acaaggacat tttactagaa gttcggcgcc    253440
     gtggcctggt gctagacgga ctgccctggc aacacagaca gagggtttat gacttgtgcc    253500
     taatcaaaaa cttggaggca cctccctcag ccccactgct ggccgacatt cggtctgcaa    253560
     ttgaggatgc agtcgaggat aggggcgacg agatcttttg caatctctat gctcgatcga    253620
     agtggctgaa gaatggtgct cctcccgcct tcaacttcta ccaagttttc gagctcgagt    253680
     tcgaatcatt gtactaccat ataaccatta cgctggggct tgacccagtt cgagaattcg    253740
     tatggccttt attggccaca gtactctgcc attatttgaa ccgcggtcca gcagacatgg    253800
     tagtgagact cgttgatacc ttggtactaa cttcatacta cggtgaaata gacgaagtgt    253860
     tcgacaagat ttgggagatt gtgctgaaag aacagtctca taagttcttc ggttctcgcg    253920
     agagcgttca tgacgagctg agatcaattc acgctcacct tccgacgctt ctacagaccc    253980
     ttcaagcgca atccggacag gcaaaagagg ttaagcaata ggacaaaata ctctttagac    254040
     attagataga ttcatgtact acggaaattc gacctaggag aagacgcaaa ccttcaattc    254100
     ctctcaagat tcgtgtaaca tgcataccat tcctcacatg tgacagcgaa tatggtgttt    254160
     tgcgggttaa aacaagctga gccctcaacg ccctaagcga accaacagct caacgatgcc    254220
     tgtattgcca aatgaatact cgataagaag ggtgaaacct agcgactacg agggaatagt    254280
     cgaaacacta agggttttga cagttgttgg cgacgtgact aaggaacagt tcgaggaaac    254340
     agtcgcctac tggaatgagg ttaccgtgaa atctaaggga gagcccatca aagcctacaa    254400
     cccacatgtt atcactgatg gctctgggaa agttgttgcc acaggaactg tcttcattga    254460
     gaggaagata ctacacgact gcgggcttgt aggccacatc gaggatatcg cggtagcaaa    254520
     ggatcagcag ggcaagaaac taggccagct attgatagag catttgacgg agcttgcgct    254580
     ttcccgcggc tgctacaaag tgattctcga ttgtgacgaa aagaatgtgg gcttctacca    254640
     aaagtgtggt tacagcataa agggcgtaga gatggaccgt cggtcctgag aaatgcagct    254700
     ttttctagtg tacataatta caaaaagtag gagtatggga gagtggaacc tcaagcaaac    254760
     gtctcgagcg cttcgaggga aacgatggag ttcccgcgca cgacggactg cgaccccatc    254820
     gcaaacttag tcccgtcctt gcgcacttcg actgcatcgt cgagtacaac gttcaggaaa    254880
     atgtcgaatc cccgcaggac gccaacgagc ttgcgcgacc cgttcagctg aatatacact    254940
     tttttgtcca tgtactgcaa agatagttag taaaacagag ttggtaccgg ggagatgcga    255000
     agagcgtaac atactttttt gagttctgga gtcgatacca taatgaaagc gaaactgcga    255060
     agctgtagtg gtcttggggc aagctcgtct caagcagctc aactactgat caagaacttt    255120
     aattaccaga acctacccat gttcgtcaat gatgacataa tttcaccaga aacgttcagt    255180
     cttaaggaca gttcattaca acttgcgggc cccgcgtcca catcagtgct ttgagctctg    255240
     agacttgaaa ccatcggtcc gccctttaga aataactctg agctttcccc cgtaaacatt    255300
     gaacggaaac accttgattg aggggcgaaa gcacctctag ttatttaacc cattctaagt    255360
     cccgtggaaa tgcctccgat catatagcag tgactcatcc aagagaagga gtcttatata    255420
     cgctcgccaa ttccaatcac tatatacgcg ccagggaccc tgaaacatgg actctgtgct    255480
     tcaacattag cggtggctca acgtctggcg acttcttttc gccaagccag actaatgctc    255540
     gtacctgtcc ttcctcttac agctggctca aatacattct tttcattttc cttctcggac    255600
     ccgacttccc gcttcctgta gatctcactt cgacaacaat aatgcgggga aaaaggtaag    255660
     aaatgggact gggctacaaa gcgcactggg atacaataca catgcgccag aacctggcca    255720
     ctaagcagga acaggcaggc ctttggcctg ctaataccgc tatcggaact cgatcttttt    255780
     acacatctct ttgtactaag attacaaaaa ttaatatata atgcgatagg tcagccaatt    255840
     gaaaatatta gatagatttc tgagaagggg caatacttgt aagttagaac aacatattcc    255900
     agtttgcggt agtaccattc gcacgcgcag agcttgtata tttatcggta cttgcgtgat    255960
     ttgttgaaat agaagaagaa gatgttgaga atgagactac aagcgggtgc ttcgcgccgt    256020
     tttttaagcg gcacttcgcg catgcttgcg gagaagaaga agcatgatct cgtggtggtt    256080
     ggctccggcc ccggtggcta cgtggctgcc atcaaggccg cacagcttgg cttcgacacg    256140
     gcttgcgtgg agaagcgtgg cagagccggt ggtacctgtt taaacgttgg gtgcatccct    256200
     tccaaggcgt tgctgaacaa ctcccatttg taccatcaaa tgaaacacga ggctaaacag    256260
     aggggtatcg acatcagcgg agacgtctcc gttaacgtcg cccagctgca gaaagccaag    256320
     gatacctccg tcaagcagtt gacgggtggt attgagatgc tgttcaagaa aaacggcgtc    256380
     acgtactaca agggccacgg ctccttcgaa gacgaaaaca acatcaaagt ctctccagta    256440
     gagggcgtcg agggcagcgt caccgaagag acaattttgg aggccaagaa catcatcgtg    256500
     gctacaggtt ctgaggtgac gccgttccca gggatcaaga tcgatgaaga gagaatcgtt    256560
     tcttcaaccg gtgctctatc cctcaaagag gtccccaaga gactggcgat tatcggtggt    256620
     ggtatcatcg ggctggagat gggctctgtt tactccagac tgggctccaa ggtcagcgtg    256680
     gttgaattct tgcctaagat tggtgccact atggacgacg aagttgcatc cgccactcag    256740
     aagtttttga agaagcaggg cttcgacttc aagctgggaa ccaaggttct ctctgctgag    256800
     cggaacggcg atgtcgtgaa catcgaggtt gaaaatgtca agagcgggaa gaaagagtcc    256860
     ttggaggcag atgttcttct ggttgcgatt ggtagaaggc cttacatcca gggcctaaac    256920
     gccgagaagc tgggcctgga agttgacaag agaggtcgcc tggtcattga tgaacagttc    256980
     aacactaagt tcccccacat caaggtcatc ggtgacgtaa cctttggccc tatgttggct    257040
     cacaaggctg aagaagaagg tattgccgct gtggagtact tgaaggaggg ccacggtcac    257100
     gttaattatg ccaacattcc atccgttatg tatacccatc cagaggtcgc ttgggtcgga    257160
     aagactgagg aacagttgaa ggaagctggc atctcttata agattggtaa gttcccattc    257220
     atggctaact ccagagctaa gaccaaccaa gactctgacg gctttgtcaa gattttgatt    257280
     gacgctgaga ccgagaggat cttgggcgct cacatcattg gtcctaatgc cggtgagatg    257340
     attgctgagg caggccttgc tttggaatac ggcgcttccg cagaagacgt tgctcgtgtg    257400
     tgccatgccc acccaactct ttccgaagct ttcaaggagg ctaacttggc tgcttattcc    257460
     aaatcaatta acttttagtt ttggctaaat cgctgctctt gttataacga tacttattat    257520
     ttttatcata gcacacaaga aatcacagcc tgcattaagt gcagacgctt gattctgaca    257580
     ggagcacttg cagcgttgtg ctggatgttc caccaccaaa aaaaatctgt taggaaaaaa    257640
     attggacgag accggagtcg aaccgatgac ctctcccatg ctaagggagc gcgctaccaa    257700
     ctacgccaca cgccctgttg atggaaaaat tggattagat tcacaccata atgctttacg    257760
     atgtaatcgt gattgaagtt gcaacctgta gagtgtcagt atggtgagca agttgatgag    257820
     gtttaggcgg ttcgcacgca gtttgcgctc catctcgtct tgttttggcg agcagataca    257880
     aaaacttata aatgttacag ctgctttcct gcggtttcag gagctgagct gtgccagaag    257940
     tacaaatact gctagccctc atcctcgcta tatttccgcc actaaacagt gatacatgat    258000
     gagattaata ttacgaattc tattaaatga gtagtgacgc agaacgtgca ggtcacacgt    258060
     tccagcaaca ggttggatgc tgttgtagac aggtcctatg caatgcggtt tctaggctaa    258120
     aagttcaaaa caataagtaa ttgggatctt gataacgaaa cctggggatt tacaagctca    258180
     aagtgagcca gtcccagtta gcattctctc ctgcgttctt tttatcggct gggttttgag    258240
     gtccactaag cccgcttgca ggctctggtt ttctcctccc ttctctccca tgtgacgatg    258300
     aaaagtagaa ggctgactgg ccctcaggct gctttgactg aggttgtgat ccttgctgag    258360
     gatgagtgcg tccggagtta ttttctgagt tcgtgggctg agaccattgt tcaagaatga    258420
     ggtcaaaact ggattcattg tgctttgtgc cttcatctac gtttgctgta gaatgctggt    258480
     cgatgtccat ctcagaggca gtgttgctca ttgtttgggt gtctgctccc gacgcttgta    258540
     ctggagtagg ggtacctgac ccgctctcac tactggcatt ctctgcgtcc cgggtattga    258600
     aactagcctt tgatttcctt ctcgaaaagg atgactgaga tcttggtaga cttggccttg    258660
     cctcgcccag aatattaact gaagacgtct tttttctgct tagcggacgc ttactcttcg    258720
     aattctgcac tgcatctttc gaaggtgaat tatcttgccc cacaacagcg gaggaatttg    258780
     cagcagtagc cttgtttgat gaacgctggc gcttcttaat cacgtcagtt ttcagcgaca    258840
     aaggccgcac aacgccgtgc agcttcagga aaagaccaca tgcgttgcag agaggatttc    258900
     cttgggggtc tctcctccac aatggggttg tttttgtgtg gcaatttgtg cacttggtat    258960
     ctgttttccc acctgacgcg cttgccccag aggttccttc attggttgtt ggcttccggg    259020
     ccgcatcgtt tgatcccttt tcttgctggc cgacaaaacc cgttggaatt gagccgccat    259080
     ttatagacgt gaagctcaaa cttcctcttc tcgaattaga gcttttgatt tgcttcttgc    259140
     gaaccgaatt gacgctaact gggcggcgag aaacctgtgg gtttggaaga gagctaggcg    259200
     ctatggcaga tgtgccaggg gcggatgcac ctagaccatt gggcagggct tgccaggcac    259260
     tgctaggccg tctaatagat attggggtaa tgttggatgt tctatcataa agatcaggaa    259320
     gtgaaatctg tgaatttgtg gcgtgcagtg gtgggaatat attttcgtta tcttggttcc    259380
     cttcattcac tggatgcaag aagtcgtggt cgtcaaagaa tgtctgacct cccaggatac    259440
     tggagttcag gccgccaatg gtaaccgagt tcggcaccgt cgaaagagca ctggcctggt    259500
     ccatattgtt gagaagcgtg gaatttgaca tagactgctg accataagat ggattgtcgg    259560
     cggatgatac cccactgtcg cttattagtg ccggcgaaga gtacgtcgct gcgcgcattc    259620
     ccatgtcctc atcctcctcg tgactcaatt cgcgacccga cgccgattcg cggccatcta    259680
     gtatgttaaa gctgtcaacg tcgacatcgg ccataaagcc aacatgctgg ctgatgttcg    259740
     agaatgaacc gaaatgaaca ttgtcgtcga agccaagagc cgatggttcc atatcccgct    259800
     gagagaatgg cttcatggag ttagacggcg tcgggcccga ggtcggacct cgccccatcc    259860
     cgctaacgat ctggtcgctt atgctgagtt tggattcaag gggttctgtt ttgactggcg    259920
     cacttgccga agaagatgac gctctgccct cagctagtcc atcagtggcc tgcatgttga    259980
     gtgtcgacga agcagctgtg gagagactct ggcctcttat ttcccgcaac tctgccatgt    260040
     aatcaatttc ttcgggcacc atagggctcg atttatcgct ctggcttaaa tacttgacct    260100
     gctccgggta cagctgatcc tggtcttgtc tggcgactgg gacgttcttc ctcatgcgtg    260160
     ccccaagcat gcgccatgtc aggttgacca tgcggtcgcg gtagggaagc gaggcttgcg    260220
     cgctggaata catgtgccat agggcctccg ccgaagagtc tgatatcgct tcttgcagct    260280
     ttttctggca ctgacgctca cggctgcgag cgtcttcttt cctctctgtc atgagcgttc    260340
     aactaaagtg gagtccaaga ggcagacttg gaaaggcagg gggctataaa attgaaagat    260400
     cgttttgttc ggggattaga cgtcggggat gtgagtcaaa acgcttccgc aagttctctt    260460
     ggcttggccg atgaaccagt agtgttcaag gatgtatatg tgtgtgaaga gtgagaagaa    260520
     agacaacttg tcacaacgcc cagagtgtat actctacgta gtggccggcc tttcgcgtag    260580
     gcaaaagcta caatgtgcgc ctgctccttc accttatcgt actggcccaa gccggcgtca    260640
     acaatcatag ggaaggcccg taccacaacg atgctttttt ttcctgcgca tgcaaagaga    260700
     acctgcagct ggcgccggtc agaatgcgcg ctatgcttaa gtgcgcagga cctcgaaaca    260760
     gctttgagtt cctagccatg caccaaaacc ggaaccggtc ttgcccgccg ccagacgtcc    260820
     ctacaaggct taccgttcgc taagcagaga cgcagggaga aaatgcagtg gaatttcatg    260880
     taaccaagac caatcaaaag ctgagctgat aacgcagcag cggaagaggc gaaaactgat    260940
     ccaatttttt ttttttattg acactactga taaagacctt agcaccgatt tcgcatgcga    261000
     taacggacga ggctggtccg gtctgcagca gtaggaggtt cacagataga gacgagaaca    261060
     ggccccaccg agaccccccg ccgcatatag accgaggatg cacgagggga agaatgaaga    261120
     gccgtaaatg ttgatgccgc atgtgacaca catatcatgc tatacgtaat tggagcgacg    261180
     tcacgtgatg aaaatgtagc cgcccaggcc gagaggcgtc tgtcccgcgt tcttggccag    261240
     tagttccgag gttctttgtc gttcaacgtt tcaatacatc tgcatcagac tcttggccgc    261300
     ggcgctgtac ttggttatct ggcgtttttg ttccagggag ggaagagagc gaaagttttg    261360
     tgtgtttgag gttttcgaag cgcgcttttc gagcttcttt tataccccag aaagttatgt    261420
     ctaccccgta ttttggcttt aattagttgg gagggcaccc agaaggttga ggggggtgag    261480
     cggctaagca gaacgcagtg ggacctaatt atagaatgca acaaagagat agacttaaat    261540
     actctgtaaa aatgccacca aatgtgtaca tagtcgccgg gcagagatct gctgtcggca    261600
     gaatgcagat atggtatgtt acaatgagag gatgcagatc gtgggatgcg aggcacgctc    261660
     acatcttgtt gcgcttctcg cgcaccttcc tgtagtgacc cttggcaccg ctggtcttct    261720
     tggcctggac ctcggtgtac ttgcgcttga aatacttgtt ggtgttttcg ctgtccatca    261780
     gttcgccgac cattgtgctc ttgcgctgct tgttgttcag cctgctgctg taaaattcgg    261840
     tcttgtcctc aactatagtg ccgacggaga agcgctctgg aacagtccac ttctccttct    261900
     tgtagtgccg tttgggatcc agcgcggcac ggtgtttcag caccagcagg tcgcgcttca    261960
     gctcccttgt aagctcaggt tttggcagcg taaaccactg ctcagtagtg gagggcttct    262020
     tggtggcagc gtcctttttc cgcgagtgta ggattgaaac cgggtcctca accttggtta    262080
     ccgccttagt tccctccacg gcactgcctg caggcagcgt caggctgtca aagccggttt    262140
     ccatgcgcgg aagtttgcgc atccgctgct ctatctctct gaatgttttc tgctgctggg    262200
     caatcttgga atcgtcctca aactcgagct tgtcctggtc aaagccttca ttttcgcccg    262260
     gcgtgctgga ctcaccggct ggagcgctgt gcgtcacgcc agcggtctcc agcttcttta    262320
     gctctgcaaa aaggtcttct atgctgtcag aggccattgt tcaggttgcg cttgggtgct    262380
     tttcttcgtg tgctgggcag ctcatcgctt gggtagagag ttagaaattt ttcagagtcc    262440
     gtaataagtg tatatgcaag taataaaaaa ggcaggcatt gaagacgagt ttacatgagc    262500
     tcgtgagatc ttccgctcct tgccctttac taacctaatc ccgcacgcag cctacagcgg    262560
     aagccaccaa atgagtgatg aatcggcgct tagtatatgc gaagactcag ttagagagtt    262620
     cacagagctg ctcgcgaagg atacgcagat tcggtatgcc caaaacgcta taagacgata    262680
     caagagcagt gaggctgtag acgtggacga cgagcgcaag agcaggcaca aacgcaacat    262740
     catagctgtg gatgacaatc tcaagatcaa ctatgagatg gtgaagatga caccaggcac    262800
     gtttattgag agcagcgtct cgacgtccaa gaacaaggcc ctcaaggaga aagctggaaa    262860
     agtgacgaaa atgaagacga actactacaa gaagaggctg tataatatga acgagcagtt    262920
     cctggccgag cagggcacat tagagccggt atcctgcagc gactcgcaat cgcctgagag    262980
     cgcagcggac gcgggagatg cgggggacac cgcaggtgca gcttcgatag cagacgatgc    263040
     tcctctggac cagcaggcga ggtggctagc tgaaattcac aaggacctgc tgcaacagta    263100
     caacacgctt cttcaggagg agaaaaagtg gtttttgaaa aaggaagtgc tactggatgc    263160
     aaacgccaag ctcgaccttt tcacaacccg cgatgaggac caaagcacat tacaactcgg    263220
     tagcaaggac accgcgggtc tctgcatgtt tcactaggat aggggcacct cattgctgac    263280
     gttcaaaaag cttaccgcgc cctagagaaa cgctgcgagt ctctgacacc aaggcaatgc    263340
     atgctgccga gccttgtggc tgcaattggc gttgatccat attcaaaaag ttagcagcgg    263400
     cccatgagcc tcaccaagag accctgtagc agtgccgagg ggtctctctt tatagagatg    263460
     aggtgcgggt aataccttga agatcgaggt ttctcataca taaaaatttt caaagtaaga    263520
     tggagcatga aatcggacag aggaagtcca tcgcgggcta ctagcggctt ctttagactt    263580
     caagatgtcc gatttgcaac tggaaattct tcagaaactt gaccaactgg gcgagatcca    263640
     atctacgctt gaggtcttcc ctaacataaa ccctcaagtg gtgctgtcgt cgttgaactc    263700
     attgaaggca catgggaagc tagagtacac caagcaggac aaaacctact atacgttgag    263760
     caaggagggt gaggagatta tggggaaggg ttcgcatgag atcagactac ttcagttggt    263820
     tgacaagttc accaagctcc aaatcaagga tgtggctacc cacatgggag ccgacggaaa    263880
     ggtgggtcag gcgcgtgcgt tcaagaacgg gtggatctcg aaaaacaagg acaacgagct    263940
     gactgtcagc gacaaaattt cgtcggttaa cgacgtgcag gacgaaacca aagatattct    264000
     ggttcagatc aaaaacggta actacgaggg cgtgaatgac aagaccctaa acgacctcaa    264060
     gaagcgtaag ctggtagcgg ccaagaagga gatcagcttc cacgtgacca agggagcaga    264120
     cttctccaca gaactcacaa agttggaaac ggacctcacc gccgacatgg ttgcctcagg    264180
     aacttacaag gacctgaaat tcaagcccta caacttcaac tctgaaggta tcttgcctga    264240
     atctggtgcc ttgcaccctc ttaacaaggt cagggaggag ttcagacaga tctttttctc    264300
     gatgggcttc actgaaatgc ctgccaacca atacgttgac acaggtttct ggaacttcga    264360
     cgctctatat gtgcctcaga agcaccctgc tcgtgacctg caggacactt tctacctgaa    264420
     agaccctata aagagtgacc tgccagagga caaggcatat ttggagaaca tcaaagcggt    264480
     gcatgagcaa ggtaagtttg agtccatcgg ttaccgttac gactggaagc cagaagagtc    264540
     tcaaaagctt gtcttgagga ctcactccac tgctacgtct gcgtacatgc tgaagaagct    264600
     ggctgaagac cccaagccta ctagactttt ctcgattgac agagtcttcc gtaacgaagc    264660
     cgtggacgcc actcacttgg ctgaattcca ccaagtcgag ggtgtcttgg ctgactacaa    264720
     catcacgctg ggtgacttga tccagtttat ggaaggtttc ttcgaaaaga tgggtgtcac    264780
     tggtctgcgc ttcaagccaa cctacaaccc atacaccgag ccttctatgg aaatcttctc    264840
     atggcacgag ggcctaggta agtgggtcga aatcggaaat tctggtatgt tcaggcctga    264900
     gatgttggag tccatgggtc ttcctcctaa catgagagtg ttaggttggg gcctatcgct    264960
     ggaaagacca accatgatca agtatggcgt gcaaaacatc agagaattgc tgggccacaa    265020
     ggtttcgctc gacttcatcg agactaaccc agccgcgaga ttggacgagg acctctacga    265080
     atgagtcccc agccaccctg ctcataccag aaaaagaacc aaggccttcg agaaattttg    265140
     gcagtgccac aaacgcctcg cttcatacaa tcttgataaa cccctagatt tctaaaataa    265200
     ccgtgttcgc ttattctata atttctacga acgtgaatga ccttacctta tatatgcttg    265260
     accggcaagt cgttagccta tcgtctgccg cctctccagg aagggctttg tgcactggtc    265320
     aggaattagg gcttcccccg cgccgcccca ctgcgaccgg gaagcgctct cgaccttgcg    265380
     ggcgctctgg cggtgcctgt ctttggatat catgttcttg atgtgtttcg aagggagata    265440
     gaatgggttg ctcttgcgat gcgagagcct tggcctcgcc ggtgcgccgg gggtttccgc    265500
     tggctggtca gcacacgcat tgaaggcctc gtaagggagc tgctccaacg atgtgtcaaa    265560
     gctttctgtc tcctgcagat ccggtagtga taaatccgcg tcaccatcaa gcgaaaatat    265620
     actgtcctgt cgtagtccgt caacggccat gtcggaagtg agaagttccg cttcgaagat    265680
     cggtggatca agctcggatt ccgttccaga aattataagc tcaagaacgt cttctatggg    265740
     agcgcgaggc tgctgttcct gctctgcgcc ttcgctcagc gaccccgcgt ccaagctcgg    265800
     gtaggacctg gcaaggccca tgctcgtctc ctggaagtca aggtctgtgt gtgcgaagat    265860
     catgtgcgac agtgtgctct acaccccacc atcaaaaact acgcctcctc tccatccaga    265920
     tcgattatat acctcgccta ccaggattag ggccaccgct tgagtaagca ccgatctcgc    265980
     cgccttttct cttgcaatga aaatctttca ttttacagcc ccaagattgc agccgtggtt    266040
     gtgccttgcg aaccctccga tactcgtgtt tctcggatat agagcactaa ctggctttta    266100
     acgcctgctt aaactcgctt ctttcggagt tccgccacag tacacttcgc ccattcaggc    266160
     agcaccaccg ccaaagtact taaaatcatt actacttttg gcaatcacca gacctttttc    266220
     gcgctgccac gagatacctt cagataatag aggcatgcac catcaacaac catttactgt    266280
     atgcattttc tgccaagatg ggcacgcgaa tcctaaagga ttttcgcacc tcgatcggaa    266340
     tttgcacccg cgcctgttgt catgggtgct caagcttatt ttccgacttc gcgttcaact    266400
     cagtatcagt tttataggat agcggaccgg ttccaacgtg caacttgcct attaaaccgg    266460
     tggcgcagca cgaggacgaa ctatgtttta catgttcggt ggtatctata gagaaccccg    266520
     cctcttgcga gtgccaaggt agatttactt gatgattcgc tataaaacct ttttttttca    266580
     gttaaaatta attgagcttc ctctatggaa tactactgca tgatcatgca gggaaggaat    266640
     tattagaaac atgccaggta ggatgttaat ctacctcggg tgagaaagaa gatctccgtg    266700
     aatgacgaag ttggagccgc gccgggggct ctcggacaac gtggcagcta gcaccaactt    266760
     gcgaggcgct ttcccgcagg gccaaggttt tgagatagcc aaggcctcgg ttccagttgt    266820
     cgagcatctt ttgcgatgag tccacgtgcc cgtagcggct agttgtaaca ctgaggatgc    266880
     cacccatgtt gacgcgcttc atgagatcga catgatcacg gaagtagttt tcggggaggg    266940
     ttgatgcgcc tgtcaccccc gcgcgctctc tggggtagcg cctctggaac cttcgcgcgc    267000
     tcgcgggccg cgagtcgcgc tctttcagcg ataaaaaggt cttcggatcg ccgagcttgt    267060
     aggcgtcgaa gtagtacctg gacatggcaa aaggatcgct gcgaatttcc tgctcaaaaa    267120
     gcggaacagt agtgagcgtg agctctgcct gtgtgccctg cttacggaag ttgcgctttc    267180
     ggaagtttgg gagtttgatc aactcatcta caattgagga gttatcgttg tcatcaatct    267240
     caggctcaga gttagcatct tgaaactctt cgctgcacca aaacataaaa tcgcgaccag    267300
     cctgggcctc tcccgtgtcc tcggggtctg tgctggatct atcacgggcg tcgccggcca    267360
     gtaagttatc gagagaactg ccggactctt catcgcttag ctcggggtcc tcagagctgt    267420
     acgtagcccc actagtcctc tccctattcc catgcccaat tttcttgaat cttgccctca    267480
     atttagactt cacaccttta gacttggaag cggagccagg cgcattttta tcatcgttga    267540
     gacagtgttt cgataccagc gtttgctcac tctggttcgc cagctgtgtt cttattccaa    267600
     aaagcaacga cggggcagag accttatttg gttcaccttc gatactgaat ccactaatcg    267660
     ctagaagccg cgagtaaaat ccataaagaa agttgatact cgaataattg atgcggtaag    267720
     cgctagctag ttgaattggc tgatggagga ggatgtgtgc aggaaactcc aagcggtggt    267780
     aaaaacaata ggcttcaaac gagagcgtca aaaactcagg gtactcattt attgttgaac    267840
     gatccatttg tcttttacgc cgttttgtct cttccaagac cttgtcaaag tccaattggg    267900
     aaatccaatc ttcggcggag gtgggtggat tacgtggccc agatttcgat ttcaaatact    267960
     tctcgcttac ttcaccacat tgtgcgtagc atatactgga gagttctctc accagatcct    268020
     caaaaataaa ccttgatgat gagttttcta gcagcttatc gtagtcaaac tgctcgaaaa    268080
     caatagagag tatgtggagc gaaatccgtg ggataatatg ctcccacact ttcagcgcca    268140
     tctcacaaga ctcctcgggc gccagtttga taattgtgtc gacattagtg ccctctaact    268200
     gcgcaaccat tgcattcagc gtagaacttt cgtcaaaaaa ggtattctga acacattgga    268260
     ggtttactga cagcctgtct tgcttatttg cctgtttgtt gaaccccttg cgggcgtaag    268320
     ttaggccgag ataaaacttg cagctgtcat taaccagcgc gtatgaccca gacgacagtt    268380
     ggcgtgtctc cacatcacaa agcactgaca gaacgcaagc gcaggtgtcg tagaatttgt    268440
     caaggaccag cttttcaagc tgcgccgcaa agctggcgtc caccagaact attgtatgtt    268500
     ttccgctata ccgcgagagc aggtcacaat aacggttcaa agaagggaaa gataggcagg    268560
     ataggattat catgtcgatg ctgtatcttc tattaccatc ggtatcctcg agctttaatc    268620
     ccagctcatc gaattccttg acaaactcgt tgggcctata aaagtttgaa cctaactttg    268680
     gagacttcca cgaaacaagt ccgtcgctcg aaatgttagt agaaactaga ataataaatg    268740
     cattggagag actgagtctc caagcaagaa attgggtggc cggcgtttca ccaacttttg    268800
     gtacaattgt tagtctcagt gaattaaagt ttcccgatta aggaacagta tttaagaaag    268860
     cacaaaccta tgagacatgt tagcggtttc cccatggcag ttagaagctt tcacgatgtc    268920
     gacaggccga agctattctg aatatatgtt cttgcgtgaa atgaccactt taaagtgtgc    268980
     agcactagtg acacaaaaat tacatcacga ttaaatacgt ggcagtgaaa cgctgacatt    269040
     tatgcacgcc aaagaatatt gtttatggaa aactaattac cacctctaag ctccgctagt    269100
     ttgaacggaa cgccattata ataccagctt aacccttttc ctctttcctt tacataagac    269160
     tcaagaagcc tgaagcactc ctcgagagga ataccgcttt cgaggccctc ctcgattgca    269220
     tgccaaattt tcttacgccg attgacttgg cgtgagaagt ttttgtcacc attgcgccac    269280
     gacgaaccat atatcctctc aagatcgcgt atcgaagtgc gacgctttaa gagtattgca    269340
     ggtcttctag cgttgtttgc accggaagac tgctgcgacg ctacatcaaa ccagtccggc    269400
     agcgcccatt cgctaggaag ctttgtgtat tcgttccaaa gctgcgagac agtggtgggt    269460
     gattttatca gaacaacgcc aaagttcggc acaccgtaac agggatcgtg ctctagcgtt    269520
     tctttcgcca ccgcatcgag aagtgaactc tcctcatcct tttctgctat tcctacgtca    269580
     gaatcgcatc ttgatcgctt tcgactcggc tgggggacga acgactgtag tgtatctata    269640
     atttcgccaa ccaaagtgtt catgacccgc ggacgggcgg tcatatcagg caaagtcgcg    269700
     gagcccgata tgcgtgacac cagagaagcc tcatccattc tttttattaa gtggcgaaac    269760
     tcgcgcttga aggtatctag cttgtccaga atcatttgca cgttctgatc cgcgtcatct    269820
     gatggatcat ccgtggggag tcctactggt gacgcctcaa gggtgctttc ttccattgtc    269880
     tccagtcggc gctctacgcc ggtatcgctg cggcccgcgg cagcttctgc ctcctcaaca    269940
     tccccataga gatccttggc tttctcgttg tattctgtgt cgaagtcgaa gtagtctgcg    270000
     tgtggacgcg ctgggacgaa tgaggtgtag taagaactgg cagtgaatgt gcgctccgcc    270060
     gcatcttctt gcaaactcgg agcgtcctcg gctagtgtcg gaggcgcagt agtttcctgg    270120
     tccagggtac tgattagatg agtcagcaac gatcccgatg gtcggtcgtg ctgctcgtgg    270180
     ttaacatcca tcaaaagctg caatctttca ctaacactcg acaccttgtc agtttccatt    270240
     gtgtacaacc aaattgatca acgcttctag ataatgagcc gagctcttga aaaaagctat    270300
     gtggaactag caacggtttc ttgaaagcag cgaaggatgt tagctggcaa agaacaccag    270360
     aacggttact aaatagctct cgaggataaa gaggcgaaat tttgataacc gtctcttacg    270420
     ttaaaaatca gctacttcta ctccctgaac tgcgctctaa atagtctccc tccactccga    270480
     attcgataac tgtcgtagag catcgcgtca agggctcgga gagccacacc aaaacttcct    270540
     tggcttatga aaattcccaa ggccggttgt agtgcaggtg cagccaacat ctaactgcaa    270600
     acgcggggcc accagggact aatttctgtt tcaccatact tgcgcccgat gtctctgaat    270660
     cgcgccctcg taacatctaa agaccagtaa gatcacgtgc cattagcgcg aagtctttgg    270720
     gttcgggatc gcgtcggaag ctagccgaag ttagccgaaa gtattaaaac atggtataag    270780
     tcgggtttaa gaggaccaat agtttaagtg gcatcacaag agccggtagt tttcttcgca    270840
     ggaacggaaa tttagtaccg tctaaccatg attttcatca gtgccgattc taagtttgtt    270900
     ggccttgaac ttgcttgttc tgattgggtt tccatattcg tctatagctt cgagttgaag    270960
     ctcctctggg gacctctcaa tcgtgccttg ggacgcgatc attctttccc ttagtctatg    271020
     gtactcaaca gccacgctgt gattcaaagc ctccgagctc agttcaacat ccacttcgtc    271080
     gtaatcagat ggtagctcga cctctttctc cactacatca gtcataatgg gccctttctc    271140
     atcatcatcg gcgccagaag cctcatcgac tgtcgcgagt gggttttctt ttagaaaagt    271200
     tgatatctcg cccttaagag tttcgacttc tttattgtaa gagttcaagt cacccagctt    271260
     ctcgagaaca gcgcctgggt cctcgacatc gctgttgtat agcccaagaa gatatgcacg    271320
     ggccatatca tcaagatctt ctccgagctt gtggaaatcg acatgagggt tttgaaccac    271380
     ttcagaaggg ttgttgttga cagcagcatt gatttccttt gggaatgctt gtggctggtc    271440
     ttgtttctcc aaaacagggc gtgattctag ccccttgggc tctgttgttt ctatctcctc    271500
     ctgttcgggc aactctggta gtttttcctt ggctggccgc ctctttacag gtttctgcag    271560
     ggagctaaga ttcttcttga attttgagtc ccaacctgga ttggaagctt tgttggctag    271620
     ggcttccgaa ttcctcggaa tatttgtggc agagaggccg ctacttggtg atgatggcgc    271680
     gtccgtttcg ctgtctcttt ccaagacacc ggtaacaggt ccggagttat ccagccttac    271740
     tctagaaaaa tccttggtga cttgcgtcac ccgctcagcg gcttcagggt ccctctccat    271800
     aatgtcttca actgcttggc cgttaattgg attctgcact tctttatttg ttgcaaattt    271860
     tgtgctttcc actgcagccg agggattcct gtctttcttg aatcgtgaaa ccttgggctt    271920
     tctctttgcc ggttgttgtt ctatctcctt ttcatatttc tcatgaacct cattggaatc    271980
     tttggcccca atcagctgag cgaacagatc cgcatcgaag ccttcatctg catcagcatg    272040
     agtaatatcc tcaacgctag attgtgctgc aaatggcgag gctatatatg tgtttgcttt    272100
     tgtctcacgt ttgacacttt cgatctcgtg aacatcaagc gtaggggcaa atccaacttt    272160
     cttagaagct tttttagcgc ccttgtcttt tttcaagatt gacttagttt tcacagtttc    272220
     actgacatgt tggacctgtg aggggcgttg aagcttctga ggctcctgag gctcctgagg    272280
     ctgctggggc tgctgttttt gagatcttaa atggttaatt tgatccaaaa acctcctttg    272340
     agcgaagcca ggaattatag agggcataga agattcatca tagtcatcgt aatcgtcttc    272400
     atcttcttcg ctttctgaat cattcagcag gcttttatgg ttgtaggaat caaagtcgta    272460
     atgtatatct tcatccttaa tgtctccacc ctcgattcca tcttctttct ctagttgtgc    272520
     aacaatatcg tcaaatgtgt aaatatcgcc cggttcgatg gcgggcccat gtttcttgat    272580
     attaggccct ttgatgttca gatcttctat atccacgtcc tttacaatag gcgacggctc    272640
     agaggccgct ttcgcttcat ctttctctct gaattctgta gaatctttca atgttttatc    272700
     gcgaacgcgg tgctcgaagt ccttgtcaaa gcccttgtca aagcgtgcgt tatgaatgct    272760
     aggttctgca tctcctgtgg cccgcttgcc gctaacaaca gtttctgttt catcacttat    272820
     ttcttcaata cgcgggtttg aaggttgcgc ggtggcggtt gggttcacgg aactgctcaa    272880
     aatgtttccc tcttcgtcca agtcttccct gatctccatg aatggcaggc cgtcttcgtt    272940
     ttcagacgga ttcgggaacg aatcttgatt gtctgacgat gcctgatctt cctctaattt    273000
     ctgggcttcc ttaaggttct tgagcgtttc cttggcctct tgaattttcc cttcgaagcg    273060
     cgcagcggct tcatctatga gacgcaattt ctcggtgatg aaatcaatag cctcaagctg    273120
     gctcttctcc acgaagtact cgtacccaat atttaggtat atttttgagg aaatgatgat    273180
     ttctccaaac acaagtcctc ttttgttgcc gtcttcattg tcatcgtagc tgtctttgtc    273240
     ataatccact aggttgcgtc ttattccaga gtagtgttgc ttctgctctt tcaggaacct    273300
     taacttattc tccaagttta cagaagtctt cgatacgata tctaccaatg aatccatggc    273360
     gctctgtgta tcagcatatg ctttgttaca cttcttttgg aaactcatcg cgtgaatatt    273420
     ttacactttc tttcaaagac aattttgaga atagatgtta gcggaatata cttctcagtg    273480
     aaaagagaaa taccaaagcg cctttagcaa accgcttaat gctagggtaa ctgcagctac    273540
     ggttgtcaaa tcgagctctt cgaaacctaa gtcaatagcg cttacagaag ccgcatgcac    273600
     gcctttttac aagagcagct tggggaacga aatcttcgcc aactagcact agccttgatg    273660
     ccctactgag caccaatatt ataccatttt atgtgtcagg aaaagaggct ccccgcaact    273720
     aatgttcagc caccaagctt tctcccatcg agattcacga ttgccgccat gcggttcatc    273780
     gcagttgttt ccttggatgt aatacaggaa cgttcaaaaa actggccttt tagcctgcta    273840
     ctattactca aagagagaaa ggcatacaaa cgggcccaga gcggcccatt cccaccgtcc    273900
     acggtcaaac agcgacaccg atacacttca cacgcgagaa aaaggggaac tcagacgctc    273960
     aacaaaaggc caagactcag atcgttgtgc tgatgccttt tgaggggaca ttctttttcc    274020
     catagccgcc gaagagtgca taaggcacgt gccatacata tcacatttga cgaataatat    274080
     gcgctgcgct tcgccaatac tttaaacctc tagccaggct atgctttggc gatgtttgca    274140
     gttctcaagg cgcttcgggt cgagcacgct tgatgctata gggtcgcaag cataagtcac    274200
     cgttcaaagg cataaacagt ctactgggac ctaccgggcc gaagccgata caaaacgctc    274260
     tcatattcac accgtaaagg gaaggcaatg cgctcacttg aacagcagat gagtgacagc    274320
     tcggggctcg ctcagcagct ctctgttcgg agaaatgatt actacgtact cagtgatatg    274380
     aagaccgaag caacaagaac gggcgggaaa aaacatttcc ggacgtggca aattttttct    274440
     ggttttcggg tggcgaataa ctcacttact aactcctatt tttattacgg gtggaagaag    274500
     gagctggtc