(data stored in ACNUC8465 zone)

EMBL: CU928166

ID   CU928166; SV 1; linear; genomic DNA; STD; FUN; 893706 BP.
XX
AC   CU928166;
XX
PR   Project:PRJNA12499;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Lachancea thermotolerans CBS 6340 chromosome B complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans CBS 6340
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-893706
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-893706
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   MD5; c7b5155b9e5d03f66e45fb32e3b1e73a.
DR   BioSample; SAMEA3138300.
DR   CABRI; CBS 6340.
DR   EnsemblGenomes-Gn; ENSRNA049515940.
DR   EnsemblGenomes-Gn; ENSRNA049573878.
DR   EnsemblGenomes-Gn; ENSRNA049573996.
DR   EnsemblGenomes-Gn; ENSRNA049574046.
DR   EnsemblGenomes-Gn; ENSRNA049574112.
DR   EnsemblGenomes-Gn; ENSRNA049574155.
DR   EnsemblGenomes-Gn; ENSRNA049574220.
DR   EnsemblGenomes-Gn; ENSRNA049574268.
DR   EnsemblGenomes-Gn; ENSRNA049574343.
DR   EnsemblGenomes-Gn; ENSRNA049574437.
DR   EnsemblGenomes-Gn; ENSRNA049574502.
DR   EnsemblGenomes-Gn; ENSRNA049574556.
DR   EnsemblGenomes-Gn; ENSRNA049574627.
DR   EnsemblGenomes-Gn; ENSRNA049574694.
DR   EnsemblGenomes-Gn; ENSRNA049574846.
DR   EnsemblGenomes-Gn; ENSRNA049574952.
DR   EnsemblGenomes-Gn; ENSRNA049575004.
DR   EnsemblGenomes-Gn; ENSRNA049575073.
DR   EnsemblGenomes-Gn; ENSRNA049575139.
DR   EnsemblGenomes-Gn; ENSRNA049575216.
DR   EnsemblGenomes-Gn; ENSRNA049575255.
DR   EnsemblGenomes-Gn; ENSRNA049575317.
DR   EnsemblGenomes-Gn; ENSRNA049575395.
DR   EnsemblGenomes-Gn; ENSRNA049575476.
DR   EnsemblGenomes-Gn; KLTH0B00638r.
DR   EnsemblGenomes-Gn; KLTH0B00660r.
DR   EnsemblGenomes-Gn; KLTH0B00726r.
DR   EnsemblGenomes-Gn; KLTH0B00748r.
DR   EnsemblGenomes-Gn; KLTH0B00792r.
DR   EnsemblGenomes-Gn; KLTH0B00814r.
DR   EnsemblGenomes-Gn; KLTH0B01012r.
DR   EnsemblGenomes-Gn; KLTH0B01254r.
DR   EnsemblGenomes-Gn; KLTH0B02068r.
DR   EnsemblGenomes-Gn; KLTH0B02112r.
DR   EnsemblGenomes-Gn; KLTH0B02552r.
DR   EnsemblGenomes-Gn; KLTH0B02838r.
DR   EnsemblGenomes-Gn; KLTH0B03718r.
DR   EnsemblGenomes-Gn; KLTH0B03960r.
DR   EnsemblGenomes-Gn; KLTH0B04158r.
DR   EnsemblGenomes-Gn; KLTH0B04202r.
DR   EnsemblGenomes-Gn; KLTH0B04840r.
DR   EnsemblGenomes-Gn; KLTH0B05566r.
DR   EnsemblGenomes-Gn; KLTH0B06842r.
DR   EnsemblGenomes-Gn; KLTH0B08184r.
DR   EnsemblGenomes-Gn; KLTH0B08602r.
DR   EnsemblGenomes-Gn; KLTH0B08778r.
DR   EnsemblGenomes-Gn; KLTH0B08910r.
DR   EnsemblGenomes-Gn; KLTH0B09988r.
DR   EnsemblGenomes-Gn; KLTH0B10362r.
DR   EnsemblGenomes-Tr; EFT00001979046.
DR   EnsemblGenomes-Tr; EFT00001979048.
DR   EnsemblGenomes-Tr; EFT00001979049.
DR   EnsemblGenomes-Tr; EFT00001979050.
DR   EnsemblGenomes-Tr; EFT00001979051.
DR   EnsemblGenomes-Tr; EFT00001979053.
DR   EnsemblGenomes-Tr; EFT00001979055.
DR   EnsemblGenomes-Tr; EFT00001979058.
DR   EnsemblGenomes-Tr; EFT00001979062.
DR   EnsemblGenomes-Tr; EFT00001979063.
DR   EnsemblGenomes-Tr; EFT00001979064.
DR   EnsemblGenomes-Tr; EFT00001979066.
DR   EnsemblGenomes-Tr; EFT00001979068.
DR   EnsemblGenomes-Tr; EFT00001979070.
DR   EnsemblGenomes-Tr; EFT00001979073.
DR   EnsemblGenomes-Tr; EFT00001979076.
DR   EnsemblGenomes-Tr; EFT00001979078.
DR   EnsemblGenomes-Tr; EFT00001979079.
DR   EnsemblGenomes-Tr; EFT00001979080.
DR   EnsemblGenomes-Tr; EFT00001979082.
DR   EnsemblGenomes-Tr; EFT00001979085.
DR   EnsemblGenomes-Tr; EFT00001979087.
DR   EnsemblGenomes-Tr; EFT00001979088.
DR   EnsemblGenomes-Tr; KLTH0B00638r-1.
DR   EnsemblGenomes-Tr; KLTH0B00660r-1.
DR   EnsemblGenomes-Tr; KLTH0B00726r-1.
DR   EnsemblGenomes-Tr; KLTH0B00748r-1.
DR   EnsemblGenomes-Tr; KLTH0B00792r-1.
DR   EnsemblGenomes-Tr; KLTH0B00814r-1.
DR   EnsemblGenomes-Tr; KLTH0B01012r-1.
DR   EnsemblGenomes-Tr; KLTH0B01254r-1.
DR   EnsemblGenomes-Tr; KLTH0B02068r-1.
DR   EnsemblGenomes-Tr; KLTH0B02112r-1.
DR   EnsemblGenomes-Tr; KLTH0B02552r-1.
DR   EnsemblGenomes-Tr; KLTH0B02838r-1.
DR   EnsemblGenomes-Tr; KLTH0B03718r-1.
DR   EnsemblGenomes-Tr; KLTH0B03960r-1.
DR   EnsemblGenomes-Tr; KLTH0B04158r-1.
DR   EnsemblGenomes-Tr; KLTH0B04202r-1.
DR   EnsemblGenomes-Tr; KLTH0B04840r-1.
DR   EnsemblGenomes-Tr; KLTH0B05566r-1.
DR   EnsemblGenomes-Tr; KLTH0B06842r-1.
DR   EnsemblGenomes-Tr; KLTH0B08184r-1.
DR   EnsemblGenomes-Tr; KLTH0B08602r-1.
DR   EnsemblGenomes-Tr; KLTH0B08778r-1.
DR   EnsemblGenomes-Tr; KLTH0B08910r-1.
DR   EnsemblGenomes-Tr; KLTH0B09988r-1.
DR   EnsemblGenomes-Tr; KLTH0B10362r-1.
DR   EuropePMC; PMC2765284; 19525356.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00488; U1_yeast.
DR   RFAM; RF00509; snosnR64.
DR   StrainInfo; 318472; 0.
XX
CC   The Lachancea thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..893706
FT                   /organism="Lachancea thermotolerans CBS 6340"
FT                   /chromosome="B"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0B"
FT                   /db_xref="taxon:559295"
FT   gene            complement(<1655..>3538)
FT                   /locus_tag="KLTH0B00110g"
FT                   /old_locus_tag="KLTH-ORF15985"
FT   CDS_pept        complement(1655..3538)
FT                   /locus_tag="KLTH0B00110g"
FT                   /old_locus_tag="KLTH-ORF15985"
FT                   /product="KLTH0B00110p"
FT                   /note="similar to uniprot|P25596 Saccharomyces cerevisiae
FT                   YCL073C and similar to uniprot|P36173 Saccharomyces
FT                   cerevisiae YKR106W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21365"
FT                   /db_xref="GOA:C5DC55"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC55"
FT                   /protein_id="CAR21365.1"
FT                   /translation="MIRVASTIKILRSINTNHKMITGGIKAYELKEEKFDVTEHDIESV
FT                   ADSNKSSKLGSGFLKVKEMEIMSSTCSGKSARAALLASAFLCGFGYYLDYITRSVYTGY
FT                   ATSSYNEHALLSTIQVINSVISIAAQIIFAQLSDIFGRLQLFLVGTVLYIVGTIIQCEA
FT                   RDIRTYAVGAAFYNSGYVGVSILLIIVLSDLSPSKWRLLFQFATSWPCIIICWISGDIV
FT                   QSANPAKNWRFDIGMWAFLFPISALPFIIFLLYFTRQASKTAEWKEIQGDNKEPSVRIV
FT                   YWIKSIYSNIDVVGTSLVTVSLGCILVPLTLAGGISDDWNKPGIIATIVVGFVSFMFFL
FT                   AWDIKFAKNAVLPFKLLKDRGVWASLAAALLEKLIYATISDYLYPVLLVSVNESSKSAT
FT                   RILWLPTFVACTGSIFFGLLVVRTKRLKIYSIIGVCLWILSIGLFYHYRGGASSHSGII
FT                   GASVVLGTGSAIFTQSLIVNLQTMTSHKNMASITGLYFMFAQIGSASGASISGAIWTQT
FT                   MYKQLYKRLEDSSLAATAFSSPYEFIELYPWGTPERTQMIYAYREVQKKTMLVSLVLTG
FT                   PLFLLILFTKDRKLGDNVTAETTQSDEDPMLTWILKRFNKIKAGWKQKSQS"
FT   gene            <4664..>6370
FT                   /locus_tag="KLTH0B00132g"
FT                   /old_locus_tag="KLTH-ORF15981"
FT   CDS_pept        4664..6370
FT                   /locus_tag="KLTH0B00132g"
FT                   /old_locus_tag="KLTH-ORF15981"
FT                   /product="KLTH0B00132p"
FT                   /note="similar to uniprot|P36172 Saccharomyces cerevisiae
FT                   YKR105C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21366"
FT                   /db_xref="GOA:C5DC56"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC56"
FT                   /protein_id="CAR21366.1"
FT                   /translation="MTEIETGQNSEYNRKISDETKDLSVKQSACIAPDASKRNRVKLFL
FT                   SLLSLGLSMFVTALDVLIVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSA
FT                   VLGPRISVISCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNE
FT                   KSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTWRWCFYINLPIGGLAIAIFIFFYNPE
FT                   GADLLEKGSQTFKKLLSYRRANLSLKQLLDQLLFGFDIVSFVLFTAGWLLFLLALTFGG
FT                   QTHPWKSGIVISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRPLLSWHLMSQRAILNAN
FT                   FTGFFSTIAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGVIIKKTGH
FT                   IKPLLVFGSAMGVLGSGLMILLNNTSTKHTQIGVLILPGVALGFVLPAALITCHVQLDR
FT                   TSPSYGADMLETTSVNALLKSLGTTVGSILSTMVFSTSLHNKMKNSNILFEVSGELDSI
FT                   ASYRLDHFDGPRSEMGCMLNDSIRNTFWMALGSSVVAFLCSLLVSRRKVSM"
FT   gene            complement(<7385..>9055)
FT                   /locus_tag="KLTH0B00154g"
FT                   /old_locus_tag="KLTH-ORF15979"
FT   CDS_pept        complement(7385..9055)
FT                   /locus_tag="KLTH0B00154g"
FT                   /old_locus_tag="KLTH-ORF15979"
FT                   /product="KLTH0B00154p"
FT                   /note="weakly similar to uniprot|P38090 Saccharomyces
FT                   cerevisiae YBR132C High affinity polyamine permease,
FT                   preferentially uses spermidine over putrescine; expression
FT                   is down-regulated by osmotic stress; plasma membrane
FT                   carnitine transporter, also functions as a low-affinity
FT                   amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21367"
FT                   /db_xref="GOA:C5DC57"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC57"
FT                   /protein_id="CAR21367.1"
FT                   /translation="MSKKENFELAVTTLEEGETTTIHDVGAETIRSLEGQAPSLEERIA
FT                   RRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMCVM
FT                   VTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDKIPKA
FT                   ALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGF
FT                   KNWSNPGAFAEYISKGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPSSF
FT                   RKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLPH
FT                   IVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKITKRGVPIYCCVAVLLVCGL
FT                   AYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFL
FT                   PYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFV
FT                   KPVEMDLFSGIAELAEEDAYWEENPPKMNLLDKAFGFIL"
FT   gene            <10791..>12137
FT                   /locus_tag="KLTH0B00176g"
FT                   /old_locus_tag="KLTH-ORF15977"
FT   CDS_pept        10791..12137
FT                   /locus_tag="KLTH0B00176g"
FT                   /old_locus_tag="KLTH-ORF15977"
FT                   /product="KLTH0B00176p"
FT                   /note="similar to uniprot|P10356 Saccharomyces cerevisiae
FT                   YER152C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21368"
FT                   /db_xref="GOA:C5DC58"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC58"
FT                   /protein_id="CAR21368.1"
FT                   /translation="MKSIINLFKGYASHDLLPRKDIIEATSEVLQPEVREYDYNDEDRH
FT                   PLVYGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNILVQTTL
FT                   PHTGYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSAN
FT                   GEREQKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDI
FT                   LIISDDVYDLLRLDDDNGSGALIPSPPELRFPHLDRESISAANTFGNTISNCTFSKIIA
FT                   PGLRTGYQETANANLATQLASGGANVSGGTPCQLNSMIVATMIKNGAVERIVHNFVSVL
FT                   RERAMVLAESIKLYLPKGTQYSECKGGYFSWCTLPVGYDSSKIVEEVSHEGVLLADGSH
FT                   FEVSGDKRNWGERSVRLSISYVTAAEIQEAVKTWGQFCEKHRYLSSKGS"
FT   repeat_region   14631..15046
FT                   /locus_tag="KLTH0B00198t"
FT                   /old_locus_tag="Klth0B.LTR.1"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            complement(<17460..>18851)
FT                   /locus_tag="KLTH0B00220g"
FT                   /old_locus_tag="KLTH-ORF15975"
FT   CDS_pept        complement(17460..18851)
FT                   /locus_tag="KLTH0B00220g"
FT                   /old_locus_tag="KLTH-ORF15975"
FT                   /product="KLTH0B00220p"
FT                   /note="highly similar to uniprot|P07991 Saccharomyces
FT                   cerevisiae YLR438W CAR2 L-ornithine transaminase (OTAse)
FT                   catalyzes the second step of arginine degradation
FT                   expression is dually-regulated by allophanate induction and
FT                   a specific arginine induction process not nitrogen
FT                   catabolite repression sensitive"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21369"
FT                   /db_xref="GOA:C5DC59"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034758"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC59"
FT                   /protein_id="CAR21369.1"
FT                   /translation="MILARGKVAGLRRVFHHGGAFLASSQAFKMSTLNTDLSSETTVQY
FT                   EKAYSAHNYHPLPVVFQKAKGAKVWDPEGKQYLDFLSAYSAVNQGHCHPDIIAALVDQA
FT                   SKLTLSSRAFSNNVFSAFAKFITEYFRYESVLPMNTGAEAVETGLKLARRWGYMKKGIP
FT                   ENEAIILGAKDNFHGRTLGALSLSTDEEARKFFGPFLESITAKIPGTDGQYLRYGNIED
FT                   VELAFKNAGDRIAAILLEPIQGEAGIVVPPVEYLQKVQELCRKYNVLLICDEIQTGIAR
FT                   TGKMLCYEHSPNVKPDVILLGKAISGGILPVSCVLSSKEIMGCFEPGSHGSTYGGNPLS
FT                   SRVAIAALEVVKKENLVERAKTLGEFFQSELKKLQQEAGGIISDVRGRGLLTAIVIDPS
FT                   KSNGRTAWDLCLLMKDQGVLAKPTHDHIIRLAPPLVISKEDLMKGVEAIRASLKLLPNA
FT                   AKSNH"
FT   gene            <21501..>22836
FT                   /pseudo
FT                   /locus_tag="KLTH0B00242g"
FT                   /old_locus_tag="pseudo-Klth0B-21501-22836"
FT   gene            <23546..>24871
FT                   /locus_tag="KLTH0B00264g"
FT                   /old_locus_tag="KLTH-ORF15969"
FT   CDS_pept        23546..24871
FT                   /locus_tag="KLTH0B00264g"
FT                   /old_locus_tag="KLTH-ORF15969"
FT                   /product="KLTH0B00264p"
FT                   /note="highly similar to uniprot|P40896 Saccharomyces
FT                   cerevisiae YJL213W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21370"
FT                   /db_xref="GOA:C5DC60"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC60"
FT                   /protein_id="CAR21370.1"
FT                   /translation="MQLTAIDVNERNNKSLEDLVTPWKIPPLKDYYIKNANLVDVREGI
FT                   TKPGAHIFTSGGFITNICFSDHEADKCTSDKFEIIDATGKFVMPGLFDNHVHVTSVPGE
FT                   TDLSKTLNMPKTRALMRVRHKLEGALARGFTTLRGCGGAESYIKAAVIEGSVIGPRLLT
FT                   CGHAISQTGGHGDMRPADLPGEAFDSCSCHMNDLGVVADGAAECYKVAREELRRGADFI
FT                   KIMAGGGVASPTDKITNLQFCDDEVTALVKVAKTYNTYVTAHAYTPEAIKACVSYGVKG
FT                   IEHGNLLDEETAQLMAKAGCYLTPTLVTYKIMASDQFSTFLSGSNREKNTQVLYRGIEA
FT                   LRIAKKNGVKICYGSDLLGSLGGYQTQEFFIRGRYLSTHEVLLSATITPAEMNGLQDQI
FT                   GEIKPGFIADMLLMNSNPLENITVLDEPESNLVFVMKEGRVY"
FT   gene            <25467..>26243
FT                   /locus_tag="KLTH0B00286g"
FT                   /old_locus_tag="KLTH-ORF15967"
FT   CDS_pept        25467..26243
FT                   /locus_tag="KLTH0B00286g"
FT                   /old_locus_tag="KLTH-ORF15967"
FT                   /product="KLTH0B00286p"
FT                   /note="similar to uniprot|Q12288 Saccharomyces cerevisiae
FT                   YLR126C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21371"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC61"
FT                   /protein_id="CAR21371.1"
FT                   /translation="MSKIAILNANPPQEALKRWGSFADMAIEMFEATKASFLNSTVEYE
FT                   VYNVYEKDFPTVLELCNGDYLGLHITGSTSDAYAIDIEWVNILRKLLQNLLKNGAHPPI
FT                   SGICFGHQILASALGSEVRRNPKGYEGGITRLEITKEALKLGLFQNSTSPLPSCEFYAS
FT                   ESHSDFVKNVPHGYINTLTSKKCDVQGLYKRNVALTFQCHPDFISEVCIKCNEGTYSRG
FT                   EINADELAHMKESGRQRNNDGRFFATYIWMLFTNVL"
FT   gene            complement(<26947..>28719)
FT                   /locus_tag="KLTH0B00308g"
FT                   /old_locus_tag="KLTH-ORF15963"
FT   CDS_pept        complement(26947..28719)
FT                   /locus_tag="KLTH0B00308g"
FT                   /old_locus_tag="KLTH-ORF15963"
FT                   /product="KLTH0B00308p"
FT                   /note="highly similar to uniprot|P53051 Saccharomyces
FT                   cerevisiae YGR287C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21372"
FT                   /db_xref="GOA:C5DC62"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC62"
FT                   /protein_id="CAR21372.1"
FT                   /translation="MVSMPNHPETEPKWWKEATVYQIYPASFKDSDNDGWGDMKGIYSK
FT                   LDYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFKVIEKTHKLGMKF
FT                   ITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDKNGAPIPPNNWKSYFGGSA
FT                   WTFDEKTQEFYLRLFASTQPDLNWESEECRKAIYESSVGFWLDHGVDGFRIDVGSLYSK
FT                   VPGLPDAPIVDKDSEWQSSDPLTLNGPRIHEFHQEMNKFMRDRVKDGREIMTVGEMQHA
FT                   PNEVKKMYTSASRHELGELFNFSHTDVGTSPLFRYNLVPAVLKDFKVSLAELFEYINGT
FT                   DCWSTVYLENHDQPRSITRFGDDSPKYRVVSGKMLSVLLTALTGTLYIYQGQELGQINF
FT                   KNWPVEKYEDVEIRNNFRVIKEEHGENSVQMKKFLEAVALISRDHARTPMQWSGEEPNA
FT                   GFSGPDAKPWFYLNESFREGINVETEEKDPDSVLNFWKKALKFRKEHKDIAVYGYDFEF
FT                   VDLENKKLFSFTKKYGKKTMFTTLNFSSDEVDFEFPNDVSYSLAFGNYDEGQVDASSKT
FT                   LKPWEGRIYINESA"
FT   gene            <29891..>31591
FT                   /locus_tag="KLTH0B00330g"
FT                   /old_locus_tag="KLTH-ORF15955"
FT   CDS_pept        29891..31591
FT                   /locus_tag="KLTH0B00330g"
FT                   /old_locus_tag="KLTH-ORF15955"
FT                   /product="KLTH0B00330p"
FT                   /note="highly similar to uniprot|P54862 Saccharomyces
FT                   cerevisiae YOL156W HXT11 Putative hexose transporter that
FT                   is nearly identical to Hxt9p, has similarity to major
FT                   facilitator superfamily (MFS) transporters and is involved
FT                   in pleiotropic drug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21373"
FT                   /db_xref="GOA:C5DC63"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC63"
FT                   /protein_id="CAR21373.1"
FT                   /translation="MSEPGVKLDRVSSNPVEGSTKPGSISSHEKLDIEREKDLHNFPPH
FT                   ENDIELPKQPLSHYFSISILCLMIAFGGFIFGWDTGTISGFVNLSDFVRRFGSRNSKGV
FT                   YYLSKVRMGLIISIFNIGCAIGGIVLSKIGDVYGRRIGLISVTIVYVIGIIIQISSTDK
FT                   WYQYFIGRIISGLGVGGIAVLSPMLLSEVSPKHIRGMLVNLYQLLGTMGIFLGYCTNYG
FT                   TKKYTDSTQWRVGLGLCFAWAMLMISGMLFVPESPRYLVEAGKLEEAKRSLSRSNKVLI
FT                   DDPAIAAELDAISAGVESERLAGDATWGELLSTKTKVIQRVIMGIMIQSLQQLTGDNYF
FT                   FYYGTTIFKSIGLEDSFETSIIIGAVNFFSSFIAIYTIERFGRRTCLLWGAASMFCCFI
FT                   VFASVGVTKLWPEGPDHPGISSKGAGNCMIVFTMFFIFSFATTWAGCCYVIVSETFPLR
FT                   VKSKGMALSTAANWMWGFLISFFTPFITGAINFYYGYVFMGCLIFAYFYVFFFVPETKG
FT                   LTLEEVDIMWLESVPAWNSSSWVPPTRRSADYVVDTSSKNFFSKFFSKN"
FT   gene            complement(<31952..>34756)
FT                   /locus_tag="KLTH0B00352g"
FT                   /old_locus_tag="KLTH-ORF15954"
FT   CDS_pept        complement(31952..34756)
FT                   /locus_tag="KLTH0B00352g"
FT                   /old_locus_tag="KLTH-ORF15954"
FT                   /product="KLTH0B00352p"
FT                   /note="weakly similar to uniprot|P25611 Saccharomyces
FT                   cerevisiae YCR106W RDS1 Regulator of drug sensitivity
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21374"
FT                   /db_xref="GOA:C5DC64"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC64"
FT                   /protein_id="CAR21374.1"
FT                   /translation="MEHQHPIKIQKRNRPSFVCQECRRRKIKCDKKRPRCSRCVDTGLP
FT                   CTYLASGSRSAADWHISGDETSIWTGESVTTTESRTPGESGAATSEAHSEALGDEQLAL
FT                   PQASTRCRCSCGSCCGYGTTFAYADGSGRRAPTSASAHEIYVNFGNPEDTMVAHEQMRY
FT                   LHKPFSALAMMQRDHFLRAFAGSVTGVILTGMHSAPANGNPESFTYDGKLNSRQDSNNE
FT                   GRGTQEIPVNVFMEEIKKTNMLMNRRRAGNDLIKLVFFQNPWSFDDNVGSTSAYPAELV
FT                   SLVTNIQDILPDVAALRFLLDCFYEAVYPLHPFLDVPSFEKVLSEVLKARSDGSQRYNI
FT                   MLGTSALHNKLENLAILLVVLKISQAALNMQQDPLKSATAKKLDIFGHNNIKDDVIILA
FT                   QKCLNALNFLRLPNENTFCCLLFLWIYQSYDLDDVNFSLPPHVALVLGTLSHLSVILGL
FT                   HNDPSMYPRLVESSQFHSSFLNYRRKLWMGVVSVRTNELLLNGNSLESTHALMSSFLKR
FT                   GREDKESYMSSVIQDEGQENSFDTRLHEFAHKEYELRRIWTKLNSACNSLDKPILLSEI
FT                   EIIISRAEITLSQLFPLTDITEISSFSCPEKGTVKCAESKAEIDYNAIRACKTYANNLR
FT                   GRIIILNISMALTVHFENLCRNEPDRYLEYYRKYLKLTFRRSLEIVKLLKKLPDNMEKN
FT                   SLFSRYKYALTRITLDSVLRTLIPMCSILFKLSFAERQLKMSVKSERVLYEKDDHSDSS
FT                   HSLQMIVNVKESLAQALRSLISLQSTNWGLGFLSCYRLVCMAKYVLHLVDIDMLPEVTN
FT                   RFWEYEKNYKQVPESIANRIFLKWGLKFKESKAIKDDLFNPNVLGAMDSDLLESFKTIL
FT                   ESLELWKLTENTPEVNDVSSLSDRNEQLSEEVAEDAQGFSLDILDYFKVFEDEYSGESF
FT                   PSIF"
FT   gene            complement(<36075..>37979)
FT                   /locus_tag="KLTH0B00374g"
FT                   /old_locus_tag="KLTH-ORF15952"
FT   CDS_pept        complement(36075..37979)
FT                   /locus_tag="KLTH0B00374g"
FT                   /old_locus_tag="KLTH-ORF15952"
FT                   /product="KLTH0B00374p"
FT                   /note="similar to uniprot|Q08989 Saccharomyces cerevisiae
FT                   YPL277C Hypothetical ORFs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21375"
FT                   /db_xref="InterPro:IPR038921"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC65"
FT                   /protein_id="CAR21375.1"
FT                   /translation="MQTRRLSFLVAAGGILVLLVFSSSRLFQTNDILSSLTSPAKTSEE
FT                   TSTAVSLIRWDNYLDYTRKLDFENSTALFNSVRAALRQSSSDIHPVGVSYFPAVIPQGT
FT                   LMYHAGSKVPTTFEWLAMDHEFSYSFGLRSPSYGRKSLQKRRGGPGRGPGGDKKPGGSN
FT                   TSVNTPDKPSRGPGLTSSQKMLTYRATRDLNKFLYLDGASAAKTETGEMDTQELLSNVA
FT                   EKKLNLSGDGENGGMQERIFAARICEWGKPFGLDGIIRVEVGFEVVLCNFSSSAVELVS
FT                   ALELVNPSEHLGLPPPSVISKENGWPLDDDGNLIEEDLTDEQKALLDKEDSWQQVLENF
FT                   YGVKSFNWLRAGAVHDKGERRIQLDYRHLVTGINRTVINPDPNNRRLLNDGTSWENQLK
FT                   IVEDLEQVLSIGFDASQSTDWQIVFDEVVDKFAPILRMLSGILQRDDSSSENIAINATA
FT                   ITLNFSLRFKAKDDVKNQYGNDREFAVYQYVRPLKDLRTNSDFLVWSASVNVVRKVVDA
FT                   IYDVNELLLPIVRSHMGKESGASIEAAQAVTRAQQEIDDLIEDLGWIELHYRCEKVCKW
FT                   DEICYTPSWGPSPMGMTVPGSPNAGTGTHYDADRQRLVIDSALRCLSLNELLGNRGHF"
FT   gene            complement(<38234..>42757)
FT                   /locus_tag="KLTH0B00396g"
FT                   /old_locus_tag="KLTH-ORF15949"
FT   CDS_pept        complement(38234..42757)
FT                   /locus_tag="KLTH0B00396g"
FT                   /old_locus_tag="KLTH-ORF15949"
FT                   /product="KLTH0B00396p"
FT                   /note="similar to uniprot|P32386 Saccharomyces cerevisiae
FT                   YLL048C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21376"
FT                   /db_xref="GOA:C5DC66"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC66"
FT                   /protein_id="CAR21376.1"
FT                   /translation="MMQFATETEKLRSTVAFLYSFLVPLSGGSFVLLGWDLLRLYWASQ
FT                   RNACGYEAPEADASTSLISRKPEHQITEHASSYPQLEWRVLCESSQQDCEQVVKKVFGK
FT                   ELLKSYAELLTIILCIVLELSLQRAVNRTQEEAPWILSSQIFWFSLLVSSLCRIVSLHR
FT                   GGKSFITFQKLRALNFLLFGFIFCVKVLHFTLVFLRSQVKSLEGKYVTGGTFLAGVLSI
FT                   LALSSQQSFGLTDPPLNQNDAPPAPEGSSSIFHSLTFSWLDGLIFRRSQKQLRFQDIFD
FT                   LQPKYRTLPVIKRYSDRSHGCTSLIKRLTAFCWKSIIMQCTWSLAGAIASFMPTLQMKK
FT                   ILEYIENPSGSNIRVAWVCVFVMIVSKIIAALCESQAVYLGARVCFQLKSIITAEISRK
FT                   ALKQSLFSSESKTRCGATNGEVINLVAIDSTAVSELCGSLHYLVQAGIMTTVAISLLYQ
FT                   MLGWSAFVGVSVIIILLPFNVKIATLMQTYQSEALAMTDKKTNAISAMLGSIKNVKFLC
FT                   WENHFQELIMGFRSSECSFLTKKLFCWATLHLVWFLTPTLVTAATFGASIYLQKQKITV
FT                   ASAYTALTLFALLRNPLTQLATMLGTIIQTTVSIQRIEKFLNRSNTKKHEILKDSFTEM
FT                   GFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGSI
FT                   RVPRGYMHDDRCSFAFCSQTPWITNATVKENIVFSSQFNTKRYQEVLHACGLEEDILEM
FT                   QEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVDPGMAVWIFQKCIM
FT                   GPLMKGKTCILATHNIALVQKHADMIILLDNGRVSKIGKARDFNFDSEFDYSKPSKLEK
FT                   AEMKPNKKPKKEMILQPDTGFSREEHKEDGSIKIEVYNWLVKHLGGWRTITAFTMLLCL
FT                   THGIEMTQNLWIKIWCSSGDGANEHYKSSIYYLSTYAAIGLFHASVTTLIMLKFLCIGL
FT                   EASSKVFAEILNRVLHAKMTFFDFTPAGRILNRITRDFEILEQELMVLLLQLLFAITSL
FT                   GAILLLISVIATKFLIFAFLLGIIYAVMITSYIPAFRDLKRYEGITRSPIFEQFSELLS
FT                   GFVTIRGFGKEKSCMGQLFRKLDLNNRPAYYVSVVQLWLCLRVEVLGSLVLGATATLSL
FT                   LNAKELGAGLAGLALTYAMPFSQSALWTATVSSNVEIKMTSVERIKEYTEIDCEDTKAG
FT                   ALINTQWSGGAEISFDHVYVRYAPHLPDVLKNVSFTLLPNSKVAIVGRTGSGKSTVMMS
FT                   LFRLIELTNGTIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFGRYSDQE
FT                   LTHFARRIGLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDE
FT                   ATASIDHETDATIQQVVRDFSSGGIVITVAHRMSTIIDYDQVIVLDSGIVKENNHPYLL
FT                   LKQNGAFHQMCKESGEYERLEDAAKKAYQKGLSQARSAPRNSESKC"
FT   gene            complement(<44522..>46297)
FT                   /locus_tag="KLTH0B00418g"
FT                   /old_locus_tag="KLTH-ORF15941"
FT   CDS_pept        complement(44522..46297)
FT                   /locus_tag="KLTH0B00418g"
FT                   /old_locus_tag="KLTH-ORF15941"
FT                   /product="KLTH0B00418p"
FT                   /note="highly similar to uniprot|P43550 Saccharomyces
FT                   cerevisiae YFL053W DAK2 Dihydroxyacetone kinase required
FT                   for detoxification of dihydroxyacetone (DHA) involved in
FT                   stress adaptation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21377"
FT                   /db_xref="GOA:C5DC67"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012734"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC67"
FT                   /protein_id="CAR21377.1"
FT                   /translation="MSQKQFKSDGNIVAPYLLGLARSNPGLTVIEHDRVVFRAASAPSA
FT                   KNKPKVTLVSGGGSGHEPTHAGFVGDGALDAIAAGAIFASPSTKQIFSALKAVESPKGT
FT                   LLIVKNYTGDIIHFGLAAERAKAAGMNVELVAVGDDVSVGKKKGSLVGRRGLGATVLVH
FT                   KIAGAAASHGLELSEVAKIARAVVENSATIAGSLDHCTVPGHKPENNLGPDEYEIGMGI
FT                   HNESGTERRSPLPSIPQLVTELLPLVLGEKEDNTFVEFSPEEDVVLMINNMGGMSNLEL
FT                   GYATEVVSEQLIKKFSIVPKRTMSGTFITALNGPGFGITLLNASKAGPDIMRYFDYPTN
FT                   ASGWNQNYHSAQEWKVLAGGKVPTAPPLETVKNEKPSGVTANYETFSKILQSGIAKVKE
FT                   VEPKVTWYDTIAGDGDCGTTLVSGGRALEEAIQKHTLRLTDAAHGIEDIAYIVEDSMGG
FT                   TSGGLYSIYLSALAKGISDSGDKTLTVDTFREASKTALDALYKYTRARPGYRTLIDALQ
FT                   PFVEALNSGQDPRTAVDAAFKGAEKTRKMDALVGRASYVAKEELSKLDDEGGLPDPGAV
FT                   GLAALLDGLVSAAGY"
FT   gene            <46950..>48908
FT                   /locus_tag="KLTH0B00440g"
FT                   /old_locus_tag="KLTH-ORF15939"
FT   CDS_pept        46950..48908
FT                   /locus_tag="KLTH0B00440g"
FT                   /old_locus_tag="KLTH-ORF15939"
FT                   /product="KLTH0B00440p"
FT                   /note="similar to uniprot|P43549 Saccharomyces cerevisiae
FT                   YFL054C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21378"
FT                   /db_xref="GOA:C5DC68"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC68"
FT                   /protein_id="CAR21378.1"
FT                   /translation="MVGESIMPSSSSSSSISSSSSDVPRATREQRGREGETEQVKWSGN
FT                   LKDSSQKTKRGDRTSVDVGVARGVSSGRKATHTEGTKNVLSRLTPLNKPAAEDAQPRHQ
FT                   KRHPVGTAFSSPNLKSLNTPLSREQARLMEYYLSTAVPRSNNNYVDPLYRHLNPSVGST
FT                   KSRPVWSLNQPLPHVLDHSLAEKMLKKNTDVKSRASSRPESREMSRAGSLASMNDWKKL
FT                   IGRSGSWRKLNDVEAQIPGATKNSGLTRNRKHSQSQIEFANNQRRAHHAASFQLGDESC
FT                   TPSLRGEDVPAQIQNQKQAGTAPTAEELLEKRFRSSLDGATPLDGGRLGTGDSESEQLA
FT                   FTNYWAKIRYRLREPFAEFLGTLILVIFGVGGNLQATVTNGSGGSYESLSFAWGFGCML
FT                   GVYVAGGVSGGHINPAVTISMAIFRKFPWKKVPVYIFAQIVGAFFGGAMAYGYFWSSIT
FT                   EFEGGTHIRTAASGACLFTNPKSYVTWRNAFFDEFIGASMLVGCLMALLDDSNSPPTNG
FT                   MTALIVGFLVAAIGMALGYQTSFTINPARDLGPRIFASMIGYGPHAFHLTHWWWTWGAW
FT                   GGPIAGGIAGALVYDIFIFTGCESPVNYPDNGYIEHRVSKILHAEFHPHDSPKSSEVVV
FT                   EEGSNSKDGSTKSNSAH"
FT   gene            complement(<49413..>51011)
FT                   /locus_tag="KLTH0B00462g"
FT                   /old_locus_tag="KLTH-ORF15936"
FT   CDS_pept        complement(49413..51011)
FT                   /locus_tag="KLTH0B00462g"
FT                   /old_locus_tag="KLTH-ORF15936"
FT                   /product="KLTH0B00462p"
FT                   /note="weakly similar to uniprot|P38866 Saccharomyces
FT                   cerevisiae YHR176W FMO1 Flavin-containing monooxygenase,
FT                   localized to the cytoplasmic face of the ER membrane;
FT                   catalyzes oxidation of biological thiols to maintain the ER
FT                   redox buffer ratio for correct folding of disulfide- bonded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21379"
FT                   /db_xref="GOA:C5DC69"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC69"
FT                   /protein_id="CAR21379.1"
FT                   /translation="MTKDARKEIKSVAIIGAGVAGLTSLFELLNTRKDGTTNLAYSSDG
FT                   KFDEANTNENKNPAFQKIVGFELKSSIGGIWSPNFDTPDFIEQKDLDSERYDDPLFLRP
FT                   PTEAPSELYNRGYTFSEPLITERPDTPSPKTWAASGIYQHLYSNVPQRYLRNSFIPYSE
FT                   NQEKQNSNIAPLITNYSITESLLDFAKTHRLEKHIRVNSEVVKIKKVSNGSWRLTVKEN
FT                   PKNSSLTRWYEEDFDAVLVSNGHYSIPYIPRIEGLSKWVARYRDSVLHSKSFREFDKFK
FT                   NKRCLFVGTGLSGIDILQYVFPVAKEVIVSRTPDKEEIYPWLTKAATSEGLIKKPRIKE
FT                   LRPSENRKVIFQDGSIVEGVDHIIFSTGYHWHYPFLNEGVSGLSVIKSGQKVLKDSASM
FT                   VDGLFLDTFSIDDPSLAFVGVTVTPLKWPSFELTASAIAGVWANASSLPSKDSQLSAIS
FT                   QRKKEMGENLLFHYFPPMHIKELMARLEHFLPKGRKAADIIDLKHLSDFEKAAEVAERL
FT                   FYLLKNEEIELSETL"
FT   gene            complement(<51712..>53412)
FT                   /locus_tag="KLTH0B00484g"
FT                   /old_locus_tag="KLTH-ORF15934"
FT   CDS_pept        complement(51712..53412)
FT                   /locus_tag="KLTH0B00484g"
FT                   /old_locus_tag="KLTH-ORF15934"
FT                   /product="KLTH0B00484p"
FT                   /note="weakly similar to uniprot|Q12300 Saccharomyces
FT                   cerevisiae YDL138W RGT2 Plasma membrane glucose receptor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21380"
FT                   /db_xref="GOA:C5DC70"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC70"
FT                   /protein_id="CAR21380.1"
FT                   /translation="MTVEEKLNGEVTEVGDVASSDQSIKVAAVFKEYEPEKEVLSEVDQ
FT                   IIREYELEDHRELLTRGALWANNPGILETESYSDEDRRVAKQAQERPLSSLSKHMLLAA
FT                   LCTSCAAINFGMDESAIGGAVLQYQKQFNITDPNIQGLTVAAPYLAAACLGSPLTIYLD
FT                   NYVGRKWIVFLSCFIGFAGSLIQGFSNGLGCLLFARLFLGIGMGLNSSTVPIYTAECSP
FT                   AISRGAILMLWQTFIALGVCLGSVFNRAFVNISGSLSWRLMIGSSAVAPFVTGILIFFP
FT                   PESPRWLIAHGKTRESLYSLMKLRPHELSGARDFYILHQSLKFESELENQLSSWQQFLS
FT                   LFTNRRNRFALIVSLIGILGQQYGGVNILVSYTTTILTNAGVDSVTAIAGSIGIGGGCF
FT                   LATFLSTQLIDRFGRRKMLLFTLPMEALCLFWLGGVLNVNDAQSRLGAGLASMYVYVLF
FT                   YGAGIGPVSFTLVAETSSITVRMAHSATCMFVNWILDFCLSMTWPKMESSMTASGGLYF
FT                   YGAFNIVVWILTFLCIPETMRFTLEQLDEIFKVGVSAHIKKSLHRIVRN"
FT   gene            complement(<53662..>54858)
FT                   /locus_tag="KLTH0B00506g"
FT                   /old_locus_tag="KLTH-ORF15932"
FT   CDS_pept        complement(53662..54858)
FT                   /locus_tag="KLTH0B00506g"
FT                   /old_locus_tag="KLTH-ORF15932"
FT                   /product="KLTH0B00506p"
FT                   /note="weakly similar to uniprot|P53912 Saccharomyces
FT                   cerevisiae YNL134C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21381"
FT                   /db_xref="GOA:C5DC71"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC71"
FT                   /protein_id="CAR21381.1"
FT                   /translation="MYKRKLESVDVGSILVSQMQERHLKRISIRSGPLIGVEAPLPLFQ
FT                   QAAVVKSFEEEIIVSDQIPVPQRLEDHEILIRNKYTGLNHVDWKSKKYRFNIHSFPWIN
FT                   GRESSGIVVRRGAKVDRDRFPIGAEVFLASTCYRELKTSTFQEFTVFDSRLVWRLPREI
FT                   LPDGTTRKRFGLDFAAGVGVPLVTAGSALSSFVDFNEIGKADQGRSLVVWGGSSSVGIF
FT                   TIQLARNLGIFKNIIAVSSLRYEDYLKELGATAVIDRTLPSEELVQKFQELCPTGVDYG
FT                   VDVISKKTAELVLEILKDGKGTKKSLVCLSGAPGEDVRAKYPDIKVEAVGIKRFHEDLV
FT                   FGETFVKFTSDLFEKGQLNPVRSVKVFKGFEKFGVGLRNGLKELEERGSSAEKFVVRL"
FT   gene            <55345..>56889
FT                   /locus_tag="KLTH0B00528g"
FT                   /old_locus_tag="KLTH-ORF15928"
FT   CDS_pept        55345..56889
FT                   /locus_tag="KLTH0B00528g"
FT                   /old_locus_tag="KLTH-ORF15928"
FT                   /product="KLTH0B00528p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21382"
FT                   /db_xref="GOA:C5DC72"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC72"
FT                   /protein_id="CAR21382.1"
FT                   /translation="MTIDHTAKRSSELEVGNAKRAQLTSPKRKNLIVNAFIMGSAGNQS
FT                   VGIWKHPQDKSAELYQSPEYWINLAKLLERGKFNAVFLADVLGPYDVYKGPANVGPVAK
FT                   AGSQWPISDPSYFIPLMAAVTTKLAFGMTISTISEQPYHLARRLGTLDLLTNGRVGWNI
FT                   VTSYLDSASRNLLDGKNLPPNEERYARAGEYVDVIYKLFLSSWRDESFKADKKTGVFTD
FT                   PEGLRHINHVGKYFNVPGPAITHPSQQKLPVIIQAGTSAKGKDLSAKNAEVVFLASLTP
FT                   EALGASIKEIKQIATTKYHRNPSKIKFIGLVTVILGDTHEEAENKYNEYKANYSDEEGA
FT                   KAMFSGWTGVDIDKFEDDEVLSNVDHIAIASAVKKWQTAYPRVEKWTKRAIIDEIKVGG
FT                   SGPVLIGTPQEVASEIQNWVDISDIDGFNFAYTVLPQSFEEIIDKLLPELEKLGLFWHD
FT                   YPNASDSSKYLTFREQLFGEPSLDKTHPASDLRWKADETREAYEARIGEALKKLVL"
FT   gene            complement(<57160..>59163)
FT                   /locus_tag="KLTH0B00550g"
FT                   /old_locus_tag="KLTH-ORF15926"
FT   CDS_pept        complement(57160..59163)
FT                   /locus_tag="KLTH0B00550g"
FT                   /old_locus_tag="KLTH-ORF15926"
FT                   /product="KLTH0B00550p"
FT                   /note="similar to uniprot|P33413 Saccharomyces cerevisiae
FT                   YHL016C DUR3 Plasma membrane urea transporter expression is
FT                   highly sensitive to nitrogen catabolite repression and
FT                   induced by allophanate the last intermediate of the
FT                   allantoin degradative pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21383"
FT                   /db_xref="GOA:C5DC73"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC73"
FT                   /protein_id="CAR21383.1"
FT                   /translation="MSEFVLNQGYGYGIVLGLGALFSVLMIALSWAIAKFLNQKQDSER
FT                   FTTASRNVKQGLISSAVVSSWTWPATLLTSNLWTYSYGIVGAYWYSVTGCFQILVFTLV
FT                   AIEIKLKCPGIHTIAEVAKVRFGKWGHFCYLFYSLGTNVIVSGMILLGGSQGIAYTTGM
FT                   NIIAACFLLPVSVCIYTLFGGLQATFLSDWSHTIVIYIMVIVSIVTVYCTSDLIGSPDK
FT                   MYDLLKDMGESFPLESSANGSYLTFANKDIILTAWNALLGGAATVFMDPSYSQKAIAAG
FT                   SKEVMRGYMLGGICWQIIPLGLGTSMGLASLALTKNPAFFTYPNKLTDLEAGRGLSLVY
FT                   AMTAIFGKSGAACAVVMVFMSATSAMSAELISCSSILTYDFYKTYVNPKASGKQLVYVS
FT                   HLNVIGFSLCMGALAVVFNYIGVTLGWLFSFVGIALGPAFFGLLGMLFYKKMNTMALVV
FT                   GVPSATLCGIVGWVASATRYSSDGRVDKASLSLSEPLAFGNFISVFSSGIFVWILSQVK
FT                   SQSWNFNEMNETYFETQIADDADSDEIEFSQVSKESVKDLRKHIFITKILVFCQFIIFL
FT                   IIIPLSMYGTKYIFSRKLFRGYVCIIIIWAFLAAMWIIFYPLYESKSNLIFVFKKLIGK
FT                   ASTDSSADLSQTDTSSIEREKLDKTSINVAAI"
FT   gene            complement(<60243..>61859)
FT                   /locus_tag="KLTH0B00572g"
FT                   /old_locus_tag="KLTH-ORF15923"
FT   CDS_pept        complement(60243..61859)
FT                   /locus_tag="KLTH0B00572g"
FT                   /old_locus_tag="KLTH-ORF15923"
FT                   /product="KLTH0B00572p"
FT                   /note="similar to uniprot|Q12235 Saccharomyces cerevisiae
FT                   YLL055W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21385"
FT                   /db_xref="GOA:C5DC74"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC74"
FT                   /protein_id="CAR21385.1"
FT                   /translation="MLATESDRSSGSLSLENADKILVNIVENEIGQSEDQIEDKVTTSR
FT                   DADVTLGFLLDNNVLVPAVSYEEERRLARKVLWTIVPLCALIDFVLYADKATASYTSIF
FT                   GMWKDTNLDQNKYSNSTTLFYVGFIIGQVNLLFLQKFPVGRVVAALSFFWSLIIYLHTV
FT                   TTSYQGIYALRFFLGFVEAIAVPALNVTMGQFLTAEEKSWTAPLFYTTCLGNEIVVGFI
FT                   AFGILHAKPAFAIWKLFMIVIATISLLVTILVLFLYPNNPTDARFLNLKEKIWVIRRVQ
FT                   RTTGSSIEQKVIKKQQIIEALKDPVSWLFCAFFFCNQLSNNLVYQEKLLFKEIGISTLG
FT                   STLVSVAYGSFSVTCAVIASSIIRKKKNSTAYSVVFWTLFPLVGSIAMVTLPWDRTYAL
FT                   LAMICICAPKGIAWILMFSWTSTSTSGHTKKITRNALIMFWYGVANIIAPQLWRANDGP
FT                   RYYPAWIVQIVFAFFLAPISALAIRYILARRNEERKSSLDGGTPLGLIKSTDIESASTI
FT                   KGNIALLDLTDLENDHFIYPL"
FT   gene            <64332..>66188
FT                   /locus_tag="KLTH0B00594g"
FT                   /old_locus_tag="KLTH-ORF15917"
FT   CDS_pept        64332..66188
FT                   /locus_tag="KLTH0B00594g"
FT                   /old_locus_tag="KLTH-ORF15917"
FT                   /product="KLTH0B00594p"
FT                   /note="similar to uniprot|P36172 Saccharomyces cerevisiae
FT                   YKR105C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21386"
FT                   /db_xref="GOA:C5DC75"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC75"
FT                   /protein_id="CAR21386.1"
FT                   /translation="MSVCLDNQTTASLSDREVVEGTKEDIHEKVTGGILEKADSANSGA
FT                   NSVAKDSENGQAAPSEPETAISPLTGLRFYVCFASLALSLFLAALDILIVGTIMETVAA
FT                   KFNGYSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAATSM
FT                   TMLIGGRVISGIGGSGIQTLCFVITSTLVTDRTRGTAISILSCAFAVASVAGPFLGGAF
FT                   ATHVTWRWCFYINLPIGGLAFFFFLFSYNPNGENTFENFKILLGRIKRISYSQLLTVSF
FT                   YRRLFRTLVFKFDFFEFALSSAGFTLVLLALTFGGNRYDWNSGTIIAYFVVGILLIIAS
FT                   FVYDFVVFDRVKPQTDRIPYLPLLSWNVISKPGVLIPNIANFCTCFCYNMQVVYIVQYF
FT                   QLVWGDSAWKASIHLIAPVISTVITVLFCGIITRKTGHVKILLVVGGIVIPVASGILTL
FT                   LGPKSSSSAKIGLLILPGISFGSVMNGSLLSSQLQIQKNHPLFRFDFIAVTTFNAFVKM
FT                   LGMAFGGIMSNMIFTTSVRNELSKIKPPLPHSQSVDGLISWWYKNYAGRDSAEVHVFMN
FT                   GIKDVFWAALGLAAIAAVACFCSSNKKVDIEKPEGDEEKNGK"
FT   gene            complement(<66965..>67327)
FT                   /locus_tag="KLTH0B00616g"
FT                   /old_locus_tag="KLTH-ORF15914"
FT   CDS_pept        complement(66965..67327)
FT                   /locus_tag="KLTH0B00616g"
FT                   /old_locus_tag="KLTH-ORF15914"
FT                   /product="KLTH0B00616p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21387"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC76"
FT                   /protein_id="CAR21387.1"
FT                   /translation="MDSTAEQSQTIVPCGYVYNLTVTSNTSAMEGWCCGTAARTGSDPR
FT                   DDRLLNGTSAITCNNGNTYLQVFNGTTYEDGYLCGLGLPGAYQFPLTETKNAASRLGPR
FT                   WAQAFLLISLLIHLFA"
FT   gene            complement(<67583..>67654)
FT                   /locus_tag="KLTH0B00638r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.23"
FT   tRNA            complement(67583..67654)
FT                   /locus_tag="KLTH0B00638r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.23"
FT                   /note="tRNA-Glu (CTC) cove score=64.56"
FT   gene            complement(<68588..>68659)
FT                   /locus_tag="KLTH0B00660r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.22"
FT   tRNA            complement(68588..68659)
FT                   /locus_tag="KLTH0B00660r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.22"
FT                   /note="tRNA-Glu (CTC) cove score=64.56"
FT   repeat_region   complement(68720..68981)
FT                   /locus_tag="KLTH0B00682t"
FT                   /old_locus_tag="Klth0B.LTR.2"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            complement(<69489..>69854)
FT                   /locus_tag="KLTH0B00704g"
FT                   /old_locus_tag="KLTH-ORF15907"
FT   CDS_pept        complement(69489..69854)
FT                   /locus_tag="KLTH0B00704g"
FT                   /old_locus_tag="KLTH-ORF15907"
FT                   /product="KLTH0B00704p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21388"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC77"
FT                   /protein_id="CAR21388.1"
FT                   /translation="MNSTAEQSQIIIPCGRIYNLTVTSNTSVLEGWCCGIAASSGADDR
FT                   EQTLSHEFSSISCGDNTMLQITANTTVMDGYFCGSGMANPSNAGQSSLTQTNAASDLAP
FT                   RWTQFFILLSFFMQYFA"
FT   gene            complement(<70106..>70177)
FT                   /locus_tag="KLTH0B00726r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.21"
FT   tRNA            complement(70106..70177)
FT                   /locus_tag="KLTH0B00726r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.21"
FT                   /note="tRNA-Glu (CTC) cove score=64.56"
FT   gene            complement(<71137..>71208)
FT                   /locus_tag="KLTH0B00748r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.20"
FT   tRNA            complement(71137..71208)
FT                   /locus_tag="KLTH0B00748r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.20"
FT                   /note="tRNA-Glu (CTC) cove score=64.56"
FT   gene            complement(<71519..>71890)
FT                   /locus_tag="KLTH0B00770g"
FT                   /old_locus_tag="KLTH-ORF15904"
FT   CDS_pept        complement(71519..71890)
FT                   /locus_tag="KLTH0B00770g"
FT                   /old_locus_tag="KLTH-ORF15904"
FT                   /product="KLTH0B00770p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21389"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC78"
FT                   /protein_id="CAR21389.1"
FT                   /translation="MGPSAKQCQTVLPCGGLYNLTITSNTSVMEGYRCGSTERSGVDDR
FT                   DELLSIEIGGINCNANPAFDLYISENTTVIDGYRCGLDSTNYTEYSQCSNTKENGASNL
FT                   SPRWTHIFVFVSLFAYLFG"
FT   gene            complement(<72118..>72189)
FT                   /locus_tag="KLTH0B00792r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.19"
FT   tRNA            complement(72118..72189)
FT                   /locus_tag="KLTH0B00792r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.19"
FT                   /note="tRNA-Glu (CTC) cove score=64.56"
FT   gene            complement(<72513..>72584)
FT                   /locus_tag="KLTH0B00814r"
FT                   /old_locus_tag="Klth0B.tAsp.GTC.18"
FT   tRNA            complement(72513..72584)
FT                   /locus_tag="KLTH0B00814r"
FT                   /old_locus_tag="Klth0B.tAsp.GTC.18"
FT                   /note="tRNA-Asp (GTC) cove score=69.96"
FT   gene            <73357..>74829
FT                   /locus_tag="KLTH0B00836g"
FT                   /old_locus_tag="KLTH-ORF15899"
FT   CDS_pept        73357..74829
FT                   /locus_tag="KLTH0B00836g"
FT                   /old_locus_tag="KLTH-ORF15899"
FT                   /product="KLTH0B00836p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21390"
FT                   /db_xref="GOA:C5DC79"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC79"
FT                   /protein_id="CAR21390.1"
FT                   /translation="MSSNLSTAPEEGKKVYATRSRDSGTSESIAALPEAMQQTTKYSSE
FT                   TPLLILENESEHDIQYKTCSWVHTSGLMLSEYIVLAIMSFPWSYSVLGIVPGIILTLFV
FT                   ASTVLYTGLTIIDYCERFPHLKNVCDIGQHLFWGQKWAWYATLVCFLANNTLIQGLHVL
FT                   VGAKYLNTVTDHSLCTVKFGVIVACISFVVSVPRTFSSLSKVAYFSAATMFIAVVLAMI
FT                   FAGVQDHPYGYDGTPVTFRAFPEKGTTFVQGMGAFLNIVYTFVGQITYPQFISEMQRPA
FT                   EFRKVLYIVTTCEIVIFTLAGVIIYVYVGNEYMSAPAFGSLTRTFKIIAFSFAVPTIIF
FT                   AGSLYSNVSGRLLFFTFFKRSKHLYSHTTVGWLTWIGILALTWVGAFIIAEVVPFFSDL
FT                   LSLMSSLFDCWFGFVFWGMAYFKLKEAKYQNPRYYSQLTASEKFHFFIAIFLIAVGLFI
FT                   LGPGLYAAIDSIILNYQDDAYGTVFSCASNGS"
FT   gene            <75377..>76294
FT                   /locus_tag="KLTH0B00858g"
FT                   /old_locus_tag="KLTH-ORF15893"
FT   CDS_pept        75377..76294
FT                   /locus_tag="KLTH0B00858g"
FT                   /old_locus_tag="KLTH-ORF15893"
FT                   /product="KLTH0B00858p"
FT                   /note="highly similar to uniprot|P23641 Saccharomyces
FT                   cerevisiae YJR077C MIR1 Mitochondrial phosphate carrier
FT                   imports inorganic phosphate into mitochondria functionally
FT                   redundant with Pic2p but more abundant than Pic2 under
FT                   normal conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21391"
FT                   /db_xref="GOA:C5DC80"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC80"
FT                   /protein_id="CAR21391.1"
FT                   /translation="MSAPIPQYSMSDYAKFALAGAIGCGVTHSAMVPIDVVKTRIQLEP
FT                   TVYNKGMVSSFKQIVSAEGAGALLTGFGPTLLGYSMQGAFKFGGYEVFKKLFIDTLGYD
FT                   QAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPSFADGLFGGFSRILREEGAA
FT                   SFYNGFTPILFKQIPYNIAKFLVYERAAEVYFGMVGPKDTLSNTTATGLNLLSGLTAGL
FT                   AAAVVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTRLVMVGTLTS
FT                   LQFGIYGTLKKSLGCAPAIEIASK"
FT   gene            complement(<76459..>76767)
FT                   /locus_tag="KLTH0B00880g"
FT                   /old_locus_tag="KLTH-ORF15891"
FT   CDS_pept        complement(76459..76767)
FT                   /locus_tag="KLTH0B00880g"
FT                   /old_locus_tag="KLTH-ORF15891"
FT                   /product="KLTH0B00880p"
FT                   /note="some similarities with uniprot|P36036 Saccharomyces
FT                   cerevisiae YKL214C YRA2 Member of the REF (RNA and export
FT                   factor binding proteins) family when overexpressed can
FT                   substitute for the function of Yra1p in export of poly(A)
FT                   mRNA from the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21392"
FT                   /db_xref="GOA:C5DC81"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR025715"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC81"
FT                   /protein_id="CAR21392.1"
FT                   /translation="MVKEIAEPVYSNIYDHESGRTAVFEFEAPEKTEEVHRALNEKEIS
FT                   GAKVTVEVFESRSRQSRRSQKKGHRGGRRGPRAPKREKPAQPTADQLDQELENYMNS"
FT   gene            <77624..>78652
FT                   /locus_tag="KLTH0B00902g"
FT                   /old_locus_tag="KLTH-ORF15889"
FT   CDS_pept        77624..78652
FT                   /locus_tag="KLTH0B00902g"
FT                   /old_locus_tag="KLTH-ORF15889"
FT                   /product="KLTH0B00902p"
FT                   /note="similar to uniprot|Q08913 Saccharomyces cerevisiae
FT                   YOR390W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21393"
FT                   /db_xref="GOA:C5DC82"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC82"
FT                   /protein_id="CAR21393.1"
FT                   /translation="MESKEKLDAEPRKTRIGAQLRAEGEVVLQLLFFSILGNYSRLGLV
FT                   RLTDYRGSYVQGPTVLWANLAACFLMGAAQALKPRDVFTPLFFTAVTTGYCGSVSSFSS
FT                   FLVEVFEHATNTAADSGSHSFPNRAYGIMEFLSVLFVQLMVSMCSHLFGLCLAREFSGS
FT                   LETSGSWEASKNARRVRKVLKLAENIARILAVPVLIVQIVLAAVYTNGSRYWTFAAVFS
FT                   FPGTLLRYVLAKYLNPRVKHFPLGTFAANVFGTVLLAIFTLLSRGKLPDGSRIIKFTTT
FT                   NDVVVGLGNGFCGCLTTISTFINEGHVLPLKKTLIYYFTSIAVSFCLIVVTLGSYAWTR
FT                   GI"
FT   gene            complement(<79302..>81446)
FT                   /locus_tag="KLTH0B00924g"
FT                   /old_locus_tag="KLTH-ORF15886"
FT   CDS_pept        complement(79302..81446)
FT                   /locus_tag="KLTH0B00924g"
FT                   /old_locus_tag="KLTH-ORF15886"
FT                   /product="KLTH0B00924p"
FT                   /note="similar to uniprot|P36037 Saccharomyces cerevisiae
FT                   YKL213C DOA1 WD repeat protein required for ubiquitin-
FT                   mediated protein degradation forms complex with Cdc48p
FT                   plays a role in controlling cellular ubiquitin
FT                   concentration also promotes efficient NHEJ in
FT                   postdiauxic/stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21394"
FT                   /db_xref="GOA:C5DC83"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013535"
FT                   /db_xref="InterPro:IPR015155"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR033510"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR038122"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC83"
FT                   /protein_id="CAR21394.1"
FT                   /translation="MVKKVFKLSATLFGHEQDVKSVAVMSNDEVATCSRDGSVRLWKKG
FT                   SNDMWQDTILYKVDEFINSLCYDKLSRLLYCGGKDTLINSISPLLGELGQEPEFVLVGH
FT                   KSNVCALNSSQGYILSGSWDATAKVWFQGALKHELVGHKASVWDVKMLPEVGFYLTASA
FT                   DGTVKLWEGEKVLKTFSNLHTDVVRHLDISPDGDQFASCSNDGTIKINDMDGNTLRTLK
FT                   GHESFVYCVKYTPCGGLVSCGEDRSVRVWGPDGAVKQVIRVPAVSVWDLDVLPNGDILV
FT                   GCSDSLARIFTCHEGRVAPQQELDTFAKEVERTAISSQTMGFDESKLSPSEALLNPGKE
FT                   GQVIVVKSPNGVNEAHQYTQGAWTKVGDVVSSAGNDKKKEFEGKMYDYVFDVDVTEGAP
FT                   PLKLPFNANGNAYQAADDFLARYELPASYREEVVRFLITNTTGVSLEQDQSSTSNGQSN
FT                   SIPQSKPMSVLPVREYLDIRSFSPDAIFNGVVKLNAQERSFDDEDLAAIGAALHDVEDN
FT                   YELLFAQASIIRSSWSNKIPAYDIMRLIVEYLPHADAMSEFIEEGLGSAMPQLEMLTVR
FT                   TLANCFKNKKWGTELMSKNAVYDSVFQTIEPNRPQASKTVNLAVSIATLIFNYSVMIIK
FT                   SGNLDLLPTVADALNNKFGPSQMIQDSEEAAYRMLVAYGNLATVEPTLLQFAKSIAWIK
FT                   PVKEKYGHLSRFSHVFADLL"
FT   gene            <81585..>83456
FT                   /locus_tag="KLTH0B00946g"
FT                   /old_locus_tag="KLTH-ORF15885"
FT   CDS_pept        81585..83456
FT                   /locus_tag="KLTH0B00946g"
FT                   /old_locus_tag="KLTH-ORF15885"
FT                   /product="KLTH0B00946p"
FT                   /note="similar to uniprot|P32368 Saccharomyces cerevisiae
FT                   YKL212W SAC1 Lipid phosphoinositide phosphatase of the ER
FT                   and Golgi involved in protein trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21395"
FT                   /db_xref="GOA:C5DC84"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC84"
FT                   /protein_id="CAR21395.1"
FT                   /translation="MAGPLLYSHLGEKIVFKLATPSSEKDVVLSLGPSGQDISLESPEI
FT                   FPTRGKIVKSAALIGCIKLKLNSYAIFAHRVEEFGVLAGHRIFKVVEHTILPLNKGGQR
FT                   DKDEQQYLDLLEMQLSSATLFYSYTYDLTNSAQRNEKLDGSSWKTADTRFFWNHYVTHS
FT                   LRTLAEKCPAAGDFIQPMIFGYAHFIETALNNVPITIGLVTRRSRFRAGTRYFRRGIDS
FT                   DGNVANFNETEQFLLVKKPEGGNSEFFSFLQTRGSVPVYWGEINNLKYKPNLVLGENSS
FT                   LDATAKHFDQQKSLYGENYLVNLVNQKGHELPVKNAYESAVNALNDPMIHYVYFDFHHE
FT                   CRKMKWYRVKLLIDHLQKMGLDPEDTFHKIVSPDGKTVDVVREQKSVVRTNCMDCLDRT
FT                   NVVQSVLASWVLQHEFQIANVVPEGTLWELDLKLLAKFQNFWADNADAVSFSYSGTGAL
FT                   KTDFTRTGKRTRKGAFADFMNSVSRYYQNNLSDGPRQDSFDLFHGNFLPFENSFQSPFP
FT                   DRRPLSIQIVPTVICAAITVIAATVFFPKGHFFSTKNLSFFFVSSAIVILSLRFIFRNG
FT                   EQYVNWPKFNNLGFLTAVQTHNKERTFKGIRYVQSPKFSKPGELKRD"
FT   gene            complement(<83522..>84985)
FT                   /locus_tag="KLTH0B00968g"
FT                   /old_locus_tag="KLTH-ORF15884"
FT   CDS_pept        complement(83522..84985)
FT                   /locus_tag="KLTH0B00968g"
FT                   /old_locus_tag="KLTH-ORF15884"
FT                   /product="KLTH0B00968p"
FT                   /note="highly similar to uniprot|P00937 Saccharomyces
FT                   cerevisiae YKL211C TRP3 anthranilate synthase Component II
FT                   and indole-3-phosphate (multifunctional enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21396"
FT                   /db_xref="GOA:C5DC85"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC85"
FT                   /protein_id="CAR21396.1"
FT                   /translation="MVFSAKRRVVLIDNYDSFTWNLYEYLCQEGAEVLVYRNDQITLEE
FT                   IDDLKPDCVFISPGPGHPRTDSGISRDCVRHFAGKIPVVGVCMGLQCMFDVFGGTVSYA
FT                   GEIVHGKTSQVTHDNKGIFKDIPQGVAVSRYHSLAGEPLSLPEVLEVTARTENGIIMGV
FT                   RHKNLTVEGVQFHPESILTEAGHVMVRNILNIQGGTWEEHEKLSKEKRVKGSSILDKIY
FT                   AQRQKDVDELSATPGFTLRDLQSNFNQGLAPEVQDFYTKLSSGPKSAVIAEIKRASPSK
FT                   GDIDMNAIAAEQGLKYAKAGASAISVLTEPHWFKGSIQDLVNVRRALDIEFKNAPQDRP
FT                   CVLRKEFIFSKYQILEARLAGADSVLLIVKMLSQDLLLELYNYSKFEVGIEPLVEVSSK
FT                   EEMGRALELNAKVVGVNNRDLHSFNVDLNTTSSLASSVPEGTILLALSGITSGADAEKY
FT                   KKEGVKGLLVGEALMRAANVDSLIKDLSA"
FT   gene            <86383..>87597
FT                   /locus_tag="KLTH0B00990g"
FT                   /old_locus_tag="KLTH-ORF15881"
FT   CDS_pept        86383..87597
FT                   /locus_tag="KLTH0B00990g"
FT                   /old_locus_tag="KLTH-ORF15881"
FT                   /product="KLTH0B00990p"
FT                   /note="similar to uniprot|P32458 Saccharomyces cerevisiae
FT                   YJR076C CDC11 Component of the septin ring of the mother-
FT                   bud neck that is required for cytokinesis septins recruit
FT                   proteins to the neck and can act as a barrier to diffusion
FT                   at the membrane and they comprise the 10nm filaments seen
FT                   with EM"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21397"
FT                   /db_xref="GOA:C5DC86"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC86"
FT                   /protein_id="CAR21397.1"
FT                   /translation="MASIIEASAALRKRKNLKRGINFTLMVVGESGSGRSTFVNTLCGQ
FT                   QVVDVSTSIMLPTDRSTQIDLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSQSFN
FT                   VVSDYIRHQYDEILLEESRVRRNPRFKDGRVHCCLYLINPTGHGLKETDVEFMKTLGPL
FT                   VNVIPVISKADSLTPAELKLNKKLIMEDIDYYHLPIYNFPFEENDISDEDYETNMYLRS
FT                   LVPFSVIGSNEVYDLGDGAMIRGRQYPWGTLDVEDSSLSDFVVLRNTLLISHLHDLKDY
FT                   THEILYERYRTEALSGETSSQRANGNSSTAYADSPVASGKSFQHAETDSLNSSKQASAN
FT                   QDTYLAREEQIRLEEERLRAFEERVQQELLMKRQELLQREQELREIEERIEREARIKEE
FT                   SGDLE"
FT   gene            <87881..>88001
FT                   /gene="SNR64"
FT                   /locus_tag="KLTH0B01012r"
FT                   /old_locus_tag="Klth0B_snoRNA_233"
FT   ncRNA           87881..88001
FT                   /gene="SNR64"
FT                   /locus_tag="KLTH0B01012r"
FT                   /old_locus_tag="Klth0B_snoRNA_233"
FT                   /product="snR64"
FT                   /note="C/D snoRNA monocistronic SNR64"
FT                   /ncRNA_class="snoRNA"
FT   gene            complement(<88067..>89371)
FT                   /locus_tag="KLTH0B01034g"
FT                   /old_locus_tag="KLTH-ORF15876"
FT   CDS_pept        complement(88067..89371)
FT                   /locus_tag="KLTH0B01034g"
FT                   /old_locus_tag="KLTH-ORF15876"
FT                   /product="KLTH0B01034p"
FT                   /note="similar to uniprot|P47124 Saccharomyces cerevisiae
FT                   YJR075W HOC1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21398"
FT                   /db_xref="GOA:C5DC87"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039367"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC87"
FT                   /protein_id="CAR21398.1"
FT                   /translation="MRLYHIFRFTLRNNSSNHLDADQSFNSTIKIFPTQRSANMPKSRR
FT                   PTWKRYVVWAVLLTIALALVGRFVSNRTATDVQAILQGLPKDIAPGADAASAQKQDVNM
FT                   VELFEKLSQDLLAKQEDQIKKFEKERKILEKKIQDLKQPATHATLREKLAHMFEYGTSK
FT                   KFPAFIWQTWPYSDLDDRMDPTLQSFERRWGDKNPGFVHEIINDDTASALIHYMYASIP
FT                   EVIEAYDALPSVYLKADFFKYLILFARGGVYADIDTDPLQPVPNWIPENVSPREIGLII
FT                   GIENDANSPDWRSNYVRRLQFGNWIMQAKPGHPVMREIVAKVTEETLKRRADGELRMNL
FT                   RNDLNIMSWTGSGIWTDVVFTYFNDYVQSGILSKITWKEFHNLGVPKLVGDVLVFPQFS
FT                   FDAPEKEEDGNKALQFCRHTGLKSWKAAPKVAGDN"
FT   gene            complement(<89368..>89970)
FT                   /locus_tag="KLTH0B01056g"
FT                   /old_locus_tag="KLTH-ORF15872"
FT   CDS_pept        complement(89368..89970)
FT                   /locus_tag="KLTH0B01056g"
FT                   /old_locus_tag="KLTH-ORF15872"
FT                   /product="KLTH0B01056p"
FT                   /note="similar to uniprot|P47123 Saccharomyces cerevisiae
FT                   YJR074W MOG1 Conserved nuclear protein that interacts with
FT                   GTP-Gsp1p which is a Ran homolog of the Ras GTPase family
FT                   and stimulates nucleotide release involved in nuclear
FT                   protein import nucleotide release is inhibited by Yrb1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21399"
FT                   /db_xref="InterPro:IPR007681"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC88"
FT                   /protein_id="CAR21399.1"
FT                   /translation="MFQKQALYGGAISTVIPKGFLDASILREVPDTQEVFVNSREEKEI
FT                   AVFKDGLGLDESVIVDLLQRVEEDDSCRALDVHLQEIAGLNGSHEWNLVECEQSAPEVG
FT                   QVPHLTCIAVEAAYKWGKSDMRETLVLCVALLRFDDVQTDVVLSVNIPVTSEPELQLLN
FT                   AWLSKTSSTIPLRIAAAYHLVKQMASEFRILDKGLFV"
FT   gene            <91145..>94192
FT                   /locus_tag="KLTH0B01078g"
FT                   /old_locus_tag="KLTH-ORF15870"
FT   CDS_pept        91145..94192
FT                   /locus_tag="KLTH0B01078g"
FT                   /old_locus_tag="KLTH-ORF15870"
FT                   /product="KLTH0B01078p"
FT                   /note="highly similar to uniprot|P22515 Saccharomyces
FT                   cerevisiae YKL210W UBA1 Ubiquitin activating enzyme
FT                   involved in ubiquitin-mediated protein degradation and
FT                   essential for viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21400"
FT                   /db_xref="GOA:C5DC89"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR018075"
FT                   /db_xref="InterPro:IPR018965"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="InterPro:IPR032418"
FT                   /db_xref="InterPro:IPR032420"
FT                   /db_xref="InterPro:IPR033127"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR038252"
FT                   /db_xref="InterPro:IPR042063"
FT                   /db_xref="InterPro:IPR042302"
FT                   /db_xref="InterPro:IPR042449"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC89"
FT                   /protein_id="CAR21400.1"
FT                   /translation="MVKPGEIDESLYSRQLYVLGKEAMLKMQHSTVLIIGLKGLGVEIA
FT                   KNIALAGVKSLTLFDPAPVVLEDLSTQFFLSEKDVGKPRAAVSQAKLAELNSYVPIDVL
FT                   DSLQDQEQLKKYQVIVATETLPLERKIELNNFCHAAGIKFIATETRGLFGSVFNDFGEE
FT                   FTVVDPTGEEPQSGIVSDIEPDGTVTMLDDNRHNLEDGNYVKFSEVEGLEKLNDGTPYK
FT                   VEVLGPFAFRIGSVKELGTYKKGGVFTQVKMPLKLSFKTLQQSLPNPEHLYSDFAKFER
FT                   PGQLHLGFQALDQFQATHQGQLPRPFNEEDANELIELTSKLAVQQPKVLGEGNSVNKDI
FT                   IRELSFQARGDIPGMVAFFGGLVAQEALKACSGKFTPLKQYMYFDSLESLPDAKEYPRN
FT                   EETTRSINSRYDPQIAVFGLEFQRKLANSKVFLVGSGAIGCEMLKNWALLGLGSGPDGK
FT                   IFITDNDSIEKSNLNRQFLFRPKDVGRNKSEVASEAVSNMNPDLQGKIKWMTEKVGAES
FT                   EDLFNDDFWNGLDFVTNALDNVDARTYVDRKCVFYKKPLLESGTLGTKGNTQVVIPNVT
FT                   ESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFTEAPENVNLYLTQPDFVQ
FT                   QTLKQAGDVKGILESIADSLNNRPYDFDDCIKWARLEFEKKFNHEIQQLLYNFPKDSKT
FT                   STGAPFWSGPKRAPEPLVFDIKNPDHFYFVVGAANLRAFNYGLTGDEGEPDISHYESVL
FT                   ANTNVPAFSPRSDVKIQANDDEPDPNSNSDVGGDALEALTASLPDPSTLAGFKLLPAEF
FT                   EKDDDSNHHIEFITSASNDRALNYSIETADRQKTKFIAGRIIPAIATTTGLVTGLVNLE
FT                   LYKVVDGKTDIEAYQNGFINLALPFFGFSDPIASPQGKYNDKSYDKIWDRFDIRGNITL
FT                   KELIDHFDEKEGLEITMLSYGVSLLYASFFPPKKLKDRLNLPITEVVKLVTKNEVAPHV
FT                   KTMILEICADDKNGEDVEVPYITIHL"
FT   gene            complement(<94260..>98156)
FT                   /locus_tag="KLTH0B01100g"
FT                   /old_locus_tag="KLTH-ORF15868"
FT   CDS_pept        complement(94260..98156)
FT                   /locus_tag="KLTH0B01100g"
FT                   /old_locus_tag="KLTH-ORF15868"
FT                   /product="KLTH0B01100p"
FT                   /note="similar to uniprot|P12866 Saccharomyces cerevisiae
FT                   YKL209C STE6 ATP-binding cassette (ABC) transporter
FT                   required for the export of a-factor catalyzes ATP
FT                   hydrolysis coupled to a-factor transport contains 12
FT                   transmembrane domains and two ATP binding domains expressed
FT                   only in MATa cells"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21401"
FT                   /db_xref="GOA:C5DC90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030246"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC90"
FT                   /protein_id="CAR21401.1"
FT                   /translation="MRQLRNLQLSNVYANVHLKQDWSLLVVITVCSVAYGLVPAVTSIL
FT                   TGTVFNLLQQPAAREFGSVNALMHELALRSMAILATGIASIPLCWLSVSAWMSLGERQA
FT                   FRLRRKMLQSYLDKSMAWYDANEQISGDFTQLNRCVEELRSSSAESSAIVFQNVVTVAA
FT                   LLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMAWSLDAA
FT                   KMVRLLGTQDRELARFEACVQKCRQHFNKMSLFSSLNYSVLRFLTLCMFVQGFWYGNSR
FT                   INIGKLKPGDVVTCFSSCVLLASTLNSTLHQIIILQKGAVGLQKIMAFVNSRDASESQK
FT                   NKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTFVIGKSGSG
FT                   KSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTETLANNVTIG
FT                   EAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVALARAYFRN
FT                   APILILDEALSAQDRIHKSLLMEAIRKWRADKTTIILTHELSDILDTDYVYVMSDGQIR
FT                   EHGYKSGLLSNPKSEFSNLHRFQACDDDFGDVATLGDGTSQIVDQKLEGVRTDVEELYS
FT                   ELGSPSTLRTCCVPESDYHPVTSHALRSSVDLLQSSIMMPHRTRRVAKTKERVDATELG
FT                   PLPTVPDIEKGQTEPSLLPLRDIIKQFFINSRQKRLLAVGGTSALLAGVANPLFSYTFS
FT                   KLLSGIASSNAYPATGRRSTKWSLIVLSVALLDSTFTFLKCFTLSKCGENWIRALRLRA
FT                   FKNISNRELAWFNSEQNSTSNVSSLVINDLRDLRALASEFLAAVTTLVVVSFCGLIWAL
FT                   ASGWKLSLVCISLIPAFILFTGAYGGLLQKCEANYKSAVASMEDQLYSAVRRIKTIRCL
FT                   QVEERVIKEYEVLEGKAKLAGRKRALGTGFGVALSNALTLITQSILLYYGMKLVITGEY
FT                   SSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFRILDSETQFADANLEGESA
FT                   LTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAGETVALVGLSGSGKSTLWHL
FT                   ITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTSVDE
FT                   REIRELLELVGMMDFVNSNPLGLQSFIDTDVLSGGQLQRLAIVRALLRKPQLLVLDECT
FT                   SALDAQHGFIMSEFVRQGSQSTTTLVLTHSEQMMRACNRILTFANGNIIEDGSFERLYS
FT                   QKGELFKILSSCSE"
FT   gene            <98689..>99342
FT                   /locus_tag="KLTH0B01122g"
FT                   /old_locus_tag="KLTH-ORF15864"
FT   CDS_pept        98689..99342
FT                   /locus_tag="KLTH0B01122g"
FT                   /old_locus_tag="KLTH-ORF15864"
FT                   /product="KLTH0B01122p"
FT                   /note="similar to uniprot|P05375 Saccharomyces cerevisiae
FT                   YJR073C OPI3 Phospholipid methyltransferase (methylene-
FT                   fatty-acyl-phospholipid synthase) catalyzes the last two
FT                   steps in phosphatidylcholine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21402"
FT                   /db_xref="GOA:C5DC91"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="InterPro:IPR024960"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC91"
FT                   /protein_id="CAR21402.1"
FT                   /translation="MDLFNDLTGKLGKVQDVYIEMLSEVVTDEKNLKLALFFIVFNPLF
FT                   WNTAARLEYKTHFLTKITGSAKRGCYVLAVTIFSLGIVRDYFFHQALMQQPTSRVLDTD
FT                   AVRKAGMVLSAFGQVLVATSMYQLGVTGTYLGDYFGILMDNIVTAFPFNVSNNPMYHGS
FT                   TLTFLGTSLYYGKAAGVFATVLVNLVYNIAQQFEEPFTAQIYAKRDAERTKKSS"
FT   gene            <99614..>100849
FT                   /locus_tag="KLTH0B01144g"
FT                   /old_locus_tag="KLTH-ORF15862"
FT   CDS_pept        99614..100849
FT                   /locus_tag="KLTH0B01144g"
FT                   /old_locus_tag="KLTH-ORF15862"
FT                   /product="KLTH0B01144p"
FT                   /note="highly similar to uniprot|P42942 Saccharomyces
FT                   cerevisiae YGR210C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21403"
FT                   /db_xref="GOA:C5DC92"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR013646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC92"
FT                   /protein_id="CAR21403.1"
FT                   /translation="MPRDPLIGIVGKPSSGKSTTLNSLTDAAAQVGSFPFTTIEPNKAT
FT                   GYLQVDCVCGRFGKQALCKPNYGWCSNGKRHVPIMLLDVAGLVPGAHSGRGLGNKFLDD
FT                   LRHADALIHVVDVSGTTDAEGKNTRGYDPLYDIEWLQDEIRLWIEGNLEKRWGSIVRRH
FT                   TATKSSAVDTLQAQFGGYGSHAPMVQRALHRIRGLPPLEQWDKEWITKVVRSFMIEKFP
FT                   TVLALNKIDHPDADKNVSKIMLKYPETKAVLASAVTEVFLRKLKKQGFVHYEEGTEFVD
FT                   TFEDDPDGLKPLDDKLLQRIENIRDLVLYRFGSTGVVQVLQAAAGVLDLVPVYTVRNIH
FT                   TFTGGHGENVFRDCFLIKRGTPVGKVARYVMGEVTIAAVETVGGVRVSEDDVVDAGKND
FT                   VLSFKLAPKSVN"
FT   gene            <102227..>103960
FT                   /locus_tag="KLTH0B01166g"
FT                   /old_locus_tag="KLTH-ORF15855"
FT   CDS_pept        102227..103960
FT                   /locus_tag="KLTH0B01166g"
FT                   /old_locus_tag="KLTH-ORF15855"
FT                   /product="KLTH0B01166p"
FT                   /note="similar to uniprot|P53388 Saccharomyces cerevisiae
FT                   YPL265W DIP5 Dicarboxylic amino acid permease mediates
FT                   high-affinity and high-capacity transport of L- glutamate
FT                   and L-aspartate also a transporter for Gln Asn Ser Ala and
FT                   Gly"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21404"
FT                   /db_xref="GOA:C5DC93"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC93"
FT                   /protein_id="CAR21404.1"
FT                   /translation="MSESLEKKNAGILYSNETLEEDVAFDKLERGASGASAAGASVDGK
FT                   HEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVM
FT                   ACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVS
FT                   REKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP
FT                   NHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKN
FT                   PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKN
FT                   AGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSL
FT                   AVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKS
FT                   GFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGY
FT                   KLVHRSKLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSPKNLTWFYDTFLGWI
FT                   F"
FT   gene            complement(<104224..>106005)
FT                   /locus_tag="KLTH0B01188g"
FT                   /old_locus_tag="KLTH-ORF15847"
FT   CDS_pept        complement(104224..106005)
FT                   /locus_tag="KLTH0B01188g"
FT                   /old_locus_tag="KLTH-ORF15847"
FT                   /product="KLTH0B01188p"
FT                   /note="highly similar to uniprot|P06169 Saccharomyces
FT                   cerevisiae YLR044C PDC1 Major of three pyruvate
FT                   decarboxylase isozymes key enzyme in alcoholic fermentation
FT                   decarboxylates pyruvate to acetaldehyde subject to glucose-
FT                   ethanol- and autoregulation involved in amino acid
FT                   catabolism and to YLR134W uniprot|P16467 Saccharomyces
FT                   cerevisiae YLR134W PDC5 Minor isoform of pyruvate
FT                   decarboxylase, key enzyme in alcoholic fermentation,
FT                   decarboxylates pyruvate to acetaldehyde, regulation is
FT                   glucose- and ethanol-dependent, repressed by thiamine,
FT                   involved in amino acid catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21405"
FT                   /db_xref="GOA:C5DC94"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC94"
FT                   /protein_id="CAR21405.1"
FT                   /translation="MSDLILYCDFYKTRNLNSNRVSQNKPEITMSEITLGRYVFERLKQ
FT                   VDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGMSCLITTFG
FT                   VGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHRMSANISE
FT                   TTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDTPIDLALKPND
FT                   QQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSI
FT                   DEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKTKNVVEFHS
FT                   DHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPSTPLKQQWL
FT                   WNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAA
FT                   EELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYN
FT                   EIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELMLPVMDAPE
FT                   SLVKQAQLTAATNAKSA"
FT   gene            <107203..>108198
FT                   /locus_tag="KLTH0B01210g"
FT                   /old_locus_tag="KLTH-ORF15845"
FT   CDS_pept        107203..108198
FT                   /locus_tag="KLTH0B01210g"
FT                   /old_locus_tag="KLTH-ORF15845"
FT                   /product="KLTH0B01210p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21406"
FT                   /db_xref="GOA:C5DC95"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC95"
FT                   /protein_id="CAR21406.1"
FT                   /translation="MALDLTPDQWERLTAWIRDRSGLPDSEALTLFQDFVLELLRNLHS
FT                   CNERKWLEEQLSGLVDNPTEFLRDLEIFLKGLGASAPPSLNSGTPFVLVAHVPYKNLNA
FT                   QDVQAAFAPFGAIVSCRADVDSRSLLVQFRKVACAIRCTKAATLFFSNRFVTVELYQGD
FT                   PESFGSVRLIGSAPQPVAADSDPVPPSAAKPSPVPFNDRVQQVQTAQQTIFEQNQRSAE
FT                   AYKHNFAQLFESKEKLLRAHQAALQELKQKVLATEDPASISRTIIEFQELQKNMESLGI
FT                   TPIAMVQLKLQKFNLDDPSEFPVESPRALAVKQKRTKKAASFRRKIKRRR"
FT   gene            complement(<108265..>110865)
FT                   /locus_tag="KLTH0B01232g"
FT                   /old_locus_tag="KLTH-ORF15843"
FT   CDS_pept        complement(108265..110865)
FT                   /locus_tag="KLTH0B01232g"
FT                   /old_locus_tag="KLTH-ORF15843"
FT                   /product="KLTH0B01232p"
FT                   /note="similar to uniprot|P46675 Saccharomyces cerevisiae
FT                   YLR045C STU2 Microtubule-associated protein (MAP) of the
FT                   XMAP215/Dis1 family regulates microtubule dynamics during
FT                   spindle orientation and metaphase chromosome alignment
FT                   interacts with spindle pole body component Spc72p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21407"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR024395"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC96"
FT                   /protein_id="CAR21407.1"
FT                   /translation="MADSEDGDFTSLPLSERLDHKLWKARLHGYQELQALFQKASVTSV
FT                   PRELAQYWANPDLFAGYIVDSNVVAQEQAITALQNMLEYLCEFRDTPRSDEMRGRWLPL
FT                   LAEKGLSSSRNSTKAKAQECVLILVSLDRSVEHSIELLEPSLTNKLPRLVANCVECISN
FT                   IVESFGLAQVSNMSGFLPVLLEPLPKLSSHADRNVRSQTMNLILQLYKWLGRDLLQELL
FT                   LEKLKPIQQRDLDKTFGKYDGEIPPTSQPRPFQWQKGLEVQNLEGSKDKDGDTLMGESF
FT                   PDVKAHANPGLPQLDPFELLPVSPVLEKFPLDFMERITSSKWKDRVEVLEEILNQVLIP
FT                   TKKFEAKGQDYSDFLRAVAHVIEKDANVQAVTLAAQCVQQLCQKLKANFTRSYGSIVLR
FT                   SLLERSKEKKASVNEAICEALNNIADCCGVDACLEDNLSFINHKTPQVRTESTRFLTRL
FT                   LKKWTPEGRHFGDELLIKLVPDISQMLLKIVGDTQPTVRDAGFECLATLMKLVGEREVS
FT                   DVLDKLDNLKKKKVYEHYEKVEVAGGATKGAVTSAPARREKPSMPYTPNASRRQAPRTT
FT                   PTPDLSAQATSGSTLPLRKPLSTIPSKRGPSSPLKTGTRVETYQDGASSMKSRLTARSL
FT                   TTDSAPASKPQAAPHAGFEELQRQKQKWLKERQEFLATITDFQNKASHLSSENSSLRQQ
FT                   LDTVQSSLHESNIELRSKEMQITRLQDRISNLEQELEAKSTLPSSNYGVRSASSFEPPS
FT                   APLSLAPPGTPPTKRVFSSSSNGRASPSFDANSDRIADSRLPSVGSRLRSPSECSDDLP
FT                   HRVNSLQLRSAERAATTGNSFLNDESWKRAAEVTSQLKARIERMRAKTRGMGNS"
FT   gene            <111566..>111647
FT                   /locus_tag="KLTH0B01254r"
FT                   /old_locus_tag="Klth0B.tSer.AGA.1"
FT   tRNA            111566..111647
FT                   /locus_tag="KLTH0B01254r"
FT                   /old_locus_tag="Klth0B.tSer.AGA.1"
FT                   /note="tRNA-Ser (AGA) cove score=80.04"
FT   gene            <112166..>112477
FT                   /locus_tag="KLTH0B01276g"
FT                   /old_locus_tag="KLTH-ORF15839"
FT   CDS_pept        112166..112477
FT                   /locus_tag="KLTH0B01276g"
FT                   /old_locus_tag="KLTH-ORF15839"
FT                   /product="KLTH0B01276p"
FT                   /note="similar to uniprot|P22217 Saccharomyces cerevisiae
FT                   YLR043C TRX1 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21408"
FT                   /db_xref="GOA:C5DC97"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC97"
FT                   /protein_id="CAR21408.1"
FT                   /translation="MVAQIGSASEFEQAVKVDKLVVVDFFATWCGPCKMIAPMIEKFAE
FT                   QYPSAAFYKLDVDQVPEVAQQNEVSAMPTILLFKNGQVIDKVVGANPAAIKQKIAAHA"
FT   gene            complement(<112541..>113476)
FT                   /locus_tag="KLTH0B01298g"
FT                   /old_locus_tag="KLTH-ORF15838"
FT   CDS_pept        complement(112541..113476)
FT                   /locus_tag="KLTH0B01298g"
FT                   /old_locus_tag="KLTH-ORF15838"
FT                   /product="KLTH0B01298p"
FT                   /note="similar to uniprot|P42941 Saccharomyces cerevisiae
FT                   YGR208W SER2 phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21409"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC98"
FT                   /protein_id="CAR21409.1"
FT                   /translation="MSSAEIVVTLIAHGSELSEQTKSGFRAFLNDLSDVELEQEKALSV
FT                   RAYDFFLRTQKDVAVIKETMGSLGNGILDVIVQKNSEWRKKKGLVVFDMDSTLIYQEVI
FT                   ELIAAYAQVEDRVAEITERAMNNELDFKQSLQERVALLKGIKTATLYDEIKAKLRVTEG
FT                   VPELTRGLQKTGCKLAVLSGGFTPFANHMKEVLGLDFARANVLATETDASTGEEVLSGY
FT                   TLGDVVDGECKAATLIELAREHGVPIEATVMVGDGGNDLPAMGVAGFGIAWNAKPKVQA
FT                   AAPSKLNTRSMQDAFYIFGYTDGEIQELLK"
FT   gene            <113672..>114448
FT                   /locus_tag="KLTH0B01320g"
FT                   /old_locus_tag="KLTH-ORF15834"
FT   CDS_pept        113672..114448
FT                   /locus_tag="KLTH0B01320g"
FT                   /old_locus_tag="KLTH-ORF15834"
FT                   /product="KLTH0B01320p"
FT                   /note="highly similar to uniprot|P42940 YGR207C
FT                   Saccharomyces cerevisiae YGR2 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21410"
FT                   /db_xref="GOA:C5DC99"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC99"
FT                   /protein_id="CAR21410.1"
FT                   /translation="MSKSLRILVPVKRVIDYAIKPRINKAGTGVEKTGVKFSMNPFDDI
FT                   AVEEAVRIREKHKKLVENIHAVSIGPLKAQDILRTALAKGADTCSHVDVKEAELEPLAV
FT                   AKILKEMVAKQNANLVILGKQSIDDDCNNTGQMLAGLLNWPQATFAAKVEIDEANMTAR
FT                   VTREIDGGEETVSAPLPLVVTTDLRLNQPRYATLPNLMKAKKKPLEKLSLSDFSKVDAE
FT                   PRLKVMKVEEPPTRSAGIKVGSVDELIEKLKEVKAI"
FT   gene            complement(<114503..>114817)
FT                   /locus_tag="KLTH0B01342g"
FT                   /old_locus_tag="KLTH-ORF15833"
FT   CDS_pept        complement(114503..114817)
FT                   /locus_tag="KLTH0B01342g"
FT                   /old_locus_tag="KLTH-ORF15833"
FT                   /product="KLTH0B01342p"
FT                   /note="similar to uniprot|P42939 Saccharomyces cerevisiae
FT                   YGR206W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21411"
FT                   /db_xref="GOA:C5DCA0"
FT                   /db_xref="InterPro:IPR019014"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA0"
FT                   /protein_id="CAR21411.1"
FT                   /translation="MGLSAEDVLHQIPLRNAHADLLPQAQRKLDLPPLALPETTPAKQH
FT                   LEAWIEECSQISQAIKQRKDRGKRFDTWYAENCLSKQPPGITDCAVLSPSRRQVKENSV
FT                   "
FT   gene            <115101..>115676
FT                   /locus_tag="KLTH0B01364g"
FT                   /old_locus_tag="KLTH-ORF15831"
FT   CDS_pept        115101..115676
FT                   /locus_tag="KLTH0B01364g"
FT                   /old_locus_tag="KLTH-ORF15831"
FT                   /product="KLTH0B01364p"
FT                   /note="highly similar to uniprot|P47096 Saccharomyces
FT                   cerevisiae YJR025C BNA1 3-hydroxyanthranilic acid
FT                   dioxygenase required for biosynthesis of nicotinic acid
FT                   from tryptophan via kynurenine pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21412"
FT                   /db_xref="GOA:C5DCA1"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA1"
FT                   /protein_id="CAR21412.1"
FT                   /translation="MSSINQVKAYLHSFQMLNTTPINIEKWLQENGHLLQPPVNNFCLH
FT                   RGGFTVMIVGGPNERTDYHVNPTPEWFHQKKGFMTLRVVDETLQGNERFKDVTIEEGDS
FT                   FLLPANVPHNPVRYANTVGIVVEQDRPEGQHDMLRWYCSNCREVVCQFDFQMLDLGTQV
FT                   KEGIQKFDSDKEYRICKKCGTENFSSPQ"
FT   gene            <116004..>116777
FT                   /locus_tag="KLTH0B01386g"
FT   CDS_pept        116004..116777
FT                   /locus_tag="KLTH0B01386g"
FT                   /product="KLTH0B01386p"
FT                   /note="highly similar to uniprot|P47095 Saccharomyces
FT                   cerevisiae YJR024C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21413"
FT                   /db_xref="GOA:C5DCA2"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="InterPro:IPR027514"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DCA2"
FT                   /protein_id="CAR21413.1"
FT                   /translation="MASCFCNKVDVTEGTHGTSSSDDALVSSQDPRHPANLICTLCKMF
FT                   YYNNWVTGTGGGISIKHSKTGHIYIAPSGVQKEQLKPADMFVMDPASGSYLRTPQLYKP
FT                   SACTPLFMSCYKQRDAGAVIHTHSQHAVMCSLIFDKELRIANIEQIKAIPSGKKDAKTG
FT                   KDINLSFFDTLVIPIIDNTAHEEDLTEGLQEALQKYPNTTAVIVRRHGIYVWGPSVDKA
FT                   KVYNEAIDYLMEVAWKMHQLGIPPDCGIGEEKKYL"
FT   gene            complement(<116792..>117124)
FT                   /locus_tag="KLTH0B01408g"
FT                   /old_locus_tag="KLTH-ORF15828"
FT   CDS_pept        complement(116792..117124)
FT                   /locus_tag="KLTH0B01408g"
FT                   /old_locus_tag="KLTH-ORF15828"
FT                   /product="KLTH0B01408p"
FT                   /note="weakly similar to uniprot|P47093 Saccharomyces
FT                   cerevisiae YJR022W LSM8 Component of small nuclear
FT                   ribonucleoprotein complexes involved in RNA processing and
FT                   splicing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21414"
FT                   /db_xref="GOA:C5DCA3"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034103"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA3"
FT                   /protein_id="CAR21414.1"
FT                   /translation="MSPLLKDFLNKRIVVVTTDGQCVKAMLEGFDKSTNLLLSDVRDRV
FT                   SGDVVASSYLVRGNQVVCCGLLEEESSPQPDFGAESVSAQLKDTKNIVPDEHLIWQRVW
FT                   GMKAGK"
FT   gene            <117284..>118162
FT                   /pseudo
FT                   /locus_tag="KLTH0B01430g"
FT                   /old_locus_tag="pseudo-Klth0B-117284-118162"
FT   gene            complement(<118238..>119137)
FT                   /locus_tag="KLTH0B01452g"
FT                   /old_locus_tag="KLTH-ORF15821"
FT   CDS_pept        complement(118238..119137)
FT                   /locus_tag="KLTH0B01452g"
FT                   /old_locus_tag="KLTH-ORF15821"
FT                   /product="KLTH0B01452p"
FT                   /note="similar to uniprot|P42938 Saccharomyces cerevisiae
FT                   YGR205W Protein that binds ATP crystal structure resembles
FT                   that of E.coli pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA4"
FT                   /protein_id="CAR21415.1"
FT                   /translation="MTKRTLVDESTHFVLTHYDSKPEGKEGDDRSPFLVLISGPQGSGK
FT                   TTSTHAIKQKLHELRPELKCLCVSIDDFYLTHADQQKVSNNNSGNGLQQGRGLPGTHDM
FT                   RLLDSFMQRLHENKGSVHVPVYDKSLFGGEGDRSASADEVALPVDVVIVEGWFLGFEAV
FT                   GEKTLEQMRSEVSSPRGKLLRTHELQHLLQVDSGLGAYARALWNNPTFRSVGVVIAADV
FT                   ANIYRWRQQQEAQMIAKYGSGMNEEQVKAFVLRYMPCYELYYRSLMEHGSLGTEAALVV
FT                   HIDADRTVTGVEEKTRAA"
FT   gene            <119312..>120331
FT                   /locus_tag="KLTH0B01474g"
FT                   /old_locus_tag="KLTH-ORF15818"
FT   CDS_pept        119312..120331
FT                   /locus_tag="KLTH0B01474g"
FT                   /old_locus_tag="KLTH-ORF15818"
FT                   /product="KLTH0B01474p"
FT                   /note="similar to uniprot|P41903 Saccharomyces cerevisiae
FT                   YJR019C TES1 Thioesterase peroxisomal acyl-CoA
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21416"
FT                   /db_xref="GOA:C5DCA5"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA5"
FT                   /protein_id="CAR21416.1"
FT                   /translation="MSSLKTLLRLTRISETKFVSPAAAPPPGGSGVFGGTLVAQSLWAA
FT                   IQTSGQAFEPSSLHCYFIVRGDTSVRITYNVEVLRQGTNFVHRQVRAYQLDKLIFVASV
FT                   LLHKTSAFEGPEDDRSRARDVRHVTKADGLYPLEDTVPADDLFRSQVLENIDRYSRLDR
FT                   AWSDPQFTHPFLERFTSGPVEYRFPRDVFNSGAYHEGPAEDHLDHLDYYQRVREPLEGS
FT                   EAPEDSLSSSELSDPRFNYVAFAYLSDAYLLLMLPYFHQLPLYCSRFSVSLDHTIHFHQ
FT                   RPPVYDWMALRVTNPRSRRGKHLVNGDYFNAASKSLIASVRQEGLVVYDSPSGIRARF"
FT   gene            complement(<121140..>123977)
FT                   /locus_tag="KLTH0B01496g"
FT                   /old_locus_tag="KLTH-ORF15815"
FT   CDS_pept        complement(121140..123977)
FT                   /locus_tag="KLTH0B01496g"
FT                   /old_locus_tag="KLTH-ORF15815"
FT                   /product="KLTH0B01496p"
FT                   /note="similar to uniprot|P07245 Saccharomyces cerevisiae
FT                   YGR204W ADE3 Cytoplasmic trifunctional enzyme C1-
FT                   tetrahydrofolate synthase involved in single carbon
FT                   metabolism and required for biosynthesis of purines
FT                   thymidylate methionine and histidine"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21417"
FT                   /db_xref="GOA:C5DCA6"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA6"
FT                   /protein_id="CAR21417.1"
FT                   /translation="MVASLIDGKAIAKTIREEISQEIKTMSSGASGFRPTLAIFQVGNR
FT                   PDSATYVRMKCKAAEDAGIEVRFVHLDEDVAEHTLLTQVQEMNEDSSVDGILVQLPLPG
FT                   HIDEDKITSAVAARKDVDGFGAFNIGELNKKNGKPFFHPCTPEGIIELLVRNDVPIAGA
FT                   RALVIGRSDIVGSPVAELLKARDATVTVVHSKSKDIPDYVSKADIVVVAIGRPEFVKGA
FT                   WFEGNSNCVVIDVGTNYVDDASKKSGYRCVGDVEFEAARQHVRLITPVPGGVGPMTVAM
FT                   LMSNVFKAAKRSLEGEGKPAFEPLPLNLANPVPSDFEISRAQKPKEITQVAAEAGILPS
FT                   ELEPYGSTKAKVKLDILDRLGSRQNGKYVLVAGITPTPLGEGKSTTTVGLAQALGAHLK
FT                   KTVFANVRQPSMGPTFGIKGGAAGGGYSQVIPMDEFNLHVTGDIHAISMANNLLAAAID
FT                   TRMFHEQTQKDAALYKRLVPSKRGVRKFTPTMLRRLEKLGINKEDPDSLTPEEITQFAR
FT                   LDIDPETITWKRVVDCNDRFLRGITIGEAPTERGFKRETGFDISVASECMAILALANSL
FT                   SDMRERLGKIVIGASKSGVPVTCEDIGCAGAMTALLKDAVKPNIMQTLEGTPVFVHAGP
FT                   FANISIGANSAISDKIALKLAGVDPTASEEVKKESQGYVVTEAGFDFTMGGERFLNIKC
FT                   RSSGLVPDVVVIVATIRALKVHGGGPEVKADAPLPTEYLNENVDLLRKGCANLAKHITN
FT                   VKAYNLPVVIAINKMSSDTEREHEVVREEALKAGADDALVSNHWEEGGKGAVDLAEGVI
FT                   KACEQPNNKFKFLYETEGSSVEEKINTIAKEMYGAGSVEFLPEAQKKIDLYTKQGFSNL
FT                   PICIAKTQYSLSHDANLKGVPTGFKFPIRDVRASVGAGYLYALAAEIQTIPGLPTHCGF
FT                   MNIEVNEKGEIEGMF"
FT   gene            complement(<124215..>124559)
FT                   /locus_tag="KLTH0B01518g"
FT                   /old_locus_tag="KLTH-ORF15806"
FT   CDS_pept        complement(124215..124559)
FT                   /locus_tag="KLTH0B01518g"
FT                   /old_locus_tag="KLTH-ORF15806"
FT                   /product="KLTH0B01518p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21418"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA7"
FT                   /protein_id="CAR21418.1"
FT                   /translation="MLAARRRRQDTHHCVRNWSNLLNISSHPTVLDLNFSFGYKQARNR
FT                   PGSASHRPEAAPLRCDCAHRRVGALARTLSHCASRCHSFLASLSNILHLRATNRVARTR
FT                   KTCIAQEYII"
FT   gene            <124955..>125440
FT                   /locus_tag="KLTH0B01540g"
FT   CDS_pept        124955..125440
FT                   /locus_tag="KLTH0B01540g"
FT                   /product="KLTH0B01540p"
FT                   /note="similar to uniprot|P22696 Saccharomyces cerevisiae
FT                   YJR017C ESS1 Peptidylprolyl-cis/trans-isomerase (PPIase)
FT                   specific for phosphorylated serine and threonine residues
FT                   N-terminal to proline"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21419"
FT                   /db_xref="GOA:C5DCA8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA8"
FT                   /protein_id="CAR21419.1"
FT                   /translation="MSSGLPEPWTVRFSKSKRREYFFHPETKQSQWEEPEGTDHQQLKQ
FT                   YLADHPLRVRCLHLLIKHKDSRRPASHRSEHITLSKDEALQELAAYQQRLEQGERFEDL
FT                   ARERSDCSSFKRGGDLGFFARGEMQPAFESVAFALPVSAVSAPVDTDSGVHLIKRVA"
FT   gene            complement(<125475..>125924)
FT                   /locus_tag="KLTH0B01562g"
FT                   /old_locus_tag="KLTH-ORF15798"
FT   CDS_pept        complement(125475..125924)
FT                   /locus_tag="KLTH0B01562g"
FT                   /old_locus_tag="KLTH-ORF15798"
FT                   /product="KLTH0B01562p"
FT                   /note="similar to uniprot|P42937 YGR203W Saccharomyces
FT                   cerevisiae Probable protein tyrosine phosphatase of the
FT                   CDC25-like phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21420"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA9"
FT                   /protein_id="CAR21420.1"
FT                   /translation="MNSRSVAAIRYVDAAELFQWIKRGTTGAGEPFQVIDVRGSDYIGG
FT                   HIVNGWNYPYRELRDGGARMEELMQRLRSAAGAAGAQPINCVFHCAQSQQRGPSAAMKF
FT                   LRSVADEDLARMRVCVLRGGFNHWQAEYGEDASVTEAYVPDLWRM"
FT   gene            <126091..>127368
FT                   /locus_tag="KLTH0B01584g"
FT                   /old_locus_tag="KLTH-ORF15797"
FT   CDS_pept        126091..127368
FT                   /locus_tag="KLTH0B01584g"
FT                   /old_locus_tag="KLTH-ORF15797"
FT                   /product="KLTH0B01584p"
FT                   /note="weakly similar to uniprot|P13259 Saccharomyces
FT                   cerevisiae YGR202C PCT1 Cholinephosphate
FT                   cytidylyltransferase, also known as CTP:phosphocholine
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21421"
FT                   /db_xref="GOA:C5DCB0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR041723"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB0"
FT                   /protein_id="CAR21421.1"
FT                   /translation="MAKDSSQGSLKSRLSSGSLTNLFKLNRKRRLDDEDSDSAASHSGE
FT                   SGSESRSETKKRRRSAGEASEPQQGMDKQQQEQEREWDAALPEELRKFRPVGFPLNLPP
FT                   TDRPVRVYADGVFDLFHLGHMKQLEQCKKCMPNVTLICGVPSDRITHKLKGLTVLSDVQ
FT                   RYETLRHCRWVDEVVEDAPWCVTPEFLEQHRIDYVAHDDLPYAAADSDDIYRPIKQMGK
FT                   FVATQRTDGISTSDIITRIIRDYDKYLMRNFARGATRRELNVSWLKKNELEFKKHIQDF
FT                   RSYFKKSHDSINHASKDLYVEVREMLLRKTLGKKVYSKLAGQDRPQQALRGSSPASEFA
FT                   RTFTDHHGGANALESSHESSHEGSREDSHDYDDQEDHNDDDDDDDGSESDRANEKEREN
FT                   DDSSYKDTDSSGSSRRTRRARHAGGR"
FT   gene            <127592..>129364
FT                   /locus_tag="KLTH0B01606g"
FT                   /old_locus_tag="KLTH-ORF15790"
FT   CDS_pept        127592..129364
FT                   /locus_tag="KLTH0B01606g"
FT                   /old_locus_tag="KLTH-ORF15790"
FT                   /product="KLTH0B01606p"
FT                   /note="highly similar to uniprot|P39522 Saccharomyces
FT                   cerevisiae YJR016C ILV3 Dihydroxyacid dehydratase catalyzes
FT                   third step in the common pathway leading to biosynthesis of
FT                   branched-chain amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21422"
FT                   /db_xref="GOA:C5DCB1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB1"
FT                   /protein_id="CAR21422.1"
FT                   /translation="MGFLGRLSSTETRRCFSNTRNVYKKLNKYSYIITEPKDQGASQAM
FT                   LFATGFKQEDFNKPQVGVGSCWWSGNPCNMHLLDFNHRITASVEKAGLKGMQFNTIGVS
FT                   DGISMGTKGMRYSLQSREIIADSFETIMMAQHYDANIAIPSCDKNMPGVLMAMGRHNRP
FT                   SIMVYGGTILPGHPSCGSQNIPKNIDVVSAFQSYGQYLSKSFTENERQDVVKNACPGPG
FT                   SCGGMYTANTMASVAEVLGITLPNSSSHPAVSKEKLAECDSIGEAIKKTMELGITPRDI
FT                   MTKEAFLNAITYVVATGGSTNAVLHMVAVAQSAGVKITPDDFQRISDKTPLLGDFKPSG
FT                   KYVMADLIKVGGTQSVIKFLYEEGFLNGNTMTVTGETLEQRAAKAAPLPEGQDIIKPIS
FT                   QPIKPQGHLQILYGSLAPGGAVGKITGKEGTYFKGKARVFDEEAGFIHALERGEIKKGE
FT                   KTVVVIRYEGPKGGPGMPEMLKPSSALMGYGLGKDVALLTDGRFSGGSHGFLIGHIVPE
FT                   AAEGGPIALVKDGDEIIIDSNNNKIDVCVSEEELAQRKTQWQEPAPRYARGTLSKYRKL
FT                   VSNASLGCVTDGDN"
FT   gene            <129632..>132004
FT                   /locus_tag="KLTH0B01628g"
FT   CDS_pept        129632..132004
FT                   /locus_tag="KLTH0B01628g"
FT                   /product="KLTH0B01628p"
FT                   /note="similar to uniprot|P42935 Saccharomyces cerevisiae
FT                   YGR200C ELP2 Elongator protein part of the six- subunit RNA
FT                   polymerase II Elongator histone acetyltransferase complex
FT                   target of Kluyveromyces lactis zymocin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21423"
FT                   /db_xref="GOA:C5DCB2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR037289"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB2"
FT                   /protein_id="CAR21423.1"
FT                   /translation="MSGMAKAEAIFIGGNRQTQASDYNPKHGILAYGAGKTIAFWKPLD
FT                   PAHRGVYATLKGHDAEVTCVRFVPGTEFMITASEDSQVRLWAFDGEDNSAMACIQSTDH
FT                   HKHTITSLSVLSNLLTVGCADGSVSVWQINERQISLVHSFVLKAGVFPLCMALKSVEDS
FT                   KVLLAVGGTNSNVFIYSFTREAAALENFQLAATLEGHEDWIKAMDFYEEGPGNMLLATG
FT                   SQDRYIRLWRIRTNDLIDNSDEDDSKLKLLSNKQSKFYIDGSLRVAINFEALIIGHDDW
FT                   VSCLKWHSDKLQLLASTADTAVMVWEPDAESGIWVCASRLGELSSKGASTATGSSGGFW
FT                   SCNWFTQEKADYILTNGKTGSWRMWKSDDISGWEQQLAITGPTKPTTDVAWSPNGLYLL
FT                   GTSLDQTTRLFARCKLDGEQDKISGSWFEFSRPQIHGYDMICVEPISNTRFISGGDEKI
FT                   MRSFDEPKGVAQILQKFAGVPFENEKYMPESASLPALGLSSKATADVDEDEDEDPDARE
FT                   TNETKNISFDIVASLHSPPVEDQLQRHTLWPEIEKLYGHGYEISCLDVSPDAKIIASAC
FT                   RSNNLQHAVIRFFDSNTWLHLEPAPQFHNLTITRLRFSKDNTQLLSVSRDRQWAVWKRD
FT                   LETNQFTLAYKNEKAHTRIIWDCEWAPLSFGSVFLTASRDKSIKLWRFSEEEQDYLQEA
FT                   SIKLGISVTAISVHEKLFDNKLIIAAGLENGSLQVYTYENEFQKVLEIEDRYTPADRIS
FT                   RLRWSSNGNELFLAAASADTSFRIYSVKSESIKNSPN"
FT   gene            complement(<132053..>134317)
FT                   /locus_tag="KLTH0B01650g"
FT                   /old_locus_tag="KLTH-ORF15784"
FT   CDS_pept        complement(132053..134317)
FT                   /locus_tag="KLTH0B01650g"
FT                   /old_locus_tag="KLTH-ORF15784"
FT                   /product="KLTH0B01650p"
FT                   /note="similar to uniprot|P42934 Saccharomyces cerevisiae
FT                   YGR199W PMT6 Transfers mannose residues from dolichyl
FT                   phosphate-D-mannose to specific serine/threonine residues
FT                   of proteins in the secretory pathway dolichyl phosphate-D-
FT                   mannose:protein O-D-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21424"
FT                   /db_xref="GOA:C5DCB3"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB3"
FT                   /protein_id="CAR21424.1"
FT                   /translation="MSSSGFLPKSSELNLRERRKNFDGDQLSDTDDNELHEKNDEKLVE
FT                   THGAELKKRKIAKFANMGGIAAITLLSFYVRFMKIDASDIVVWDEAHFGKFGSYYIKHE
FT                   FYHDVHPPLGKMLIALSEYLAGFDGNFDFSSGDPYPNGVNFKFMRQFNATFGALCAPIM
FT                   LLSAQNLGFSTLCSYLLGLMVALELSFISLSKFILLDSMLLFFTATTFHCITEVHKLRG
FT                   KQFTKKWSLWMLLLGISIGCVCSVKWVGLFVTVIAGVYTVADLLSYHYDKNMGRLRYYK
FT                   HWFIRIIDLIVIPFMIYLFCFKIHFTILSRSGTGDAATNTLFQVNLDGNNIEVGPRDVA
FT                   YGSELTIRSHGLSPNLLHSHVQLYPLGSGQHQVTGYGHSDDNNRWVVKFSRESGLSLDN
FT                   STILDSKHLLLRDNSEIRLVHKNTQANLHSHEIPAHVSKNSYEVSGYGDEVIGDTKDDW
FT                   VVEIVEQLDSSNSSLPQEDPSVLHPISTSFRLRHKELGCYLATTGLAYPAWGFKQAEIV
FT                   CKHSWTKRDKSTWWNVEDHWNPAMEKTEGYIPPKSKFWADFVLINFAMASSNNALVPDE
FT                   DKYDSLASEAWEWPILHVGLRMCGWGHHTVKYFLMGSPFQTWLSTGSLVAFVFIILRLA
FT                   YKWRRQSVLVTSDFLSKVGMQGILPFLAWLLHYLPFVAMGRVTYVHHYVPALYFALLVL
FT                   GFVLETCVPKRFYLNYIIYALLYAGCIYIYNLFSPIAQGMQGSAIDFRYLQWFNTWNIA
FT                   L"
FT   gene            complement(<134593..>136791)
FT                   /locus_tag="KLTH0B01672g"
FT                   /old_locus_tag="KLTH-ORF15782"
FT   CDS_pept        complement(134593..136791)
FT                   /locus_tag="KLTH0B01672g"
FT                   /old_locus_tag="KLTH-ORF15782"
FT                   /product="KLTH0B01672p"
FT                   /note="similar to uniprot|P46951 Saccharomyces cerevisiae
FT                   YGR198W Essential protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cytoplasm in a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21425"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB4"
FT                   /protein_id="CAR21425.1"
FT                   /translation="MQEDYEQVEAALGSRLLGASEFRTKNKRLNQVLSLQYRVHYHVHQ
FT                   KGIIKEAACKVLLEECNRFERDSSDALVEKVWLNLAGILNYHLSHPQTADKCLAESAKI
FT                   SAAQGAFGTFLSVENLYYSGLLRGDKSRDFYVKHLPEVVTSLPKESNVLTYHYLDRIIS
FT                   RLSMNWSQAISAFPRTVISSFIAIMSEPDGHDQELLALGKTILASAKFPNAEEANNASL
FT                   EQFHLVLQHYLRSTKSELSPDWHSFVVESMSRTFQSMIVTKTAMIYFGRENQLRESILN
FT                   FNVFLNYNRSYRDLNNGEWFDVLAIIDAYEHIVSRSEGRDIPKIFALKDVMKRFEGLLC
FT                   SFYEDSALPLVKVERSIEWASEGTRVFVPERASSLLARSWNALYEYSREDLDKLLNDNH
FT                   TYYLANALAARPDNSKIAFNYAFTLAQKREITHAVKFLKSNILEREPENYKAWHLLALC
FT                   ESIKEDKNVSFKIVCSVLQALENAVHEDPQAPARDRWQLIHLKLTQLAIIQEMFGVNDA
FT                   LELLPELFELFNFAFPENGKNGDLGSAYNKTKDYLHQSVWLFAVKLYLTQGLIVDAREA
FT                   LAESRNVTKNFQNLNNDLADGYLSLDVDGKKALRSFEKVLFYDALNIDAIVGFAKCLVP
FT                   TSQENSSHQLQPQTPSAAGLDAFTGEKDRSAAYARLKMVLEEVVERSIEGCHAPEVWWY
FT                   LSRVYENYDDTERLETSLWNCVKYQELQPIRDFKNCNF"
FT   gene            complement(<136942..>137535)
FT                   /locus_tag="KLTH0B01694g"
FT                   /old_locus_tag="KLTH-ORF15779"
FT   CDS_pept        complement(136942..137535)
FT                   /locus_tag="KLTH0B01694g"
FT                   /old_locus_tag="KLTH-ORF15779"
FT                   /product="KLTH0B01694p"
FT                   /note="similar to uniprot|P47089 Saccharomyces cerevisiae
FT                   YJR014W RBF22 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21426"
FT                   /db_xref="GOA:C5DCB5"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005873"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB5"
FT                   /protein_id="CAR21426.1"
FT                   /translation="MSLRTVIYCGVCSFPPEFCEFTGKLKRCKVWLLENHPEKYQSLYG
FT                   DAEVEDAAAKLAGSSIGEEREEKLEKDLLKLQSKQENREQRELAKKLSSKVIIKREART
FT                   KRKTMVAIAGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIIIQGDVADEAETYI
FT                   QKLLEEKGLKEVKVEQMDMKKKKKPTTTTPTPAA"
FT   gene            <137755..>140211
FT                   /locus_tag="KLTH0B01716g"
FT                   /old_locus_tag="KLTH-ORF15778"
FT   CDS_pept        137755..140211
FT                   /locus_tag="KLTH0B01716g"
FT                   /old_locus_tag="KLTH-ORF15778"
FT                   /product="KLTH0B01716p"
FT                   /note="weakly similar to uniprot|P46949 Saccharomyces
FT                   cerevisiae YGR196C FYV8 Protein of unknown function
FT                   required for survival upon exposure to K1 killer toxin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21427"
FT                   /db_xref="InterPro:IPR026248"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB6"
FT                   /protein_id="CAR21427.1"
FT                   /translation="MSDNVERRKSQRWVSVGKGSYDGKEWDSSDEDGSYEAWEDDNGET
FT                   AQSPKRSGTVTKLPPLPKLQYGRDVDSAPEGSNGSSPKLESTSSNLDQLMSQISHEMTP
FT                   RSESRERFSPNDGTPRPPRQFGDEGDEHSSAFSYSDSEEELQVSKTGYFSNMVGATQSA
FT                   GRSGSYSDDEVYVTPDPSSLSRATAEPEAARMDTRGSDSASSAAHASKSELERYNASPD
FT                   DRESMSASTTEVSKSSSPKENSASLSGGQPASVKSDNGSSETDHLTGSVLSSADEVHTG
FT                   SKDVQSGLESVQGSQPSGSAVEESKETISKGTLAHQGDDTAPQQEPHESHGTPIKDARN
FT                   NSSDEYGDNESFFNHYGNNSSQSSPANNPDNSPKKHDSSPLKLRQSSKTQLGYENVKSQ
FT                   AQDENSSDNASSTSEPGSFKFKDRVRESILESSDEDIGDDESVLRVPTSGYYAKMLKDS
FT                   SQAERGDDQSTETEGSSIVSSETDTGSITKSINGSNQDGATTPEAISPRKHNEEDQTTD
FT                   TEPLEEQEGSKNLQSRQSINLGKWQPDTDATRAAFLGEARPEVPEDFVIDQDGNMVDVN
FT                   PSSMRNPRVVSTYSEAESAWNAFPSAGNAEGDLDTIYDTKTIYDNQTIYNVPGIATNNS
FT                   SLPPLPNNISALESSDSAAVTDSDSILRHLSGEKKPHFSNLKENFSVHTPNSEEIAQVR
FT                   GREAPSVNLDSLISAKGKTHAMKISDLRNHSEQLNAYDTGLHTWINYALKNSSSDKDYI
FT                   FQDYKVNKHVRDAYAQADELSKKMTVSNTVANVNQNVSHLKRKVFSHTMKEKSKGLFSS
FT                   IGKKKA"
FT   gene            complement(<140265..>141002)
FT                   /locus_tag="KLTH0B01738g"
FT                   /old_locus_tag="KLTH-ORF15773"
FT   CDS_pept        complement(140265..141002)
FT                   /locus_tag="KLTH0B01738g"
FT                   /old_locus_tag="KLTH-ORF15773"
FT                   /product="KLTH0B01738p"
FT                   /note="highly similar to uniprot|P46948 Saccharomyces
FT                   cerevisiae YGR195W SKI6 superkiller ExtraCellular Mutant
FT                   Ribosomal RNA Processing homolog of RNAse PH"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21428"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB7"
FT                   /protein_id="CAR21428.1"
FT                   /translation="MSRLEIYSPEGLRVDGRRWNELRRLECSINTHANASDGSSYLEQG
FT                   NNKVITLVTGPQEPKLRSQMNVTKATISVALNITRFSKIERSKSSHKNERRVLEMQTAL
FT                   VRTFEKNVMLHLYPRTQIEIQIHVLQQDGGLMSSLINGITLALIDAGIAMYDYISGVSI
FT                   GLYDTTPLLDLNSVEENAMSSVTLGVVGKSEKLSLLLVEDKIPLDRMESVLAIGIAGSH
FT                   RIRELMDKELRKHGERRLANMST"
FT   gene            complement(<141964..>143148)
FT                   /locus_tag="KLTH0B01760g"
FT                   /old_locus_tag="KLTH-ORF15771"
FT   CDS_pept        complement(141964..143148)
FT                   /locus_tag="KLTH0B01760g"
FT                   /old_locus_tag="KLTH-ORF15771"
FT                   /product="KLTH0B01760p"
FT                   /note="similar to uniprot|P47088 Saccharomyces cerevisiae
FT                   YJR013W GPI14 Glycosylphosphatidylinositol- alpha 1 4
FT                   mannosyltransferase I involved in GPI anchor biosynthesis
FT                   requires Pbn1p for function homolog of mammalian PIG-M"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21429"
FT                   /db_xref="GOA:C5DCB8"
FT                   /db_xref="InterPro:IPR007704"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB8"
FT                   /protein_id="CAR21429.1"
FT                   /translation="MDTATVSLFLGALALRLGFFFYGIYQDKYFEVKYTDVDYFVFNDA
FT                   ASYVFHGLSPYLRDTYRYTPLLSWLLVPNHYLQWIHFGKMMFVLFDLLTGLLILNLLEA
FT                   QSKRKKLILSSLWLLNFMVITISTRGNAESVLCFLILLSLYFLKARQFVLSGLFLGFAI
FT                   HFKIYPIIYSIPIAVYVYRQRQGGLFNVFKVGVSAILALAGTSYWMYQIYGMEFLDNAY
FT                   FYHLSRTDHRHNFSVFHMLLYFESALPTDSFWAKLAFLPQAAITLGVVPLLLRDPSFNS
FT                   LLSLLFIQTFAFVTYNKVCTSQYFIWYLIFLPFYLARTSITLKKGLTMALIWVGTQGAW
FT                   LFFGYLLEFKGKNVFYPGLFLASLSFFLGNVWILGQFIDDFKVKTELSEEKKKR"
FT   gene            <143331..>143672
FT                   /locus_tag="KLTH0B01782g"
FT                   /old_locus_tag="KLTH-ORF15770"
FT   CDS_pept        143331..143672
FT                   /locus_tag="KLTH0B01782g"
FT                   /old_locus_tag="KLTH-ORF15770"
FT                   /product="KLTH0B01782p"
FT                   /note="some similarities with uniprot|P47087 Saccharomyces
FT                   cerevisiae YJR012C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21430"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB9"
FT                   /protein_id="CAR21430.1"
FT                   /translation="MSGPLTYEELVDHIVNEKPIPNILSVPNVTLDPSLVTKSNMKPRP
FT                   KPWERNNAATSELAGEPPHQQTAVAEGPEICTRSRSSESLSKYYAIEAEFEQQLQSFLG
FT                   GNEESEKLQ"
FT   gene            complement(<143910..>144818)
FT                   /locus_tag="KLTH0B01804g"
FT                   /old_locus_tag="KLTH-ORF15768"
FT   CDS_pept        complement(143910..144818)
FT                   /locus_tag="KLTH0B01804g"
FT                   /old_locus_tag="KLTH-ORF15768"
FT                   /product="KLTH0B01804p"
FT                   /note="weakly similar to uniprot|P38087 Saccharomyces
FT                   cerevisiae YBR104W YMC2 Putative mitochondrial inner
FT                   membrane transporter, member of the mitochondrial carrier
FT                   (MCF) family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21431"
FT                   /db_xref="GOA:C5DCC0"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC0"
FT                   /protein_id="CAR21431.1"
FT                   /translation="MSARTDNNVVVPNEAYSRIMGFVSGMFSGLAKNAVGHPFDTVKVR
FT                   LQTSQDTGRFKGPLDCVYQTMRQQGVRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLK
FT                   KYVYQHEEKLPLSGCILSGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYRGPIDVIK
FT                   KVYVADGIRGLYKGLISTLIFRTHFIYWWGSYELLTRWFKANTNLSDTAINFWAGGFSA
FT                   SFGFWTTAYPSDVIKQVVLCSDKYDGSFKSWKMAASDIWRSKGFKGFFKGFVPSFLRSF
FT                   PANAAALASFEFVLRVSGAKP"
FT   gene            <145103..>145798
FT                   /locus_tag="KLTH0B01826g"
FT                   /old_locus_tag="KLTH-ORF15767"
FT   CDS_pept        145103..145798
FT                   /locus_tag="KLTH0B01826g"
FT                   /old_locus_tag="KLTH-ORF15767"
FT                   /product="KLTH0B01826p"
FT                   /note="some similarities with uniprot|P47086 Saccharomyces
FT                   cerevisiae YJR011C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21432"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC1"
FT                   /protein_id="CAR21432.1"
FT                   /translation="MDSQAFSPSFEDELTRCATIIERFIVSLVNVAYYACFHKQNEDAS
FT                   PSTAAAKSAAFKKVRDSLLALAVRAEKLTSSEKISPADMKGLVCRDFLQELHRCSEVAS
FT                   DELLQVLNPITTKPLDGYEEPSSLNKIPTHLRNCILGFVQIFHFFRKLPVQEQYHISAL
FT                   QARILERELKSDLLGPWTRQVETLHSTIGWILLSDSHFQQKLNEYKSKTQTEPGALAFN
FT                   EWLRHEIRQ"
FT   gene            <146051..>146317
FT                   /locus_tag="KLTH0B01848g"
FT                   /old_locus_tag="KLTH-ORF15766"
FT   CDS_pept        146051..146317
FT                   /locus_tag="KLTH0B01848g"
FT                   /old_locus_tag="KLTH-ORF15766"
FT                   /product="KLTH0B01848p"
FT                   /note="similar to uniprot|P46965 Saccharomyces cerevisiae
FT                   YJR010C-A SPC1 Subunit of the signal peptidase complex
FT                   (SPC) which cleaves the signal sequence from proteins
FT                   targeted to the endoplasmic reticulum (ER) homolog of the
FT                   SPC12 subunit of mammalian signal peptidase complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21433"
FT                   /db_xref="GOA:C5DCC2"
FT                   /db_xref="InterPro:IPR009542"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC2"
FT                   /protein_id="CAR21433.1"
FT                   /translation="MSEVLQEIQKKLVFPIDFASQRRLDRSVYLCLMIGTVVSCFIGLF
FT                   TQSLFNLVVSFGLTFCVCLALGLPSYPAYNKQRLEWVKPKISH"
FT   gene            <146628..>148373
FT                   /locus_tag="KLTH0B01870g"
FT                   /old_locus_tag="KLTH-ORF15764"
FT   CDS_pept        146628..148373
FT                   /locus_tag="KLTH0B01870g"
FT                   /old_locus_tag="KLTH-ORF15764"
FT                   /product="KLTH0B01870p"
FT                   /note="similar to uniprot|P42826 Saccharomyces cerevisiae
FT                   YGR194C XKS1 third enzyme in the xylose pathway;
FT                   Xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21434"
FT                   /db_xref="GOA:C5DCC3"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC3"
FT                   /protein_id="CAR21434.1"
FT                   /translation="MTADKVGAFYLGFDLSTQQLKCLVIDQNLALVHSETIGFDKDLSH
FT                   YKTTKGVYLHEDGTVECPVAMWLEAVDLVFERMSKHKHIDLSLVRAMSGSCQQHGSVYW
FT                   AESGPGLLPKLDSKQSLKQQLYPEAFSRNVAPNWQDHSTGEECREFEESCGGAAQLAQV
FT                   TGSRAHHRFTGPQIMKIAKKEPEVYRATSKVSLVSSFLASILAGEFTPLEEADACGMNL
FT                   YNIDKRDYDDKLLRNVDDDTETLRSKLGGPPINCDKPAPVGTLSPYFVEKYGLNPECQI
FT                   FPFTGDNLATICSLPLQPNDVLVSLGTSTTILLVTDQYHPSPNYHLFIHPTIPRHYMGM
FT                   ICYCNGALARERIRDQLSETHDWEPFNAAVKSTTLNTDNEIACYFPLGEIVPNVPSSYR
FT                   RATFAKSPDSQEVKLELKDAFADIAHDAKNIVESQALSCRVRISPLLSKDCADPSVDLG
FT                   DSMVHFDCDDFPLSEYKKRPRRAFFVGGASKNDAIVERFAQVLGATDGNFRLETPNSCA
FT                   LGGCYRAMWSHLYYGGLTKAPFDNFLNEQFRWDTDVQSLSLTKDKEWQYFNNKIQALSE
FT                   LEKTL"
FT   gene            <148776..>150023
FT                   /locus_tag="KLTH0B01892g"
FT                   /old_locus_tag="KLTH-ORF15759"
FT   CDS_pept        148776..150023
FT                   /locus_tag="KLTH0B01892g"
FT                   /old_locus_tag="KLTH-ORF15759"
FT                   /product="KLTH0B01892p"
FT                   /note="similar to uniprot|P16451 Saccharomyces cerevisiae
FT                   YGR193C PDX1 Dihydrolipoamide dehydrogenase (E3)-binding
FT                   protein (E3BP) of the mitochondrial pyruvate dehydrogenase
FT                   (PDH) complex plays a structural role in the complex by
FT                   binding and positioning E3 to the dihydrolipoamide
FT                   acetyltransferase (E2) core"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21435"
FT                   /db_xref="GOA:C5DCC4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC4"
FT                   /protein_id="CAR21435.1"
FT                   /translation="MIARGLLRGNAGRLACLRALHRSSALSKAQTFAMPAMSPTMEKGG
FT                   IVEWKFKVGDPFSAGDVLLEVETDKAQIDVEAQDDGKLAKIVVDNGAKDINVGEVIAYL
FT                   AEPEDDLATLELPQPEKSTGKSKAETKSAAKPSATAKTSPASISQENKPEPKKNAPSKS
FT                   SSDSKSSTGVAVKANPSQTLLPSVQMLLHVNNISAEDALNNIPASGPNGRILKGDVLSY
FT                   LGKVSQESVTKLAEYIEKGSALDLTNIELKEPEPAPKAKEEVAKKEPVVLSEQLHLKVA
FT                   SGVTYEQLARSLESYVKEAKYLAHEQPTTNPYSEHFDAVFEELITPEPRAPRFEVSYDL
FT                   ISLGSSGISAKQQDDIFDLLAGTKPSPAASEVETAQPNEFLVSVRVQVSDKFTDAPTKA
FT                   ERFVQYLRDLESSAEL"
FT   gene            complement(<150142..>151659)
FT                   /locus_tag="KLTH0B01914g"
FT                   /old_locus_tag="KLTH-ORF15757"
FT   CDS_pept        complement(150142..151659)
FT                   /locus_tag="KLTH0B01914g"
FT                   /old_locus_tag="KLTH-ORF15757"
FT                   /product="KLTH0B01914p"
FT                   /note="highly similar to uniprot|P08536 Saccharomyces
FT                   cerevisiae YJR010W MET3 ATP sulfurylase catalyzes the
FT                   primary step of intracellular sulfate activation essential
FT                   for assimilatory reduction of sulfate to sulfide involved
FT                   in methionine metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21436"
FT                   /db_xref="GOA:C5DCC5"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027535"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC5"
FT                   /protein_id="CAR21436.1"
FT                   /translation="MPAPHGGVLQDLIARDAQIKDQLLQEAAQASIKWDLTPRQICDLE
FT                   LIQNGGFSPLSGFMNQKDYDGVVEKSRLSNGLVWTIPINLDVDEAFAKQLKPDARVVLL
FT                   QDNEIPVAILTVTDVYKPDKQNEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYP
FT                   VHYDYPGLRKTPAQLRLEFDSKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHP
FT                   VVGLTKPGDIDHHTRVRVYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYG
FT                   ATHFIVGRDHAGPGKNSAGVDFYGAYDAQELVESYKNELGIEVVPFRMVTYLPEEDRYA
FT                   PIDQIDLSTTSTLNISGTELRNRLRSGGPIPEWFSYPEVVKILRESNPPRPKQGFAIVL
FT                   SSSLKSNKQLSTALLTTFLQFGGGRHFKVLEHNNDANVLGLVPDFISSGAGLIIPSQYE
FT                   KWNSVSNAYLVGTSEDADITLDSDDEAVLHVVQKVVLFLEDHGFFTF"
FT   gene            complement(<152392..>153252)
FT                   /locus_tag="KLTH0B01936g"
FT                   /old_locus_tag="KLTH-ORF15751"
FT   CDS_pept        complement(152392..153252)
FT                   /locus_tag="KLTH0B01936g"
FT                   /old_locus_tag="KLTH-ORF15751"
FT                   /product="KLTH0B01936p"
FT                   /note="similar to uniprot|P38892 Saccharomyces cerevisiae
FT                   YHR209W Putative S-adenosylmethionine-dependent
FT                   methyltransferase of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21437"
FT                   /db_xref="GOA:C5DCC6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC6"
FT                   /protein_id="CAR21437.1"
FT                   /translation="MSLYLNGVIDSDKYQKYRITYPKSLYEAIMAHHAGGRLLAVDVGC
FT                   GTGIGTFPLLEYFDTVVGCDPSAKMLATAAQVREKLPGVSRRRVSFQQAAGEDISRLFE
FT                   ERSVDMITGGESIQYVKHDEFFRAAARLLRPGATLAFWFYADPVFVDYPEANAIFKHCA
FT                   YEDQRSFAPLWPPEMELVRRLGESIQVPSHEFEMVHSEVNVPLKTKGTRSFRVTREGCT
FT                   LKDLRDLISTWSVYDAWKKNNKDCAEDVIDALIEKLKRGCGWDDNIKLRLEWETSFYVA
FT                   RRRQT"
FT   gene            <154881..>155879
FT                   /locus_tag="KLTH0B01958g"
FT                   /old_locus_tag="KLTH-ORF15741"
FT   CDS_pept        154881..155879
FT                   /locus_tag="KLTH0B01958g"
FT                   /old_locus_tag="KLTH-ORF15741"
FT                   /product="KLTH0B01958p"
FT                   /note="highly similar to uniprot|P00358 TDH2, to YGR192C
FT                   uniprot|P00359 TDH3 and to YJL052W uniprot|P00360 TDH1
FT                   Saccharomyces cerevisiae glyceraldehyde 3-phosphate
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21438"
FT                   /db_xref="GOA:C5DCC7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC7"
FT                   /protein_id="CAR21438.1"
FT                   /translation="MVTTVAINGFGRIGRLVLRIALSRKDLKVVAINDPFISVDYAAYM
FT                   FKYDSTHGRYQGTVSHEGSDLVIDGQKIAVFQERDPAQLPWGKLNVDIAIDSTGVFKEL
FT                   DSAQKHIDAGAKKVVITAPSSTAPMFVVGVNEDEYKGQNIVSNASCTTNCLAPLAKVIN
FT                   DKFGIEEGLMTTVHSLTATQKTVDGPSQKDWRGGRTASGNIIPSSTGAAKAVGKVLPVL
FT                   QGKLTGMAFRVPTVDVSVVDLTVKLAKETTYDEIKAAVKEASEGKMKGVLGYTEEDVVS
FT                   SDFLSDSHSSIFDASAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHVAKA"
FT   gene            complement(<156072..>157040)
FT                   /locus_tag="KLTH0B01980g"
FT                   /old_locus_tag="KLTH-ORF15739"
FT   CDS_pept        complement(156072..157040)
FT                   /locus_tag="KLTH0B01980g"
FT                   /old_locus_tag="KLTH-ORF15739"
FT                   /product="KLTH0B01980p"
FT                   /note="similar to uniprot|P47085 Saccharomyces cerevisiae
FT                   YJR008W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21439"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC8"
FT                   /protein_id="CAR21439.1"
FT                   /translation="MSVRPASHAGSWYSTNSGKLGLQLQQYLGQGLPVAGARVIISPHA
FT                   GYAYCGATMGKVYAALDLTNVKRIFVLGPSHHIYFKNRAHVSNFKEVATPLGSLPVDIA
FT                   TVKELVEDEAFEYMDPEVDVEEHSLEMQFPMLRALLKLRGVDTASVGVVPIMISHNSTR
FT                   SDQHLGKVLSEYLADQSTVFIISSDFCHWGRRFSFTGYVGDKSEIQEALAEDTEIESLT
FT                   ARSKLSHHQVPIWKSIEILDQYAMSILSQTEPRDKYELWKHYLEVTGNTICGEKAISVM
FT                   LCALSHQAEPAVFQWPAYAQSSQVTSVMDSSVSYGGGYCKI"
FT   gene            complement(<157328..>158236)
FT                   /locus_tag="KLTH0B02002g"
FT                   /old_locus_tag="KLTH-ORF15736"
FT   CDS_pept        complement(157328..158236)
FT                   /locus_tag="KLTH0B02002g"
FT                   /old_locus_tag="KLTH-ORF15736"
FT                   /product="KLTH0B02002p"
FT                   /note="highly similar to uniprot|P20459 Saccharomyces
FT                   cerevisiae YJR007W SUI2 Alpha subunit of the translation
FT                   initiation factor eIF2 involved in the identification of
FT                   the start codon phosphorylation of Ser51 is required for
FT                   regulation of translation by inhibiting the exchange of GDP
FT                   for GTP"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21440"
FT                   /db_xref="GOA:C5DCC9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC9"
FT                   /protein_id="CAR21440.1"
FT                   /translation="MSTSNCRFYENKYPEVDDVVMVNVQQIAEMGAYVKLLEYDNIEGM
FT                   VLLSELSRRRIRSIQKLIRVGRNEVVVVLRVDKEKGYIDLSKRRVSSEDIIKCEERYQK
FT                   SKAVHSILRHCAEKFSFPLEDLYKSIAWPLSRKYGHAYDAFKLSIVDETVFEGIEPPSK
FT                   EIFEELRLYISRRLTPQAVKIRADIEVSCFSYEGIDAIKAALKAAEEMSTEQMQIKAKL
FT                   VAAPLYVLTTQALEKQHGIELLEKAIEKITKVITSHDGFCNITMAPKAVTATEDAELQA
FT                   LLENKALENGSDSEEEDSDYE"
FT   gene            complement(<158779..>163020)
FT                   /locus_tag="KLTH0B02024g"
FT                   /old_locus_tag="KLTH-ORF15733"
FT   CDS_pept        complement(158779..163020)
FT                   /locus_tag="KLTH0B02024g"
FT                   /old_locus_tag="KLTH-ORF15733"
FT                   /product="KLTH0B02024p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21441"
FT                   /db_xref="GOA:C5DCD0"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018515"
FT                   /db_xref="InterPro:IPR024584"
FT                   /db_xref="InterPro:IPR027107"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD0"
FT                   /protein_id="CAR21441.1"
FT                   /translation="MAPPLIYKAYTSGLKRELFRTLSGNFKSTPTPSNYEQCAVTKEPL
FT                   HAQKLIPLIADRASGYSSRARLVKEIIPELSFLSAESVLELWDGANDLIAPEIPSSTRA
FT                   YGLDLLHACIERLLPVMSETLRLAFFYNIMDNCGVADEKAGKAEKELHKVIKSLDALTC
FT                   HGTRLESILRADESTCGLEDFFESIFASISVGGEPKPPHQTVVSALRFAESCARHGVPI
FT                   TDELISCVVTISRGWDENEVRKGALDLLKAAFSERPVESKELSRSVLQALLTIYHENNE
FT                   LSDSVTETLHLALSGQNGTQLLPLFLDMGFFDGGNTDVSYISLLVSLLTVDNVEGLWQK
FT                   CGSSPRHIAELLLRLLRQEFNKHSSSNISASQLFGNILCLLESEEFLRWISKFRGFWLV
FT                   SEEEPSIQDLLTPFLQKVELDDLDVKYLRMIFNQILNISQSGNYKLFGINEFKDIFEFL
FT                   FAYSRHLNDSLANQLLDLLDQSTSDAVLVDGLVHDIITRVYLADFGTNVRCRTLEVIEK
FT                   CCYEIISKRKQWDSSLCRSLKHLFSMLETEKDNTVALKQIEIYCETCRYLPSGFIAAVN
FT                   SEVFGQAFTKPSSRRRSSLIPLSLGSSPAPAWSEVKLIKLTEGLAGLLVWCIAFERGDC
FT                   FGSFYRLLTKAAQYAYQTAQSELFLASARVLSKVYCGNSRQVVFQETNDVEGITIALNK
FT                   NSRAASTLENNGWSYPETIIYFNEAQSKVLKCDAYSPELVKDDFVTPGAVDIRTWISTA
FT                   IDMIGNPTTWEVYSYLLTFMCPQFANLVALRSIDDLVGLYRDVICRHMKSGLPSKLKIP
FT                   SGLCTDNLHAVYVRSLSPLLAYHSYLPKDFTDGIVESLLYGLHTKDSTLTLSLHLLTIC
FT                   CQEIPGSVKKLLTPILVQLQTRVTSSMCTPAILEFLLALSNSPFITSHLTADEFKRVFA
FT                   IAFKFIQSSRDLKERAQTQNIIQQISYLEQAADSSPSTHSFKITASVAHFFLTLSYKVI
FT                   SSWFLRMKLSNRVELAPFVVKCLVSSASEAESKDYDVSAHIDIISHLTATPHGPSFPHR
FT                   INEDRANESNDGYDFGRWILSDKIVSIETDIQTGDSVITMRSPSSSEVFKLQFERSQIP
FT                   KPYDIFRIGQEEEEEPSTEKFEQFKFTASFVLTQLGCVGRHPVKVPDDSSIARSVHLFD
FT                   KTPVSEYHKIGLIYVGPQQDSEAEVLSNTNGSYQYKLFLSRLGHLVKLKDCMNVYTGGL
FT                   EPDVDGEFALVYNAEKTQAVFHAATLMPNNPQDDQYSMKKRHIGNNFVTIFFDESGSAS
FT                   FDFNIIKSQFNFINIVIKPYQATDTGKGSKHFKVRMYRKAGVPAFFSTSHFKILSAENL
FT                   AKYVRHVSLIADTFSTCWFSASAPEVCTTWARRAKQMSSIREKTLKWYEGHGEPVSPPD
FT                   FASVVEAAGGL"
FT   gene            complement(<163199..>164968)
FT                   /locus_tag="KLTH0B02046g"
FT                   /old_locus_tag="KLTH-ORF15732"
FT   CDS_pept        complement(163199..164968)
FT                   /locus_tag="KLTH0B02046g"
FT                   /old_locus_tag="KLTH-ORF15732"
FT                   /product="KLTH0B02046p"
FT                   /note="similar to uniprot|P06775 Saccharomyces cerevisiae
FT                   YGR191W HIP1 High-affinity histidine permease also involved
FT                   in the transport of manganese ions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21442"
FT                   /db_xref="GOA:C5DCD1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD1"
FT                   /protein_id="CAR21442.1"
FT                   /translation="MAESRSTWQRMIDSFKPAETQPSRLRSARSRYDSADDRADSKQKD
FT                   LMSGSETKALENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTT
FT                   GGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLA
FT                   QWAVLLPLELVAASLTIRYWNHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVK
FT                   ILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAFVGHTAGDRFHGLCSVFVTAAFSY
FT                   SGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSS
FT                   VDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKV
FT                   FTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHI
FT                   RFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESF
FT                   FETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVDLELMKDEKRIEEQAMR
FT                   QKSLFARFIHLWC"
FT   gene            <165854..>165956
FT                   /locus_tag="KLTH0B02068r"
FT                   /old_locus_tag="Klth0B.tTrp.CCA.2"
FT   tRNA            join(165854..165889,165921..165956)
FT                   /locus_tag="KLTH0B02068r"
FT                   /old_locus_tag="Klth0B.tTrp.CCA.2"
FT                   /note="tRNA-Trp (CCA) cove"
FT   gene            <166400..>167779
FT                   /locus_tag="KLTH0B02090g"
FT                   /old_locus_tag="KLTH-ORF15720"
FT   CDS_pept        166400..167779
FT                   /locus_tag="KLTH0B02090g"
FT                   /old_locus_tag="KLTH-ORF15720"
FT                   /product="KLTH0B02090p"
FT                   /note="highly similar to uniprot|P53301 Saccharomyces
FT                   cerevisiae YGR189C CRH1 Putative glycosidase of the cell
FT                   wall may have a role in cell wall architecture"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21443"
FT                   /db_xref="GOA:C5DCD2"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017168"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD2"
FT                   /protein_id="CAR21443.1"
FT                   /translation="MVQVNKILTGIVGGAGLALAADSCNPLKSSGCSADAALAGSFSED
FT                   FTSEPAHFKKTEYATGIIDYSDSGMNMTIAKRYDNPSLKSDFYIMYGKVEVELKAAPGQ
FT                   GIVSSFYLQSDDLDEIDLEWVGGDTTQFQTNYFSKGNTATYDRGAFHSAASPQETFHNY
FT                   TIDWAMDKTVFYLDGVAVRTLTNDSSQGYPESPMYVMMGSWAGGDSDNAPGTIEWAGGL
FT                   TDYTQAPFSMFIKRVIVSDYSSGEEYSYNGQSGSWESIEAKNGEVYGRYDQAQSEFAAL
FT                   AGGESISSSATVHSSSTSSASRSASSTASSTSNSSSTVSSTSSTSSSASTTLSSSSKAG
FT                   YNSTSSAAPSSTSSLSSVSSKASTSSSAASTKASASSSVSSSAASSKASASASASSTAA
FT                   AASSKVSAATTTSASSTLATSTAEAASSSTSEYLAIATTNGAFALQSKLSSFLAALVFL
FT                   I"
FT   gene            complement(<167943..>168015)
FT                   /locus_tag="KLTH0B02112r"
FT                   /old_locus_tag="Klth0B.tLys.CTT.17"
FT   tRNA            complement(167943..168015)
FT                   /locus_tag="KLTH0B02112r"
FT                   /old_locus_tag="Klth0B.tLys.CTT.17"
FT                   /note="tRNA-Lys (CTT) cove score=77.79"
FT   gene            <168159..>168626
FT                   /locus_tag="KLTH0B02134g"
FT                   /old_locus_tag="KLTH-ORF15715"
FT   CDS_pept        168159..168626
FT                   /locus_tag="KLTH0B02134g"
FT                   /old_locus_tag="KLTH-ORF15715"
FT                   /product="KLTH0B02134p"
FT                   /note="similar to uniprot|P47076 Saccharomyces cerevisiae
FT                   YJL011C RPC17 RNA polymerase III subunit C17 physically
FT                   interacts with C31 C11 and TFIIIB70 may be involved in the
FT                   recruitment of pol III by the preinitiation complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21444"
FT                   /db_xref="GOA:C5DCD3"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="InterPro:IPR038846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD3"
FT                   /protein_id="CAR21444.1"
FT                   /translation="MKIESVRDAFLSDYEVLQFLSQLERRHDWGLNQDDELAAGNNRKR
FT                   KRRPYNHPELQAITRDTIRYLSEAKGAADAEESEAGAGDTKSPLTKLNDKKFAELMTQL
FT                   NQFSLFKAEKLQIVNQLPTNLVHLYAIVEECDSRFSEEQSGQILEIVRNAC"
FT   gene            <169117..>171258
FT                   /locus_tag="KLTH0B02156g"
FT                   /old_locus_tag="KLTH-ORF15711"
FT   CDS_pept        169117..171258
FT                   /locus_tag="KLTH0B02156g"
FT                   /old_locus_tag="KLTH-ORF15711"
FT                   /product="KLTH0B02156p"
FT                   /note="highly similar to uniprot|P47075 Saccharomyces
FT                   cerevisiae YJL012C VTC4 Phosphate metabolism transcription
FT                   is regulated by PHO system polyphosphate synthetase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21445"
FT                   /db_xref="GOA:C5DCD4"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD4"
FT                   /protein_id="CAR21445.1"
FT                   /translation="MKFGEQLNRSLIREYSYYYICYDDLKTELEENLESNNGEWSEALE
FT                   TQFLESLEVELDKVYTFCKVKHNEVVRRVKEAQEQVHMTVRAIESNAPPSELDFEILEE
FT                   ELSDIIADVHDLAKFARLNYTGFQKIIKKHDKKTKFILKPVFQVRLDAKPFFKENYDDL
FT                   VVKISQLYDLVRTRGNPIKGDSSSGGKQQNFIRQTTKYWVHPDNITELKLIILKHLPVL
FT                   VFNTNKEFEKEDSAITSIYYDNENLDLYYGRLRKDEGAEAHRLRWYGGMSSDTIFVERK
FT                   THREDWTGEKSVKARFALKERYVNDFMHGNYTVEQAFAKMRKDGKKSLKEIENLEALAT
FT                   EIQYTMLKKKLRPVVRSFYNRTAFQLPGDARVRISLDTELSMVREDNFDGYDRTKGNWR
FT                   RMDIGVDWPFKQLPEKDICRFPYAVLEVKLQTQLGQEPPEWVRELVGSHLVEPVPKFSK
FT                   FIHGVATLLNNKVESIPFWLPQMDVDIRKPPIPTHINISRPGRSDNDSDDDLYTNESHP
FT                   AGNLMDPEERVGYGAIEGGDPQNSQPAADQHSASAVLQRKARNASNPVTRMFYQVGAAV
FT                   DHYLHGDQVTKVPQGTVFDTEVRAPPGKTICVPVRVEPKVYFATERTFLSWMSIGLIFN
FT                   GVAISMLTYGTRTTMVASVGFFLTALVTIIYNAYVYCKRVVNIRLKRAIDYQDKVGPPL
FT                   VCACLLASTIFSFYCKLAS"
FT   gene            <171582..>174551
FT                   /locus_tag="KLTH0B02178g"
FT                   /old_locus_tag="KLTH-ORF15707"
FT   CDS_pept        171582..174551
FT                   /locus_tag="KLTH0B02178g"
FT                   /old_locus_tag="KLTH-ORF15707"
FT                   /product="KLTH0B02178p"
FT                   /note="similar to uniprot|P41695 Saccharomyces cerevisiae
FT                   YGR188C BUB1 Protein kinase that forms a complex with Mad1p
FT                   and Bub3p that is crucial in the checkpoint mechanism
FT                   required to prevent cell cycle progression into anaphase in
FT                   the presence of spindle damage associates with centromere
FT                   DNA via Skp1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21446"
FT                   /db_xref="GOA:C5DCD5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012572"
FT                   /db_xref="InterPro:IPR013212"
FT                   /db_xref="InterPro:IPR015661"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD5"
FT                   /protein_id="CAR21446.1"
FT                   /translation="MSIGKAPVTNFDVIEVEKENIVPLRSGRSAAALSRSLKVRSDAGA
FT                   GTKVSEIRLEFEKRILHELDELDDPLELYLDYINWINNAYPQGGQSKQSGMLEVLERCL
FT                   MYFKDFDTYKNDPRYLKLWLWYLELFAGSESEKQSLFVFMMRKQIGSKLSLFYEELAAF
FT                   LEKQQDLPQAKDVLARGIENNARPLGRLRRTSQRFDERMRDMSVDVPSVPHGGSILDGE
FT                   LPSIVLGRARGQIEEASLKSKPSHSASAKHEIFKDVAGTDQFDDLKKEGWDHLDGRAQR
FT                   NKENEASKQLLAPGVNLGTLKQEGSTKISVNRVPIFKDSIGRSGPIYKILEIPGRKPEK
FT                   IDCNFDLVYPTKNQEYCFEELLAMSRGIYHKRPKAKRVLEIETIDISDNHSRERPSKQQ
FT                   KKALKEISPPPEAYRPSAQESQISNENDNLQDFKAVERTSILPLNDEPTLHYGTQKKSA
FT                   PSSPTVTFFSKDAIEEVYSMFNQNFSEPNRHLDNDDTTSKFAAFENFTQEFTRKTIDDL
FT                   TEVKQKIQSEQVNETPQKNENVPHGIEAPTEVSKETTTPSYKSKLQEYMTPIQERSESS
FT                   FKLASNSNEEYDNEVTKNNTITNTAESSPFLTQPQRLQLSLEHEPLIIENPLSNETRSA
FT                   QLSTMEPPLSAYPNFYHYNQSLKMSALLKKIHTASKNANKNPIVDFKKTNELYCIRSQL
FT                   GQGGFATVYLAESSTGSLKALKVEKPASIWEFYILKQVEKRLAGQQILASIINVDSLHC
FT                   FEDESYLVLNYASQGTMLDLINLEKERNGGPLDESLCMYFAVELMKVLEYIHNVGIIHG
FT                   DLKPDNCMVRFEENPEALSDYDASGNGGWDRKGVYLIDFGRSFDLTLFPSGTRFKANWK
FT                   TDQQDCSEMREGRPWTFEADYYGLAGIIHAMLFGKFIETRLLPNQTYALTNSFKRYWRQ
FT                   DLWAPLFDVLINSGNSTKLPITSTIREHRLAFEASLEESGGRLRSQVLSLESDLQRLRK
FT                   "
FT   gene            complement(<174660..>176267)
FT                   /locus_tag="KLTH0B02200g"
FT                   /old_locus_tag="KLTH-ORF15703"
FT   CDS_pept        complement(174660..176267)
FT                   /locus_tag="KLTH0B02200g"
FT                   /old_locus_tag="KLTH-ORF15703"
FT                   /product="KLTH0B02200p"
FT                   /note="highly similar to uniprot|P39077 Saccharomyces
FT                   cerevisiae YJL014W CCT3 Subunit of the cytosolic chaperonin
FT                   Cct ring complex related to Tcp1p required for the assembly
FT                   of actin and tubulins in vivo"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21447"
FT                   /db_xref="GOA:C5DCD6"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012719"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD6"
FT                   /protein_id="CAR21447.1"
FT                   /translation="MQAPVVFMNTSQERTTGREAQISNITAAKAVADVIRTCLGPKAML
FT                   KMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGEIL
FT                   AQCAPYIIEKNIHPVIIIQALKRALSDALEVVKQVSRPVDVENTEAMNKLIQAAIGTKY
FT                   VNHWSEKMCDLALSAVRTVRVDQGAVDDDTNRYEIDIKRYVRVEKIPGGDVLDSRVLEG
FT                   VMLNKDVVHPKMSRYIENPRVVLLDCPLEYKKGESQTNIEITREEDWNRILQIEEEQVQ
FT                   YMCEQILSVKPDLVITEKGVSDLAQHFLLKGGCSVLRRTKKSDNNRIARVTGATIVNRV
FT                   EDLKESDVGTRCGVFKVELIGDEYFTFLDKCKDPQACTVMLRGASKDILNEIERNLQDA
FT                   MAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAMECIPRTLIQ
FT                   NAGGNPIRILSQLRSKHAQGNYTAGIDGDAGKVTDMVEYGVWEPEVIKQQSIKTAIESA
FT                   CLLLRVDDIVSGVRKQEE"
FT   gene            complement(<176446..>178038)
FT                   /locus_tag="KLTH0B02222g"
FT                   /old_locus_tag="KLTH-ORF15700"
FT   CDS_pept        complement(176446..178038)
FT                   /locus_tag="KLTH0B02222g"
FT                   /old_locus_tag="KLTH-ORF15700"
FT                   /product="KLTH0B02222p"
FT                   /note="weakly similar to uniprot|P47072 Saccharomyces
FT                   cerevisiae YJL016W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21448"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD7"
FT                   /protein_id="CAR21448.1"
FT                   /translation="MKSFLGLTKLGNSGRKKVAPDQFSHIKSGMETMGTQDYEPLKPLL
FT                   ILLDCQKRKPYVSWDEGNELLLQVRGLTEVLPVRSLALQGTQLRVIVEPEDNGYDNVMV
FT                   LDVANGVSPSGWKLGQTSLELNDGAMVFLCRSVEAQAHLQFLYDMCMLSRFESMSLYKA
FT                   LTATVISTHGSRISDISSILMSQRSYKDWCYISINGEWVKAWCHVDRSPKHSDSRKGRH
FT                   QVKFFRDDKSLTAKNLICYIPDCGDIEDLFFVEDQSADLTQGSPDDGFGDLHFQNHLNS
FT                   VRDQKVPLQMSLEPLLTRLTTLRFIGDVYWPAPSSNSTSSRSRSSTVLSFGAGNSNNES
FT                   PKKSRDRRAMSTSSTSMFTSPKKSVKHTRTRSTASVTSTVHHADVNDACAITSELLIKP
FT                   IPHSGVTHLESLIRAALPMMGCLSLYGRPVHFKNTREDIDSLLFALPKLPVIDYFAAEE
FT                   LPLLFQYVGSVNSTAGSLNKTLTAYKRFLHERLQEPGRDKRSFTTLSDLLQNNSKNTYG
FT                   VGSSRSTSSSPLM"
FT   gene            complement(<178507..>180393)
FT                   /locus_tag="KLTH0B02244g"
FT                   /old_locus_tag="KLTH-ORF15699"
FT   CDS_pept        complement(178507..180393)
FT                   /locus_tag="KLTH0B02244g"
FT                   /old_locus_tag="KLTH-ORF15699"
FT                   /product="KLTH0B02244p"
FT                   /note="weakly similar to uniprot|P47069 Saccharomyces
FT                   cerevisiae YJL019W MPS3 Essential integral membrane protein
FT                   required for spindle pole body duplication and for nuclear
FT                   fusion localizes to the spindle pole body half bridge
FT                   interacts with DnaJ-like chaperone Jem1p and with centrin
FT                   homolog Cdc31p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21449"
FT                   /db_xref="GOA:C5DCD8"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD8"
FT                   /protein_id="CAR21449.1"
FT                   /translation="MDTSTHSRGFYNSKTEDAYNQMLADRRSERSAQISDSDDSVSADF
FT                   SNEMLDFSNSSSHSDLGINEDYEHFKTSLLQDDWGEPLEDDDDEDYTEEADQSFIMESD
FT                   AAEALSRGPDYHIKSFSTWIRGSLVPLVASLVVVVLAIMVLAPGGSPQAPEIQNAVPGT
FT                   NAQLRTQLNSLYREFQEEKKAAKKDLDNAIKLIILQVEKHMKQLLPRDLGSVNSQLRRL
FT                   DTQVQDLSQSLSLNNVTEWQESLMHELERLLPDQIPVVLDNSTNALMVVPELHRYLAEV
FT                   IPQAVNRTLPRGLAAPFNYDAGQYVREILRDEYEYVDKSDFLRELDSALRVNKEDILRE
FT                   MEARISTLENVPQQYSNVLQRKLIHKIYNANQHQWQDDVDFATVAQGTRILNHLCSSTF
FT                   KGHQGIPPNGVSPLDLLADTPAATSTYWLCKDKRATGSCSWAMHFAQPLYLTRISYLHG
FT                   RFTNNLHLMNSAPKSIAVYVKLQSPPTAEFQRIAAKHGQGAVWDRDNSFVEIGSWDYDV
FT                   SDARIRQYFLLPPWFVQCKPQVRSLALVVRSNHGNTHYTALRKFVINAVTAQDLQLSST
FT                   YAQQRQFEIPEYASPFEDRERSRASQIAAWQRRGPSDADPAVPSFGQDEYDR"
FT   gene            <180934..>182203
FT                   /locus_tag="KLTH0B02266g"
FT                   /old_locus_tag="Klth0B.mRNA.120.p"
FT   CDS_pept        join(180934..181515,181757..182203)
FT                   /locus_tag="KLTH0B02266g"
FT                   /old_locus_tag="Klth0B.mRNA.120.p"
FT                   /product="KLTH0B02266p"
FT                   /note="similar to uniprot|P53292 Saccharomyces cerevisiae
FT                   YGR165W MRPS35 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21450"
FT                   /db_xref="InterPro:IPR021036"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD9"
FT                   /protein_id="CAR21450.1"
FT                   /translation="MLSPARSGPALQQVQLQQVRFISRRRTAYPFYAFKRLGKQHPKKH
FT                   DSNLKYAMRQFLGPKNFKGEYVYNKYYGVPQNHEPNYIMPEIERGQSLKDNVTGEQLAI
FT                   QTDGSIAPARVGAGRPRDPVSGKRKLQPFPSNRHCLTNRVLGEELKLQVHDDIQNKHLS
FT                   AQEVSQKYGLKIPRVEAAVKLVELEQKWEKYNRIAPSLKSMSSVLYKMFPLFVPRVEVS
FT                   RENLSEIPVPAKALRSRFMTIAESEPFGPIDAAKALELEPAAETLEKLATLGEHSAHHA
FT                   SRSSAHKEKVIYGELLKGEKSLFKFENKHVGKVGFRYGSGNRDSKKDRKIGFNELGKMV
FT                   YL"
FT   gene            <182351..>183724
FT                   /locus_tag="KLTH0B02288g"
FT                   /old_locus_tag="KLTH-ORF15690"
FT   CDS_pept        182351..183724
FT                   /locus_tag="KLTH0B02288g"
FT                   /old_locus_tag="KLTH-ORF15690"
FT                   /product="KLTH0B02288p"
FT                   /note="similar to uniprot|P32893 Saccharomyces cerevisiae
FT                   YGR166W KRE11 Protein involved in biosynthesis of cell wall
FT                   beta-glucans subunit of the TRAPP (transport protein
FT                   particle) complex which is involved in the late steps of
FT                   endoplasmic reticulum to Golgi transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21451"
FT                   /db_xref="GOA:C5DCE0"
FT                   /db_xref="InterPro:IPR024662"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE0"
FT                   /protein_id="CAR21451.1"
FT                   /translation="MKILLPLDKHLDSGPESIENSHEDRKFIVFNEDLRVFFKGDQARI
FT                   ESISVFINEACVYSSSQPARSIKEREHDLWELHRSIVVDHIFNSNIVMNNGHKNTLRIV
FT                   VEYRSCAGRSTPQSARSSPDLPDLLPSFEPLNSGRTASASPQKMSMPKLQTAELAFPIH
FT                   SLLNARLRSVAVHTNQCIFSSLDLQSSKSCHTMMTLYDLARIRMSIKEIDYRIVRNFSS
FT                   VPVKPLCQLELPLEMGLWDSYSVNYQLPQTKNLDSHRVRVSLYYILEVGNYNFVVRTCW
FT                   ETDVNVRKQSAPTALPSQPTSIISTPMLTPSMIFASSVNSLVANKLNNVKFKFLTSRIT
FT                   CRKGFKFSLPLQIVNQSQSPLEIVVYCTNSAIQPQGQLPVEKEYQMHKRWMKITEGIVL
FT                   LSSDHKLPTIPVSETFCANLEFVAIQSGYYHSIPGLKVLDLNTQEIMNVGNGVKVLVE"
FT   gene            <184055..>184708
FT                   /locus_tag="KLTH0B02310g"
FT                   /old_locus_tag="KLTH-ORF15689"
FT   CDS_pept        184055..184708
FT                   /locus_tag="KLTH0B02310g"
FT                   /old_locus_tag="KLTH-ORF15689"
FT                   /product="KLTH0B02310p"
FT                   /note="similar to uniprot|P17891 Saccharomyces cerevisiae
FT                   YGR167W CLC1 Clathrin light chain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02310g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21452"
FT                   /db_xref="GOA:C5DCE1"
FT                   /db_xref="InterPro:IPR000996"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE1"
FT                   /protein_id="CAR21452.1"
FT                   /translation="MADKFPPLENEDFDTEVTAGQEETDFLKREAELLGDEFKTEEDSE
FT                   FLQENKNDELENFEEQYPALDEGAAVSKAEGQAQADDDDDFGEPQSAVSQNARATNSEA
FT                   IAKWKESRDKEISERDASQEKAKAELQEKAVKHMDDFYDNYNRKKEQQLKDTEAEAEKF
FT                   SKEREGFFNQDNTTWDRVLQLINVDDADLVAGRDRSKFKEILLKLKGNKNAPGA"
FT   gene            complement(<184844..>185872)
FT                   /locus_tag="KLTH0B02332g"
FT                   /old_locus_tag="KLTH-ORF15688"
FT   CDS_pept        complement(184844..185872)
FT                   /locus_tag="KLTH0B02332g"
FT                   /old_locus_tag="KLTH-ORF15688"
FT                   /product="KLTH0B02332p"
FT                   /note="weakly similar to uniprot|P53293 Saccharomyces
FT                   cerevisiae YGR168C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02332g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21453"
FT                   /db_xref="GOA:C5DCE2"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE2"
FT                   /protein_id="CAR21453.1"
FT                   /translation="MNKALSKIIAIILSEPITMRQVLRRALAVYGLASILSLVKLRRAS
FT                   AGIRRALVIGIFQNASWLLALLNGYPVARKVLKNKFLSFNAALVAAMQLMLPPWVSSYA
FT                   LVESIVDAVRNIHVSIAGSVHFDDVTSNSVRQAALSLLLPLLWKTRNARVKSLLFDRKS
FT                   VARDFLALFALWNTISLYSFVKSSLYKKEDRQKRRGPDTNKDRETHNALNSRVLKDKFR
FT                   EISELRTSRGTWDKVISCCFGENLTIAAKWAIWRQLLWFLMRVEKKPCSNLQLSSMLML
FT                   GFYVLDSSYSRMFVRPGVLRYLARVLVADKLQHRGDWQKTALWAGFNLSLWSKIQEEGQ
FT                   RP"
FT   gene            <186128..>189772
FT                   /locus_tag="KLTH0B02354g"
FT                   /old_locus_tag="KLTH-ORF15685"
FT   CDS_pept        186128..189772
FT                   /locus_tag="KLTH0B02354g"
FT                   /old_locus_tag="KLTH-ORF15685"
FT                   /product="KLTH0B02354p"
FT                   /note="weakly similar to uniprot|P47068 Saccharomyces
FT                   cerevisiae YJL020C BBC1 Protein possibly involved in
FT                   assembly of actin patches interacts with an actin assembly
FT                   factor Las17p and with the SH3 domains of Type I myosins
FT                   Myo3p and Myo5p localized predominantly to cortical actin
FT                   patches"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21454"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR035552"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE3"
FT                   /protein_id="CAR21454.1"
FT                   /translation="MEEPEPPFTVIAQFPYTSEHDDDLNFEKGSLITVQSIEDDEWYFG
FT                   EYQDESGTYKEGIFPRSFVKLAGDEEPSKPVEDPLDRVPSPTQNPGAVASSERNSIPAQ
FT                   EEDVYSSEQEEDPKNSAEHNAASQAASVPVPVPVPVPAPITSSVKQEKANQPLQAEAGE
FT                   TKKAPVPIFPASFPNFGGVESGLDKSPVAPQASSADMPRDSEEDQPKMSLKQRIAMLQE
FT                   QQRLQQEREQELVQKKLEKKKKQERHEAAVIEASSTEALVIGEEQPEHPQEDSVPSTPE
FT                   ESAGPQLPSSTTVANDESTSVRRDTSEQEAAEGTQATIGGAEQERQLKDHETDDAESEG
FT                   GHAAAEEEDEEARRAALRERMAKLAGAGRMGMPGSFNPFGIPIAPPEATAAKTKKPEET
FT                   SKGDKEVSNLPRAVPVMPFADPNALPMFKNKALDTSEKEALSDSSEVPKESAGISDPRD
FT                   EENDQGSGHVVEEVISKNGASKSAHEYAKLAAPPPPLDTPGMEADAEEEAGMVENNYFG
FT                   KDARHTTVQPTQSETATPVKSQTPTQSPPIEMNRSNSKSDLASDSDGYLSSVEDISETG
FT                   PKFPKDIPHLSKHAVKNAFSSTRSLSSGIESTGDGTEANLGQNKEGGFDVVKAAQDTRL
FT                   DTATLNEYVPPHSNYLTNQHGEANIRAPPVPSAPPVPLRPSVDRVLPTDGDGERPSEAF
FT                   GASTSREAPPVPTGGSAPPIPVEKRAPPVPPVGGVPPIPLEKSTPQIPSSRGAPQVPTD
FT                   KGVPPIPTNKGAPPVPTGKQPLPIPSEPISRSTQHSATDRGHPDVPPVPSVPHAVNPIP
FT                   SENLTESNSKIGSISSEADTPNQFASSTQKTPKEAPPPPPPIATKNENILEEGPKSPPP
FT                   PPPPSVSQPSRRHNSVSSVGREKRNSGIPEVPRNIPPIPVATASHAPPSSAPSPSKSIP
FT                   ESFKNTEHSVPSSQAPSGPAGKEMKRSQTFEANLENQRPCIKFDAAEEWWLTKSIPAGL
FT                   IGNNRLKYLWEMDENRIEKRGKEQWVMRDFYFLFEDYSQLHVTVTFNEANPQLSVKFWE
FT                   EFIPRPSAGHDLEKFASKIGYKIFEQANQLINTSSRNFVPKLIEGSREPAIPPIASRTF
FT                   GVPLLTYSPESTLDEDALKLIRPGDILAVRRGKFQSHGKLLQKTTHEIGMDAVPFAGVI
FT                   TEYDFSKHKFRVIEEHNGKIKQSSYRVHDMKSGKLKVYRVVGRSYVGW"
FT   gene            complement(<189853..>191046)
FT                   /locus_tag="KLTH0B02376g"
FT                   /old_locus_tag="KLTH-ORF15678"
FT   CDS_pept        complement(189853..191046)
FT                   /locus_tag="KLTH0B02376g"
FT                   /old_locus_tag="KLTH-ORF15678"
FT                   /product="KLTH0B02376p"
FT                   /note="similar to uniprot|P53294 Saccharomyces cerevisiae
FT                   YGR169C PUS6 RNA:Psi-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21455"
FT                   /db_xref="GOA:C5DCE4"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE4"
FT                   /protein_id="CAR21455.1"
FT                   /translation="MMGAEVYFANGLRKIKPYHHSRLSFAKGRWLDRTLLDVLSDEFRA
FT                   NTKEEYEKGILQKKFQIIRDGAELSVEEVLKGQIRNKDVIRTTSHKHEPPVRQWAKEEN
FT                   SGLGWVAGMKVVHECEDLLVIDKPSGIPIHPTGQYYQNTLVEVLKSHGKTVFPSHRLDK
FT                   ITSGVLILTKNPHMANKIQHQIRQRTMSKIYLARVDGAFPMADTLGSLTPFESPDKTQT
FT                   VDSAIYTVELKKQFPAAFSPPREAKTKFYPLKYYPKSDETLVACQPITGRTHQIRIHLA
FT                   RLGHPIVNDPFYNLKNSRYPKRLTFMLECHNWNKQANKSPSLSELFEEFLGEAEKLQRS
FT                   ERSALTLEKCPECDASIYPDPTCEELQLFLHAWKYTDDSGSLKFETEIPKWAKSGWT"
FT   gene            <191249..>192256
FT                   /locus_tag="KLTH0B02398g"
FT                   /old_locus_tag="KLTH-ORF15675"
FT   CDS_pept        191249..192256
FT                   /locus_tag="KLTH0B02398g"
FT                   /old_locus_tag="KLTH-ORF15675"
FT                   /product="KLTH0B02398p"
FT                   /note="weakly similar to uniprot|P47065 Saccharomyces
FT                   cerevisiae YJL023C PET130 Protein required for respiratory
FT                   growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21456"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE5"
FT                   /protein_id="CAR21456.1"
FT                   /translation="MTSRLVLKELKAGFKATNKFPVTEKTSPVSKATAPKLMGDVMTLG
FT                   SISATNNFCKPNKRLEKPPRGERALVEVRSMLRGTNSVAQVYQNTFRIFSGQSKVYHCD
FT                   FFRLLYFPPEHFLSVFRKSKPAVNVRIVGEVFLNGNVSKSQGRSVANTAVYARGSRIEG
FT                   YGKSQDVSNLKQLQNVFANDGSNVPRNYAYLRRSLRASLNKWFIQHWMALQGPQAVEEQ
FT                   IRRQGEAGSSAQWQYLDAQGRSKTSVAKDGFYLFQVLVFPDKTTKQEFKANVARGVKTV
FT                   ADLEWDDFLRSKSNKSRTWVQECNDRVRVPVMNSYLANDQMPRVLRKLQSSRAK"
FT   gene            complement(<192399..>192665)
FT                   /locus_tag="KLTH0B02420g"
FT                   /old_locus_tag="KLTH.mRNA.225AT.m"
FT   CDS_pept        complement(192399..192665)
FT                   /locus_tag="KLTH0B02420g"
FT                   /old_locus_tag="KLTH.mRNA.225AT.m"
FT                   /product="KLTH0B02420p"
FT                   /note="some similarities with uniprot|Q3E772 Saccharomyces
FT                   cerevisiae YGR169C-A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21457"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE6"
FT                   /protein_id="CAR21457.1"
FT                   /translation="MGKRFSESAAKKAAGNQRKREQAAAKGRAEREKAESEEAAKWEEG
FT                   SKKPSTKKQLEEQKKQEKLRAKQEREELLAAEEAALGRGGKGK"
FT   gene            <193387..>196533
FT                   /locus_tag="KLTH0B02442g"
FT                   /old_locus_tag="KLTH-ORF15669"
FT   CDS_pept        193387..196533
FT                   /locus_tag="KLTH0B02442g"
FT                   /old_locus_tag="KLTH-ORF15669"
FT                   /product="KLTH0B02442p"
FT                   /note="similar to uniprot|P53037 Saccharomyces cerevisiae
FT                   YGR170W PSD2 Phosphatidylserine decarboxylase of the Golgi
FT                   and vacuolar membranes converts phosphatidylserine to
FT                   phosphatidylethanolamine"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21458"
FT                   /db_xref="GOA:C5DCE7"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033179"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE7"
FT                   /protein_id="CAR21458.1"
FT                   /translation="MGIIRRRSRRARLTLRVHAIQAHDVTMQNSGCNPVCLVTSNGVFS
FT                   RTAKLKNTTSPHWDQMLKLKLPERPTSEYLRVVVYDALASTVDESAVDEFHTRSAGLND
FT                   LDSSAKYLYLGETQLSLRDLFRRKDQPTSYKFSRDAAWYPLYNKNALRFEHTDMQNAPA
FT                   AMAVGEIQLALSLSCTKGQSLFKAFNSWQSAFSEPRSSSSMSSSISAAAKSGSDGPSSS
FT                   AAGSGIFDDFDEETNFDLITQDPSMDELEPTENDLEGLQFIYSKLEDEDGVEDISSSSD
FT                   ELEPGAQLNFTKVATALDEYDVAISRSDFDPSSGNSRVSTPPLISEDDLIDEDNASSSD
FT                   SKESRYVRMIQTRKRRPRRPRKGNASAKFELSKRGHAAGVAYVDIDSINDLPTLKNKFS
FT                   KKYMMDPFIIITFGRRVFKTSWRKHSLNPVYNERLAFEVYENEMNFSLHFRIIDKDNFS
FT                   YHNNVAKGDVSLTDLINRQQKSEAGEEWVAMHIPLQFNKTIDSSISPPILNLKAKFVSY
FT                   TDLKKHFWEKALDLLTKQETFDVIDINLLMEKLGSFSDEEIEDFFYFFGKSPWAHDKLS
FT                   RDEVISYLQQSKNSSGFKKLKKCPLCSGWCKSTRNVVKSKLILENDLVTHLSICSSNSE
FT                   KKKMLKASYVSSDFASKRWFSKFLIKLTYGKYALGSNNANILVQDRDTGIVLEEKISAH
FT                   VKVGIRIIYNARGTESKKFKTLLRNLSIKQGRKFDNPSSVRQIDSFIRFHSLDTSECEE
FT                   TEYKTFNEFFYRKLKPGSRSPEVENPEILLSPADCRCTVFSNIKASKEIWIKGKTFTIT
FT                   KLTNSYHPEIYNDASCSIGIFRLAPQDYHRFHCPCDGVIGKPQEISGEYYTVNPMAVRT
FT                   ELDVFGENVRVVVPIHSKEFGTILYIAVGAMMVGSIILTCKEGETVERGQELGYFKFGG
FT                   STILLVVPSQNVMFDTDLLNNSNERIETLVKVGMSIGHTPAVKEHKREKRVLYSKEDID
FT                   RIKRTISVSDETVEKADNAPWEYHSLRKLAPHHHSAETTVSSDPTETARELDLLSIFSD
FT                   "
FT   gene            <196583..>198121
FT                   /locus_tag="KLTH0B02464g"
FT                   /old_locus_tag="KLTH.mRNA.163AT.p"
FT   CDS_pept        join(196583..196677,196756..198121)
FT                   /locus_tag="KLTH0B02464g"
FT                   /old_locus_tag="KLTH.mRNA.163AT.p"
FT                   /product="KLTH0B02464p"
FT                   /note="similar to uniprot|P46957 Saccharomyces cerevisiae
FT                   YJR006W HYS2 DNA polymerase III (delta) 55 kDa subunit
FT                   essential for cell viability involved in DNA replication
FT                   and DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21459"
FT                   /db_xref="GOA:C5DCE8"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR040663"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE8"
FT                   /protein_id="CAR21459.1"
FT                   /translation="MFKMLIKFRMSVMPTFIYGTVKSMDSVLRQFNESRETGEIEPRKR
FT                   DKLVVEPQPNEFYLKYEDRKYDEQYYSMYQYRLKVLRERVTKNCEVKWDSHFKLKNRKV
FT                   VKKNKVLDIQANEPCWCVGTIYCEMKYKPNILEEVVNDVYGAPDLVKGYLDEDGTDEVM
FT                   LEDESGRVLLVGELAKTKPLVSGTVVGILGMEADAGTFQVLDICFPSALPQTELPAGSQ
FT                   PGKVALVSGLNANPSNPRLSLKLQLLQQYLTGDVMSPESVAEIGRLIICGNSINPVDPD
FT                   QLTGCLTEAGTFFGNTLQSMPIDLMPGPRDLSDQSLPQQPLHKALFGPMISPFFEESNK
FT                   ELFCPTTNPAWFQLNGVQLLGTSGQNIDDMCKYVLPFEPDSQENLAEANIATRMDIIEG
FT                   CLRWQNIAPTAPDTLWCYPYKDEDPFVLKKWPHVFFVGNQPQFASKDVQLEGGVKVKAI
FT                   AVPEFSKTGQVVILDLETLDTTLVTIDM"
FT   gene            complement(<198167..>200032)
FT                   /locus_tag="KLTH0B02486g"
FT                   /old_locus_tag="KLTH-ORF15664"
FT   CDS_pept        complement(198167..200032)
FT                   /locus_tag="KLTH0B02486g"
FT                   /old_locus_tag="KLTH-ORF15664"
FT                   /product="KLTH0B02486p"
FT                   /note="similar to uniprot|P22438 Saccharomyces cerevisiae
FT                   YGR171C MSM1 Mitochondrial methionyl-tRNA synthetase
FT                   (MetRS), functions as a monomer in mitochondrial protein
FT                   synthesis; functions similarly to cytoplasmic MetRS
FT                   although the cytoplasmic form contains a zinc-binding
FT                   domain not found in Msm1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21460"
FT                   /db_xref="GOA:C5DCE9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE9"
FT                   /protein_id="CAR21460.1"
FT                   /translation="MWGTSIRIVVAHSTPKGLRFWCISLFRKIINASHFKSRKPVRRTS
FT                   TMPPSRGVPARLKGALFHITTPIFYPNARPHLGHLYSSLLCDVTKRWRAMQGYNTLFTT
FT                   GTDEHGLKIQNASEKNGYSNPKQFVDVLYREFVKLDQMANISYTRFIRTTDYDHVRAVR
FT                   ELWNRCWESGYIYKGEHEGWYSISDECFYPESKVVQLQGDGQELPFGSPEIRKDGKFIN
FT                   TETRNGVVYHSETNYFFKLSSFQNRLLTFLEKENPHFISPPSRRDQIINELRGSKLRDL
FT                   SISRPSSRIKWGIDVPQDPSQKIYVWFDALCNYLTSVGGLQAVLDNSPAAVKHTITSQL
FT                   KMPRNWWVNTTHIIGKDIAKFHAIYWPCFLMAAGIPLPKQIIVHGHWLSGGVKMSKSVG
FT                   NVVDPLDMILHYECDPVRWYLLENSHIEADGDFREERLHATREQIVSKWGNLLNRCCSN
FT                   KFNIPRAVETFASQAANPENNAATLIGTEAQESYRELIQLLQTLPELFSSHMRQLETRS
FT                   ALKLLWDVIGKANAFVQTSTPWLKSGEEQDLIIFTAIEVVRITSILAQPIMPTLSNALL
FT                   DRIGVDTENRDLSRTRLGADTLYGKGSNDKGREVPIKKVNFRGTT"
FT   gene            complement(<200122..>200841)
FT                   /locus_tag="KLTH0B02508g"
FT                   /old_locus_tag="KLTH-ORF15663"
FT   CDS_pept        complement(200122..200841)
FT                   /locus_tag="KLTH0B02508g"
FT                   /old_locus_tag="KLTH-ORF15663"
FT                   /product="KLTH0B02508p"
FT                   /note="similar to uniprot|P53039 Saccharomyces cerevisiae
FT                   YGR172C YIP1 Golgi integral membrane protein binds to the
FT                   transport GTPases Ypt1p and Ypt31p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21461"
FT                   /db_xref="GOA:C5DCF0"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF0"
FT                   /protein_id="CAR21461.1"
FT                   /translation="MSFNNGANPQGGFGFYQPSPQFQMPQGSMNFAQQPATQAFSQDPL
FT                   PPGLLNALSTKGYPHELPLLEEIGINFSHILTKTKNVLQPLRRSDSLPLEIISDCDLAG
FT                   PLIFCLLFGTLLLAAGKVHFGYIYGVALFGTISLHTLLRLMGNEDNKAQPQQLFLRTAS
FT                   ILGYCFLPLCLLSLVGVFFPLNNMMGYALALIFVCWCTWSSSGFFTAVLQLKNARVLIA
FT                   YPLSIFYSVFALMAIFV"
FT   gene            <201208..>202314
FT                   /locus_tag="KLTH0B02530g"
FT                   /old_locus_tag="KLTH-ORF15660"
FT   CDS_pept        201208..202314
FT                   /locus_tag="KLTH0B02530g"
FT                   /old_locus_tag="KLTH-ORF15660"
FT                   /product="KLTH0B02530p"
FT                   /note="highly similar to uniprot|P53295 Saccharomyces
FT                   cerevisiae YGR173W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21462"
FT                   /db_xref="GOA:C5DCF1"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF1"
FT                   /protein_id="CAR21462.1"
FT                   /translation="MGVIEKIKAIEEEMARTQKNKATEYHLGLLKGKLARFRQQLLAEE
FT                   TAPTGGGGTGFEVAKSGDARVVLIGYPSVGKSSLLGKVTTTKSEIAHYAFTTLTSVPGV
FT                   LKYQGAEVQIVDLPGIIYGASQGKGRGRQVVATARTADLILMVLDATKGAHQRESLEKE
FT                   LEAVGIRLNKEKPNIYYKKKETGGVKVTFTSPSRANLTEEAIKMILKDYRVHNAEVLVR
FT                   DDKCTIDDFIDIINDQHCNYIKCLYAYNKIDAVSLEEVDRLAREPNTVVMSCENDLGLD
FT                   DVVDEIWYQLNLSRVYTKKRGVKPDFSDPLVVRNASTIGDMCHSIHRDFKEKFKYALVW
FT                   GSSAKHSPQKCGLTHKLHDEDVVSLFTK"
FT   gene            <202478..>202559
FT                   /locus_tag="KLTH0B02552r"
FT                   /old_locus_tag="Klth0B.tSer.AGA.3"
FT   tRNA            202478..202559
FT                   /locus_tag="KLTH0B02552r"
FT                   /old_locus_tag="Klth0B.tSer.AGA.3"
FT                   /note="tRNA-Ser (AGA) cove score=80.04"
FT   gene            complement(<202770..>203798)
FT                   /locus_tag="KLTH0B02574g"
FT                   /old_locus_tag="KLTH-ORF15658"
FT   CDS_pept        complement(202770..203798)
FT                   /locus_tag="KLTH0B02574g"
FT                   /old_locus_tag="KLTH-ORF15658"
FT                   /product="KLTH0B02574p"
FT                   /note="highly similar to uniprot|P43534 Saccharomyces
FT                   cerevisiae YFL058W THI5 Protein involved in synthesis of
FT                   the thiamine precursor hydroxymethylpyrimidine (HMP) member
FT                   of a subtelomeric gene family including THI5 THI11 THI12
FT                   and THI13"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21463"
FT                   /db_xref="GOA:C5DCF2"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF2"
FT                   /protein_id="CAR21463.1"
FT                   /translation="MSTEKITFLLNWQPAPYHIPIFLALQKGYFKEQGLDLALIEPTNP
FT                   SDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVGSLLDEPFTGLLYMAGRGITDDFQ
FT                   SLRGKKIGYVGEFGKIQLDELTKHYGMTPDDYTAVRCGMNVAKYIIEGKIDAGIGIECM
FT                   QQVELEEYLKAQGKPATDAKMLRIDKLACLGCCCFCTILYICNDKFLAANPEKVRKFLT
FT                   AVKKATDFVLAHPIDAWKEYVDFKPELDNDLSFKQFQRCYAYFSSSLFNVHRDWNKVTG
FT                   YGKRLEILPLDYKANYTNEYLSWDEPNEVEDPLEAQRLMAIHQETCRDCGGFKRLSVPL
FT                   KA"
FT   gene            <204289..>204732
FT                   /locus_tag="KLTH0B02596g"
FT                   /old_locus_tag="KLTH-ORF15654"
FT   CDS_pept        204289..204732
FT                   /locus_tag="KLTH0B02596g"
FT                   /old_locus_tag="KLTH-ORF15654"
FT                   /product="KLTH0B02596p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21464"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF3"
FT                   /protein_id="CAR21464.1"
FT                   /translation="MSILVVDMDEVRSLAQRHSIEMGLERLRVVGQYVGSWWDAGRLRL
FT                   EFGNVSGLASAGGRAVLDASESALERVRRARAGLVEGAVCDVRCCVMGRDVEVMELRVL
FT                   TLREVQALGEFLAGDAGREFMSLSSGALQHAGHDRRDDEDRAR"
FT   gene            complement(<204902..>205501)
FT                   /locus_tag="KLTH0B02618g"
FT                   /old_locus_tag="KLTH-ORF15652"
FT   CDS_pept        complement(204902..205501)
FT                   /locus_tag="KLTH0B02618g"
FT                   /old_locus_tag="KLTH-ORF15652"
FT                   /product="KLTH0B02618p"
FT                   /note="similar to uniprot|Q07915 Saccharomyces cerevisiae
FT                   YLR009W RLP24 Ribosomal Like Protein 24"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21465"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF4"
FT                   /protein_id="CAR21465.1"
FT                   /translation="MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRN
FT                   PRKLRWTKAFRKAAGKELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQKRE
FT                   RAFYKNRMRGNKEREFLRDRQLVEKNPELLNMRDVELLRTAERAERVEAASDAESEEMD
FT                   VDSESEHESEDESEAEAQKQKVVLTNKRKVGKKIAF"
FT   gene            <205524..>206159
FT                   /locus_tag="KLTH0B02640g"
FT                   /old_locus_tag="KLTH-ORF15650"
FT   CDS_pept        205524..206159
FT                   /locus_tag="KLTH0B02640g"
FT                   /old_locus_tag="KLTH-ORF15650"
FT                   /product="KLTH0B02640p"
FT                   /note="similar to uniprot|Q07914 Saccharomyces cerevisiae
FT                   YLR008C PAM18 Constituent of the mitochondrial import motor
FT                   associated with the presequence translocase along with
FT                   Ssc1p Tim44p Mge1p and Pam16p stimulates the ATPase
FT                   activity of Ssc1p to drive mitochondrial import contains a
FT                   J domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21466"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF5"
FT                   /protein_id="CAR21466.1"
FT                   /translation="MGCDAMRCPCRLSKNFFQLNFYSHFLPELENSLETGRRKAKWTGE
FT                   KDEKASNMAPIEAPQLAIPGEPSAVAPQAFNELVPATAAPVGSAKKSMDEKFDEALAFM
FT                   GRHPVMSGVGGFLGLYFAAGAFKSVSRMMGGGPKAAQFAKGGFDPKMNTKEALQILNLS
FT                   ENNLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGLRK"
FT   gene            complement(<206266..>207135)
FT                   /locus_tag="KLTH0B02662g"
FT                   /old_locus_tag="KLTH-ORF15647"
FT   CDS_pept        complement(206266..207135)
FT                   /locus_tag="KLTH0B02662g"
FT                   /old_locus_tag="KLTH-ORF15647"
FT                   /product="KLTH0B02662p"
FT                   /note="weakly similar to uniprot|Q07913 Saccharomyces
FT                   cerevisiae YLR007W NSE1 Essential nuclear protein required
FT                   for DNA repair forms a complex with Smc5p and Rhc18p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21467"
FT                   /db_xref="GOA:C5DCF6"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF6"
FT                   /protein_id="CAR21467.1"
FT                   /translation="MEVDAVREESGGDEAQLSYEDKGKFLLQYVLSRRGVCSEKALAKA
FT                   LKTLERDGEQLEDSETEAQVVKMVGRLNVRLSALDYKLVRQRDQLGAWMYAYVDVSPSG
FT                   DTKLATPLTIEELKYVQWCVREMLEAGQEVAEARGAKSAVERSVDEALVQSGSGRDELS
FT                   AEFDSKSLRFRVSYTAGARQLFQFDDLGPLETERLLTRLCQLRWFYRTNEGHFGLATRA
FT                   LSELQEYLRTQYTVPVCTVCDEVALRGVKCQCAEGAWHAPCFQHYVAHVSNACARCERP
FT                   VLEAIYMA"
FT   gene            <207260..>209047
FT                   /locus_tag="KLTH0B02684g"
FT                   /old_locus_tag="KLTH-ORF15644"
FT   CDS_pept        207260..209047
FT                   /locus_tag="KLTH0B02684g"
FT                   /old_locus_tag="KLTH-ORF15644"
FT                   /product="KLTH0B02684p"
FT                   /note="some similarities with uniprot|Q07084 Saccharomyces
FT                   cerevisiae YLR006C SSK1 Cytoplasmic response regulator part
FT                   of a two-component signal transducer that mediates
FT                   osmosensing via a phosphorelay mechanism dephosphorylated
FT                   form is degraded by the ubiquitin-proteasome system
FT                   potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21468"
FT                   /db_xref="GOA:C5DCF7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF7"
FT                   /protein_id="CAR21468.1"
FT                   /translation="MAQKVGFRSPVPSPSGLAVQVPHKEIRLKVWVRLDSQKLPPDTIN
FT                   QATAIEFEREDTIDDLKDRIFRRFRDTRWAQENDSFGIAIGCWCECGFGATSAGDLKDL
FT                   LLQPVPNMASNAAPIDLSHAPPYIRRTSRTCSPHAATLGTPPSYSPHPAHPSYNKLQCS
FT                   TQSSTPLAQLRLSVGAGNKELGGGMDGCALSPVRLGSARRLSRTATPAVGEVDPDSIPH
FT                   QSLLEPDELVFNVCKNLFGGVAAQTANDALVVFSNNPDIPLFDETMDGAPMVEDLTDYK
FT                   LVVDEEQLRKLSHTNDEENIDCPKQAILLLPRGFEGDVNLPSPNVATPSASSPPALEEV
FT                   SPGAAISPTQRVSPVLMTSAPLVEEEIGLVPPRDPIVQREGSPFILSAMESVTTESITR
FT                   DKVFPKISVLVVEDNMINQAILSSFLRKHKIHYKVAKNGVEAVDRWKEGGMHLILMDLE
FT                   MPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTE
FT                   ALLAGCNDYLTKPVNLDWLTRKITEWGCMQALIDFDDWKDNDERLNSCIEQKAKASQKT
FT                   TSTSNASKSTNLNKRITTS"
FT   gene            <209215..>211308
FT                   /locus_tag="KLTH0B02706g"
FT                   /old_locus_tag="KLTH-ORF15639"
FT   CDS_pept        209215..211308
FT                   /locus_tag="KLTH0B02706g"
FT                   /old_locus_tag="KLTH-ORF15639"
FT                   /product="KLTH0B02706p"
FT                   /note="similar to uniprot|P27351 Saccharomyces cerevisiae
FT                   YJR005W APL1 beta-adaptin large subunit of the clathrin-
FT                   associated protein complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02706g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21469"
FT                   /db_xref="GOA:C5DCF8"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF8"
FT                   /protein_id="CAR21469.1"
FT                   /translation="MSELRLFSKCKAYEIRAELQQTNIKKHRASATKRKDALRKIIANL
FT                   SMGNFGEMALLFPDVLRFWQVEDDLEVKRICHHYLVAMAPTKSGHFATALSMVLEDFNS
FT                   GTEAVQILALRTLSSVPLPAYLEEASKCASAVLHQHSEPEALKKAALYALLRLAQLDSE
FT                   RSQLLMGIVGKVLQSAKEKPSVRAHALFVLYQEEESSSETRTMGLGRDLCLSMLELLPR
FT                   LNEWDNGRVLDALTANYVPQTHDDAHFMIDKALPQLQHANTSVVLNALKLIVFLTNYVD
FT                   RLSESIVKQLSSSVISLLNKPPELQFLVLRNVILLLLGREKPLLKVDVPYFFVEFNDPI
FT                   YIKDTKLEILYLLAKEDNLAQIFQELKEYATDIDIQMSRKAIRAVGNLAVKLKNSVDEC
FT                   INLLLDLLDFEVEYIVQEIISVFKNVLRRYPEKSKLCLYKLVRFTDSVQEPESRSSMIW
FT                   IITQYSSQLPNYFELFEGFSNNFLEESLEVQFTILSSTVKLFTRHPTPATEKLCINILK
FT                   SSTEKLDNPDLRDRAFMYWRLLSCTQKSGGNILTMDAVREVVDGNLPLITLNSRLDPHV
FT                   IEELELSIGTIVSIYLKPVNQVFRLNKPRVLPKSPALNSDKDNLEIIADDTRSHSSSFT
FT                   DDSSLASRRQSSSPVKKMDDYDRPAEVVNQLKLKRKTSSATSLLSRKPSVLGRKLSMKR
FT                   PFG"
FT   gene            complement(<211394..>212266)
FT                   /locus_tag="KLTH0B02728g"
FT                   /old_locus_tag="KLTH-ORF15637"
FT   CDS_pept        complement(211394..212266)
FT                   /locus_tag="KLTH0B02728g"
FT                   /old_locus_tag="KLTH-ORF15637"
FT                   /product="KLTH0B02728p"
FT                   /note="similar to uniprot|Q07897 YLR003C Saccharomyces
FT                   cerevisiaeCMS1 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21470"
FT                   /db_xref="InterPro:IPR032704"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF9"
FT                   /protein_id="CAR21470.1"
FT                   /translation="MPLGDDLDDGLDYQVDSSEGENFGDVVEEQPNHSASDSENAKRPH
FT                   SAGEEDETAKQPQSKRQKKLAKSKVHQKKLEKLEADREQKKQLPRSSSERIAEHLGTLI
FT                   REKNPDLSALELEELYFKKTDFISTERYDKERSLHNILDFVNNFSKSPRAIVLSTSNLR
FT                   VADVFRGLGGSKNAVKLFSKNKLKEDLARVDQLLKAPSSKDRQAKNKGKKKGDAMVKFF
FT                   TATPGRMLKIVQETDAFFLGKDKLDIFVDASYLDPKMNTIFTSDDCTALLKVLKEFLGK
FT                   KSSVKILLF"
FT   gene            complement(<212432..>213997)
FT                   /locus_tag="KLTH0B02750g"
FT                   /old_locus_tag="KLTH-ORF15633"
FT   CDS_pept        complement(212432..213997)
FT                   /locus_tag="KLTH0B02750g"
FT                   /old_locus_tag="KLTH-ORF15633"
FT                   /product="KLTH0B02750p"
FT                   /note="highly similar to uniprot|Q07904 Saccharomyces
FT                   cerevisiae YLR004C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21471"
FT                   /db_xref="GOA:C5DCG0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG0"
FT                   /protein_id="CAR21471.1"
FT                   /translation="MSASLTESENSKKQITEKTNAVCTEEDADVALQYLKRAHAENVAL
FT                   SDESSAVDVAEKMAKNYYGSHELEPKLLRKVDFFILPFLCCTYLLMFLDKALLNYAASM
FT                   GIKQHLKGDEFSNLGTIFSAAYIFAEPFVTFCIQRYPISKVMGVFITLWGAVLACHSAC
FT                   KSYASLMIVRTLLGLFESSSAVGCIAISGMYYTKSEQSARIGFWATQAGTGYIVGGLIS
FT                   FGFLHYHGTDFTSWQIMFLVVGLVTVLFGVITFLYLPDNVTNAWFLDEKEKIEVLQHIR
FT                   ANQTGLENKKFKKHQLKELFFHDKLTYPMLLLTACSQISTGAIGTFSVTITQTFGFDKY
FT                   ETALLQLPIGAITALIILITTQMLSLWGHYTLVTFSMYIPAIIGCIVMICLPLSHKIGN
FT                   LFALYLLYSGSCVITNIYIWNSCNTSGYSKRVFRNAITMVVYNVSCIVAPQMFRTSSAP
FT                   RYIPAKIALLVTQCVCVPLQLYIGYLCKKENKKRDREQEGQVTSSYQFLDLTDIENRSF
FT                   RYVY"
FT   gene            <214541..>217132
FT                   /locus_tag="KLTH0B02772g"
FT                   /old_locus_tag="KLTH-ORF15629"
FT   CDS_pept        214541..217132
FT                   /locus_tag="KLTH0B02772g"
FT                   /old_locus_tag="KLTH-ORF15629"
FT                   /product="KLTH0B02772p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21472"
FT                   /db_xref="GOA:C5DCG1"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG1"
FT                   /protein_id="CAR21472.1"
FT                   /translation="MNVLLSFLALSKFFLLAIAVPVRDDDLYTEMVEAQLDEEFEEQVE
FT                   RTEVRSSGFESSPGATGRALFGLSDGLFEEFPFLNYVDVFYGTEGGGHMFPGTTVPFGM
FT                   CKMGVDVLHPHSTDAYSGYHSTGDVCGISMLHESGTGGSPTYGVVSQLPLMASSASDVD
FT                   TSRQIAFPRSKPDAGHIGYYRVSLSNRVTIEFSSNSRSGLYKYTFPTKHQQHHMSPIVM
FT                   VNVTQHLHSVKRPWWTQNFEGGYIKVDKSYKSYRGKAYFSGGWSDPGTWSVSFYGVFDK
FT                   PAKRVRAFHGSKAYNRLRLNLAKSLNSNMGMLFEFEKGTKVLYSHVGVSFSETDGINVA
FT                   RQNLALNYPEENMFDLHWSVRSTAEAWDNEVFSKVNIDESKEDPIIVEKMYNALYGSHL
FT                   MPSDKSGREAPWPTNEPYYDDWFTLWDTFRCLHPLLNILNTKRSADMTRSLIEIWRKEG
FT                   YMPDGRSASRSGRTQGGSNADIVLADAFVKGVGEGVDWQDGFSAMRSNADKSPEYILDK
FT                   AAPDSTNKYGRGALNDWLELGYITRRFSRSVTRTMEYAYNDFALSVVAEGLGYFELAKQ
FT                   YLKRSSNWQNIWNFEATTPEYDYSGFIQPKDSNGNFIEKKYNPLSCFGCYWRDDEYEGK
FT                   PIEYGWAVPHDIQSLKEFIGPDELFMRRLDDMFDLYGDGIADIGNEPSFLTPYLFNFIN
FT                   AQYRTSETLGYLIDHKFLLGPKGLPGNSDAGAMQAWLWFGLVGFYPIAGTDIYLITSPK
FT                   ITELEIQLEGNGKALIQAHNLYAEDADSEYDYDKAHSSFTRNLYISSVELNGKLINRNW
FT                   FTHEELFGSNGGLLVFTMTDEPTFWDADGEYPPSRGHFQRDDIERPNRLVD"
FT   gene            <217284..>218696
FT                   /locus_tag="KLTH0B02794g"
FT                   /old_locus_tag="KLTH-ORF15626"
FT   CDS_pept        217284..218696
FT                   /locus_tag="KLTH0B02794g"
FT                   /old_locus_tag="KLTH-ORF15626"
FT                   /product="KLTH0B02794p"
FT                   /note="highly similar to uniprot|Q04673 YLR005W
FT                   Saccharomyces cerevisiae SSL1 Component of RNA polymerase
FT                   transcription factor TFIIH"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21473"
FT                   /db_xref="GOA:C5DCG2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004595"
FT                   /db_xref="InterPro:IPR007198"
FT                   /db_xref="InterPro:IPR012170"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG2"
FT                   /protein_id="CAR21473.1"
FT                   /translation="MAPIVESDSEDESLNRPKKQVRGRTSKGKKHVRIEEDYNEDGHSM
FT                   SEDDENLFSEDEADSGPSNGRKKKKLANKNLQGANGGYAWEEDIQRSWDLVKVDDEGNM
FT                   AALVSSIIEARKKRASNKNLTPFQRGIIRTMVLVLDCSDAMMEKDLRPNRYAMTIQYAI
FT                   NFVHEFFDQNPISQIGIVCMRNDLAQLVSQVSGNPQDHIDALKAIRKQEPKGNSSLQNA
FT                   LEMARGLLLHVPAHCTREVLIIFGALSSTDPGDIHQTIASLVQERIRVRVIGLSAQVAI
FT                   CKELCKQTNYGDNSFYGVILNEVHFKDLFAEAVTPLPVNKINKGFTLVKMGFPTRVYED
FT                   MPSFCTCHSKLMYGGYFCPNCKSKVCSLPTVCPCCDLMLILSTHLARSYHHLMPLKTFQ
FT                   EVDVAETFPTDTCYSCQKRFPRLKNQKTQELLTSSRYRCADCHQDFCIDCDVFIHEILH
FT                   NCPGCESQPGIW"
FT   gene            <219220..>220971
FT                   /locus_tag="KLTH0B02816g"
FT                   /old_locus_tag="KLTH-ORF15622"
FT   CDS_pept        219220..220971
FT                   /locus_tag="KLTH0B02816g"
FT                   /old_locus_tag="KLTH-ORF15622"
FT                   /product="KLTH0B02816p"
FT                   /note="highly similar to uniprot|P53389 Saccharomyces
FT                   cerevisiae YNR055C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21474"
FT                   /db_xref="GOA:C5DCG3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG3"
FT                   /protein_id="CAR21474.1"
FT                   /translation="MDKYTNIHHPDYLPGTFNIYSSSSLENGVIYESSLRKTTEDVVLI
FT                   PQPSESPNDPLNWSKARKFLHFALMSFITAFTAATSNDAGAAQDSLNEFYGISYDSMNT
FT                   GAGVLFLGIGWSTLFLAPLANLYGRKITYIICTALGLAGAIWFGFARRTSDTIWSQLFV
FT                   GISESCAEAQVQLSLSDIFFQHQLGSVLTVYILATSAGTFLGPLIAGYISALTSFRWVG
FT                   WIAAIISGALLIIIVFGCEETYFDRNRYVTPVSRKAHLRSGGNYDSQCSAQPLLASQDN
FT                   CDEYGFKHDPKNVPNQKTEKTTEVEPSFNASIEDFKLIDGSEEKLKPYYKRVAIITKST
FT                   NLRGWGVKQYFNYLGINMRMFLFPPVWLSGLFWGIQDVFLTFYLTTEDTYFPEAPWNYS
FT                   DYGVAIMNVPTLIGAIIGCIYAGIVSDYFVLWMARRNHGILEAEYRLYFSFATAIIGPA
FT                   GLLMFGIGAARQLPWQVIYVGLGFIGFSWGCSGDIAMAYLMDCYPDMILEGMVCTAIIN
FT                   NTISCIFTFVCSYWLDASGTENTYIALAVINFGITMLAVPMFIWGKKIRQATRKWYIRS
FT                   VGVRDGV"
FT   gene            <222444..>222516
FT                   /locus_tag="KLTH0B02838r"
FT                   /old_locus_tag="Klth0B.tLys.CTT.4"
FT   tRNA            222444..222516
FT                   /locus_tag="KLTH0B02838r"
FT                   /old_locus_tag="Klth0B.tLys.CTT.4"
FT                   /note="tRNA-Lys (CTT) cove score=77.79"
FT   gene            <223097..>225583
FT                   /locus_tag="KLTH0B02860g"
FT                   /old_locus_tag="KLTH-ORF15618"
FT   CDS_pept        223097..225583
FT                   /locus_tag="KLTH0B02860g"
FT                   /old_locus_tag="KLTH-ORF15618"
FT                   /product="KLTH0B02860p"
FT                   /note="some similarities with uniprot|P20840 Saccharomyces
FT                   cerevisiae YJR004C SAG1 Alpha-agglutinin of alpha-cells
FT                   binds to Aga1p during agglutination N-terminal half is
FT                   homologous to the immunoglobulin superfamily and contains
FT                   binding site for a-agglutinin C-terminal half is highly
FT                   glycosylated and contains GPI anchor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21475"
FT                   /db_xref="GOA:C5DCG4"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR024672"
FT                   /db_xref="InterPro:IPR033504"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG4"
FT                   /protein_id="CAR21475.1"
FT                   /translation="MLCRMLALVLATSFFLGHTLATQIKSVSFEGLSIDSISSQSFPHK
FT                   MWELSFEFTIEDVNQISESDYFLLDLPHVYRVKFSNDADYQYITMADGSDAFKCYASQQ
FT                   AAYKYGSSVLRCDAVRTFSSFTSLRGNLSIGAVFSNGGSSYEFELENSKYFKSGEQLVE
FT                   LSEKLSAVANFARAPDFDSYYYEGRTTTYGSMESYYLGLSCPDGYILGGTQVIDYSPGT
FT                   QPSSFDCSDAQVQLSSDFNDWFFPESYQSFSGDYVCNGATLSISFDKIDSGKRIWVNNL
FT                   QYLDASASTVYHSIYFDYTCTNTLSSLVYTTAVHQSPAFVIKDGVFTGSAVVDALSTSA
FT                   ILTTTTTTTTTWKSAYATTTTGSVSSGATVITIHVDTPGTSSTQSFSSSRSDSSESIIA
FT                   STSSDFSKPTTSTLTVTSCVSNRCSKLELISPSTSSIVSIVTSSPSESSTSPSESSTPS
FT                   SASSTSPSESSTPSSASSTSSSVSSTPSSVSSTPSSVSSTPSSESSTSPSESSTSPSES
FT                   TTSTPITTFANRTSAPPSTGHYSSTISTPGFPSSARGSQSISFGTVPFTELSYSVSTSR
FT                   PSSLVLTSTTLKSTSPTSSLSGSSPCLGTACFETVSFVKPSDSSPPSHPASTSSTRPTM
FT                   QTGTTTMEFQTSSSSISASKFTDSKLLSSGGVSKATSSFSESTAATWKVTSSITKSTAS
FT                   SLDKSIVTTPSLTTNIIKSSETGTQSDLASSDSSQVERPGSSNGGVITSTTHLSKASSN
FT                   AFLGSIAASSFSSSSDSATTTTKVSAQITSTPSLVLSSTSAFSSASFSVYEGLAARHKF
FT                   QVTLGALASLVLYSFT"
FT   gene            <225842..>227395
FT                   /locus_tag="KLTH0B02882g"
FT                   /old_locus_tag="KLTH-ORF15614"
FT   CDS_pept        225842..227395
FT                   /locus_tag="KLTH0B02882g"
FT                   /old_locus_tag="KLTH-ORF15614"
FT                   /product="KLTH0B02882p"
FT                   /note="weakly similar to uniprot|P47084 Saccharomyces
FT                   cerevisiae YJR003C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21476"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG5"
FT                   /protein_id="CAR21476.1"
FT                   /translation="MLSLRRQFSARLGLRNSAQKSLRQTYSGLLADPCFKNFNINESLN
FT                   DELEPYDLSASIIGKLSSLHAAPSVRETIHNRMIEALTKHDFSIGTIHTRELLKMGGQL
FT                   SLESFVQIINSNPGRVQSSWELFLQHYHLVNSSPEALLTVLRKLLYFDPVDIEDGKKEL
FT                   DTRDLARCIFLMKLISSAGCLEQVPNDYWNIILEATIEGKASTLIPLITRSFMPSYDSF
FT                   DETQELTSYQVFQLFHDGGKRLADENLPMFKRVLSVLGRNSCIKLTPQENEVEKELEKE
FT                   LENISKKLHTLIPVTFPYEEVSSQSAFENMLQTVLELDKNKISKCGVYEVALRSLGIYK
FT                   GNLSSADKYFEEFMKVAPSEVDNMQYELFLAFIHRGVQTRDEKLLQKAVLLVPQSSSKY
FT                   LELSVDRALIIAYSIFDIEKALEYYNRSISSFGKAQLEGCSNSEAGLLTEALILAYLGK
FT                   KDRDFAHVILEGAIGEGLFPSPYAIKSVKKTFAAYGDILDQDNSDAQLQALVLDYIKGL
FT                   "
FT   gene            complement(<227825..>228442)
FT                   /locus_tag="KLTH0B02904g"
FT                   /old_locus_tag="KLTH-ORF15612"
FT   CDS_pept        complement(227825..228442)
FT                   /locus_tag="KLTH0B02904g"
FT                   /old_locus_tag="KLTH-ORF15612"
FT                   /product="KLTH0B02904p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21477"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG6"
FT                   /protein_id="CAR21477.1"
FT                   /translation="MTFRLIMVDPSPSSKEHLDFSTEKPESVKQHDARGSSKRRKDLSV
FT                   VMHTFEKGRVEKVSPPCRGICTKKKNHKNAAAAKPSEKRCKKLEGVQDEEKMNSSCVIP
FT                   PKPLTFVTSVASDYSLEYANAWQSSLEFNSKKAQRPLFRITKYKGRKGCEKVESSTELL
FT                   GTIDPNFCFSYNSLNSSKEKGAKTPPMNFSTAPVFKVLLNDR"
FT   gene            <228615..>230591
FT                   /locus_tag="KLTH0B02926g"
FT                   /old_locus_tag="KLTH-ORF15610"
FT   CDS_pept        228615..230591
FT                   /locus_tag="KLTH0B02926g"
FT                   /old_locus_tag="KLTH-ORF15610"
FT                   /product="KLTH0B02926p"
FT                   /note="similar to uniprot|Q92280 Saccharomyces cerevisiae
FT                   YLR002C NOC3 Protein that forms a nuclear complex with
FT                   Noc2p that binds to 66S ribosomal precursors to mediate
FT                   their intranuclear transport also binds to chromatin to
FT                   promote the association of DNA replication factors and
FT                   replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21478"
FT                   /db_xref="GOA:C5DCG7"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR011501"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016903"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG7"
FT                   /protein_id="CAR21478.1"
FT                   /translation="MGSKKRSQRVAEDKASKRRKEQDSLLEGGIFTREDVQEIEDSIPA
FT                   KKSWDDEEQDYERKPRKLAGYPEDNIEQLPIKIGAKVERRIVRAPKVEPESNNDDSEDV
FT                   DLMKNDDEEQSTEADDSAVADSPEAVLQLKEQIAELVENIMEDAEENVGSLTRLRKMAQ
FT                   SKNSNTCKFSLLALIPVFKSVIPSYKIRPLSDAEKKEKVSKEVAKLRNFEEHLVRNYKE
FT                   YIDLLSKLAKTPNSADQKQVAMGNLAANALVELLPSASNFNFSTEVFTAIIRRICKPNP
FT                   LADPVYQKMVKALETLLNEDDDGRNSLEIVRILAKTIKSRSYMIDESVLNILLSLDVLQ
FT                   DFDPNTKDEDFTKVKVKKKDRAHLSKKQRKVRKEMKKVEEEMQKAEQTVLAEEREKNQA
FT                   EILKFTLSLYLNILKSNVAKLIGSVLEGLSKFGHMANFDLLGDFLEVMRELIANSELDN
FT                   LSPLEVRKVLLCIVTAFSLVSRHSQMKLSMDLTSFVDALYSVIPNLSVDAEIEYSHKTL
FT                   RLADPLGSDLVKPSVNVSTKAELLLRALDHVFFRSRSGSKVRAAAFAKRLYVAMLATPE
FT                   KTSIAILKFLEKLMDKYPEVGGLYSTEDRIGNGNFKLQAETPARSNAEAATIWENILLL
FT                   KHYSPAVIKGTKALLEKSRGSLK"
FT   gene            complement(<230675..>232498)
FT                   /locus_tag="KLTH0B02948g"
FT                   /old_locus_tag="KLTH-ORF15607"
FT   CDS_pept        complement(230675..232498)
FT                   /locus_tag="KLTH0B02948g"
FT                   /old_locus_tag="KLTH-ORF15607"
FT                   /product="KLTH0B02948p"
FT                   /note="weakly similar to uniprot|P47083 Saccharomyces
FT                   cerevisiae YJR002W MPP10 Component of the SSU processome,
FT                   which is required for pre-18S rRNA processing, interacts
FT                   with and controls the stability of Imp3p and Imp4p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21479"
FT                   /db_xref="GOA:C5DCG8"
FT                   /db_xref="InterPro:IPR012173"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG8"
FT                   /protein_id="CAR21479.1"
FT                   /translation="MTSFINKISDNPISIISENEDTSTDSLRLVKTYIDDVILSQKALD
FT                   GKVLLDEIVVEGLDANQIWQQVRLVLENSGPKLMGKISTIRTSLAEVNESDEEISSSES
FT                   SEVEENKEEELEGMNEFDSDESEKVDAIITTGQSAGLPINNSDDEYHSEVREGHNSNRG
FT                   SGDEGSEEEEGGANNSDGAEEITVGPKKDSFGLNDEFFDLEEFNRQTIDNENTAEPDNE
FT                   INYFEDVPSEEDEEVLYYDDFFDKPSSSKRKVTSGGDKQVKFGEHGEDFHENSDDEYDR
FT                   AMESAKLDLFAEVEDDEMKPEVDPVSKLSTFQRQQLDIQRQIAQLEKEAVAEKKWALKG
FT                   EVKAGDRPEDALLTEDLDFERTSKPVPVITSDVTESLEDMIRRRIQQREFDDLARRVEA
FT                   NLNFSSAKPQFELSDSKSSKSLAELYENDYNNIPQDSEVSEELKKSHAEISDLYSKLVY
FT                   SLDALSSAHFIPKPAQKTLEVRVQTPAINMEDAQPLTMSTAPTLAPQEVYAPGASRSTN
FT                   EISLKNGVVMSRDELSKDDKNRLRRALKRKRSKRLENQSGLSQKKSKKDSVIQTLSSAK
FT                   NVTLIDKRGDKRDVKGNIVKDGTTGRKNFKL"
FT   gene            complement(<232632..>234431)
FT                   /locus_tag="KLTH0B02970g"
FT                   /old_locus_tag="KLTH-ORF15603"
FT   CDS_pept        complement(232632..234431)
FT                   /locus_tag="KLTH0B02970g"
FT                   /old_locus_tag="KLTH-ORF15603"
FT                   /product="KLTH0B02970p"
FT                   /note="similar to uniprot|P47082 Saccharomyces cerevisiae
FT                   YJR001W AVT1 Vacuolar transporter imports large neutral
FT                   amino acids into the vacuole member of a family of seven S.
FT                   cerevisiae genes (AVT1-7) related to vesicular GABA-
FT                   glycine transporters"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21480"
FT                   /db_xref="GOA:C5DCG9"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG9"
FT                   /protein_id="CAR21480.1"
FT                   /translation="MPGEAGTQSSLLRHRPSQNVHYMSIPVNRASQASSPEDPGAFCDN
FT                   ARRQSILDHPIGSFRGVNSLGRFASSLRRANSFMNIEVNTDKERSFLKDGQDALYDPNT
FT                   LAPSADGRRLSIALTSGRGVSVRPSVTDLTSGRFDGSAFADDQDSSSAVRSVISSDQLI
FT                   SRRPTLCFNDFNNAIDPDTESIMLKQVERKDGKIVTLLAGQSTGPQTIFNSVNVLIGIG
FT                   LFALPLGMKYAGFVAGAILLFVFAGATFCSAELLSRCLDTDPTMISYGDLGAAAFGPKG
FT                   RALVSFLFTLDLLGSGVALIIIFGDSLNALFPKYSVNFFKLVAFFAITPQAFMPLSVLS
FT                   NVSLLGIASTLGTVFCIIFCGLYKSSSPGSLLNPASTSLWPENFKGFCLSIGLLSACWG
FT                   GHAVFPNLKSDMRHPAKFKKCLVTTYSITATADIATAIVGFLMFGTDVKDEVTKSLLLT
FT                   EGYPHYAYVAISALMALIPVAKAPLCARPIASVFNVLMGVSQEDTNVEGAKYHFKKIVC
FT                   AFNALLVNVLFVAIGIKFPEFDKFIAFLGAGLCFAICLILPCLFYMKLCADSIKPWERK
FT                   ACIFTILLSTVFSILGVGAALVT"
FT   gene            complement(<234560..>235174)
FT                   /locus_tag="KLTH0B02992g"
FT                   /old_locus_tag="KLTH-ORF15600"
FT   CDS_pept        complement(234560..235174)
FT                   /locus_tag="KLTH0B02992g"
FT                   /old_locus_tag="KLTH-ORF15600"
FT                   /product="KLTH0B02992p"
FT                   /note="weakly similar to uniprot|P40561 Saccharomyces
FT                   cerevisiae YIR001C SGN1 Cytoplasmic RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21481"
FT                   /db_xref="GOA:C5DCH0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH0"
FT                   /protein_id="CAR21481.1"
FT                   /translation="MSDTRWTTSYPHMNEFLSDSSQQDNKPDYYHVITEETSRLKDIEK
FT                   RMAENAHGAGCPGFSRFNDQSADARSVYVGNLDPSINAETLQEFFKGSVSRVNRVEIQI
FT                   NKLTGFAKGFAFVEFAQPRDVMDAIKLSNTKLGGKPLKIVPKRPSFHQESPNRGSHRMR
FT                   RATTRTHPPLRGRPHGRHLHNAWRGNRRGRVRARGRGKRFI"
FT   gene            <235495..>238068
FT                   /locus_tag="KLTH0B03014g"
FT                   /old_locus_tag="KLTH-ORF15599"
FT   CDS_pept        235495..238068
FT                   /locus_tag="KLTH0B03014g"
FT                   /old_locus_tag="KLTH-ORF15599"
FT                   /product="KLTH0B03014p"
FT                   /note="weakly similar to uniprot|Q07895 Saccharomyces
FT                   cerevisiae YLR001C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03014g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21482"
FT                   /db_xref="GOA:C5DCH1"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH1"
FT                   /protein_id="CAR21482.1"
FT                   /translation="MINIIWLAISVLWLKLLPFSTATPKSGDDDDFPFTTVVDYLWQNA
FT                   EFSTFLRVLQKDGLIPYLNELDNFTIFAPINSAFAQSNQNTVLDHYLLQNHVLDFEKYG
FT                   SGTHVLTLNDSRPHLIEKRTDGAWKINGVSVLKEILKPSMQNAVLYSITSLISGTLELE
FT                   DLIEKSANISSFSMLLDRVVFGNLQVFDNKTLIIPKDSAFNASFNDIELEYLLGPTDTA
FT                   ISNPHLLKTYKNRKKDQNFLFERLLVDGILGGDINKTDALNLDNELLNFESHENGTVIS
FT                   VNNTFSALSNQLYTKGIAHMFSKLDFLPSHLSFTAEKYLIGLGADRFVEEIYMRKLDHL
FT                   INGAHDRNLTIFVSVESSNEGSGFSKSSLLYHFVDDQVDLTDYALPTSSKRLYDTMFCS
FT                   SNKRLGGECQRLKIERSSRGKQRVLINGKYCLKSLEPIKVGNTSIYLLENDVTLPADLL
FT                   SSIDPFSGCSKSLHFLDELNLLELRPNNQGYTVLLPCFDSWDYFDLNLDYLEHNITALN
FT                   LIMKNYILNGLIYTDSKEQTLETRNFYNELIQVEILGRESDSSQFAMNLSTVAGPVTLK
FT                   NGADTFFDRGVLHPMERVFFPKSLDITLLNLLETTKSFEFLSFLENFPEFDNIVHQGKP
FT                   SSILVPTSQSLLLDDISLDSSRLKEFLELHIIPANSTEALLNCQSNIQTLHGEYLQCRE
FT                   SSSNTHLLRFKSGLDKEVRVLRKGCASTDNNTCVFVIDQPLSLSWLDQARYQIGLPGIA
FT                   FAVGMLLGVLGIFSLLSCTLMLFMRRRNVEDRGSGQVYNEQEGLLSSQPQPQQPYSSMN
FT                   MSTPPPTAAQRNSSKNDTNSRSRIFENSYSMHSSRNPVSIQQNRG"
FT   misc_feature    complement(238187..238312)
FT                   /locus_tag="KLTH0B03036s"
FT                   /old_locus_tag="centromere.klth0B"
FT                   /note="Centromere Klth0B"
FT   gene            complement(<238392..>240707)
FT                   /locus_tag="KLTH0B03058g"
FT                   /old_locus_tag="KLTH-ORF15596"
FT   CDS_pept        complement(238392..240707)
FT                   /locus_tag="KLTH0B03058g"
FT                   /old_locus_tag="KLTH-ORF15596"
FT                   /product="KLTH0B03058p"
FT                   /note="highly similar to uniprot|P54861 Saccharomyces
FT                   cerevisiae YLL001W DNM1 Dynamin-related GTPase required for
FT                   mitochondrial fission and the maintenance of mitochondrial
FT                   morphology assembles on the cytoplasmic face of
FT                   mitochondrial tubules at sites at which division will occur
FT                   also participates in endocytosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21483"
FT                   /db_xref="GOA:C5DCH2"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH2"
FT                   /protein_id="CAR21483.1"
FT                   /translation="MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSIL
FT                   ETLVGKDFLPRGTGIVTRRPLVLQLNNISPNSPLINEYQDIHGQNYDTSDTKGELTLED
FT                   HLRKSQGFEPTTKDEWGEFLHLPGRRFYDFGEIRQEIENETARIAGKNKGISRIPINLK
FT                   VFSPRVLNLTLVDLPGITKVPIGEQPADIEKQIKNLILEHVAKPNCIILAISPANVDLV
FT                   NSESLKLARDVDPHGKRTIGVITKMDLMDSGTNALDILSGKLYPLKLGFVGIVNRSQQD
FT                   IQANRSVEEALNNEEIFFTRHPVYRTISTKCGTRYLAKLLNHILMNHIRDKLPDIKARL
FT                   NTLMGQTEQELATYGGSGIITKENRAGLVLQLMNKFAARFVSSIEGTSSDISTKELCGG
FT                   ARIYYIYNNIFGHSLESINPTSNLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIY
FT                   LLLEPSQRCVEMVYEELMKICHNCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVE
FT                   SLIDIHRAYINTNHPNFLSATDAMSDIAEAKKNKQKATPGKSDLENAKISLVKELSRKD
FT                   AELQFSNATGKEIPESSTPSEASSEEEERIPSKESKDSFLNYFFGKDQQKSGHFTKFPE
FT                   NGQFPGSHSFDQAENAPPSSDFEKLQINGSTTERTFDEPKLTEREELECELIRRLIISY
FT                   FGIVREMIQDQIPKAVMCLLVNFSKEIIQNRLVTKLYKESLFEELLLEDQNLAQDREKC
FT                   VKLLDTYKEASKIIGDIL"
FT   gene            complement(<240890..>242173)
FT                   /locus_tag="KLTH0B03080g"
FT                   /old_locus_tag="KLTH-ORF15594"
FT   CDS_pept        complement(240890..242173)
FT                   /locus_tag="KLTH0B03080g"
FT                   /old_locus_tag="KLTH-ORF15594"
FT                   /product="KLTH0B03080p"
FT                   /note="similar to uniprot|Q07794 Saccharomyces cerevisiae
FT                   YLL002W RTT109 Regulator of Ty1 Transposition Regulation of
FT                   mitochondrial network Killed in Mutagen sensitive to
FT                   diepoxybutane and/or mitomycin C diepoxybutane and
FT                   mitomycin C resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21484"
FT                   /db_xref="GOA:C5DCH3"
FT                   /db_xref="InterPro:IPR013178"
FT                   /db_xref="InterPro:IPR016849"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH3"
FT                   /protein_id="CAR21484.1"
FT                   /translation="MSSLENLLSRVLPENKKFELLHLQSPPKESHSVFVQQRSDCTQTV
FT                   VKVQHFFGLGADEKIFYSLELFVYLTIESSKAIEKLIFVSKADTNGYCDEKISVKDITT
FT                   AILDYIVTLDPSHYLSKEIKVSGTSPGCGPSITRCTTTKRALKILKARHDSKKGDNCPN
FT                   RGFFRNIEGKDPDWTCKICLFTRSEPQYLFSESSRNPKKHILSGEQLLRWWLSVIDKIL
FT                   VRHFDSGTKATLQIPGEEESRTLRYLSNNKAPFWRVGDIFSGKSSELAIFAIPVFPDDP
FT                   KGRFLEQVVEENRAKKVRLSDFWVELQVQQEFRLGCTVSVIGVDGRIPKKCFGPHNNEV
FT                   IVMPSKKVFSIVKSYIVGEQYDTSEGAYEAYANLRDFLHLRMQRSLLEIRGCRKSSEPG
FT                   SKGTGSDRNAPVRPLNTLTVRRKVKKSI"
FT   gene            complement(<242293..>243024)
FT                   /locus_tag="KLTH0B03102g"
FT                   /old_locus_tag="Klth0B.mRNA.1545.m"
FT   CDS_pept        complement(join(242293..242875,242960..243024))
FT                   /locus_tag="KLTH0B03102g"
FT                   /old_locus_tag="Klth0B.mRNA.1545.m"
FT                   /product="KLTH0B03102p"
FT                   /note="highly similar to uniprot|P38624 YJL001W
FT                   Saccharomyces cerevisiae PRE3 20S proteasome beta-type
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21485"
FT                   /db_xref="GOA:C5DCH4"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR037559"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH4"
FT                   /protein_id="CAR21485.1"
FT                   /translation="MNGIQVDINHLKKGEVSLGTSIMAVTFRDGVILGADSRTTTGAYI
FT                   ANRVTDKLTRVHEKVWCCRSGSAADTQAVADIVQHYLELYTAQFGEPSTKTAASIFKTL
FT                   CYENKDNLTAGIIVAGYDEKNKGEVYSIPLGGSVHKQKYAIAGSGSTFIYGYCDKNYKE
FT                   NMSKDETVSFMKNSLSQAIKWDGSSGGVIRMVVLTKDGAERLIFYPEDYENL"
FT   gene            complement(<243194..>246085)
FT                   /locus_tag="KLTH0B03124g"
FT                   /old_locus_tag="KLTH-ORF15588"
FT   CDS_pept        complement(243194..246085)
FT                   /locus_tag="KLTH0B03124g"
FT                   /old_locus_tag="KLTH-ORF15588"
FT                   /product="KLTH0B03124p"
FT                   /note="weakly similar to uniprot|Q12369 Saccharomyces
FT                   cerevisiae YLL003W SFI1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21486"
FT                   /db_xref="InterPro:IPR013665"
FT                   /db_xref="InterPro:IPR018907"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH5"
FT                   /protein_id="CAR21486.1"
FT                   /translation="MSRLGTKASLSTRFTAQDDQLTSALIHGDSMYSTGSLLKKDIHDL
FT                   LKEAKASSSQFLPENNHLNPPDEPEEPLYHLPFHPAKETGYLGDLSQIFGEFDPNFTSK
FT                   NRAKCDDALILLLFNKTQVFLLRNGFSLDFLMILKRFVELLVEEGLNPLENESLLELQN
FT                   ELEKGWEITPSFVALLDTFMMNPKNIYIALALFEFKSKRHSLKINFTRWKLQTELELNL
FT                   RQLTDIWNSYIKQKHLQRWENTYRFRSEDLKGEADSFYNFKSLSNATDKWMKRMDEQKI
FT                   KQELADAFLIQKEFKTIQKAYTLQIRSRELALRAHSKSCLGRFFTTWRLAARLKETRRQ
FT                   LSAPTEGLFFRKFRQKYRNLDSLSDKARILEKSLVLSPILILWKERLIQRVEKTKHLEI
FT                   LELIFQRKMALKVLKSAFTWKEREAAAKESIHFTLLKYFFCDVWRKRLNERQLFSEHTL
FT                   RQDALLCCKYCTLWRNRVMVKKKANDHYQRAMSQKYFELFQLKCAYSRNERRKRESSTR
FT                   LIFERWQRATELNLQLKAYESNFLRLFWRHEWKRKYANFNDLTSITIKCHNSLVVKQYF
FT                   FRWAKKKENYETLRSKAFLFAKTRVITKMRLVAQRVKKLDAVARKYRTESDAECKRRYM
FT                   TLWLASLKVQMRLKHEILLDQYSSLTGQVLIVRYLKVWRTRTRYLRTECEEAADRLRYE
FT                   SLVGMMFRKALDKMRTYEQWNSVSEELNLQSVLLNHFNIFKQSYAELKQMSEYLERIRA
FT                   EKDLTALVKCMNMWTMKQLKCTRNIETVEIFRNRWNRASLRAIMLLWKEKAETVNTSSA
FT                   TKLRHELYEGGDKVEDQSLVTPTRIKKSGNITIPGSERMKQNRMEAMRNHYRRARKAIP
FT                   SPIKFSDNLDTITKKRLEIGDRESSEPSPPPKLDLGKINKKLASRHTKISFKTIPETKF
FT                   SMEASPERPPRLVVDPSFLSSRPDEVDSSPSIR"
FT   gene            <246188..>247645
FT                   /locus_tag="KLTH0B03146g"
FT                   /old_locus_tag="KLTH-ORF15585"
FT   CDS_pept        246188..247645
FT                   /locus_tag="KLTH0B03146g"
FT                   /old_locus_tag="KLTH-ORF15585"
FT                   /product="KLTH0B03146p"
FT                   /note="similar to uniprot|P41543 Saccharomyces cerevisiae
FT                   YJL002C OST1 Alpha subunit of the oligosaccharyltransferase
FT                   complex of the ER lumen which catalyzes asparagine-linked
FT                   glycosylation of newly synthesized proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21487"
FT                   /db_xref="GOA:C5DCH6"
FT                   /db_xref="InterPro:IPR007676"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH6"
FT                   /protein_id="CAR21487.1"
FT                   /translation="MYYKCSSLLKTVGEMLSATRLAAIFLLFLNFVVGDLDAGIIPKLW
FT                   ENLELHRTIDVSRSYTQELVDIRIKNIHDEPVRQYYFVLPEEVFDAISLFSSTLKGVDA
FT                   YIESAIMPEQNFVANGRTIKVGVIGLPSPIEPGHETSILLNLVYNSRYQPYPGHVDLGE
FT                   EQKLLLRTNRFPISAYNTQKYTLEFQGSSSFEELQSFNGEEHAGMVANGKMVVGPFDSI
FT                   MPYEDFSPIEVVFEHNTPLPRVSHLKRDIWVSHWASSLQFEEYYELINDAASLKSGFSR
FT                   ADYMKGQHALKKGGHLTALEMILPDSSEAHYCTDLVGAVSTFKVLKDHFFLKPRYPLFG
FT                   NWKYNFTVGWTNQLSQFLHSQEDGSDTYILSFPILNGPADTVYDSVSLSIYLPEGAEVL
FT                   DVWCPLPVQKTEVTTEKSYFDLNQGHTKVNIELKNLIDRIAGSEAFVRYKVTSTTFYKK
FT                   PFSIAVSVFTALMAYFFLKHISLMIDS"
FT   gene            complement(<247739..>249631)
FT                   /locus_tag="KLTH0B03168g"
FT                   /old_locus_tag="KLTH-ORF15583"
FT   CDS_pept        complement(247739..249631)
FT                   /locus_tag="KLTH0B03168g"
FT                   /old_locus_tag="KLTH-ORF15583"
FT                   /product="KLTH0B03168p"
FT                   /note="similar to uniprot|P54790 Saccharomyces cerevisiae
FT                   YLL004W ORC3 Subunit of the origin recognition complex
FT                   which directs DNA replication by binding to replication
FT                   origins and is also involved in transcriptional silencing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21488"
FT                   /db_xref="GOA:C5DCH7"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="InterPro:IPR040855"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH7"
FT                   /protein_id="CAR21488.1"
FT                   /translation="MSLNEFAEAQKTHYTVCPKVKRRRISCEKGIDPFVKLLAGKESMQ
FT                   MVNKRWVLYHQLHSQFHAQVEEIVHRVSIDMYREISSVLSKDTSKRTSPSFNCLFLLGS
FT                   DSTTTIELHEQNSKTMQAIIDLTPKESPNVRMMLRRSMFKLLSATEAPLRVKTDEKESF
FT                   APEGDMGELPRTSPLGISYDLSLVQNFRKLFGKRLKLIFNFKDVDSFNSQVLDDFIILL
FT                   KSALNYKDVEICLVLNINTNLSNIQKNLRQSTIRLLKKDFTVIDLSHNKGHKYANQTFQ
FT                   SFLNTVDGKLNLSAEFIKFILDKMSNNATHNLQLLIKILDYSLMSYFFQNPFSVFIDPT
FT                   NVVNFDENYLPPLLKCPTFMTFVEGMVHAHAPSEEIMALLDNKNSTLEEFFTEFLVREN
FT                   PINDHLKLVVDVLENQLGVFNYNLIDLYYHMLTGKLHEFLQRWPECQQFEDILKFEPVD
FT                   IIFQELFTLDNSKELFSQSLFPFLRTNLENNLINSDRMLPPAKRLPGIKDPFEAEFNSS
FT                   VDLPLCQLFSLYREASSIINLYDFFLAFKETLPRSEIANFVNYSVENKESDLRHEDREK
FT                   LSILLKEKGLDNLLDKMMLVWFVQSISEFQHMGLLKTQSNKSYEVVEKCIWRGL"
FT   gene            complement(<250346..>250702)
FT                   /locus_tag="KLTH0B03190g"
FT                   /old_locus_tag="KLTH-ORF15582"
FT   CDS_pept        complement(250346..250702)
FT                   /locus_tag="KLTH0B03190g"
FT                   /old_locus_tag="KLTH-ORF15582"
FT                   /product="KLTH0B03190p"
FT                   /note="highly similar to uniprot|P47081 Saccharomyces
FT                   cerevisiae YJL003W COX16 Mitochondrial inner membrane
FT                   protein required for assembly of cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21489"
FT                   /db_xref="GOA:C5DCH8"
FT                   /db_xref="InterPro:IPR020164"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH8"
FT                   /protein_id="CAR21489.1"
FT                   /translation="MSFGDRKFRSRRQQLAYEASIAGKYQARMKKNPFLYFGLPFCSII
FT                   VLGSYWLSGFTAVRYEQKDRKIQEMSEDDLVKMKANKRQFDIKEEYYRLQGLGEQDWEP
FT                   VRVPRMKGESENVW"
FT   gene            <250834..>253770
FT                   /locus_tag="KLTH0B03212g"
FT                   /old_locus_tag="KLTH-ORF15581"
FT   CDS_pept        250834..253770
FT                   /locus_tag="KLTH0B03212g"
FT                   /old_locus_tag="KLTH-ORF15581"
FT                   /product="KLTH0B03212p"
FT                   /note="some similarities with uniprot|Q07798 Saccharomyces
FT                   cerevisiae YLL005C SPO75 Meiosis-specific protein of
FT                   unknown function required for spore wall formation during
FT                   sporulation dispensable for both nuclear divisions during
FT                   meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21490"
FT                   /db_xref="GOA:C5DCH9"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR032880"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH9"
FT                   /protein_id="CAR21490.1"
FT                   /translation="MPKCCLYSLLPVSAKMASMLGSNQNTPKPEFAKCIQPIIETDYMT
FT                   TAISMDFNTASFRSENRHYSITESILTTFLNTTRAGSAQKHTGMSFDALISSLVVSIVY
FT                   CGLQTLLFTMLRGKLKTLYQTRNFQLSEANEMRSLQENGPLGWVKSAWKTPLNEYKRAN
FT                   GLDSFFFLRFMKAFGLFFLSLSVINIPVLIPIHYCSGAKVLRQRCKIDSLQAFNETEAR
FT                   LTSHFLEIEDSLKAQGLDKLSISNVSLQHADRLIFHFILAAFVVLWFHALLIKELKFFI
FT                   AERNKALSNNEVPGSFYQSVLFLDNIPRDMFLNRAQLPKLFRFADSNDIQLTFLPTNYQ
FT                   RLKKYYQKDKKIIDKLEHLQLKLIVLQSNQCGTQKALPPNERAVSGFATDVSDKYAVRT
FT                   NKLGRKAESAQQCYGPERSKKIYNNGTARKIRKEKVSRYGCARWASKLRLSSHNLNITI
FT                   KHISKQKSHIKINTRWLRALGIPSSFNIIKFRLNKDQARESLMKALEKLATELIQNREK
FT                   WKELSEKPTPFVADGDQKQEEHPKKLFITFKSSRTAHLFAQVLISDKFKELNNVIIGPN
FT                   PIDMIWSNVIQSSRWLKVVRIIFADLIAVLVILGWVLPVAFVGLISQVPNMKILVPFFT
FT                   WLDSDNAFFSSVLSSLVPILFLIFLIDIVPFIFRWLSILKVNRTGAEIELDVQRWLFVF
FT                   FFVHIFLVVTVSSGISVIFEKLINNPTSLPDLLAANLPKSSNFFYSFIFIRGLAYFGGN
FT                   LLQVKELLFELFYYRWCIRTPRKVRKRMEVVSENMWGSVYPLFSTIASIGIVYSVIAPL
FT                   VLIFATVTFLIVQFSFKCRLNHQQHSRGKSETFGKLYPQALMQSYAGIYCLEICMIGLF
FT                   ALSNRYVLVICMALVFIFTILAHFKISKFYDKYINFLPLKEDEESLLTEHPRKDLFPFF
FT                   VKEKCLWIPQDSSGASNDQCHLMNEKFDIFCRNEGCFFDGATGSLNFL"
FT   gene            complement(<253796..>255139)
FT                   /locus_tag="KLTH0B03234g"
FT                   /old_locus_tag="KLTH-ORF15578"
FT   CDS_pept        complement(253796..255139)
FT                   /locus_tag="KLTH0B03234g"
FT                   /old_locus_tag="KLTH-ORF15578"
FT                   /product="KLTH0B03234p"
FT                   /note="similar to uniprot|P41800 Saccharomyces cerevisiae
FT                   YLL006W MMM1 Mitochondrial outer membrane protein required
FT                   for normal mitochondrial morphology and mtDNA stability
FT                   involved in tethering mitochondria to the actin
FT                   cytoskeleton and in anchoring mtDNA nucleoids"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21491"
FT                   /db_xref="GOA:C5DCI0"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="InterPro:IPR027537"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DCI0"
FT                   /protein_id="CAR21491.1"
FT                   /translation="MKSPNETSFTNHTLENASTFGADLSIESNESLVSLDEYLSNTLPL
FT                   HLQQLFLENLQKRQQGILESASDSIIEAVRDSSQQKFQNGLHLSLDSGVGSKGSVFSAW
FT                   SFAQGLVIGQLSVIVVLIFFIKFFIFSEGPIKTEGPKGGKSGPKRDSAYVSPLLSTSTS
FT                   HFLSSIIKRGESDGADSSENTDTDRKFSQINTILEKTYYNVETHSPETLDWFNVLIGQT
FT                   IQQFREEALQKDNIVHSLNNFIARKSGELPQYLDTIKITELDIGEDFPILSNCRIQYSP
FT                   NSNKQRLEAKIDIDLSDRLALGIETKLLVNYPKPFTAALPIQLTVSIVRFQACLTVSLT
FT                   TAEEFVPTSENEASYGSENGGYFLMFSFSPEYRMEFDVKSLIGARSKLQDIPKIGSLIE
FT                   SQIKKWFVERCVEPRFQFIKLPSLWPRSKNTREEKTENDDISMKSTDL"
FT   gene            <255399..>257324
FT                   /locus_tag="KLTH0B03256g"
FT                   /old_locus_tag="KLTH-ORF15577"
FT   CDS_pept        255399..257324
FT                   /locus_tag="KLTH0B03256g"
FT                   /old_locus_tag="KLTH-ORF15577"
FT                   /product="KLTH0B03256p"
FT                   /note="some similarities with uniprot|Q07799 Saccharomyces
FT                   cerevisiae YLL007C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21492"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI1"
FT                   /protein_id="CAR21492.1"
FT                   /translation="MSDSFTTQSFGSPRDYAEQLLNLLSKTTDKTALVTLHRTLSTAEN
FT                   SVFEDCLIARPERWAFVFTAVEKLPKDEEVIKAADFIVRKGASILTSKAEQNGSLKHFC
FT                   AAVNSNFIINTVLTQFMWPHCDAQLEIEVISTVGSFLECLLLLDQYEPQLTSAMLCDTC
FT                   LALRTGGFFTLLTAVLETGPQHDNKVEHMAHRTALKLVEVDQEMYGRGIDKLPSHLMRK
FT                   MLDLLSKQFKVNEWDNENSFPSVDEGGKQISELSLLNAIDLITFATDSNLSFRKKFLER
FT                   LLFEDDAFPIVKALSWLSDQLTHCFSSSFRAEEPTVFILQCFLNKDILIFSLVDKLMEL
FT                   WIESNAQSFDDLRSVLETFKVAFFQRDSFLGAKEPDVGACLVNIRSLTYEDLRKLQLKQ
FT                   IRASHYKKWEKQISQFDSMLSNQVLEYVRHQRLLQLQKGAWVYSENPLDNNVKQPKVYF
FT                   LVLCDNQMNLLAREFRIRSEENPSVQGNEIISSSDTPASKSKTIVIPLRRINKFQHWRV
FT                   QSENKVPENAKLINILNKAVYTEIHLLDKDAAKLLRFFLDTKEASYIWLDGLQLIVASA
FT                   LGKKPALSDDIKSQISTLVDLRKNVQIIGLDDQTKLEHSDQDSEAEEMYYDLETLQSVA
FT                   TDFHYD"
FT   gene            complement(<257395..>259614)
FT                   /locus_tag="KLTH0B03278g"
FT                   /old_locus_tag="KLTH-ORF15574"
FT   CDS_pept        complement(257395..259614)
FT                   /locus_tag="KLTH0B03278g"
FT                   /old_locus_tag="KLTH-ORF15574"
FT                   /product="KLTH0B03278p"
FT                   /note="similar to uniprot|P32892 Saccharomyces cerevisiae
FT                   YLL008W DRS1 Nucleolar DEAD-box protein required for
FT                   ribosome assembly and function including synthesis of 60S
FT                   ribosomal subunits"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21493"
FT                   /db_xref="GOA:C5DCI2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI2"
FT                   /protein_id="CAR21493.1"
FT                   /translation="MDKQKFKDFEDFVPTISDSENEVPDLDGSEDETLHPETSTKTKSK
FT                   KKKANNSNPNEDIHEDLNPSFRFDLDGAEVSSGFEGWNFDGDKKLETNPDVDLDGIIRR
FT                   KGGLIQMAGTGDSESDGSEKESESEGELALDGFGMGADEKSSKCQSATHEGDATDSEGD
FT                   ESGVDEDSGVESDKQTEGQEALMTAGNGSVSDIEDDSEEAKAEFYALEEESTEAKKTVH
FT                   TNFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAYMIPI
FT                   IERLLYKPAQIASTRVIVLTPTRELAIQVSDVGAKLAKFVNGISFGLAVGGLNLRQQEQ
FT                   TLRSRPDIVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEEGFQDELNEIMSLIP
FT                   SKRQTLLFSATMNSKINQLISLSLKKPVKIMIDPPRQAAAKLTQEFVRVRKRDELKPAL
FT                   LFHLIRKLDDLSQKRVVVFVARKEVAHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGF
FT                   KSLQVPVLICTDLASRGLDIPKIEFVINYDMPKTYDIYLHRVGRTARAGREGRSISFVG
FT                   ESSQDRNVVKNAIKSAEENKKQDTVVGRMVDWAKVEEINKLTTNKDDVIAEILEEEKQE
FT                   KEILRAEMEVRKGENMLKHKDEISARPRRTWFQTEGEKKNSKVIQALSKGKKTVNSKKR
FT                   KRIEATEDRSRSYKKTQKDRGSDQQRTYAKQKAKKEMKKKKQARK"
FT   gene            <259839..>260405
FT                   /locus_tag="KLTH0B03300g"
FT                   /old_locus_tag="KLTH-ORF15569"
FT   CDS_pept        259839..260405
FT                   /locus_tag="KLTH0B03300g"
FT                   /old_locus_tag="KLTH-ORF15569"
FT                   /product="KLTH0B03300p"
FT                   /note="similar to uniprot|P41544 Saccharomyces cerevisiae
FT                   YJL004C SYS1 Multicopy suppressor of ypt6 null mutation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21494"
FT                   /db_xref="GOA:C5DCI3"
FT                   /db_xref="InterPro:IPR019185"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI3"
FT                   /protein_id="CAR21494.1"
FT                   /translation="MVTIRRYLRIPQELRPTQIFRQDSLSPIKIALQIILLQLFYYCTA
FT                   YILFYGWARLGGYDVSITKWLFTWEFIDFSNSLGIVLSLLWLLDSLICVLFLTVIVGRS
FT                   KLAWDFGITIHAVNLLVVWINTGRWPSLSWFVVQLLSSAILVFLGTWTTRWSELRDTFF
FT                   DGLVSSQPNPEGQVEMKDLEAQKPI"
FT   gene            complement(<262380..>268052)
FT                   /locus_tag="KLTH0B03322g"
FT                   /old_locus_tag="KLTH-ORF15567"
FT   CDS_pept        complement(262380..268052)
FT                   /locus_tag="KLTH0B03322g"
FT                   /old_locus_tag="KLTH-ORF15567"
FT                   /product="KLTH0B03322p"
FT                   /note="similar to uniprot|P08678 Saccharomyces cerevisiae
FT                   YJL005W CYR1 Adenylate cyclase required for cAMP production
FT                   and cAMP-dependent protein kinase signaling involved in
FT                   cell cycle control and glucose and nitrogen repression of
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21495"
FT                   /db_xref="GOA:C5DCI4"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI4"
FT                   /protein_id="CAR21495.1"
FT                   /translation="MSEQTRRRANSLEAEKSFQVPEDAAEAGASGGLHGRPHFRKQYSV
FT                   GGFGPTFSGGASGASGGIAGAGSASAQGHGARGRAAKALGKGRYKGFHNPVALHSPDDP
FT                   IPPYAHPIKPRIPGLNRTISGNSLFSSSQAARDPQQLQHQQQQQQRKGSRAGSLFKRLT
FT                   GMKMTNASASEPSDQESAAANPTAGPAGIRRKMSTLIHGGSGAGSGQAQDAGHVSGSDL
FT                   NSKTSKSGFLNTPSSTNSRRGSAASIITSPSGNNSPKISHISNSNVNNALSATSASASA
FT                   NDSGNQVSDSSESPGRNALNRSTSYFLLDTDLNNLSDITNISDKKPKEKAKLPPKSRSQ
FT                   TPVAKVQPQDIGKAPLVDTETSAPHEAAHSKVQWIAPESWDIDEEVGKPLPGKKNKRRV
FT                   HRHHTSNTTSKIDRERAGGATKKPGRPKQKENTPKLGSLKEVTDQEHNHLSTTAQEDTK
FT                   ESSGSAASISSAASRSQEFSEAASSTSDYEDDYGDESHWRAGSLDSLQTYDSDQAKNDE
FT                   AFDRVGYELDKYYNDFSDIDPTRRYAIRVFNTDETFTTLSLTPNTTVQEMIPQLKRKFN
FT                   IGQGNYQVSLKVAKILKVLRPTARPILIQRKLLLLNGYQKGDPLHILGIEDLSYVFNFI
FT                   FHPVATSHLSYEEEQRLTRGDFIHVDLRSMNLTTPPIIFYQYTPNIESLDVSNNANIFL
FT                   PLDFIESASKLSSLRMVNIRASRFPPNITEAHVLVSLDLERNFIERIPPSISNLSELTI
FT                   LNLQCNELDRLPTGFTELKNLRLLDISSNNFAQYPEVINHCTNLLQVDLSYNKIQTLPD
FT                   SINRLTKLAKMNLSNNKLTNIGSLSGMVNLRTLNLKDNRITSLKLENSNLQNLSISNNR
FT                   ISVFDDKLPKLKSLEIHENPITSISYDGEYLVNIVTLSLNKAKLASLPPELLCKLPRLE
FT                   KLELNGNNLTQIPPEISKLTKLVYLSAARNKLESISEDITELRNLKTLDIHSNNLSNLV
FT                   KGLGKMELINFNVSSNLLGNTMDIQEVFLNRRDSVLAKSLRFLSMADNNLGDQFWTLFN
FT                   MYENLKTLNLSYNNLSDLSNFKLENLTELYLSGNKFITLQGDTVLRWKSLKVLMLNGNN
FT                   LLSLPSELSQLTQLNVLDVGSNQLKYNISNYHYDWNWNNNKNLKYLNFSGNKRFEIKST
FT                   AALDSESKADLSDLTILKELRILGLMDVTLKTSKVPDEGVNMRLRTTASVLNGMKYGVA
FT                   DTLGLKDSVTSRDVTFERFRGKEDECLVCLFDGKNENVSTGHNISKIIRDIYHKILIRQ
FT                   LEKYGDTAEGIKNALRFSFLQLNKEINSTLNSVDNEATSEDFSSADLLSGSSATVLYMK
FT                   GKRLYTANIGDTMAILSKNNGDVVPLTKLHVPSKREEYERIRISGGYVNNYKLDGVSDV
FT                   SRAVGFFDLLPHIHASPDLSEFNLTTTDDLVIIATAKLWDYLDYQTACDICRENKVEPM
FT                   LAAEKLKDYAISFGCAANMTILCISLDKSSSNQNNFMLNKNDLISRRSTFEDSTLRRLQ
FT                   PEISPPTGNLAMVFTDIKNSTFLWESFPNAMRSAIKTHNDIMRRNLRIFGGYEVKTEGD
FT                   AFMVAFPTPISALVWCMSVQLKLLEAEWPEEITSIQGGCLITDNEDRKIYLGLSVRMGI
FT                   HWGCPVPELDVVTQRMDYLGPVVNKASRVSGIADGGQITLSSDFCSEFNKILGLHERVV
FT                   KENAPLKEVYGEEFVGEIMEREVHLLESIGWEFRELGEKKLKGLETKEFITIAYPKALE
FT                   ARHGFTTRDAETSLVDEETLFQLRAVSTKLESLVSVLNGVMLEKKEYSEAGSYVNLDKK
FT                   QISAVSHSTTEGDRIALLDHIITRLESIVATLQIRQRVEGALEPPKIGDAGGERSIFEI
FT                   VDQLLLETGRLTDSRK"
FT   gene            <270448..>271410
FT                   /locus_tag="KLTH0B03344g"
FT                   /old_locus_tag="KLTH-ORF15559"
FT   CDS_pept        270448..271410
FT                   /locus_tag="KLTH0B03344g"
FT                   /old_locus_tag="KLTH-ORF15559"
FT                   /product="KLTH0B03344p"
FT                   /note="highly similar to uniprot|Q07938 Saccharomyces
FT                   cerevisiae YLR017W MEU1 Methylthioadenosine phosphorylase
FT                   (MTAP) catalyzes the initial step in the methionine salvage
FT                   pathway affects polyamine biosynthesis through regulation
FT                   of ornithine decarboxylase (Spe1p) activity regulates ADH2
FT                   gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21496"
FT                   /db_xref="GOA:C5DCI5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI5"
FT                   /protein_id="CAR21496.1"
FT                   /translation="MVNASELPKTFNGPIDLGIIGGTGLYQLDCLEAIAVLPPVKTPWG
FT                   QTSSPITISKITGDSEEHFHVAFISRHGLHHQFSPSTVPFRANMAALKHLRCKAVLSFS
FT                   AVGSLQQQIKPRDFVLPQQIIDRTKGVRDSSYFNDIGLVAHVGFGEPFSKSFAEYISKF
FT                   HGILENPGVDEPCELHFDIDTTVVCMEGPQFSTRAESKMYRMLGGDVINMSVLPEAKLA
FT                   RECELPYQMVCMSTDYDAWRDEAEPVTVETVIGNLQNNGANANALASAIITDMANKMPE
FT                   FMKTGDGLKGSIKMSISTKPAAMSKDALEKLKFLFPDYW"
FT   gene            complement(<271449..>272618)
FT                   /locus_tag="KLTH0B03366g"
FT                   /old_locus_tag="KLTH-ORF15558"
FT   CDS_pept        complement(271449..272618)
FT                   /locus_tag="KLTH0B03366g"
FT                   /old_locus_tag="KLTH-ORF15558"
FT                   /product="KLTH0B03366p"
FT                   /note="weakly similar to uniprot|Q7LGY6 Saccharomyces
FT                   cerevisiae YLR018C POM34 nuclear pore integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21497"
FT                   /db_xref="InterPro:IPR012578"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI6"
FT                   /protein_id="CAR21497.1"
FT                   /translation="MSNSAMDNSFEPSSSNSAFSALYRRDFGNAMNSSTVPRKMFSTPV
FT                   KPVTQERFASVREKVVRESPYLYKSKILSSPVKDGKRVSKSVGGTPLARPTVFQKSRPT
FT                   SSESTSNETEAKGTVASENTESVLGGFENPVLAQYSCRIVNKELETRKIISNLLAVLVW
FT                   NLALKFLSLYLDHTLHGAGFSKRVAKWVQETLVYRINPYADFEHSRWARLITLANVSHI
FT                   FHLIIFYNVTVSLWRLLVKSQNVKIDDLHLNQRQKQLLGLSDQTQTSSALPRVVLAASP
FT                   QEPLSKPTSLASSPHKASAPPVFLFKSLQTPLKSKERAAAAERAGVRSERAPKINAFGD
FT                   LRSSVLKKSSLTPSHVSSGLLPTAMNRTGYIPSSKYAYMRDSPSPRKTM"
FT   gene            <272914..>274143
FT                   /locus_tag="KLTH0B03388g"
FT                   /old_locus_tag="KLTH-ORF15557"
FT   CDS_pept        272914..274143
FT                   /locus_tag="KLTH0B03388g"
FT                   /old_locus_tag="KLTH-ORF15557"
FT                   /product="KLTH0B03388p"
FT                   /note="similar to uniprot|Q07800 Saccharomyces cerevisiae
FT                   YLL010C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21498"
FT                   /db_xref="GOA:C5DCI7"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI7"
FT                   /protein_id="CAR21498.1"
FT                   /translation="MGFISSLLCCSSSQSGNQREKANGKRPLTAQQSRIHTALSNSTRQ
FT                   MNTAPSRNDGKPAGEAKATGSSKAIRTSKARSEAQVVSSAQHGHASTEEPAETEDDTLN
FT                   KEEKQVVSVYNGETESSTGTAEDHGLLARKAAGGAGETDEEDADEDEDRNSTSHEVTAV
FT                   VHEAEQSSSAEDDSDAALAEHQDREGDMQRAPSYDYDPENAVSEEMVDLAALQPDQAHA
FT                   PGVNTLLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADFVIPVEIDNQVHNVYVIKR
FT                   PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHCIHHRLFRDSCYNYDGNYIKN
FT                   LSQIGRPLSDLIILDNSPASYIFHPQHAIPISSWFSDVHDNELLDILPLLEDLAEENVP
FT                   DVGKILDVTI"
FT   gene            complement(<276115..>277548)
FT                   /locus_tag="KLTH0B03410g"
FT                   /old_locus_tag="KLTH-ORF15554"
FT   CDS_pept        complement(276115..277548)
FT                   /locus_tag="KLTH0B03410g"
FT                   /old_locus_tag="KLTH-ORF15554"
FT                   /product="KLTH0B03410p"
FT                   /note="highly similar to uniprot|P33750 Saccharomyces
FT                   cerevisiae YLL011W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21499"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007287"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI8"
FT                   /protein_id="CAR21499.1"
FT                   /translation="MKIKTISRSADDYVPVKSTQESQLPRNLDPALHPFERAREYTKAL
FT                   NATKMERMFAKPFIGQLGYGHRDGVYTIAKNYHALNKLASASADGVVKYWNMSTREEIC
FT                   SFKAHYGLVHGLCVTPQHLSANKNENYMLSCGDDKTVKLWSVNTEDFSSSKNDEEQSST
FT                   DGLIKTFHGDYAFLGIDHHRSKPYFVTAGAEINLWDSSRSRPTANLSWGADNVSTVKFN
FT                   QNETDIFASAGSDNSVVLYDLRTNSPTQKFTQRMRTNALCWNPMEAYNFVVASEDHNAY
FT                   YYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQVKHGHSREVYHTK
FT                   RMQHVFQVKYSMDSKYIMSGSDDGNIRMWRAKAWERSSVKTTREKNKLEYDEKLKERFK
FT                   YMPEISRISRHRHVPKVVKKAQEIKNIEIGSMKRRETNERRTNKDMAFVPERKKQIVGV
FT                   VHQYQDNKREKSTDADQED"
FT   gene            complement(<277684..>279213)
FT                   /locus_tag="KLTH0B03432g"
FT                   /old_locus_tag="KLTH-ORF15551"
FT   CDS_pept        complement(277684..279213)
FT                   /locus_tag="KLTH0B03432g"
FT                   /old_locus_tag="KLTH-ORF15551"
FT                   /product="KLTH0B03432p"
FT                   /note="similar to uniprot|Q07950 Saccharomyces cerevisiae
FT                   YLR020C YEH2 Steryl ester hydrolase catalyzes steryl ester
FT                   hydrolysis at the plasma membrane involved in sterol
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03432g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21500"
FT                   /db_xref="GOA:C5DCI9"
FT                   /db_xref="InterPro:IPR006693"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI9"
FT                   /protein_id="CAR21500.1"
FT                   /translation="MALSMDLVYTPISLVVSTTFLTVLLVLSLCHNVVEAHFKKKDPRD
FT                   TRSSNVRNSPKNHSRDSSVGSATPLGYGRYEMGNIEYDHDVTNPDTRPNTAFENSAYQP
FT                   RPVGIRENPFSSVLNAEDLKLVPDLKYYFEEYGIAIEEFEIQTLDGFFIDLWHLKPKGH
FT                   SNPSKGGHPMLMLHGLLQSSGSFASGGRKSLAYYFYESGYDIWLGNNRCGFKPKWNDYI
FT                   VKKKDRWNWDMRDLVQYDLRALVSTVLEKTGKEKLTLIAHSQGTTQGFMGLANGETVYD
FT                   DDFKLLDKLENFVALAPAVYPGPLIEEKMFVRFMSKFIDSPYVFGRCCFLPLMMLMRSL
FT                   MVGWKLFSFLSYVMFNYLFDWNDSLWDKPLRNRHFLFSPVCISVNLLQWWLSQDKRKSS
FT                   FKTYSNGIFPDSKTWFPSGGEPAKKQTEMHSNQEKITTDEYPRILMFIPKQDRLVDGER
FT                   LINHFTNCEPQSLYKIWYIDEYSHLDVLWSHDVIERVGKPILNTIRTNSSH"
FT   gene            <279356..>279877
FT                   /locus_tag="KLTH0B03454g"
FT                   /old_locus_tag="KLTH-ORF15548"
FT   CDS_pept        279356..279877
FT                   /locus_tag="KLTH0B03454g"
FT                   /old_locus_tag="KLTH-ORF15548"
FT                   /product="KLTH0B03454p"
FT                   /note="similar to uniprot|Q07951 Saccharomyces cerevisiae
FT                   YLR021W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21501"
FT                   /db_xref="InterPro:IPR018854"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ0"
FT                   /protein_id="CAR21501.1"
FT                   /translation="MFCREIRKVVPSDLNLGADNTLEAVAVHFTNKVVLKLRFNGELDT
FT                   CYEILSKGLPAEGLGSTPLGKVVLNSGIGPEDEDFEDLSPIEDGLSNFHVTTRLGNSND
FT                   MKLPIVCTQIAEMYQKAVLPSNIDGLRDIAPSRDFVVSLSAKMWKRDTSETDFALLVFI
FT                   LQTIKEMYNS"
FT   gene            complement(<279956..>280684)
FT                   /locus_tag="KLTH0B03476g"
FT                   /old_locus_tag="KLTH-ORF15547"
FT   CDS_pept        complement(279956..280684)
FT                   /locus_tag="KLTH0B03476g"
FT                   /old_locus_tag="KLTH-ORF15547"
FT                   /product="KLTH0B03476p"
FT                   /note="highly similar to uniprot|Q07953 Saccharomyces
FT                   cerevisiae YLR022C SDO1 Protein required for cell
FT                   viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21502"
FT                   /db_xref="GOA:C5DCJ1"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR018023"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="InterPro:IPR036786"
FT                   /db_xref="InterPro:IPR037188"
FT                   /db_xref="InterPro:IPR039100"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ1"
FT                   /protein_id="CAR21502.1"
FT                   /translation="MINQPSGQIKLTNVSIVKLKKGKKKFEIACYQNKVQDFRKGVEKD
FT                   VDEVLQIHQVFINVSKGQVASKEDLTKSFEAKDLDTIIKEILTRGEIQLSEKERQLMLN
FT                   KINNEMLTIVSAKCINPKSKKRYPPTMIHKALVELKFNVVLNKPAKLQALEAIKVLVAK
FT                   QIIPIVRARMRIKVDLQKPGNDDLIEKLLPLIKSPELTEAESSWCCAGLIDPVSYRTIV
FT                   EACNNRGTLQVLDMAVVDNK"
FT   gene            complement(<281148..>282788)
FT                   /locus_tag="KLTH0B03498g"
FT                   /old_locus_tag="KLTH-ORF15545"
FT   CDS_pept        complement(281148..282788)
FT                   /locus_tag="KLTH0B03498g"
FT                   /old_locus_tag="KLTH-ORF15545"
FT                   /product="KLTH0B03498p"
FT                   /note="some similarities with uniprot|Q07959 Saccharomyces
FT                   cerevisiae YLR023C IZH3 Membrane protein involved in zinc
FT                   metabolism member of the four-protein IZH family expression
FT                   induced by zinc deficiency deletion reduces sensitivity to
FT                   elevated zinc and shortens lag phase overexpression reduces
FT                   Zap1p activity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21503"
FT                   /db_xref="GOA:C5DCJ2"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ2"
FT                   /protein_id="CAR21503.1"
FT                   /translation="MDRLESLLPNDGAYRPRLHKLRTRGKQIVRWSKSQVAGVPAYALR
FT                   KITWGAASEADEDAGDDARAAAAEPPTELFAADFDAITMVDSRPQSMLNSYRMKDAQTA
FT                   RWHAKTATAAAAMASGVSYVSSAATLVSSSSFSSAENISLSLPSASPARSLSSADSCGT
FT                   SPVSPVAGLRICDAKAIEKSFQSIQNDAEAVAASIKFHNYEVALQLGQQRHLHYYELPF
FT                   PWRENRFIIHGYRFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKGFSQT
FT                   TVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCACVDYTGITVL
FT                   VTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPLRIA
FT                   FYLLLASFGFFSYLHSRLFNTAVDSSDLIKPVFMKSLAWYIIGVVFYGTFIPERWRSDV
FT                   QVDANIPTEEQLTTDLEIITKHRHIHFRSQPASHHKCKNADHKRSFKSLWWVDYFCCSH
FT                   TLWHLFVLLGVIGHYTAMLEMFEKRWLRG"
FT   gene            <284167..>286437
FT                   /locus_tag="KLTH0B03520g"
FT                   /old_locus_tag="KLTH-ORF15535"
FT   CDS_pept        284167..286437
FT                   /locus_tag="KLTH0B03520g"
FT                   /old_locus_tag="KLTH-ORF15535"
FT                   /product="KLTH0B03520p"
FT                   /note="some similarities with uniprot|Q02601 Saccharomyces
FT                   cerevisiae YLL013C PUF3 member of the PUF protein family
FT                   which is named for the founding members PUmilio and Fbf"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21504"
FT                   /db_xref="GOA:C5DCJ3"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ3"
FT                   /protein_id="CAR21504.1"
FT                   /translation="MSTTENQRDPWVTHDAAGSAGGAHAANMDSELASIVSSLSALSSV
FT                   SAHQQHGQIGSFRRGSFHSNQGSDVESEMLFHTQTSPPIKRTTLSVGGMPLGGPSGVNN
FT                   RLSKMKNYSGSLAGGSVLQQQPIQGGFFERFGRSLAEGTREVELNLGSTSGRASRRESM
FT                   NAMDSLSRATTNSTFQGVAMEGRRTSVASDAMESLSENLNMQPEEPGNLNHRNIWKVAE
FT                   APVFRPQASENSGMEPAFPQPPAEALNQPYGFSYPNYWKMGAPMIPLAVPPSEQLKAGK
FT                   DFPEPSAAGGNVPVDPSSQPFPPFMFPNNPYLFFPPGATPPPPPHPFQPAASNPKDLPK
FT                   GPNAKTHGNPYLYNSRNHKPARGSPSAPFPPQPNPAAAANSSTPRGKGKYNVVRSPLLE
FT                   EFRNNSSGKEYRLPDIYGSALEFCKDQHGSRFIQQELVKATDTEKEVIFNEIRDEAINL
FT                   ADDVFGNYVIQKYFEHGLKSQKDVLFEKFTGKMEKLSLQMYACRVIQRALECIDLDQKV
FT                   ILVNELSGCVLKMIKDQNGNHVIQKAIERIPIEKLPFILGSLEGQIYHLSTHSYGCRVV
FT                   QRLLEYGTLEDQEKILADLDQFIPFLIQDQYGNYVIQHILKQGPETDDTHIGRTKQNIV
FT                   DIVCKNVVEYSKHKFASNVVEKTMVFGSPAQKKQFMEKVLPESAEHATRLEDNAPLILM
FT                   MRDQYANYVVQKLVGVAEGDDKKVTVIAIRSYLEKLNKINALGNRHLASVEKLAAIVEN
FT                   VQV"
FT   gene            complement(<286578..>286901)
FT                   /locus_tag="KLTH0B03542g"
FT                   /old_locus_tag="KLTH-ORF15528"
FT   CDS_pept        complement(286578..286901)
FT                   /locus_tag="KLTH0B03542g"
FT                   /old_locus_tag="KLTH-ORF15528"
FT                   /product="KLTH0B03542p"
FT                   /note="similar to uniprot|Q12431 Saccharomyces cerevisiae
FT                   YLL014W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21505"
FT                   /db_xref="GOA:C5DCJ4"
FT                   /db_xref="InterPro:IPR008504"
FT                   /db_xref="InterPro:IPR029008"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ4"
FT                   /protein_id="CAR21505.1"
FT                   /translation="MSSQELFRNIKAQESIAYNKKVLLYIQDATSLGIGCGAGILQLEG
FT                   SRGFAAFVSGYAVVALLFIAWFCGLSPKRFFQSPIQEIFFDSFFRELMGFVMAWTFVYA
FT                   LVD"
FT   gene            <287100..>288245
FT                   /locus_tag="KLTH0B03564g"
FT                   /old_locus_tag="KLTH-ORF15527"
FT   CDS_pept        287100..288245
FT                   /locus_tag="KLTH0B03564g"
FT                   /old_locus_tag="KLTH-ORF15527"
FT                   /product="KLTH0B03564p"
FT                   /note="similar to uniprot|P48362 Saccharomyces cerevisiae
FT                   YGR187C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21506"
FT                   /db_xref="InterPro:IPR007205"
FT                   /db_xref="InterPro:IPR007206"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039717"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ5"
FT                   /protein_id="CAR21506.1"
FT                   /translation="MPSQLEELVSFLHSPQPAVRQIALDNLVGFSTGSNATVFRYDNYR
FT                   AISDLKGLARENSKLLVQQSVTILANLCDDLTMRKMIASDEGFLKYLTCKICDLRNTSA
FT                   DIMCILLTNLAKEDCITKVFSFTTMDSKDVTLDKNVFKSERIVDCLMDCFVKGSDRTLN
FT                   KFANFDYLAYFFADISRFRLGREYFIQKQKYDGVIPISKLLVFTEKYDSKTRREGVAST
FT                   IKNSLFDSEKHEELLSNEEINLLPYILLPIASAKDSEIDDEDMFNLPEELQLLPEDKQR
FT                   DPIPEIICVHLESILLLCTTKKGREYLRSKSVYPLVRELEKNVENNDISELCDRIVNML
FT                   MRGEIGTDQIEEMPTRNAEDEKSRLSDDEDSEDDNAIVEVA"
FT   gene            complement(<288352..>290331)
FT                   /locus_tag="KLTH0B03586g"
FT                   /old_locus_tag="KLTH-ORF15524"
FT   CDS_pept        complement(288352..290331)
FT                   /locus_tag="KLTH0B03586g"
FT                   /old_locus_tag="KLTH-ORF15524"
FT                   /product="KLTH0B03586p"
FT                   /note="similar to uniprot|P41895 Saccharomyces cerevisiae
FT                   YGR186W TFG1 Largest subunit of the RNA Polymerase general
FT                   transcription factor IIF (TFIIF) interacts with Fcp1p
FT                   phosphatase and with TFIIB potentially phosphorylated by
FT                   Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21507"
FT                   /db_xref="GOA:C5DCJ6"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ6"
FT                   /protein_id="CAR21507.1"
FT                   /translation="MPNPLKSSNSASPFIKREQLRRDFLRSRLKKNGTPRPYVKKEDPE
FT                   AYDERTRQLLSGGQSHSGIKREEGSQYNEFPLRAVSHEQLENIRTHILKFQSKKKVDPQ
FT                   RDMHLPVRLHRKDTRNLQFQLTRAEIVQRQKEIAEYKMKADSERNGGEQSQAGSSATNL
FT                   QSDSNVASSAAQTPVETPGDTPADTPVKQESVKEEHGSSSMAIKKEGADLPATKLEEAG
FT                   VAEDPTKVGMVKYDGKEKPLETESKEDPFADVAPDGGGRFRRGNTKRKTRQLKLLDENA
FT                   KRLRFEEFYPWVLEDFDGLNTWVGSYEAGNSDSYVLLSVENDGSFTMIPADKVYKFTAR
FT                   NKYATLTIDEAEKRMEKNGKGIPRWLMKHLDDIGTTTTRYDRTQRKLRAVDARQGEEDD
FT                   RNDNSEVELDFDEEFADDEEAPIIDGDEKENKESEQRIKKEMLQANAMGLRDDDEEADD
FT                   DLFGEKKIDDEGERVMKALQKSDMAALYESDDESKSNPYLSESEGENTEEAKAKDENQE
FT                   NGKSSRKGSPKKKSSRGSPSGPRIYVKSIKDFQLVLRADKSVLRNFPEGNWNPHAKDEK
FT                   SRTPGAASSPSSPPIKIEDDIENPDLLTERDIIDVVTGRQMTLKQLIKELKEKVAKHPS
FT                   NKDRMKYLVKRLVRLNNGYLELNK"
FT   gene            <291073..>292290
FT                   /locus_tag="KLTH0B03608g"
FT                   /old_locus_tag="KLTH-ORF15518"
FT   CDS_pept        291073..292290
FT                   /locus_tag="KLTH0B03608g"
FT                   /old_locus_tag="KLTH-ORF15518"
FT                   /product="KLTH0B03608p"
FT                   /note="highly similar to uniprot|P36421 Saccharomyces
FT                   cerevisiae YGR185C TYS1 tyrosyl-tRNA synthetase
FT                   cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21508"
FT                   /db_xref="GOA:C5DCJ7"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023617"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ7"
FT                   /protein_id="CAR21508.1"
FT                   /translation="MTGESQTIQDPQAAYELITKNLQEVLNPQIIKNVLEVEKRPLKLY
FT                   WGTAPTGRPHCGYFVPMTKLADFLKAGCEVRVLLADLHAFLDNMKAPLEVVKYRAKYYE
FT                   CVIKSLLRSINVPIEKLDFVVGSSYQLSSEYTMDIFKISNVVSQNDAKRAGADVVKQVA
FT                   NPLLSGLIYPLMQALDEEHLGVDVQFGGVDQRKIFVLAEENLPSLGYKKRAHLMNPMVP
FT                   GLTQGGKMSASDPNSKIDILEEPKQVKKKINTAFCAPGVVEDNGLLSFIEYVVAPIQEL
FT                   KHGANYFKFYIDRPEKFGGPVTYNSFKELVEDFKNEKLAPPDLKTGVSDIINELLAPIR
FT                   EDFAKDPEFQEAQAKGYPVVSTEKVKKQKKPKNKGTRYPGGQAPNNDPTAVVAEKLEQT
FT                   ELKESS"
FT   gene            complement(<292423..>297858)
FT                   /locus_tag="KLTH0B03630g"
FT                   /old_locus_tag="KLTH-ORF15516"
FT   CDS_pept        complement(292423..297858)
FT                   /locus_tag="KLTH0B03630g"
FT                   /old_locus_tag="KLTH-ORF15516"
FT                   /product="KLTH0B03630p"
FT                   /note="similar to uniprot|Q07963 Saccharomyces cerevisiae
FT                   YLR024C UBR2 Cytoplasmic ubiquitin-protein ligase (E3)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21509"
FT                   /db_xref="GOA:C5DCJ8"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039164"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ8"
FT                   /protein_id="CAR21509.1"
FT                   /translation="MTPEVNSLREFLVSLPRLASYKYNPSIEYLLWKTLDECVKDGLSS
FT                   VNWLEKEQFFASQNWENGAYQALRLPENWRDSFFSTAAKSGLNHAGSSCNRLCSPTETV
FT                   FYCFDCTRNPLYEICERCFDAQKHKGHRFTSRVVTRPEGRACHCGDPSGFNSGTNELLC
FT                   KNEANNQVRSPNYNYDANLTSIFEQILDYLIDTIIFLKELYEEPNKTVMSDGKGCPETT
FT                   STTCALQLYESDCSLHIKDLAYRISLLLNKPIEFGLMMVDKLQRDCSFITLFECADTKK
FT                   LAIIQDAFASENITLHVKATSNVFKEYLIDEIINWLYKLCLYSPSLTSKLSLRLALSGA
FT                   WNSGLLSTKHTPHDFSPFTSKIALLGGFVVPFEQRETFPWPKPWGFPFESDARHDPRIL
FT                   QVMHEYDKRLQETNSSGVTTRFTSILGSRLQTILVEEAALLPKIARFRILKIVSSIFTI
FT                   TDDSRKCIAAQYIDVYPNLLYNAVACDSFSQKVSLMSSLSQHIFQVPEIANMIISSGFI
FT                   ERIIQFAFTLMSFSPEELTECPPVPLYGDFKLPTDMIKNKRSVVCFKDIYLLMSTNTQP
FT                   EMLLTNDSITQCMIRCFSAFNNVLPLRRETAEHVEFENFEFSSYFFYFSSILVMVDGFI
FT                   RNICLLEDPHARGRVVRHFLKLSLSKEFELLGNAKSLMPGKLSTSCELKTSNGLRVIRE
FT                   KVCNTISSVIQFQVGIDCQSFFNPMSYFFKFVTLWSQCGRYEPLPYNFSDFFDIREVFG
FT                   DKIQMNWMCESALSTIVLLAQINVGFWVRNGSPIQHQARMYTRYSMREFTYFSDIFMLQ
FT                   LAMSIADPNEFMVTFLSRWGLKNWAEGIPIGDYPDAEITAGMVDQLLLLLIQLFSEIRS
FT                   LTMKSSVEGFEKTMQMEISHALCFKNSTHSEILNLIPEHVTKHPAFDLYLREMADYAPP
FT                   NGPVDAGIYTLKEKYFSLIDPYFIGFSPSKRFEAEKLIRKRLSIETQTDYNMSYIPARD
FT                   FASCLKETPYKNLYQICSTEIFGCFLKNTLDHINKFNYESMLTKATHLVHLCVVNDLLG
FT                   FTSIFWKEYGFSNSEYLYNSSIGSLLYSFLFKEEFVNEHGKIREIFQHFMKYAPHVNIE
FT                   GYLTEQTPSFNFEILKTPFKTTERKDEEYEKRKQLAKHKREKIMKRIAKQQQKFLANNH
FT                   ISLEDESGSLCKNRDQGENQFFPEMTCVFCKMHKVNDTFIYFAYLERNICEAEVELDWE
FT                   LSHARVSAIPKEGGRSHSNEAARDMDIVEMPQSLSSKISVFPVLRTCGHGSHVCCLTSH
FT                   MKSTRTVHNHITKNIPSSLGFSLMFCPLCSALTNCFLPRMCGDSSGSAPNPSEPIERND
FT                   PFESSLKNCNRSVAVLRELVQMDGVGESPIQVLNYIYRNTLRNTELATRLKRPHRETVK
FT                   ECSDFASHQQLLTLRLLSDLRRIYSQFSEPKEYVSPKEYSLFPPPFKYTPNQKSTKQEC
FT                   ELDLLNLADYRILNTDFGSKVCVKEFLLEFINKGLHQDFLAICGSIATKGSREVTACKH
FT                   QLQKKTSFTSSEEKHVFCILRSYLSNFSTADLTAVELATSITRGVLKDSMVIRLRRLFA
FT                   LLYFGGTPEFELKERIIDFGVLGDLLKGFDLPDFSELLQNYIDRDLQQMLKHVELTLKE
FT                   QGEEELIKNANALKIGCFKKNFLINLPQSYSEFMSNEDEFLQMRAKKQEIAICLFCGSR
FT                   VRVQNAVLLHNYSIGECTNHSLNVCRVNPIYGCFLLVRSNTVYLSYGHRGTFYQAPYLN
FT                   SHGETDDDYRNGAPVFLDRNRYLHLSQDVILNNMVPHLVFRLTENTLDLGGWESL"
FT   gene            <298170..>303941
FT                   /locus_tag="KLTH0B03652g"
FT                   /old_locus_tag="KLTH-ORF15512"
FT   CDS_pept        298170..303941
FT                   /locus_tag="KLTH0B03652g"
FT                   /old_locus_tag="KLTH-ORF15512"
FT                   /product="KLTH0B03652p"
FT                   /note="similar to uniprot|P19812 Saccharomyces cerevisiae
FT                   YGR184C UBR1 Ubiquitin-protein ligase (E3) that interacts
FT                   with Rad6p/Ubc2p to ubiquitinate substrates of the N-end
FT                   rule pathway binds to the Rpn2p Rpt1p and Rpt6p proteins of
FT                   the 19S particle of the 26S proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21510"
FT                   /db_xref="GOA:C5DCJ9"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR039164"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ9"
FT                   /protein_id="CAR21510.1"
FT                   /translation="MIREGSADFQLHLRRTLQLIQNEPHFKKAKGPKDRAELDKLLKSF
FT                   IFRYLYFIVSNNGKFLPQLFTSVPHEKFPATLQEALDVDRASISRHDPFYVIDDSVANE
FT                   SHRHTGRNCGRKFQAGEPIYRCKECSFDDTCVLCIHCFNAKDHINHHVYTSICTHVNNG
FT                   ICDCGDVEAWNVPLNCKAETEDEGSESEGAFESPEMTYILELTLTEIFDHFLDVFNQNI
FT                   EPLPTMQRDITVKLRDMVQSEKSEEKEEFLQDLQYKNEDMQDLKKGLTEIEAPDYTVLV
FT                   YNDEYHNYSQATAALKQGVPDDKNTDKLTARIDGEGRAMLKCSKDISSVLSGFFAVRTN
FT                   GLSATLTAWSEYIQQEACKYIIAWVGHCLTIPNSSFQQGFRSAMGRVLCSGSERLPEAV
FT                   DVSLLVDKHFPAKHSEEDPYRYANLSVLDRENVVPFSHHKVLAEGETDHISLTLNKTEP
FT                   PSPKRYANSRLQLLLFFDNRYWKKLRKDIQDIVIPTMASSLEFKPIFCEQLVEIFNHMT
FT                   RSVAFMDREPQLTVLRESVVQLFTCPTNAYSIFQSGSFCDIMWSVIDIFTEFSKKDAGV
FT                   LVWQKVKKTNPTKSYSISFKQNLYSVETILSKVSDPNLLLRPKEFIAIVTLCKLFNGAW
FT                   KIKRKEGEHVLREDQNFIPYLEYTTSIYSIVQTVDKILENKRDEVDETLLLQAIKLLST
FT                   FLGHRTPSQTVYDSHEIIKFKVSKQPVAFMNPVHTLMSFLIEKVPLAKAFAALSGCNDF
FT                   LTISDFSLRAVVLCSQIDVGFWVRNGMSVLRQSSYYKNNPEMACYIRDVHLNQLTFLNE
FT                   KDDLVRLIYNILDRWELLEWFNGKEDFDKTVYEDKIVYILQQFIAFVYQLLTERQSFKI
FT                   FKSPEEKEYYQIKRAIMYGLYMEPLSYSSLLSAVPEYLTESTDQFDRALEDVSVYMGPK
FT                   GLMDNGVFKLKPELYKRIDPLQLPNMGNDFEHSASIIKARLAESGEDPKNTVLEPQLIS
FT                   PKFLDESAKNLGAFTRTKVFAKVIYNLLRVSIDLDEGTFLYALLHLVHSILKDDELVNG
FT                   KNSIPEVYISKPICNLLFIIIDIKSSVFSENVVAKADYLLESLIWKNPTSILESLVSSF
FT                   GEECVERYKARKLHQGINFEESEKGRKRRLAKERQEKILSKFSRQQHKFMKENQSEFGS
FT                   NDDDIEMADNGLSQAVEDYTCALCQDTSSVDAFVIPVYHENTPIFRNGDIRNVKEFGVE
FT                   WNRFQNNKDSATTYEEESVQNFREDGSKGSRKVFVSCNHYIHYKCFKRYAQKKRFSTNS
FT                   FICPLCQTFSNCVIPVAGYSPKPSESSIKELLQNSGAKSNIDHLHQTDPNEDFNGVFNM
FT                   FLEINKKNMYYDRHWATTPESQRPDVAYILAVHWANTISMLEVSARIADHPNDSLLQGK
FT                   EQKFRTLKNVLSSIAWLHKVLGRPSKEIIPYVNGEDTIWNQNQLFQFIVRRSLFSSEPI
FT                   TNVITGGLSVFSRQLLVDFLKGSTPNDVKMMREASANFGGIHDIDNETLDVLRDVCDIS
FT                   VSDEDTCRQLYSLAFASLIKNVLPTIRRCLILLKAINMLIMKSDEASLIVNGINLELVT
FT                   SSSTPEYINSVIGLITPFSSFNDLLRKSNSYVKSVTDPYLSNIPYEFTGIVKLMDLAPH
FT                   LNTYLTNSKEVKLREEHPARMRNAGNRLDFKICLTCGVKVHARNDRTELVRHLANHCFK
FT                   PFGLFLIPNLNEVTLILTNPRSSISISAPYLNSHGEAGRNAIQRGDLTALSLQRYEHLN
FT                   NVWLNSEVPGLISRVMGDEFRVLIVSNGVVLNFNRNVLRPRRANAEEPDGDSSSSEAED
FT                   DDLEGGEVRWEIRPEEFFEEAGIRFEGAGAIPGGDIRDFFQFINNLDTETDAFEEDEET
FT                   GGEAQGLANAFVPRFEFLPNFRNFNARNEDEPDDEDEDEVNHPVSDDIE"
FT   gene            <304162..>304797
FT                   /locus_tag="KLTH0B03674g"
FT                   /old_locus_tag="Klth0B.mRNA.231.p"
FT   CDS_pept        join(304162..304164,304585..304797)
FT                   /locus_tag="KLTH0B03674g"
FT                   /old_locus_tag="Klth0B.mRNA.231.p"
FT                   /product="KLTH0B03674p"
FT                   /note="similar to uniprot|P22289 Saccharomyces cerevisiae
FT                   YGR183C QCR9 7.3 kDa subunit 9 of the ubiquinol cytochrome
FT                   c oxidoreductase complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21511"
FT                   /db_xref="GOA:C5DCK0"
FT                   /db_xref="InterPro:IPR008027"
FT                   /db_xref="InterPro:IPR036656"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK0"
FT                   /protein_id="CAR21511.1"
FT                   /translation="MAFSTIYNIFFKRNSIFVGTVFASSFVFQAAFDSAVTSWYEQHNK
FT                   GKLWKDVKAKLAQGGDDDDEDDEDDE"
FT   gene            complement(<305074..>305463)
FT                   /locus_tag="KLTH0B03696g"
FT                   /old_locus_tag="KLTH-ORF15507"
FT   CDS_pept        complement(305074..305463)
FT                   /locus_tag="KLTH0B03696g"
FT                   /old_locus_tag="KLTH-ORF15507"
FT                   /product="KLTH0B03696p"
FT                   /note="similar to uniprot|P53299 Saccharomyces cerevisiae
FT                   YGR181W TIM13 Translocase of the inner membrane
FT                   mitochondrial intermembrane space protein mediating import
FT                   and insertion of polytopic inner membrane proteins Subunit
FT                   of mitochondrial protein import machinery"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21512"
FT                   /db_xref="GOA:C5DCK1"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039238"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK1"
FT                   /protein_id="CAR21512.1"
FT                   /translation="MELPLEAIPLYSQRTLSRTNDCSTFRMALSSIFGGASPSQQRTTT
FT                   SSSKASSVKEQLKTQIAQELAVANASELVNKVTENCFEKCLTNPYSNAEEGCVDQCLAK
FT                   YMRSWNVVSKAYVARIQQASTSGEI"
FT   gene            <305780..>305850
FT                   /locus_tag="KLTH0B03718r"
FT                   /old_locus_tag="Klth0B.tGly.GCC.5"
FT   tRNA            305780..305850
FT                   /locus_tag="KLTH0B03718r"
FT                   /old_locus_tag="Klth0B.tGly.GCC.5"
FT                   /note="tRNA-Gly (GCC) cove score=62.63"
FT   gene            <306104..>306745
FT                   /locus_tag="KLTH0B03740g"
FT                   /old_locus_tag="Klth0B.mRNA.237.p"
FT   CDS_pept        join(306104..306125,306192..306745)
FT                   /locus_tag="KLTH0B03740g"
FT                   /old_locus_tag="Klth0B.mRNA.237.p"
FT                   /product="KLTH0B03740p"
FT                   /note="highly similar to uniprot|P47064 Saccharomyces
FT                   cerevisiae YJL024C APS3 Small subunit of the clathrin-
FT                   associated adaptor complex AP-3 which is involved in
FT                   vacuolar protein sorting related to the sigma subunit of
FT                   the mammalian clathrin AP-3 complex suppressor of loss of
FT                   casein kinase 1 function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21513"
FT                   /db_xref="GOA:C5DCK2"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR027155"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK2"
FT                   /protein_id="CAR21513.1"
FT                   /translation="MIHAVLIFNKKAQPRLVKFYTPVELPQQKLLIQQVYELISQRNSE
FT                   FQSSFLTTPPSLVHAGSDELSDDQDIQVIYKNYATLYFTFIVDDQESELAILDLIQTFV
FT                   ESLDRCFAEVNELDLIFNWQTLESVLEEIVQGGMVIETSVAKIVSAVDQLNRSSSGDNR
FT                   AGRFAGAGLGNALQSIVQAGFSGWGANQ"
FT   gene            complement(<306845..>307276)
FT                   /locus_tag="KLTH0B03762g"
FT                   /old_locus_tag="KLTH-ORF15503"
FT   CDS_pept        complement(306845..307276)
FT                   /locus_tag="KLTH0B03762g"
FT                   /old_locus_tag="KLTH-ORF15503"
FT                   /product="KLTH0B03762p"
FT                   /note="weakly similar to uniprot|P37267 Saccharomyces
FT                   cerevisiae YGR174C CBP4 Essential for the expression and
FT                   activity of ubiquinol-cytochrome c reductase ubiquinol--
FT                   cytochrome-c reductase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21514"
FT                   /db_xref="GOA:C5DCK3"
FT                   /db_xref="InterPro:IPR012420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK3"
FT                   /protein_id="CAR21514.1"
FT                   /translation="MDKPLWLRWLRVYIAGGAIIGVGAVLFKYTTPTDEELINSLSPEL
FT                   RLQYERERQLRQAEQKELMNIVRETAKSDDPIWKTGAINSPWEKNSSEQSREQFQRVKA
FT                   EEIQKEELQRIRQELQQIRADSVAKTQEEVKKSAGWKFW"
FT   gene            complement(<307535..>309028)
FT                   /locus_tag="KLTH0B03784g"
FT                   /old_locus_tag="KLTH-ORF15502"
FT   CDS_pept        complement(307535..309028)
FT                   /locus_tag="KLTH0B03784g"
FT                   /old_locus_tag="KLTH-ORF15502"
FT                   /product="KLTH0B03784p"
FT                   /note="highly similar to uniprot|P32476 Saccharomyces
FT                   cerevisiae YGR175C ERG1 Squalene epoxidase catalyzes the
FT                   epoxidation of squalene to 2 3-oxidosqualene plays an
FT                   essential role in the ergosterol-biosynthesis pathway and
FT                   is the specific target of the antifungal drug terbinafine"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03784g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21515"
FT                   /db_xref="GOA:C5DCK4"
FT                   /db_xref="InterPro:IPR013698"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040125"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK4"
FT                   /protein_id="CAR21515.1"
FT                   /translation="MSGGKATNTDLKNADASITYDAIIVGCGVIGPCVATGLARKGKKV
FT                   LIVEREWSMPDRIVGELMQPGGVRALRSLGMVQSINDIEAIPVTGYTVFYNGEKVAIPY
FT                   PYKADIAPVEKVPKLVRDGNDKVTEDKTIHVKDFEEDERERGVGFVHGKFLQNLRAIVA
FT                   EEPNVTRLQGNVVEILKNGHNEVVGAKVDIDGRGKVEFKAHITFVCDGIFSKFRKELST
FT                   DHVPTVGSSFVGMSLFHAKMPSPNHGHVILGTEHMPILVYQISPEETRILCAYNSPKLP
FT                   SDVKAWMTKKVQPYIPESLRPSFDEALAQGKFRSMPNSYLPGRQNNVIGMCVIGDALNM
FT                   RHPLTGGGMTVGLNDVVLLMKKIGDLDFSDREVVLDELLDYHYERKSYDSVINVLSIAL
FT                   YSLFAADSKDLKVLQKGCFKYFKRGGDCVKLPVSFLSGVMPRPFLLTRVFFAVAFYAVY
FT                   VNFQERGMAGFPVALIEAFSILFTAARVFTPYLYTEMIG"
FT   gene            complement(<309522..>311090)
FT                   /locus_tag="KLTH0B03806g"
FT                   /old_locus_tag="KLTH-ORF15499"
FT   CDS_pept        complement(309522..311090)
FT                   /locus_tag="KLTH0B03806g"
FT                   /old_locus_tag="KLTH-ORF15499"
FT                   /product="KLTH0B03806p"
FT                   /note="similar to uniprot|P40353 Saccharomyces cerevisiae
FT                   YOR377W ATF1 Alcohol acetyltransferase with potential roles
FT                   in lipid and sterol metabolism responsible for the major
FT                   part of volatile acetate ester production during
FT                   fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21516"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK5"
FT                   /protein_id="CAR21516.1"
FT                   /translation="MTTSQADTKLEELEKRGHARRLGNLENYFALGQRQDLYSNFGMFC
FT                   ELDRACSENELAEALRGMCLEYPLLLHTVLEKKEAQDVNFYQTSEYLSKPWPQHDYIRV
FT                   LQRVRFADVLLNDQEEYAEIVNAALKEFASNGGQYSSEVFELINKVRIPYCHNSRPNWR
FT                   IMCFPEEGNAQSREWRKILLLSNHCSSDGMSSANFFHDLQDHLNNLPPSLPQADVIFDY
FT                   SQDHETLGKLPAPIETQISYVGPKSYFAQLVGNQVLREYFGYKSPTPPIPRVNEPGGND
FT                   FYSYFLKITPSEVAAVKKKLKNKLDPSCTLTPFFQACWFAALYKSGIVFSKSFSQQLSN
FT                   IMVAMNTAQLLPEDKQLKKQYRYGANVGGSHYNYQISSFNVADKPEAFWKLVRYYQDVF
FT                   VDAKRKKHFLYPLGALMIDSIYKTKNIDLAVTNSILGKSRLGTMLSNVGYFPQKARATV
FT                   GGFHIQDLIFAQTTGSFRFTFDINLCATDIGGLNITACVAEGALPTREDWKKLCELFKT
FT                   IILES"
FT   gene            complement(<311528..>313060)
FT                   /locus_tag="KLTH0B03828g"
FT                   /old_locus_tag="KLTH-ORF15495"
FT   CDS_pept        complement(311528..313060)
FT                   /locus_tag="KLTH0B03828g"
FT                   /old_locus_tag="KLTH-ORF15495"
FT                   /product="KLTH0B03828p"
FT                   /note="similar to uniprot|P40992 Saccharomyces cerevisiae
FT                   YJL025W RRN7 involved in the transcription of 35S rRNA
FT                   genes by RNA polymerase I member of yeast Pol I core factor
FT                   (CF) also composed of Rrn11p Rrn6p and TATA- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21517"
FT                   /db_xref="GOA:C5DCK6"
FT                   /db_xref="InterPro:IPR021752"
FT                   /db_xref="InterPro:IPR033599"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK6"
FT                   /protein_id="CAR21517.1"
FT                   /translation="MSTFFRGPVCGTDNCRSRLWRIIDGRRTCQYGHVMEGDVEFNDDE
FT                   DDINSMGVITRRLNLTTNATGSFRSSMNSQSQLSQKEDANQKVYGAEGERLFLRCFQYI
FT                   LKLQCTWLIEHQNFPPVFTDVVKLMWMRFIRSLEIADQRSATGDDNGGTSMQVPGKKPR
FT                   LSLLSSICLLYMANTHLRMPVHSCDYIRWICSMKLVYFKANLHLPALWRKQLPNYYHQV
FT                   LEGGKTPSEGQFFHKLAHMCFAVQLSSCFSTYVSYEALTLKLLFAVKLPPQILFDVKEL
FT                   IRISGESDSSFCLYENHRERVERLYQCSDLRIAAYFILAVRYKILQDDPFFVNYCLAWL
FT                   EIEGSEDSPAATEDLVTKLSHDAASLHQNNHRWSDQQTTDYLDWMEQHFLPASTKTQTE
FT                   AQTIDHRIASKKLYSMFPLEKAPTGSAEDRATRPSYVDKTQEAYLEISDALAHGVRVPR
FT                   QKQTPMLAQLAEAKLLREISYRFAVSQPQLRECLGHLQSRICKTRNSMNCAS"
FT   gene            complement(<313316..>315457)
FT                   /locus_tag="KLTH0B03850g"
FT                   /old_locus_tag="KLTH-ORF15492"
FT   CDS_pept        complement(313316..315457)
FT                   /locus_tag="KLTH0B03850g"
FT                   /old_locus_tag="KLTH-ORF15492"
FT                   /product="KLTH0B03850p"
FT                   /note="similar to uniprot|P53297 Saccharomyces cerevisiae
FT                   YGR178C PBP1 Protein interacting with poly(A)- binding
FT                   protein Pab1p likely involved in control of the extent of
FT                   mRNA polyadenylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21518"
FT                   /db_xref="InterPro:IPR009604"
FT                   /db_xref="InterPro:IPR025852"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK7"
FT                   /protein_id="CAR21518.1"
FT                   /translation="MKGTYSGKRREGNGNSNNGINRNPNANTSSGAFYETEETTKNFND
FT                   RLNYLLATSISTEATVTVTTGVKYSGILAACNPEGSNGVDVVLKFPKVIDKGFATSNID
FT                   QLASDLKENLVIKGEDVAELQLHDVNFSGEGKVGKEAKEESGQKAEVKAEFKPSSKLAG
FT                   PATERKIKAEFKTDTDISGANTVIKERELEKWVPDDHETFDMNESLEDSTTSWNQFAVN
FT                   EEKFGVTSTFDEHLYTTRINKDDPNYLHRLKEADRIAKEIESQGASGNVHLAEERGIIV
FT                   DDSGIDEEDKYSGVDRRGDELLAALKLNAKSNPPKAKKYVPPTLRSQPHNADPAIISSK
FT                   AAVISPQTVHPKEHKNQELAPEGGHSHSRKKNQLDELKEFSEKFKVPYEMPEEVKAMLK
FT                   KSSENSPKAPQAALKVNPSLPPKPTSTPPTNPNSSASSKNARATRDLTPSANKAELRKP
FT                   PARMSQGHTPVHSPSSGRHANISRRRNISQGSFFGSKCPLANKKDFSKNFNMFIKGKEA
FT                   FEQNRAAGKSKGGAASVFVIEKPYFTAPTWFSNVEQSYRTMFPDEHTAIQRSQMKMQQR
FT                   SMSAMSSPGSPHMMGVPGMMMGMPMGPSGSPNPYMMAPNASANMYMPFQPPAFYPPVMQ
FT                   MMPMGDERGGSGTPPPQNTGSPLGGPTFMNAGPGGPIPPFNYSAAAPFQPVMGSRSFRQ
FT                   GFQNQSYQNHHNRHRAHDR"
FT   gene            complement(<315749..>316837)
FT                   /locus_tag="KLTH0B03872g"
FT                   /old_locus_tag="KLTH-ORF15487"
FT   CDS_pept        complement(315749..316837)
FT                   /locus_tag="KLTH0B03872g"
FT                   /old_locus_tag="KLTH-ORF15487"
FT                   /product="KLTH0B03872p"
FT                   /note="weakly similar to uniprot|P53298 Saccharomyces
FT                   cerevisiae YGR179C OKP1 Outer kinetochore protein required
FT                   for accurate mitotic chromosome segregation forms a complex
FT                   with Mcm21p and Okp1p that binds to centromeres via the
FT                   CBF3 complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21519"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK8"
FT                   /protein_id="CAR21519.1"
FT                   /translation="MSLQKPLLDAIVESDHEGSVMVDHATDDSTSEVDESFVQLDGDEF
FT                   RLDQEARRKGPVGKKLFVEEDSIAESPLRNGLLGPSLIASSPQKSDLESPSKRVQFKHH
FT                   IDSASEEEPISEQPIDQWNFKDLIGDRFRERLPETDLKAWQRPSKRLLNSITDILENNI
FT                   DLALEATFEKYEAECERLAIGRSVKHIRRDKERMLHKTIGKIERQLQSSKFPSRVKDRD
FT                   FDIEYIYAKRTFIQNSFSQELEHTDSVEHQVLREQKALEDLKHVQAKLSNRALRQTKLL
FT                   TEQLSHNLHPALSKAMVNSFGLIGDNAINKERYKKDVDELNLKLADPSAGVTHSLLHKY
FT                   LPSLKNYEKTAEKLQGSLPNLN"
FT   gene            complement(<317072..>318892)
FT                   /locus_tag="KLTH0B03894g"
FT                   /old_locus_tag="KLTH-ORF15485"
FT   CDS_pept        complement(317072..318892)
FT                   /locus_tag="KLTH0B03894g"
FT                   /old_locus_tag="KLTH-ORF15485"
FT                   /product="KLTH0B03894p"
FT                   /note="weakly similar to uniprot|P53283 Saccharomyces
FT                   cerevisiae YGR138C TPO2 Polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21520"
FT                   /db_xref="GOA:C5DCK9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK9"
FT                   /protein_id="CAR21520.1"
FT                   /translation="MASISSSELESIQSHAQEYTPHQEKVSGDGATGAQTHRMMSKESD
FT                   EAELRKLLTAHSRGVQKRLSRLESNTHGIGPVEPPLDLERRETRPAPDSTFHEQDKWKY
FT                   PIDEETGMRIVEFIDDDSEDPRNWPTRQKWNYTVLLGIICFDVAMMSAIITGDMDSPAA
FT                   YFGVSMEVMCLCVSLMVWGFGLGPMLFAPLSEEFGRNPVYLVTLFIAVVFIVPCGAAKN
FT                   IGTLLAFRFLDGLAFSAPMCLIGGSLSDMWRNKERGVAMSLFSAAPFLGPVMGPIVGSL
FT                   LSVKCSWRWVYWFMVIFSGCLYAVMAVFLPETHHQTLLKKRAKKLRKLTGDPSYRAICE
FT                   IKVRSMKEVAQETLFRPLVLLTELIVFLITMYMSVIYGLLYMFFFAYPMVYTEGKHYGA
FT                   IKTSIMFIPVGAGVIGSTVAAPFLNKDYVKRAQRYLDRGEVPPAELRLIPMMIGCWFVP
FT                   AGLFAYAWSSYPRLSWAGPCFSGFACGFGFNMLYNPANNYIVDSYQHYAASGLAAKTFV
FT                   RSMWGGAVPLFTIQMYRRLNYEWASTLMAFISLACCAIPYLFYFYGARIRQKSKYAYSP
FT                   SVDTTNTTRTDIENQAAGSHSSNSEGSSKV"
FT   gene            <320151..>321128
FT                   /locus_tag="KLTH0B03916g"
FT                   /old_locus_tag="KLTH-ORF15480"
FT   CDS_pept        320151..321128
FT                   /locus_tag="KLTH0B03916g"
FT                   /old_locus_tag="KLTH-ORF15480"
FT                   /product="KLTH0B03916p"
FT                   /note="highly similar to uniprot|P32318 Saccharomyces
FT                   cerevisiae YGR144W THI4 Protein required for thiamine
FT                   biosynthesis and for mitochondrial genome stability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21521"
FT                   /db_xref="GOA:C5DCL0"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR027495"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL0"
FT                   /protein_id="CAR21521.1"
FT                   /translation="MSTTTTNTETAQLQVSAGTIRHALSDVVKQEDWSDFQFAPIREST
FT                   VSRAMTSRYFQDMDKFAVSDVVIVGAGSSGLSAAYVIAKNRPDLKVACVESNVAPGGGA
FT                   WLGGQLFSAMIMRKPAHLFLDELELPYEDEGDYVVVKHAALFTSTVLSKVLLFPNFKLF
FT                   NATAVEDLVTRPADDNTGGVSVAGVVTNWTLVSMAHDLQSCMDPNVIELSGYQNDGTRD
FT                   PSKKHGVILSTTGHDGPFGAFSAKRIVSIDKNKKLGGMKGLDMNRAEAGVVKGAGAYSG
FT                   VANMYFAGMEVAELEGCNRMGPTFGAMAVSGIKAAEEILRHFAE"
FT   gene            complement(<321488..>322699)
FT                   /locus_tag="KLTH0B03938g"
FT                   /old_locus_tag="KLTH-ORF15478"
FT   CDS_pept        complement(321488..322699)
FT                   /locus_tag="KLTH0B03938g"
FT                   /old_locus_tag="KLTH-ORF15478"
FT                   /product="KLTH0B03938p"
FT                   /note="highly similar to uniprot|P09938 Saccharomyces
FT                   cerevisiae YJL026W RNR2 Ribonucleotide-diphosphate
FT                   reductase (RNR) small subunit the RNR complex catalyzes the
FT                   rate-limiting step in dNTP synthesis and is regulated by
FT                   DNA replication and DNA damage checkpoint pathways via
FT                   localization of the small subunits"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21522"
FT                   /db_xref="GOA:C5DCL1"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL1"
FT                   /protein_id="CAR21522.1"
FT                   /translation="MVNAKETPSKAAASALSDLELKDSKNNLSGRLGAVPESAGEDAAA
FT                   LELKLSQAAEQHRQFLKSHHVHRHQLKEMEKEEPLLMENKRRFVLFPIKYHEIWQAYKR
FT                   AEASFWTAEEIDLSKDLHDWNNRMNENERFFISRVIAFFAASDGIVNENLVENFSAEVQ
FT                   SPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKESDFLFNAIETIPQIKEKAEWAIRW
FT                   IQDEDALFAERLVAFAAVEGVFFSGSFAAIFWLKKKGLMPGLTFSNELICRDEGLHTDF
FT                   ACLLFAHLKNKPDPAIIERIITEAVEIEQRYFRDALPVSLLGMNADLMNQYVEFVADRL
FT                   LVALGNQKFYNVTNPFDFMENISLAGKTNFFEKRVSDYQKAGVMAKSTKAETEGGEFAF
FT                   DEDF"
FT   gene            complement(<323080..>323192)
FT                   /locus_tag="KLTH0B03960r"
FT                   /old_locus_tag="Klth0B.tLeu.CAA.16"
FT   tRNA            complement(join(323080..323123,323155..323192))
FT                   /locus_tag="KLTH0B03960r"
FT                   /old_locus_tag="Klth0B.tLeu.CAA.16"
FT                   /note="tRNA-Leu (CAA) cove"
FT   gene            <323351..>323989
FT                   /locus_tag="KLTH0B03982g"
FT                   /old_locus_tag="KLTH-ORF15468"
FT   CDS_pept        323351..323989
FT                   /locus_tag="KLTH0B03982g"
FT                   /old_locus_tag="KLTH-ORF15468"
FT                   /product="KLTH0B03982p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21523"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL2"
FT                   /protein_id="CAR21523.1"
FT                   /translation="MPCSFILYVPYTPCVRALRAPYTSRVLSDALLSELSGSSDVRPWL
FT                   RSRLNTCSISVSLYIHLMPAYPTTPSAPNPARYPKNCEGGVSALCSWLALCDMLVRRLT
FT                   AILQEAGLIMWCAGVLVCYCALAGSAGPGRYVRAASPPLYTAATGLCAPTPVPRDAEQS
FT                   ALAGSNAGGRARRNLKAAPQTGRQGRHNGAIYSGSIHKGYVETGTDAHT"
FT   gene            complement(<324153..>324614)
FT                   /locus_tag="KLTH0B04004g"
FT                   /old_locus_tag="KLTH-ORF15465"
FT   CDS_pept        complement(324153..324614)
FT                   /locus_tag="KLTH0B04004g"
FT                   /old_locus_tag="KLTH-ORF15465"
FT                   /product="KLTH0B04004p"
FT                   /note="highly similar to uniprot|P36010 Saccharomyces
FT                   cerevisiae YKL067W YNK1 Nucleoside diphosphate kinase
FT                   catalyzes the phosphorylation of nucleoside diphosphates
FT                   into the corresponding triphosphates for nucleic acid
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21524"
FT                   /db_xref="GOA:C5DCL3"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL3"
FT                   /protein_id="CAR21524.1"
FT                   /translation="MSSQTERTFIAIKPDGVQRGLVAKILARFEDRGFKLVAVKLLRPS
FT                   QELLRQHYAEHVDKPFFPKMSAFMSSGPVLATVWEGKDAVRQGRVILGATNPLNSAPGT
FT                   IRGDFAIDMGRNVCHGSDSVESAQREIALWFQPEELVEWTPAQAAWVYE"
FT   gene            <325075..>325740
FT                   /locus_tag="KLTH0B04026g"
FT                   /old_locus_tag="KLTH-ORF15460"
FT   CDS_pept        325075..325740
FT                   /locus_tag="KLTH0B04026g"
FT                   /old_locus_tag="KLTH-ORF15460"
FT                   /product="KLTH0B04026p"
FT                   /note="some similarities with uniprot|P11746 Saccharomyces
FT                   cerevisiae YMR043W MCM1 Transcription factor involved in
FT                   cell-type-specific transcription and pheromone response
FT                   plays a central role in the formation of both repressor and
FT                   activator complexes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21525"
FT                   /db_xref="GOA:C5DCL4"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="InterPro:IPR033897"
FT                   /db_xref="InterPro:IPR036879"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL4"
FT                   /protein_id="CAR21525.1"
FT                   /translation="MSDTGVDDKELSAGPQPQPQQKERRKIEIKFIQDKTRRHITFSKR
FT                   KHGIMKKAYELSVLTGTQVLLLVVSETGLVYTFTTPKFQPIVTQPEGKNLIQACLNAPE
FT                   EDEDAEEEEDDDEDADDDDDAAKLPSAHQQVPMAGAPPQQHGQQPHQQQQQQVQQHAHA
FT                   HAHAHAQQHPHQQQQQQQPPQAAAAAAYGNPAAAYLSADQAAVYQQYFNGVNPQQGQY"
FT   gene            <326073..>327434
FT                   /locus_tag="KLTH0B04048g"
FT                   /old_locus_tag="KLTH-ORF15456"
FT   CDS_pept        326073..327434
FT                   /locus_tag="KLTH0B04048g"
FT                   /old_locus_tag="KLTH-ORF15456"
FT                   /product="KLTH0B04048p"
FT                   /note="weakly similar to uniprot|Q04213 Saccharomyces
FT                   cerevisiae YMR044W IOC4 Member of a complex (Isw1b) with
FT                   Isw1p and Ioc2p that exhibits nucleosome-stimulated ATPase
FT                   activity and acts within coding regions to coordinate
FT                   transcription elongation with termination and processing
FT                   contains a PWWP motif"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21526"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL5"
FT                   /protein_id="CAR21526.1"
FT                   /translation="MPPKKHIYQPTDIVLAKVKGFPAWPALVVPEEIAPANVLEERPGR
FT                   PTVEELDDEQNPENFIPYSDTLRFRKNFKPHNSYLLKFLCDDSYIWLKPTDFKPLTPEQ
FT                   CDAWLSKSSKKSKKLIPAFELARRGTHGPDAIDVLEFVQYGSSGKPAEEEYVEPAAEQE
FT                   EEDEEEGEAEPAAEQEPLDEDADADADQESPLSELPSSGSDSDFEDDTTHRRRPVRGTR
FT                   QSKRTRARTNEREPELQELQDEPAPKKARSHKKKQPQKVEVEKYKFEDDEDWSIVGLGP
FT                   QDPPVSKFNSLVNKLSQKRNLEVHNEFKADLRDRLGIVNKMLVGIVFDTKRKSVTEDLH
FT                   VLLDELEQCSALRGTQDELITVFLSDHELVINISALFNLKQDQLREAGLYDKLQQWYSQ
FT                   IYGGQFVADPVAWSLDKINDVHAPPQEDAPSAADAASNGAGPAAPPVTTSDANM"
FT   gene            complement(<327578..>331249)
FT                   /locus_tag="KLTH0B04070g"
FT                   /old_locus_tag="KLTH-ORF15451"
FT   CDS_pept        complement(327578..331249)
FT                   /locus_tag="KLTH0B04070g"
FT                   /old_locus_tag="KLTH-ORF15451"
FT                   /product="KLTH0B04070p"
FT                   /note="weakly similar to uniprot|Q02629 Saccharomyces
FT                   cerevisiae YKL068W NUP100 Subunit of the nuclear pore
FT                   complex (NPC)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21527"
FT                   /db_xref="GOA:C5DCL6"
FT                   /db_xref="InterPro:IPR007230"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="InterPro:IPR036903"
FT                   /db_xref="InterPro:IPR037637"
FT                   /db_xref="InterPro:IPR037665"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL6"
FT                   /protein_id="CAR21527.1"
FT                   /translation="MFGSTGTAFGNSGSTPFGSAATPATTGASPFGSAAPNPTPAFGAA
FT                   QPSNAASGFGGFGAANSNPSAGGTGLFGMSNNSNSSSSTTGAAAPFGQATSAPANGPSL
FT                   FGSAVPTGAPNTSVPGAAQGPGTAIKPFSTYTEKDATTGSNNVFQSISCMPEYRAYSFE
FT                   ELRYQDYQANRRFPTGPVGSAGVASPFGAQTSSPFAQNNSTNTNAFGMVGNNNNNNNNN
FT                   TTGGLFGQNNTGAAGTSAFGQPAGGSLFGANNAANNSPFGLNKPASSGGLFGQPSNTAA
FT                   PGGSGLFGQSNNTAQGSGGLFGQNNNTGTTGSSMFGATNNAPGQQPGGLFGQPSTNTGG
FT                   GLFGQNNNANANNSPFGQSNTNTGGGLFGQNPNNGAANSPFGQNNQAQAGGGLFGNKSA
FT                   PSGGLFGQNNNTSGGGLFGQANNTNNSPFGQNNNAGGGLFGQNNSGNTGGGLFGQNNNN
FT                   NNTTGGGLFGQNNNNNNNAGGGLFGQNNNNATGGGLFGQNTANNSTFGQNSGSAPFGQS
FT                   QQQGSSLFGNKPAGSGGLFGQNNTASTGFGQNNSSAGGGLFGQNNNNNSTGNTGGLFGQ
FT                   NNTNTGSGLFGQNNSQQQQQQQPAGGLFGQNTQQNQGGLFGQNNANTGGGLFGQNNQQQ
FT                   QQQPSGGLFGAKPATGATGGGLFGQNNNQQPPATGGLFGQNNNANQPSTSGGLFGNKPA
FT                   GSTGGGLFGQNNTAGNTGTTGGGLFGQNNSTAANNSSGGGLFGAKPATNTGGGLFGNKP
FT                   AGAPTTGGGLFGSKPAGTATGTTGGGLFGAKPAGAATGGLFGNTNGTNNTNATGTQPGV
FT                   SGGLFGNQQNQQQAAPGSQPSLQQTGANPYGTNELFSRVLIPDSITQPTKPSATKLNAD
FT                   FKKKASLSGAYRLAPKPLFAPRSASTSPVARLGSTTTSQSNGRVLSVASSTDSLGREIV
FT                   PANTGSSSIFTNESDELILSSNDTLFNPDKKSFKNLIINRKKMEDTVDSKEDDQVLRIT
FT                   FKADGDSTSNEGVQGGAKTESTKIETPLYDDVQGTPLRQGSRIDAPFKNSVSTPLAKTP
FT                   LKSSNLASSSATSTTINEKPSGVIGDDISFMDDGYYISPSLETLSSMTLLQLRKVSGLT
FT                   IGRRDYGKIDFLEPVDLSNISLPALCGQLVVFEPKTCTVCPNASMQPAEGEGLNVRARI
FT                   STSGCYPVDKSTRKPIKDPNHPIIKRHINRLKSISDTKFDSYDPQTGTWVFTVDSPV"
FT   gene            <332711..>333547
FT                   /locus_tag="KLTH0B04092g"
FT                   /old_locus_tag="KLTH-ORF15433"
FT   CDS_pept        332711..333547
FT                   /locus_tag="KLTH0B04092g"
FT                   /old_locus_tag="KLTH-ORF15433"
FT                   /product="KLTH0B04092p"
FT                   /note="weakly similar to uniprot|Q04659 Saccharomyces
FT                   cerevisiae YMR048W CSM3 Protein required for accurate
FT                   chromosome segregation during meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21528"
FT                   /db_xref="GOA:C5DCL7"
FT                   /db_xref="InterPro:IPR012923"
FT                   /db_xref="InterPro:IPR040038"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL7"
FT                   /protein_id="CAR21528.1"
FT                   /translation="MSQQLQERFSDGTALSQDPDSSLLVDPTAINPSGLGPDGDAPLQD
FT                   PTAVTTRVRRPQVKLTAEKLCSAKGLPAVMKHAPRRLRISKRRSSYDNLCHLLQFYQLW
FT                   AHDLYPKAKFHDFVELCRNLGKTDPQLREYRIELLRQELEMGSALEEGAPAFPQERSPA
FT                   PEPTPDAPGIADLRSEPPSPAPAPAGADSDDDLIYNITRRAPARVLHDSDIDEDSLMET
FT                   QPPASSTAGDAPRSAESGPGPILNNNNNNNNNNKNNDDDDDDEDEDELAVMREMGL"
FT   gene            complement(<333569..>335644)
FT                   /locus_tag="KLTH0B04114g"
FT                   /old_locus_tag="KLTH-ORF15430"
FT   CDS_pept        complement(333569..335644)
FT                   /locus_tag="KLTH0B04114g"
FT                   /old_locus_tag="KLTH-ORF15430"
FT                   /product="KLTH0B04114p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21529"
FT                   /db_xref="GOA:C5DCL8"
FT                   /db_xref="InterPro:IPR008429"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL8"
FT                   /protein_id="CAR21529.1"
FT                   /translation="MNAAQPSEGRSYIQYGVLALSLASLLKKSLSPSKEPINALNCAQD
FT                   EEKNITSTTFSQRVARRIISSALEKRSLKVGDLKKSQERLEYESSLKVLPQENETFVEH
FT                   TPPSVQSINITSTSHANGIPEYFLEEAPTLEALAYKNSKKAPKLLIPGWRAGTPLALEY
FT                   YLSTNSSYDRADFSPQDSSAWRGSLDSLDLDEPQTISENFKFRVPEGFGNDFVYLHLYL
FT                   MTSCEGSEEVGYTNCEYVSKNTIPLSYKLTKTEKAAKKNLLASKKKTREDNIGYELSYM
FT                   DDVPFWHPEITIYLGKPFGIVEADSVPKAMKSLISVDEGTKRDNLTGLAQRYSPPVLYN
FT                   NFWQMAHEMIEINTTTRELPINLRLEIPPAWKFRVYSTALHNLRELAMFGGASKANSSV
FT                   FTLDHYKLVWLGTKTSVLALTVIATVLHSALGVLALKSDTAHWQKRENHIGVSVRGLFA
FT                   NILMQALVMLYLLDNFEGTSSTVFVSQVVGFLIECWKVSTILKIQIVASREEASLNADT
FT                   EVVMMPLARGKRLAISNKHLLNEEEKKTREYDATAFRILLKVFVPLILGYAGFSLVYGE
FT                   HKSWYSFFVRVMVGIVYTYGFLIQLPAVYINYKLKSVAHMSKRAFAYKVVNTFIDDLFA
FT                   FVAKMPWLHKIATFRDDVVFFIYLYQFWAYRVDYARTNEFGEPAAAPGSEKAEKQE"
FT   gene            complement(<335902..>338352)
FT                   /locus_tag="KLTH0B04136g"
FT                   /old_locus_tag="KLTH-ORF15427"
FT   CDS_pept        complement(335902..338352)
FT                   /locus_tag="KLTH0B04136g"
FT                   /old_locus_tag="KLTH-ORF15427"
FT                   /product="KLTH0B04136p"
FT                   /note="similar to uniprot|Q04660 Saccharomyces cerevisiae
FT                   YMR049C ERB1 Protein required for maturation of the 25S and
FT                   5.8S ribosomal RNAs homologous to mammalian Bop1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21530"
FT                   /db_xref="GOA:C5DCL9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012953"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR028598"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL9"
FT                   /protein_id="CAR21530.1"
FT                   /translation="MAKNQQAKRLSTTRSNSKGEAEKKRELEEESSDDELNVQGLIDDE
FT                   ADESDEDYSEVDSEADETGQFQSAEEGEDGASEEEAGSDSDEEFNKLLAEEEPEDGSEA
FT                   NESLEFSDASNSNSMVEKLSSIKLNMIPDQDEEVIRTKFSDGRPRTIKPEINPVYDSDD
FT                   SDVEVQNTIGNIPLSAYDEMPHIGYSINGKRIMRPAKGSALDQLLETIELPEGWTGLLD
FT                   KDTGASLNLSQEELELISKIQKNEKTDDSVDPYQPYVDWFTRHTETMPLTAVPEPKRRF
FT                   VPSKNEAKRIMKIVRAIREGRIIPPNKLKEMREEEESSHHYDLWGASDESDDHVMNLRA
FT                   PKLPPPTNEESYNPPEEYLLSKEEKEEWENQEPSERERNFVPQKFNALRKVPGYVESVR
FT                   ERFERSLDLYLAPRVRKNKLNIDPESLIPELPSPKDLRPFPTRCSTIYRGHEGRIRTLS
FT                   IDPSGLWLATGSDDGSVRIWEILTGREVYKVQVVDPEAKSGDNVEAIEWNPDKTTGILA
FT                   IAAGENIFLIVPPIFGFEVENTGRTKIEDGFGFDTYGNSKTSNLNVNSDDENDQPESTA
FT                   VKSQVAQWHKASQKQAEKDIAVVITCRHTVKKLSWHRKGDYFVTVQPKSGHTSVLIHQL
FT                   SKHLSQSPFKKSKGIVMDAKFHPFKPQLFVCSQRYVRIYDLSQQALVKKLMPGARWLST
FT                   IDIHPRGDNLLASSFDKRVLWHDLDLASTPYKTLRYHEMAVRKVAFHKKLPLFCSASDD
FT                   SIIHVFHATVYDDMLKNPLLVPLKKLEGHKVVNSLGVLDLVWHPREAWLFSAGADNTAR
FT                   LWTS"
FT   gene            <338551..>338624
FT                   /locus_tag="KLTH0B04158r"
FT                   /old_locus_tag="Klth0B.tVal.AAC.6"
FT   tRNA            338551..338624
FT                   /locus_tag="KLTH0B04158r"
FT                   /old_locus_tag="Klth0B.tVal.AAC.6"
FT                   /note="tRNA-Val (AAC) cove score=65.28"
FT   gene            complement(<338704..>339237)
FT                   /locus_tag="KLTH0B04180g"
FT                   /old_locus_tag="KLTH-ORF15423"
FT   CDS_pept        complement(338704..339237)
FT                   /locus_tag="KLTH0B04180g"
FT                   /old_locus_tag="KLTH-ORF15423"
FT                   /product="KLTH0B04180p"
FT                   /note="similar to uniprot|P36088 Saccharomyces cerevisiae
FT                   YKL069W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04180g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21531"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM0"
FT                   /protein_id="CAR21531.1"
FT                   /translation="MGEQGEHHADYAHFDGLQREEALQLLLDSYAALAADQDNWVCNLA
FT                   NASSLLWHAYRSLPLDVNWAGFYISRTENKQELLLGPFQGKVACQTIRAGSGVCGAAAQ
FT                   TKETQVVPDVNKFPGHIACDGETKSEIVVPILSDAGECLGVIDIDCLEYNGFGETDKKH
FT                   LEELANLISRTCKF"
FT   gene            complement(<339997..>340099)
FT                   /locus_tag="KLTH0B04202r"
FT                   /old_locus_tag="Klth0B.tTrp.CCA.15"
FT   tRNA            complement(join(339997..340032,340064..340099))
FT                   /locus_tag="KLTH0B04202r"
FT                   /old_locus_tag="Klth0B.tTrp.CCA.15"
FT                   /note="tRNA-Trp (CCA) cove"
FT   gene            <340239..>340847
FT                   /locus_tag="KLTH0B04224g"
FT                   /old_locus_tag="KLTH-ORF15421"
FT   CDS_pept        340239..340847
FT                   /locus_tag="KLTH0B04224g"
FT                   /old_locus_tag="KLTH-ORF15421"
FT                   /product="KLTH0B04224p"
FT                   /note="similar to uniprot|P46671 Saccharomyces cerevisiae
FT                   YMR052W FAR3 Protein involved in G1 cell cycle arrest in
FT                   response to pheromone in a pathway different from the
FT                   Far1p-dependent pathway interacts with Far7p Far8p Far9p
FT                   Far10p and Far11p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21532"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM1"
FT                   /protein_id="CAR21532.1"
FT                   /translation="MENSADSFEYLLHLTKGLSTECRSTRQGTERIEHLVKRLAKLTQT
FT                   SYEELSKNPGPQVLQKYRELGRESERDRLERENYALIYQIERQEYVCRRIWSLIDQVED
FT                   LLESIKKFVVEQQGHRLRTENEFLETVVHSRMANLQVNTEDLVEAKNASRTKLDLLTRE
FT                   LKDLCKQIDWNKMSDSEDATLLSRKVSEVESKYKLKLKS"
FT   gene            complement(<340919..>343189)
FT                   /locus_tag="KLTH0B04246g"
FT                   /old_locus_tag="KLTH-ORF15419"
FT   CDS_pept        complement(340919..343189)
FT                   /locus_tag="KLTH0B04246g"
FT                   /old_locus_tag="KLTH-ORF15419"
FT                   /product="KLTH0B04246p"
FT                   /note="weakly similar to uniprot|P46679 Saccharomyces
FT                   cerevisiae YMR053C STB2 or to uniprot|P36085 Saccharomyces
FT                   cerevisiae YKL072W STB6"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21533"
FT                   /db_xref="InterPro:IPR038919"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM2"
FT                   /protein_id="CAR21533.1"
FT                   /translation="MQNDDPKTPATPRKLAAAHSSIPLSHQSPPAQDVECPPLTAFVFP
FT                   DLRAVYTMKLHEIPGIAFSEVTLFGFEIYIVEQWILERKHSTIIASYTGNSQDIVHAVE
FT                   FALPESPYFWPAPFKAYYDELITFSAPKWTDDGTLFVSTSSQIPSALNLLHVECGDLRK
FT                   IWNVLKVNLDLKRLHCGGRSAMLLCEPSSASCEKFAQLYKVVSPTKMSQDTESISLTHA
FT                   VVELITLVQISLTYFDLLDLQYRDGILCSFTERAINDWWVLYGSVYLGISRPKHEGTLG
FT                   PTTVAALLSLVLTVFFKLTVVNCISSKEPFDEEAFHGGIYLFQKKHGLLKSNSTSISVL
FT                   DPIVLAKLFEVTPKVSNTDFFKIKKVVKSTVQDITGKGNPMQLANGILTTDLDYLAKNV
FT                   HGSILCFLWRGKNTKQSAQKLSSKRKFANITFNRGDPADEILKSNVYASKRDDEIWEDF
FT                   DDQNSSNSPRQESHQFDKDSIQRYSPKNEDLREAREVELSRKSDGRVFETELHRRPSVP
FT                   YLPEDVGMLQMEYENAPRKNNLGNVKTRRRSLSTVQDAIETWANPFDPSLIRLARNALR
FT                   LEKEISWNQTQRTTKSEKDQLITPHMKRLRENHSELRSKLQGLEHLRETLNNKHSVVLG
FT                   DISELDSLGSKLKYDVRILENRMRDVEERVAQFGSKLNSMARSMEDKEACQLITSSFYN
FT                   NPKKLDRYAREILEGAGRFKSHGVILNLWELTKSMPSPLLAEVQRIWIYLCDRFAPQGH
FT                   LRK"
FT   gene            <343801..>346512
FT                   /locus_tag="KLTH0B04268g"
FT                   /old_locus_tag="KLTH.mRNA.153CN.p"
FT   CDS_pept        join(343801..343825,343937..346512)
FT                   /locus_tag="KLTH0B04268g"
FT                   /old_locus_tag="KLTH.mRNA.153CN.p"
FT                   /product="KLTH0B04268p"
FT                   /note="similar to uniprot|P37296 Saccharomyces cerevisiae
FT                   YMR054W STV1 Subunit of vacuolar-ATPase V0 domain one of
FT                   two isoforms (Stv1p and Vph1p) Stv1p is located in V-
FT                   ATPase complexes of the Golgi and endosomes while Vph1p is
FT                   located in V-ATPase complexes of the vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21534"
FT                   /db_xref="GOA:C5DCM3"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="InterPro:IPR026028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM3"
FT                   /protein_id="CAR21534.1"
FT                   /translation="MTREEAIFRSADMTYVQLYIPLELSREVVCLLGNMGNVMFRDLNT
FT                   DLTTFQRGYVNQIRKFDDLERLIDYMSNVASRYSEATWKYVFHGDNDNATQHPSMNFLM
FT                   SSMHTHSLDTVSDLTAEITEFESRVRQLDESLVNLRKRLNTLIEHRHAAFECGRYMEVN
FT                   PGLRGRAARSQQHRDLEQLTVEDFRLSDDEVSETLSDTFSFDEVSEDNSVPSAGRDLSA
FT                   ELEEGFRHRTTIIGSINRSKVETLNKILWRILRGNLFFHNIPIEEPLLEKGELVQKDCF
FT                   VVFTHGDVLLKKVKRVVESLNGTIFPGNEGRSTIKNLNTQIADLQQICQTTEQTLHTEL
FT                   LIVSDQLPMWRAVARREKLIYAALNLFRQESQGLVAEGWLPSTELLIVSNALKNHSENI
FT                   GSENSAVVSVIKTSKKPPTYHRTNKFTQSFQAIVDAYGIATYKEVNPGLATIVTFPFMF
FT                   AIMFGDTGHGAIVFLIALFLVLNEKKLAQAQNGEIFDMAFSGRYVILLMGFFSIYTGLL
FT                   YNDIFSLSMTFFKSGWKWNSGFKEGEAIEATNTGVYPFGLDYAWHGTENNLIFSNSYKM
FT                   KLSILMGFIHMTYSLFFSLVNYRYFRSRVDIIGNFIPGFIFMQSIFGYLSWAIIYKWSK
FT                   DWIKDGKVAPGLLNMLINMFLAPGVVDEPLFRGQSYLQVFLLLCALICVPWLLLYKPLK
FT                   LRAQNKAAISNGYQNIHDQNASESLLESQEDAGGEILVTDYDENHSNTFEFGDIMIHQV
FT                   IHTIEFCLNCISHTASYLRLWALSLAHAQLSSVLWTMTIANAFSSKDSGSPLAVIKVVF
FT                   LFGMWFVLTVCILVLMEGTSAMLHSLRLHWVEAMSKFFEGDGYPYEPFSFKALD"
FT   gene            complement(<346686..>349340)
FT                   /locus_tag="KLTH0B04290g"
FT                   /old_locus_tag="KLTH-ORF15413"
FT   CDS_pept        complement(346686..349340)
FT                   /locus_tag="KLTH0B04290g"
FT                   /old_locus_tag="KLTH-ORF15413"
FT                   /product="KLTH0B04290p"
FT                   /note="similar to uniprot|P36016 Saccharomyces cerevisiae
FT                   YKL073W LHS1 Molecular chaperone of the endoplasmic
FT                   reticulum lumen"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04290g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21535"
FT                   /db_xref="GOA:C5DCM4"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM4"
FT                   /protein_id="CAR21535.1"
FT                   /translation="MKLSTFIGGLSVFGSIASGALLGFDAGQEFSKAMLVSPHAPLELV
FT                   LTPDSKRKDVSGLAIKPWKNDIERVYGSGVDSAHVRAPEGALLHIKPLLGKQEEEDLTF
FT                   YHKSHPGITFVPTERGSIALKCFGHEYPVEQVLAMNLDETIGRANKLLAEKNGLDVVDS
FT                   LAITVPEFFNQDQRLALKSAAELPHGVKAQLVNDGMSVAIDFALKQRDFPPGEREYYVF
FT                   YDMGSGSTRASLFAIEQPLNKSEPLMIEFGGYGFDTTLGGAKFTQNVAELLKNKFLEQN
FT                   PAIRTEQLDRSARSLVRIHQAAEKAKLVLSANVDASVSIESLYDDIDFKAVITRQEFED
FT                   FSEDLTGRIVQPIEDALKNQFFENTVDTSNVKSLVLTGGSTRTPIVQKQLTHYLGSDLI
FT                   ARNVNADESSVNGVTIRGIQLFKSFQTKAIDILDRSIFSYGIIVNGSASPVEIFPRGSQ
FT                   YPNKTSFLIPPTNYTREFSIDLKENGNTFKKHVIETGPIQERFSEEICPQGVAFNATFT
FT                   LSQERIFDLDSVEAICLHNSKNSTGLFKKLFSGGTPRQEQDTIGKGDLDDIVPHKVKML
FT                   KTSESFTHVGPMSITEKLRVRQHIDDLNQKDKMRLQTQELLNALESILYSTRAFLEQED
FT                   VIAGGPRQDIDSLSEYVTVNLEWLDYESDEASVAELMEKIDHISSLKDKIELYLMSSGE
FT                   PLSFEQFSELHTNGSRLVQELRGIEVTANATLEALKDAFSEIGLDVAKEFKKLKAPRHL
FT                   SSPNYKLKDKIEAFEKNLADISSLLSAQDFDSFSREELFELKLIFDSSFDDLRKRLELE
FT                   QAIQNFKMNELASLHSRRLRVLKKREERRKSQESSTSLNASNSTLTSTTTESTKSEEEA
FT                   SKAEEFTIDHDEL"
FT   gene            <349547..>350941
FT                   /locus_tag="KLTH0B04312g"
FT                   /old_locus_tag="KLTH-ORF15412"
FT   CDS_pept        349547..350941
FT                   /locus_tag="KLTH0B04312g"
FT                   /old_locus_tag="KLTH-ORF15412"
FT                   /product="KLTH0B04312p"
FT                   /note="some similarities with uniprot|P36084 Saccharomyces
FT                   cerevisiae YKL074C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21536"
FT                   /db_xref="GOA:C5DCM5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM5"
FT                   /protein_id="CAR21536.1"
FT                   /translation="MSNSREKSRFSAGPAGEYDSRSSYRRDTRGPRRFDRGDMGGTDGG
FT                   RSRYGGRSSRNFENRSRYQGGGRYRQEPRYGDSRKPEDVDWSAVVSISQRRRMRETQWD
FT                   MAPKGFEKVPAERAKLSGLFPLPGQPQDLDRSKLEGIVSSGVLTRRTRILFEDPTESNM
FT                   SKTKYNQILILTSVGSSPAEMNQLAEYVKEFVKLVDETQELKEHKILQENRLYLRFSSE
FT                   EITTIALSCQKFIERKTGSKFIWQRPGECVEKKEPVDPICAGSVIALQELGDCTEEGLQ
FT                   SDLNQSGVETNWLKLISLGKTNEFTGTALIDPKANVDELSHYKWIRPNDCKLRQDFTEI
FT                   TFQQLPHLVARKDHAESRVIVLLNCVDPMDLKNDEFVKEIRDSMTSSKTMTALGEIESV
FT                   KIPQPGADYRTSFESIEESVGKIYVKFKEQESAKAAMSQLSGVSFNDRTVLCAYYSERD
FT                   YNMDVL"
FT   gene            complement(<350971..>351879)
FT                   /locus_tag="KLTH0B04334g"
FT                   /old_locus_tag="KLTH-ORF15409"
FT   CDS_pept        complement(350971..351879)
FT                   /locus_tag="KLTH0B04334g"
FT                   /old_locus_tag="KLTH-ORF15409"
FT                   /product="KLTH0B04334p"
FT                   /note="similar to uniprot|P26448 Saccharomyces cerevisiae
FT                   YMR055C BUB2 Mitotic exit network regulator forms GTPase-
FT                   activating Bfa1p-Bub2p complex that binds Tem1p and spindle
FT                   pole bodies blocks cell cycle progression before anaphase
FT                   in response to spindle and kinetochore damage"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21537"
FT                   /db_xref="GOA:C5DCM6"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM6"
FT                   /protein_id="CAR21537.1"
FT                   /translation="MSSLEKFLGQQPLIVHSSLAQLRYLVLSEGIPLSKEKSAARLRCN
FT                   AWSVLARCSMDGATSDYVSLVRRGPPPHPIYSKIKNDTFRTLNTDPQFIACVSEDAITR
FT                   CLSSFAWSVLDEEDEEFHLSTYVQGMNVLLAPILYTCPSEPMAFRLFRSLCQDHIKTYL
FT                   NQSLTGVHNGAKLLDMCLKVIDPKLSKFLADNLLTAEIYGIPSILTLSSCTKPLDQVCK
FT                   LWDFMFAYGFHMNILFIVAQLVVIRSRVLKSSAPMNLLRMFPEFDAEEIIRLGVGFVAK
FT                   LPSNLYDLLVQHLEDPNLVIE"
FT   gene            <353523..>355418
FT                   /locus_tag="KLTH0B04356g"
FT                   /old_locus_tag="KLTH-ORF15404"
FT   CDS_pept        353523..355418
FT                   /locus_tag="KLTH0B04356g"
FT                   /old_locus_tag="KLTH-ORF15404"
FT                   /product="KLTH0B04356p"
FT                   /note="similar to uniprot|P38993 Saccharomyces cerevisiae
FT                   YMR058W FET3 Ferro-O2-oxidoreductase required for high-
FT                   affinity iron uptake and involved in mediating resistance
FT                   to copper ion toxicity belongs to class of integral
FT                   membrane multicopper oxidases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21538"
FT                   /db_xref="GOA:C5DCM7"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM7"
FT                   /protein_id="CAR21538.1"
FT                   /translation="MIGSSWLLVMLAAVQSVAAETHVFNWTTGWGNYNVDGGAERPVIT
FT                   CNGEFPWPDVRVKKGDQVEVYLKNGFDDRNTSMHFHGLFQNGTNSMDGPPMVVQCPIGP
FT                   GDTFLYNFTVDDNVGTYWYHSHTAGQYQDGMRGAFVIEDDDFPYDYDEDVILQLGEWYH
FT                   DTTDVLNPKFMSVYNPTGAEPIPQNLIMNNTRNMTWEVQPDTTYLLRVINTGGFVSQYF
FT                   WIEDHEFDVVEVDGIYTEKNTTDMIYITTAQRYTLLLHTKNDTSRNYAIMTKFDDTMLD
FT                   LLPKDLQLNSTNYLIYNTSADKPTESYVDELAPLDDFYLVPYQKEEALGDPDYRVVVNV
FT                   TMDNLVSGINYAFFNNLTYTAPVVPTLFTVLSADEDDVKNPEIYGSNINAFVLDKDEIV
FT                   EIVLNNEDTGTHPFHLHGHAFQVMVRDVTYDDALGETPHAYDENDHPDFPEYPMIRDTL
FT                   YVRPQSNFVIRFKANNPGVWMFHCHIEWHLTQGLAIILIEDPESIKATQSQQLSDNHKS
FT                   VCANVGMATEGNAAGNTDDFFNLKGEPIQEKFIPDGFTAKGIVAMTFSCLAGVLGLIMI
FT                   AIYGLMDISNVEEKVIDELHLDADKVAAVDVDDVDDIDNDETSSISAAREEVVNK"
FT   gene            <356395..>357537
FT                   /locus_tag="KLTH0B04378g"
FT                   /old_locus_tag="KLTH-ORF15397"
FT   CDS_pept        356395..357537
FT                   /locus_tag="KLTH0B04378g"
FT                   /old_locus_tag="KLTH-ORF15397"
FT                   /product="KLTH0B04378p"
FT                   /note="similar to uniprot|P36083 Saccharomyces cerevisiae
FT                   YKL075C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21539"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM8"
FT                   /protein_id="CAR21539.1"
FT                   /translation="MKESIGPTCRCSKCNSLLKASPKATAKKPIRYRFNFMKHMDLRQS
FT                   NYRTITSISYLTEKYGEKKAENIARFVRCIHKQINSGVNRISDLQASSILPWTRVRLFL
FT                   LLVTLSQRGGSDYWMGKEGEMKEPARPSEPRERKPQDKSKPYGTLIEEIMRQNINDNYR
FT                   EADHDENYVFSSIWANFMEGLINHFLEKVIIPSSERKVCQQLYKPMMKIISLYNEYNEL
FT                   MEKSERNGFLPPNQEPPAIISSDEATSIEDGKLQTAQRLLWQARQDIPKTISKELTLLS
FT                   EMYSTLSADEQDFELDEFVCSAEEYIELEYLPSLIEVLFANGGTLNFWKIMIVLEPFFY
FT                   YIEEVADEESPCYDGDSAKPDPRVVTLEKICEVAAEQEWI"
FT   gene            complement(<357622..>358890)
FT                   /locus_tag="KLTH0B04400g"
FT                   /old_locus_tag="KLTH-ORF15394"
FT   CDS_pept        complement(357622..358890)
FT                   /locus_tag="KLTH0B04400g"
FT                   /old_locus_tag="KLTH-ORF15394"
FT                   /product="KLTH0B04400p"
FT                   /note="similar to uniprot|P36081 Saccharomyces cerevisiae
FT                   YKL077W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21540"
FT                   /db_xref="GOA:C5DCM9"
FT                   /db_xref="InterPro:IPR028000"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM9"
FT                   /protein_id="CAR21540.1"
FT                   /translation="MSYPIIKFFIRNNNDFDLKIIPQRDFSEQNTMLVPQSIALLLLAW
FT                   LSAVDARRNVIKPKETTTTSEIPKPWLRTIYSGQKEVVTPTVIAGVTFSAKPLATTNGL
FT                   EPWISLDQFGSPKTKRPQIKGAKTKDARPDYSTYFKTVATRTLSYDELKAHNMEEDEVY
FT                   EEEVFTDEDDTYVSLNPIIRCTPDRYFKKGPAGDISSEPFCTPKENKELKVDNTYFVSW
FT                   YTKFFQKPDTDETIENVQLHLFYVKESIKDKGLKKRDLKAAFFSSGWLKNVDGIYPLEL
FT                   TADFLDGAYDRKVLLAIQPDNIRDDEFNPWEHYVLFRMIMGPRVAKTTKQQKALQDAGI
FT                   SDDTWYYVALSIPTVVVIACVAMYFFLYLNRSHRDIHNVKDFAINQRRRVLGKFKDFKK
FT                   YKKINNRPYSELPTHTKKTGKQN"
FT   gene            <358915..>359253
FT                   /locus_tag="KLTH0B04422g"
FT                   /old_locus_tag="KLTH-ORF15393"
FT   CDS_pept        358915..359253
FT                   /locus_tag="KLTH0B04422g"
FT                   /old_locus_tag="KLTH-ORF15393"
FT                   /product="KLTH0B04422p"
FT                   /note="similar to uniprot|Q04675 Saccharomyces cerevisiae
FT                   YMR059W SEN15 Subunit of the tRNA splicing endonuclease
FT                   which is composed of Sen2p Sen15p Sen34p and Sen54p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21541"
FT                   /db_xref="GOA:C5DCN0"
FT                   /db_xref="InterPro:IPR018593"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN0"
FT                   /protein_id="CAR21541.1"
FT                   /translation="MDNQHIIKLVRNNLVHQQLWDDVEEAKLEDTDAWVLRGLPPHKLS
FT                   NDDPQLDHEWILPIELSQYKPGKLTLELMDKIFSELKCRRVTLGIVNDDGTVVYYFIYK
FT                   GLHKPKRN"
FT   gene            complement(<359264..>360151)
FT                   /locus_tag="KLTH0B04444g"
FT                   /old_locus_tag="KLTH-ORF15392"
FT   CDS_pept        complement(359264..360151)
FT                   /locus_tag="KLTH0B04444g"
FT                   /old_locus_tag="KLTH-ORF15392"
FT                   /product="KLTH0B04444p"
FT                   /note="similar to uniprot|P50110 Saccharomyces cerevisiae
FT                   YMR060C SAM37 Component of the mitochondrial outer membrane
FT                   sorting and assembly machinery (SAM) complex required for
FT                   the sorting of some proteins to the outer membrane after
FT                   import by the TOM complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21542"
FT                   /db_xref="GOA:C5DCN1"
FT                   /db_xref="InterPro:IPR019564"
FT                   /db_xref="InterPro:IPR031317"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN1"
FT                   /protein_id="CAR21542.1"
FT                   /translation="MKATVHLWGLNGKPSIVSPESVALFWLLNDTQNDRNVTIVFSNNT
FT                   DLSPNQELPLLIDGDKKLYGYANIARHFSAEETALEMALLQFTQDHICVLTQYQLYLNK
FT                   NNYDSFTRRVFAYLLEWPLWYNTPLKYRALARKRCETLGYFGHDDDPEQVEQPNAELDG
FT                   LVQSKAFKLTNASKARGEELLKSARYNLQYMSRLNRHVVSWREARARLDKDSTAADFLL
FT                   WANLFVQMELPDGQLVKEQLQTALGPEDYESIIKRLNDCSKSTSTLELRGPFFAEKGNV
FT                   VMSAYHALQRLVAA"
FT   gene            <360380..>362344
FT                   /locus_tag="KLTH0B04466g"
FT                   /old_locus_tag="KLTH-ORF15388"
FT   CDS_pept        360380..362344
FT                   /locus_tag="KLTH0B04466g"
FT                   /old_locus_tag="KLTH-ORF15388"
FT                   /product="KLTH0B04466p"
FT                   /note="similar to uniprot|P25298 Saccharomyces cerevisiae
FT                   YMR061W RNA14 Cleavage and polyadenylation factor I (CF I)
FT                   component involved in cleavage and polyadenylation of mRNA
FT                   3' ends bridges interaction between Rna15p and Hrp1p in the
FT                   CF I complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21543"
FT                   /db_xref="GOA:C5DCN2"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN2"
FT                   /protein_id="CAR21543.1"
FT                   /translation="MSATPEIVKNGSAGFIRPTKRQIRPEEDVEGRLRDVIEERPGDIC
FT                   TYLELARLLQSRDQQEEARGVFDQLHERFPLFSPLWTVEVGYDLERDEFSHAGSLLTRC
FT                   LSGTLENNDLGLWFMYLDFVRRKNNLITGGEEARGVVLKAFDAVATKCASWEPRSSAFW
FT                   NEYLSFLEHWKPVSKWEEQQRIDLTRSLYKRMLCIPFDGLERSWNKYTQWEQEVNSLTA
FT                   RKFIGELSANYMKARSLYREWNNITKGIKRVLPSRLSQCSKQTIPQPGEYQVEQIHLWM
FT                   DWIKWELQNKLDLPDEFHSQRVDYVYKQAIQHLLFSPEIWYNYSMYASPENAREILIQG
FT                   LKASPGSTTLTFKLSEHFELQNEVEQMQKCFERCIDHLVLEYHIMSDEGQETYSQRQKI
FT                   TFVYCIYMNAMKRVSGLSSARKVFGKCRKLKDLLTHEIYIENAYLEFHNNNDHKTACKV
FT                   LELGLKYFSSSGEYVNKYLDFLILINQDGLIKPLFESSLDRIIDLDELQRIYKKVINYE
FT                   SKFGNLTNAYSIENRFFEKFPQLEKIEVFTDRYQVQNANLIKSLELTYLPSDNDFRFGS
FT                   FNETNGGLKRSRGLSQSGDSAAQKRHKSQDFVPENVLDLLRLLPKRQYFKTAVLDAEKL
FT                   TRYLIENVNIPSSDNGTAA"
FT   gene            complement(<362390..>363715)
FT                   /locus_tag="KLTH0B04488g"
FT                   /old_locus_tag="KLTH-ORF15386"
FT   CDS_pept        complement(362390..363715)
FT                   /locus_tag="KLTH0B04488g"
FT                   /old_locus_tag="KLTH-ORF15386"
FT                   /product="KLTH0B04488p"
FT                   /note="highly similar to uniprot|Q04728 Saccharomyces
FT                   cerevisiae YMR062C ECM40 Mitochondrial ornithine
FT                   acetyltransferase catalyzes the fifth step in arginine
FT                   biosynthesis also possesses acetylglutamate synthase
FT                   activity regenerates acetylglutamate while forming
FT                   ornithine"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21544"
FT                   /db_xref="GOA:C5DCN3"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DCN3"
FT                   /protein_id="CAR21544.1"
FT                   /translation="MRVSSALLQKAAKTVDKYSLYVPKSGVFPKGFKVASLASGVKKNG
FT                   NRDLGIILNTNKSRPSNAAAVFTTNRFKAAPVLVSKQVLDGSSGEGVNAIVANSGCANA
FT                   VTGELGMQDAQKVAGQVNAHIGKENSTLVMSTGVIGQRLQMDKISKGINTLFDQKQFGS
FT                   DFNSWLNLAKSICTTDTFPKLISSKFQLSDGTEYTLTGISKGAGMICPNMATLLGFIVT
FT                   DLPIKASTLQAMLTAAVNRSFNCISVDGDMSTNDTICMLANGAVDTFVIDEASPDFEQV
FT                   KSQVTEFAKQLAQLVVRDGEGATKFVTVNVKNSANFKDARIIAETISNSMLVKSALYGQ
FT                   DANWGRILCAIGYSKLENLASLDESKINVSFIATDNSSPRELKLIANGVPQFDIDENRA
FT                   SEILALPDLEILVDMGTGSEECQFWTCDLSHEYVTINGDYRS"
FT   gene            complement(<364062..>365768)
FT                   /locus_tag="KLTH0B04510g"
FT                   /old_locus_tag="KLTH-ORF15382"
FT   CDS_pept        complement(364062..365768)
FT                   /locus_tag="KLTH0B04510g"
FT                   /old_locus_tag="KLTH-ORF15382"
FT                   /product="KLTH0B04510p"
FT                   /note="highly similar to uniprot|P39932 Saccharomyces
FT                   cerevisiae YDR536W STL1 Glycerol proton symporter of the
FT                   plasma membrane subject to glucose-induced inactivation
FT                   strongly but transiently induced when cells are subjected
FT                   to osmotic shock"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21545"
FT                   /db_xref="GOA:C5DCN4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN4"
FT                   /protein_id="CAR21545.1"
FT                   /translation="MPSRLSVNRTSTLGLNGRSLRLAITITSVIGFSLFGYDQGLMSGL
FT                   ITGKEFNSEFPATGGDDRRTKLVQGAVTACYEIGCFFGSLFVMFRGEQIGRKPLVILGA
FT                   CLTIVGTVISTAAFGPHWGLGQFVVGRVCTGVGTGLNTSTIPVWQSEMSKPENRGILVN
FT                   LEGSMIAVGTMIAYWIDFGLSYVDSSVQWRFPVAMQIFFALLLLAGIWELPDSPRWLMS
FT                   RGRRDDALHVLAKLDNLPEDDDAIIAEATVIQDAVNRFRHEKRSVKDLFTGGKTQNLQR
FT                   ALVASSTQFFQQFTGCNAAIYYSTVLFQESIGLTGKLPLILGGVFATIYACFTIPSFFL
FT                   VETLGRRKLFMLGAAGQAISFTITFGCLTKDDTEVAKGAAVGLFLFICFFGMSMLSLPW
FT                   IYPPEIASMRVRSATNALSTCTNWLCNFAVVMFTPIFIMDTGYGCYLFFAVMNYLYLPV
FT                   IFFFYPETAGRSLEEIDIIFAKAHVDGTMPWRVAANLPKLSFSEIEDQANALGLYEDDN
FT                   EKQDLDLDEAADREDAIRQNSGVQGYTLFEKRENGAESGQPDGSSTSQKSD"
FT   gene            <367438..>367770
FT                   /locus_tag="KLTH0B04532g"
FT                   /old_locus_tag="KLTH-ORF15368"
FT   CDS_pept        367438..367770
FT                   /locus_tag="KLTH0B04532g"
FT                   /old_locus_tag="KLTH-ORF15368"
FT                   /product="KLTH0B04532p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21546"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN5"
FT                   /protein_id="CAR21546.1"
FT                   /translation="MDAAGRLCSLLSCPTRAAPAMKRSSPDDCVYVASKKCQMYTACSG
FT                   TDAFRAMLRTARRASRPAAPAAFEQECYYCSSRAPTAVCGACHESVCTVCSAGGTATCL
FT                   NCRVAC"
FT   gene            <367962..>370022
FT                   /locus_tag="KLTH0B04554g"
FT                   /old_locus_tag="KLTH-ORF15363"
FT   CDS_pept        367962..370022
FT                   /locus_tag="KLTH0B04554g"
FT                   /old_locus_tag="KLTH-ORF15363"
FT                   /product="KLTH0B04554p"
FT                   /note="weakly similar to uniprot|P53309 Saccharomyces
FT                   cerevisiae YGR241C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21547"
FT                   /db_xref="GOA:C5DCN6"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR014712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN6"
FT                   /protein_id="CAR21547.1"
FT                   /translation="MTTYVKLVKGATKIKMAPPKAKYVDPILLGTADPHEFREIMNALD
FT                   ARVQDTAWTIVYKSLIVVHLMIREGEPLVTIKYLSKNQDFFSLKDIFHSKLSSGDLQAL
FT                   RRYRDYLRTRCVEYANTGKDYVRENNSSLTTSAASDPKLSLSHVESLEAQISALIKNRY
FT                   SQYDLGNDLLLTAFRLLVQDLLVLYNSLNEGIITLLESFFELTHQDAERTLKLYKRFVE
FT                   LTESVVKYLKTGKAVGLKIPVIKHITTKLIRSLEEHLKDDNNNHGQNFSSSDSKTPAQR
FT                   ELEQIREQKRQLEEQMKTQQQMIISPTIPQQQTGYNPFAEGFSFEQPAAAQPIATQPTS
FT                   NPFMAQAQVPQHTAQPLQYQQTQQAVQPLQYQQTQQTVQPLQYQQTQQTPAVGQLQQVS
FT                   TTGQFQQTPMAGQFQAAQHMAQQAPQQVPQQMSQQMPQADQYQQAQMQQQTQVPQQTPQ
FT                   AFQYQHTQGPQQASPGEHFQPFQSLNPQTAQPSPQLQSASTGFFSSNTQVTPSFTGAGF
FT                   GGYYSPDTGAGAASGPGPAPAPVQTAMPTGSNNPFSMENIARSKDERERVNPFSQTNQS
FT                   PALNSSAAANPFDKPMQNHHTFGGLENMPTVSVFPQTRSQTTQLQQAQIQPQHTQLQFQ
FT                   QPQQAYGHPQQSSLNPYTQAQQNLQQQQQQQQQYGNLQYSRPGEGPNLIDI"
FT   gene            <370504..>373431
FT                   /locus_tag="KLTH0B04576g"
FT                   /old_locus_tag="KLTH-ORF15355"
FT   CDS_pept        370504..373431
FT                   /locus_tag="KLTH0B04576g"
FT                   /old_locus_tag="KLTH-ORF15355"
FT                   /product="KLTH0B04576p"
FT                   /note="highly similar to uniprot|P16861 Saccharomyces
FT                   cerevisiae YGR240C PFK1 Alpha subunit of heterooctameric
FT                   phosphofructokinase involved in glycolysis indispensable
FT                   for anaerobic growth activated by fructose-2 6-
FT                   bisphosphate and AMP mutation inhibits glucose induction of
FT                   cell cycle-related genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21548"
FT                   /db_xref="GOA:C5DCN7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="InterPro:IPR040712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN7"
FT                   /protein_id="CAR21548.1"
FT                   /translation="MTQETVYGVAFRSVATADESAYRSAIKFYHKLGFSTVKTYDKFRG
FT                   NKEAATSGTAQGSVKETWLESFKLSEVDSNGFRIPQQEATNHEQSDGALLKIRLVAHQP
FT                   LEAKNSRVTYYSASIDEVSKAFPDAKKLENGEYALNDPLGYELRLSGYVRAGDKKTVDK
FT                   EFFLDESKTPADYLKGQNLSPNQIPGATSTGIKKKIAVMTSGGDSPGMNSAVRAVVRAG
FT                   IYYGCDVFAVYEGYEGLLKGGDLLKKMEWKDVRGWLSEGGTLIGTARCMEFRERWGRKQ
FT                   AAGNLISEGIDALVVCGGDGSLTGADLFRSEWPSLVEELVKDGKFTEKQVEPYRNLKIV
FT                   GLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLALM
FT                   AGIATGADYIFVPERAAPAGKWQEELKKVCQAHREKGRRNNTVIVAEGALDNNLKPITS
FT                   EQVKDALVELGLDTKITTLGHVQRGGTAVAHDRWLATLQGVDAVKAVLEMTPETPSPLI
FT                   GILENKIIRMPLMESVKLTKSVAEAIENKDFDKAISLRDTEFIELYENFISTTVKDDGS
FT                   ERLPEDQRLNIAIVHVGAPSAALNAATRAATLYCLSRGHKPSAILNGFSGLIQTGEIKE
FT                   LSWIDVENWHNLGGSEIGTNRSVASEDMGSIAYHFQKNKFDGVIILGGFEGFKSLKELR
FT                   DARAQYPIFNIPMVLIPSTVSNNVPGTEYSLGVDTCLNTLVNYTDAIKQSASATRRRVF
FT                   VVEVQGGHSGYIASFTGLVTGAVSVYTPEDQIDLKSIREDLALLKENFRHDQGETRNGK
FT                   LVIRNEQASSIYTTDLLADIIAEASSGKFGVRTAIPGHVQQGGVPSSKDRVTGSRYAVK
FT                   CVKFIEAWNRKNSDEQNEDFKILRFKYVNGVKEYTIQDEDASAAIIAVNGSHISFKPIA
FT                   RLWEEETNVELRKGQEVHWEEFNKIGDILSGRLNLRKEVDAGKSA"
FT   gene            complement(<373616..>375145)
FT                   /locus_tag="KLTH0B04598g"
FT                   /old_locus_tag="KLTH-ORF15349"
FT   CDS_pept        complement(373616..375145)
FT                   /locus_tag="KLTH0B04598g"
FT                   /old_locus_tag="KLTH-ORF15349"
FT                   /product="KLTH0B04598p"
FT                   /note="weakly similar to uniprot|Q04746 Saccharomyces
FT                   cerevisiae YMR065W KAR5 Protein required for nuclear
FT                   membrane fusion during karyogamy localizes to the membrane
FT                   with a soluble portion in the endoplasmic reticulum lumen
FT                   may form a complex with Jem1p and Kar2p expression of the
FT                   gene is regulated by pheromone"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21549"
FT                   /db_xref="GOA:C5DCN8"
FT                   /db_xref="InterPro:IPR007292"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN8"
FT                   /protein_id="CAR21549.1"
FT                   /translation="MGASVIVVILWAFYFRLGNSDRLEIAGYKLLSLDDSDSLTDGLER
FT                   IVELNFPLYKSSCAMNALRDFLPKCIKHGIDTIDPKQRVNAAIKLSFCEFQESGLDELP
FT                   ESCQKSTQDGLKKCLDEMKSSAQWWTTYSGNYQRLPTLCYESSLPFEKEQLLDVFLNVT
FT                   RMYANFNEVLDLKLQRRFEEYEAAAEKNLFKVERIFEEYFSDFDNSYSARKAMFFQDFE
FT                   HYQKDVLLAFDKNVKVVQREVGSFESDIWQEVIALKQYIQEMNAELNASGPRDQIKSLK
FT                   VESLIQIQALRDSIRLASEDSISLLKSKDKSFNDFYSKTTEQLSKLDEALGNTYMDALV
FT                   VIQDLRGLVQNSITPLLREDIEKPLSQFSQNLAQNLEYLDENFCAKAELWVRSFDGTFQ
FT                   RVHADLNLTAQEVLHINEDLGNFTTTFESHLKALNISVKVFSASMSSLARLLRVVPPAA
FT                   RPFLAIALLRYCPTLLIRFFGSLFENVTQVSRVCAVLIALISGCALGFNLT"
FT   gene            complement(<375653..>377353)
FT                   /locus_tag="KLTH0B04620g"
FT                   /old_locus_tag="KLTH-ORF15348"
FT   CDS_pept        complement(375653..377353)
FT                   /locus_tag="KLTH0B04620g"
FT                   /old_locus_tag="KLTH-ORF15348"
FT                   /product="KLTH0B04620p"
FT                   /note="weakly similar to uniprot|P32493 Saccharomyces
FT                   cerevisiae YMR064W AEP1 Protein required for expression of
FT                   the mitochondrial OLI1 gene encoding subunit 9 of F1-F0 ATP
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21550"
FT                   /db_xref="GOA:C5DCN9"
FT                   /db_xref="InterPro:IPR031467"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DCN9"
FT                   /protein_id="CAR21550.1"
FT                   /translation="MGSRIFSPRRLYSALSELKTETVIPKNPNKRTRDGSFRKFKRVAP
FT                   AIGDSMHPFYSPNIMERAILCASEIKPELLDGQPIVPAVIKQLKTLEPALVNTRWQPQS
FT                   TQGLNDWLEPFRKMRRKSSPLKLIENHEIDNVIRPSRIDSGRIPELRKFALMFEKEDAG
FT                   ILSASTIGSLIDRLAADQEKAVFSEEVFLYILQHYCKSSQGIASVVDSITEFLHKDIDD
FT                   LKTAETLLAHVLMALRRNSIPLTPRATSAILKLIDSVSTRFHRPFCVVDFSPAVVQMTT
FT                   EFYVDSGFLKESKVLFTDMVNKERCPSAQLVEKYLGLIESVCGISTSDNDFLKKFVYIS
FT                   NFRPIFQTTMTPRITEFLVSYCRHFDEILSLLVLVDHSKVKKQIWDLVLPQMIRRVSLL
FT                   TKDSAKNCCHLTVLYQKASRFYGMPLSTKVNKAFIIQYAVNGNFAMVARLLSIIDSNAF
FT                   PSFYASVLAAYDQSSAFSMEVPSSGAALKNKHQFMTSMIIPHYTEISFVGRQLALKHAD
FT                   TEELLEQVLKAEIAIKGRGGKSLLPQVSLKAQDCKSNYIITEAEKCLQH"
FT   gene            complement(<377498..>378223)
FT                   /locus_tag="KLTH0B04642g"
FT                   /old_locus_tag="KLTH-ORF15346"
FT   CDS_pept        complement(377498..378223)
FT                   /locus_tag="KLTH0B04642g"
FT                   /old_locus_tag="KLTH-ORF15346"
FT                   /product="KLTH0B04642p"
FT                   /note="weakly similar to uniprot|Q04734 Saccharomyces
FT                   cerevisiae YMR063W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21551"
FT                   /db_xref="GOA:C5DCP0"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP0"
FT                   /protein_id="CAR21551.1"
FT                   /translation="MPSKSRSVIFVLLTLALIFQIFPTISIPVVDRIYLSTYNGRKFGV
FT                   FGWCTAKSSECTSPRIGYEILPLNGTTEVASLFLPSRAKRSISKLLIVHPISLFFTFVL
FT                   WTLALALNMHNFGQSRKILAGAVLWSLLTVLLSLLSFLVDILLFVPYLAWPGWLVLVST
FT                   VFIAVASSMMCIIRRAVSLRKYEKLRNRDNVELVPLRFSNVNSNSSKPTASEGVSDTQE
FT                   SAAWQHVAPDQPELVHRAV"
FT   gene            <378488..>380590
FT                   /locus_tag="KLTH0B04664g"
FT                   /old_locus_tag="KLTH-ORF15345"
FT   CDS_pept        378488..380590
FT                   /locus_tag="KLTH0B04664g"
FT                   /old_locus_tag="KLTH-ORF15345"
FT                   /product="KLTH0B04664p"
FT                   /note="similar to uniprot|P36009 Saccharomyces cerevisiae
FT                   YKL078W DHR2 Predominantly nucleolar DEAH-box RNA helicase
FT                   required for 18S rRNA synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21552"
FT                   /db_xref="GOA:C5DCP1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP1"
FT                   /protein_id="CAR21552.1"
FT                   /translation="MSKGKKFRKIGKTSFQPPKNVVFSDKRSSADGSSDHEDGLTKSAS
FT                   KHDLAREAASLLKVRATLPVYKHKDSIMSHINKNQVTILIGETGSGKSTQIPQFLMENF
FT                   PEKTDKRIAVTQPRRVAAINLASRVAQEYGCRLGERVGYSVRFDNKSNARTKLKYLTDG
FT                   MLLREIMLDKNLSDYSCVIIDEAHERTILTDLILGFLKELINSSRQDLKVVVMSATLQA
FT                   EKFSEFFGRAPILFVEGRKFPVQRSYLKAQCDDVVDAIIRCCVQLNQSEQMGDILCFMP
FT                   GQEEIDKAVAILSKVGEHLGASVPRLVALPLYAALPPAEQAKVFAPVKGFKRKVVFSTN
FT                   LAETSVTISGVKFVVDSGLRKVKVWRHQLGLATLLTVPISKASASQRTGRAGRESAGKC
FT                   FRLYREQDYQKLPNQTEPEIARSEVTSPILMLKKVGVKDIVNWSWLENPGKQAILMALQ
FT                   ELFQLGALDDSGKITNKGQKMALLPLAPHLSSVLLKAHEDGCLLPVIDIVSCLSVENLL
FT                   INPSPEQRDEVNEKRFSIATRGSKYGDLVMLKEFYDAYMSLKSAAEKDDWCKELCVSKR
FT                   GFKNVVKIRAQLLSYMERLFKEKLSDNEDESDSFDIKAIVKCFLAGFAKNTAIGMPDRS
FT                   FRTSTTGETISVHPSSMLFMDRSCPAILYTEYVFTTKGYARNVSRLELSWLQEVAGIST
FT                   VKVSAR"
FT   gene            <381618..>381932
FT                   /locus_tag="KLTH0B04686g"
FT                   /old_locus_tag="KLTH-ORF15341"
FT   CDS_pept        381618..381932
FT                   /locus_tag="KLTH0B04686g"
FT                   /old_locus_tag="KLTH-ORF15341"
FT                   /product="KLTH0B04686p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21553"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP2"
FT                   /protein_id="CAR21553.1"
FT                   /translation="MRYAFYEEHAPQLRSSRTTIVSNEDTWLSYKDAILDNINAPEKSQ
FT                   FENAYARELSRLESVGTWDATAPRPAHSLAPEAIIDTNFEFNTNSNGEKCCRVVQEGVS
FT                   "
FT   gene            <383780..>390259
FT                   /locus_tag="KLTH0B04708g"
FT                   /old_locus_tag="KLTH-ORF15338"
FT   CDS_pept        383780..390259
FT                   /locus_tag="KLTH0B04708g"
FT                   /old_locus_tag="KLTH-ORF15338"
FT                   /product="KLTH0B04708p"
FT                   /note="highly similar to uniprot|Q12680 Saccharomyces
FT                   cerevisiae YDL171C GLT1 NAD( )-dependent glutamate synthase
FT                   (GOGAT) synthesizes glutamate from glutamine and
FT                   alpha-ketoglutarate with Gln1p forms the secondary pathway
FT                   for glutamate biosynthesis from ammonia expression
FT                   regulated by nitrogen source"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21554"
FT                   /db_xref="GOA:C5DCP3"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP3"
FT                   /protein_id="CAR21554.1"
FT                   /translation="MLRSDEFDPLQEAYDGGMPLDTRRMHSDDSDINGFGASSKDSQFW
FT                   ADAIPGKQGLYDPEYERDACGVGFVANIKGAQSHKIVSDARYLLCNMTHRGAVSSGGNG
FT                   DGAGILVGIPHEFMKREFRLDSGIEIPAAGQYATGNFFFKKDAPETLEASKRTFESLAE
FT                   SLGLLVLGWRSVPRDSSILGAVALSREPAIFQPLVVLQEAHHEQQPISAQDFREKFDVK
FT                   FQTQLYILRKQASSAIGLQNWFYACSLNPRTIVYKGQLTPTQVYQYYHDLTNAHFESHM
FT                   ALVHSRFSTNTFPSWDRAQPLRWIAHNGEINTLRGNKNWMRAREGVMASETFGEQLDKL
FT                   YPIIEEGGSDSAALDNVLELLVINGALSLPEAIMMMVPEAYHKDMDSNLKAWFDWSACL
FT                   MEPWDGPALLTFTDGRYCGAMLDRNGLRPCRYYITSDDRVICASEVGVIPVDNSLVVQK
FT                   GKLKPGDMLLVDTDLGEMVDTKKLKSTFSKKRDYKSWLSKLIKLEDLLVKTQKYIPDSF
FT                   LSDRHASLKAQQDPRLLAMGYTFEQVSMVLIPMALGSKEALGSMGNDAPLACLNENPVL
FT                   IYDYFRQLFAQVTNPPIDPIREANVMSLECYVGPQGNLLEVHPSQCDRLLLHSPILQWR
FT                   EFEAIKNIEKAHPAWSVADIDITFEKSQGLLGYTSTIERITHQASEAIEQGKRIIMISD
FT                   RRMGPDRVPLSSLIAVGAIHHHLIRNKQRSQVALILETGEAREVHHFCVLLGYGCDGIF
FT                   PYLAMETLVRMNQEDLVRNVENDDIDIDDTTLLENYKHAIDGGILKVMSKMGISTLASY
FT                   KGAQIFEALGVDNTVVDLCFAGTASRIQGVTFEYIAQDAFSMHERGFPSRFTISKSVNL
FT                   PESGEYHWRDGGAKHINDPTAIASLQDSVRNKNSNAWEMYVKKEMESIRDCTLRGLLEL
FT                   DFENSESIPLEQVEPWTEIARRFATGAMSYGSISMEAHSTLAVAMNRLGAKSNCGEGGE
FT                   DAERSIVHSNGDTMRSAIKQVASARFGVTSHYLSDADEIQIKIAQGAKPGEGGELPAHK
FT                   VSPDIAKTRHSTPYVGLISPPPHHDIYSIEDLKQLIYDLKCSNPRAGISVKLVSEVGVG
FT                   IVASGVAKAKADHILVSGHDGGTGASRWTGIKYAGLPWELGLAETHQTLVLNDLRRNVV
FT                   VQTDGQLRTGFDIAVAVLLGAESFTLATVPLIAMGCIMLRKCHLNACAVGIATQDPLLR
FT                   EKFKGQPEHVINFFYYLIQDLRKIMAKLGFRTIDEMVGHSEKLRKRENVNTKAINIDLS
FT                   PILTPAHVIRPGVATKFTKKQDHRLHTRLDNKLIDEAEITLDRGLPVNIDATIINTDRA
FT                   LGSTLSYRISKKFGEEGLPQDTVVVNIEGSAGQSFGAFLASGITFILDGDANDYVGKGL
FT                   SGGRLIIRPPPDSRFKSDENVILGNTCFYGATSGTAFISGVAGERFCVRNSGATIVVEK
FT                   IKGNNAFEYMTGGRAVVLSQMESLNAFSGATGGIAYCLTSDYDDFVGKINTESVELQGL
FT                   IDPVEIAFVKNLIQEHYNYTKSELAARILGNFNHYLKNFVKVIPTDYKKVLEKDAEEKA
FT                   KLKQKNTANFLKKFNSGTDLKSDVTNGEVDAIREAKKKAVRNISHKATLAEPKVQDLED
FT                   AVNDIEQLEKNGEKIQKTRGFMLYKLRHEKYRHASARTKDWKELSACVTKKDAKYQTAR
FT                   CMDCGVPFCTSDTGCPISNVIPKFNELVFKNQWKLALDKLLETNNFPEFTGRVCPAPCQ
FT                   GSCTLGIIDDPVGIKSIERLIIDNGFKEGWIQPCPPEVRTGRNIAIIGSGPAGLACADQ
FT                   LNRAGHSVTVYERADRCGGLLMYGIPNMKLDKKIVQRRVDLMAAEGVEFVTSVEIGKDI
FT                   TVEQLKAQNDAVVYAIGSTIPRDLRIPGRDLKNIDFAMSLLTANTKALLSKDLETIRQQ
FT                   ISGKKVIVIGGGDTGNDCLGTSVRHGAASVINFELLPQPPNERASDNPWPQWPRVMRVD
FT                   YGHAEVKAHYGRDPREYCILSKEFIGNEEGEVKAIRTVRVEWKRSESGVWQMVEVPGSE
FT                   EIYEADVVLLSMGFVGPELFEDPSVVKTKRGTINTVSDASYSVDDGKVFAAGDCRRGQS
FT                   LIVWAIQEGRKCATSVDSFLMGSTSLPGNGGIVKRDYRLLEELASTVEA"
FT   gene            complement(<390460..>390954)
FT                   /locus_tag="KLTH0B04730g"
FT                   /old_locus_tag="KLTH-ORF15330"
FT   CDS_pept        complement(390460..390954)
FT                   /locus_tag="KLTH0B04730g"
FT                   /old_locus_tag="KLTH-ORF15330"
FT                   /product="KLTH0B04730p"
FT                   /note="some similarities with uniprot|Q6Q543 Saccharomyces
FT                   cerevisiae YDL173W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04730g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21555"
FT                   /db_xref="InterPro:IPR022024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP4"
FT                   /protein_id="CAR21555.1"
FT                   /translation="MGSSFNISTGRGGAGNMVVSSEKPSPKIIPQGSQTPNILQPVFST
FT                   GRGGAGNMYKNVDTKLTRKAQDVDEISIAPEDDVIKAVESPLSLDQGRSAHSGDAQKGG
FT                   LRPKKSRSEHPQTVSIGRGGAGNILSPSNSRKSERGSKKSGKSGKQSKPGLWSKVKGFF
FT                   A"
FT   gene            <391353..>392171
FT                   /locus_tag="KLTH0B04752g"
FT                   /old_locus_tag="KLTH-ORF15327"
FT   CDS_pept        391353..392171
FT                   /locus_tag="KLTH0B04752g"
FT                   /old_locus_tag="KLTH-ORF15327"
FT                   /product="KLTH0B04752p"
FT                   /note="similar to uniprot|Q05775 Saccharomyces cerevisiae
FT                   YLR192C HCR1 Dual function protein involved in translation
FT                   initiation as a substoichiometric component of eukaryotic
FT                   translation initiation factor 3 (eIF3) and required for
FT                   processing of 20S pre-rRNA binds to eIF3 subunits Rpg1p and
FT                   Prt1p and 18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21556"
FT                   /db_xref="GOA:C5DCP5"
FT                   /db_xref="InterPro:IPR013906"
FT                   /db_xref="InterPro:IPR023194"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP5"
FT                   /protein_id="CAR21556.1"
FT                   /translation="MSWDDEDFDLPSSAKNEPVLASWDDEFAETNDDDDAVLESWDAEP
FT                   AAASAKKPTAPAKKPAAKKDKKDAAASKPLLEIDTLDESTRRELLRKAEVDSDLNNAAD
FT                   LFGGLGVAEEHPRARALRKQQEEEALTRPAALTKDTPLDTHPLFQAESKKEYQELRKAL
FT                   AAAITPLNERSALNYSSGLAIDLIRDVANPMSTESIRQTIATLNVLMKDKERQERLARL
FT                   AKVKGGTATGGAGKKKAKATRANLGGAFKKDQEFDLETPAFDDFGEDDFM"
FT   gene            <392485..>394206
FT                   /locus_tag="KLTH0B04774g"
FT                   /old_locus_tag="KLTH-ORF15322"
FT   CDS_pept        392485..394206
FT                   /locus_tag="KLTH0B04774g"
FT                   /old_locus_tag="KLTH-ORF15322"
FT                   /product="KLTH0B04774p"
FT                   /note="similar to uniprot|P32891 Saccharomyces cerevisiae
FT                   YDL174C DLD1 D-lactate dehydrogenase oxidizes D-lactate to
FT                   pyruvate transcription is heme-dependent repressed by
FT                   glucose and derepressed in ethanol or lactate located in
FT                   the mitochondrial inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21557"
FT                   /db_xref="GOA:C5DCP6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP6"
FT                   /protein_id="CAR21557.1"
FT                   /translation="MWRTGFSRSSQAWRRACTQYGRRWQSSKAWGSGASHRFAQRNSRM
FT                   ARVSVLAAGMAAVAGAGAASWNASVQNDEFSSTTRLDELQSPQYCHDADKFAEAVEKLK
FT                   KLLNNDEECFSVSKSDLDAHSDTYFNTHHATPEQRPRIVLYPHNTEEVSEVLKICHEYA
FT                   IPVVPFSGGTSLEGHFLPTRIGCTVTLDLSKYMNKIKKLNKTDLDVEVQAGVPWEDLND
FT                   FLNEKGLLFGCDPGPGAQIGGCVANSCSGTKAYRYGTMKENVVNLTAVLADGTVIKTKR
FT                   RPRKSSAGYNLNGLLIGSEGTLAVVTEATIKCHVRPAFENVAVGSFPTIADAAACTSRI
FT                   IQEGIQLNAMELLDDNMMRIVNKSGATYKTDWIEAPTLFFKVGGRNKKIIAELIHEVDR
FT                   IAQHHGCHKFEFAKDDDERLELWEARKVALWSVINDGKSRDPDVNVWTTDVAVPLSQFA
FT                   NVIGATKKDMDASGLQNAIVGHAGDGNFHTFLLYNDKEREKAGRLVDSMVKRAIDAEGT
FT                   CTGEHGVGMGKRGYLLEELGDAPVDFMRRLKLAADPKRILNPDKIFKIDPEDKEGH"
FT   gene            <394777..>395400
FT                   /locus_tag="KLTH0B04796g"
FT                   /old_locus_tag="KLTH-ORF15313"
FT   CDS_pept        394777..395400
FT                   /locus_tag="KLTH0B04796g"
FT                   /old_locus_tag="KLTH-ORF15313"
FT                   /product="KLTH0B04796p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21558"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP7"
FT                   /protein_id="CAR21558.1"
FT                   /translation="MLRSTASHALRIPSRLVATPAVYSSASRVCALHSSARVPKSLGEK
FT                   VRSTLSDLNKKVGEAAASGIDKAQEASHTVEEKSHTAAEATKHGLEQLNKKTGQAAASG
FT                   IDKAQNMAQEAGEKAQELKKRDLTQEAKGKAQELKDSDLAQEAKDKAQDLKEGAQEKAG
FT                   EAKGKAQELKHEGKGKAQELKHEAKGKAHEGAAKAKETAREYKD"
FT   gene            complement(<395490..>396632)
FT                   /locus_tag="KLTH0B04818g"
FT                   /old_locus_tag="KLTH-ORF15307"
FT   CDS_pept        complement(395490..396632)
FT                   /locus_tag="KLTH0B04818g"
FT                   /old_locus_tag="KLTH-ORF15307"
FT                   /product="KLTH0B04818p"
FT                   /note="weakly similar to uniprot|P80667 Saccharomyces
FT                   cerevisiae YLR191W PEX13 Integral peroxisomal membrane
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21559"
FT                   /db_xref="GOA:C5DCP8"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007223"
FT                   /db_xref="InterPro:IPR035463"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP8"
FT                   /protein_id="CAR21559.1"
FT                   /translation="MSTSVKQPRPKPWEAQGGQNTPMDDGAMITAGEAQGTRGEGAKAD
FT                   GNAAPEPPQKPAALGPENGVGARSGLGNAGTFLGSGGPYSSGYGGSLYGGGMGSMYSGG
FT                   YNSMYGGGYGSMYGGGYGSMMGGGYGAGGMYGMNNNGAQTLAESTQATFQLIEGLIGAV
FT                   AGFAQMLEATYMATHNSFFTMVSMAEQISSLKEMVGSFFGIFAAMKMLKRLLYKVTNGR
FT                   AGLAPARAAAGSKSPLVQEFAKFGDASAQAKRRRRMSWKPLLVFVAAVVGFPLLLRKFI
FT                   AKLSEIQQRRLGAGAVGAGAGGTLDPRNLEFARAVYDFTPENPQVEAALRKGDLMAVIS
FT                   KQDPLGNASEWWQVRTKKGDVGYVPSNYVELIRRTRSESS"
FT   gene            <396900..>396972
FT                   /locus_tag="KLTH0B04840r"
FT                   /old_locus_tag="Klth0B.tAla.AGC.7"
FT   tRNA            396900..396972
FT                   /locus_tag="KLTH0B04840r"
FT                   /old_locus_tag="Klth0B.tAla.AGC.7"
FT                   /note="tRNA-Ala (AGC) cove score=70.00"
FT   gene            complement(<397225..>398769)
FT                   /locus_tag="KLTH0B04862g"
FT                   /old_locus_tag="KLTH-ORF15300"
FT   CDS_pept        complement(397225..398769)
FT                   /locus_tag="KLTH0B04862g"
FT                   /old_locus_tag="KLTH-ORF15300"
FT                   /product="KLTH0B04862p"
FT                   /note="some similarities with uniprot|Q06324 Saccharomyces
FT                   cerevisiae YLR190W MMR1 Phosphorylated protein of the
FT                   mitochondrial outer membrane localizes only to mitochondria
FT                   of the bud interacts with Myo2p to mediate mitochondrial
FT                   distribution to buds mRNA is targeted to the bud via the
FT                   transport system involving She2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21560"
FT                   /db_xref="InterPro:IPR013712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP9"
FT                   /protein_id="CAR21560.1"
FT                   /translation="MNTPPMGAEKLTPKMSPTMLHLDDSLAPLANPSFMYLDESKSNYP
FT                   AMYRTSLSKLTERGRSGRGRTVEAKTPTKLLRSNSPIRAMLNNPPKMLKPEYIGISKLL
FT                   NNNNSSRVGSAVTPSMILTSSKLNFGNTKKASSEEVRQPTQTQEAKKQVVAPPPTPTPV
FT                   PQTEEPALPQATTASQQMPPPSAQPRTQKHPEPAVHSHHGEKVPQPKQRHHSQMLSHKD
FT                   SRGSKHARGLSSTSTAISGSTACELRTEHAAALPTPGSVEEIATKTPGYRFPSTTSTAS
FT                   SSSTFDLKEFPEALNLNFEVPNDKEEFVLATQSKRSSYISSIGSANEDDLNGWFAQYAE
FT                   DRQVSTLSMGDAQKEKALQTEHFSLRVKQLELQIAELRLQNEEMRHNITAHRTIQDRCM
FT                   FEALHDVQREKENTYKEMDRKMKQLEKQINNYRKVIQKLTNSTKTAPVSKPRIPMLDAL
FT                   ALDEISETRSSDGEEDEHVDDATIISELNPDERSASASQSPRKRPAGFNLSLTFEK"
FT   gene            <400193..>401914
FT                   /locus_tag="KLTH0B04884g"
FT                   /old_locus_tag="KLTH-ORF15294"
FT   CDS_pept        400193..401914
FT                   /locus_tag="KLTH0B04884g"
FT                   /old_locus_tag="KLTH-ORF15294"
FT                   /product="KLTH0B04884p"
FT                   /note="highly similar to uniprot|P00927 Saccharomyces
FT                   cerevisiae YER086W ILV1 Threonine deaminase catalyzes the
FT                   first step in isoleucine biosynthesis expression is under
FT                   general amino acid control ILV1 locus exhibits highly
FT                   positioned nucleosomes whose organization is independent of
FT                   known ILV1 regulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21561"
FT                   /db_xref="GOA:C5DCQ0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ0"
FT                   /protein_id="CAR21561.1"
FT                   /translation="MASKISSQELKMSSTLLTRTRPALVSRFLLRYQSSAVANLQKLHA
FT                   KLNPDELLPDSTPDYVRLILRSSVYDVIEESPITRGVGLSSRLNTNVQLKREDLLPVFS
FT                   FKLRGAYNMMAKLSEAQKNQGVIACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSIKYQ
FT                   NVSRLGGQVVLYGNDFDEAKTECTRISEERGLTNIPPFDHPYVIAGQGTVAMEILRQVH
FT                   NAAKIGAVFVPVGGGGLVAGVAAYLKRIAPHIKIIGVETYDSATLKTSLEAGTRTPLST
FT                   VGTFADGTSVRMIGEETFRICQDLVDDVILVNTDEICAAVKDIFEDTRSIVEPSGALAV
FT                   AGLKKYVTQVHPDVDHSKKTYVPILSGANMNFDRLRFVSERAVLGEGKEVFMLVTIPDV
FT                   PGSFKQLQRVIHPRAVTEFSYRYNEHRHSSASDVPKAYIYTSFSVVDREKEIKQVLQQL
FT                   HGLGFDAVDISDNEMAKSHGRYLVGGASKVPNEKIVSFEFPERPGALTKFLDGMSDSWN
FT                   LTLFHYRNHGSDVGKVLAGVSVSAEDNEGFQKFLDDLGYKYQDETNNMVYQKFLKF"
FT   gene            <402179..>403885
FT                   /locus_tag="KLTH0B04906g"
FT                   /old_locus_tag="KLTH-ORF15290"
FT   CDS_pept        402179..403885
FT                   /locus_tag="KLTH0B04906g"
FT                   /old_locus_tag="KLTH-ORF15290"
FT                   /product="KLTH0B04906p"
FT                   /note="similar to uniprot|P39965 Saccharomyces cerevisiae
FT                   YER087W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04906g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21562"
FT                   /db_xref="GOA:C5DCQ1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ1"
FT                   /protein_id="CAR21562.1"
FT                   /translation="MRPCLKTIVRNVHVYQTKSLTGDAVKASSTHNLLQSLGYIKQTQS
FT                   GLVHWLPLGLRTLNKITNIIKHRMETDGKAEEVSLSLLSPKSLWVHTNRWDNGELFKLK
FT                   DSKGSDYCLAPTCEEEITSLIGSYVTSYKDLPMTVYQVGRKYRDEKRPRGGLLRGREFL
FT                   MKDAYSFDASKEEAVRTFESMNHTYDLIFKDLGVPFVSAWADSGDIGGDMSKEYHYTHE
FT                   SGEDTVMACDSCGHISNVEKCSSFPVEDNQYSGDVSVRYALSEDRDTLVCLYYPQNRVL
FT                   NWNLVKAALDGDVDSSLRDTSNEKVLELFRANKSEDEMMLASVLRVMDCRLNSRSNYPD
FT                   FPLNQYLKSNFSQLSDASIVDAEAGELCGSCEEGHLSSKRSIEVGHTFFLGQKYSEPLN
FT                   AKFSTRENTEEYCEMGCYGIGVSRLVGAIAHVTRDDAGLRWPRAVAPYEISICAAKQDE
FT                   LVAEVEGLLSSWGREVWVNRDEKAGLGRKIAASHSLGIPVCVIVGKKSWPCVEIEVRAP
FT                   LVGERWRAELAQHGEAWGWTVQESAPVGGAAHHRVRKEHLKDVVGVILTDM"
FT   gene            complement(<403949..>404218)
FT                   /locus_tag="KLTH0B04928g"
FT                   /old_locus_tag="Klth0B.mRNA.pd.5.m"
FT   CDS_pept        complement(403949..404218)
FT                   /locus_tag="KLTH0B04928g"
FT                   /old_locus_tag="Klth0B.mRNA.pd.5.m"
FT                   /product="KLTH0B04928p"
FT                   /note="highly similar to uniprot|P52871 Saccharomyces
FT                   cerevisiae YER019C-A SBH2 Ssh1p-Sss1p-Sbh2p complex
FT                   component involved in protein translocation into the
FT                   endoplasmic reticulum homologous to Sbh1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21563"
FT                   /db_xref="GOA:C5DCQ2"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR030671"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ2"
FT                   /protein_id="CAR21563.1"
FT                   /translation="MSTPTPPGGQRTLQKRRQAQSVKEKQQKQTPASTRQAGFGGSSNS
FT                   VLKLYTDEANGLRVDPLVVLFLAVGFIFSVVALHVVAKVTGKLF"
FT   gene            <405537..>407279
FT                   /locus_tag="KLTH0B04950g"
FT                   /old_locus_tag="KLTH-ORF15281"
FT   CDS_pept        405537..407279
FT                   /locus_tag="KLTH0B04950g"
FT                   /old_locus_tag="KLTH-ORF15281"
FT                   /product="KLTH0B04950p"
FT                   /note="some similarities with uniprot|P34217 Saccharomyces
FT                   cerevisiae YBL051C PIN4 Protein involved in G2/M phase
FT                   progression and response to DNA damage interacts with
FT                   Rad53p contains an RNA recognition motif a nuclear
FT                   localization signal and several SQ/TQ cluster domains
FT                   hyperphosphorylated in response to DNA damage"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21564"
FT                   /db_xref="GOA:C5DCQ3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034069"
FT                   /db_xref="InterPro:IPR034186"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ3"
FT                   /protein_id="CAR21564.1"
FT                   /translation="MSDMPAATLQEPLMGNSAAMGGSVFAPRSPEDDVIPTAIVIKNIP
FT                   FAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFATTDETTQVVHSLNGKEIG
FT                   GRKLRVEYKKMLPQAERERIEREKREKRGQLEEQHRATSALSLHSLNKSPNVASGPAAA
FT                   AGSNANTNETAGGAAAGSAAASTSGPTQSASQALSNPASSQMFNDFGSSGGANATGGPI
FT                   NSVLSSQPAMSSQPLLSAQNTATSMVLPPALPVGSSERYYAPLPASNNLPLPPQQLDFN
FT                   DPDTLELYSQLLLFKDREKAYHELAYPVGLSASHKRVINVLCSFLGLVEVYDPSFIIIR
FT                   RKVLDHAALQSHLQQEGQLSLMQPLQPSSTGGSGMSRSHSYTSLLQAHATAAAAAVNSV
FT                   GGQSQHIPPPSQSPLLQPTAIHQMESQHQQQQSLLRQQATQTPSSSILQNRIPTGYATK
FT                   HTTPSGMNNPLLRNAGVSPTTGQVQPNTVQRMPSFYSQAPSTPNLSDNRYGSTQNLVPQ
FT                   HTNGSVHSNYSVHSFHDPSAADPQNHAMMYSSVSQLGIGPELEGDLSRSLSGLDLQGKK
FT                   NLWG"
FT   gene            <408153..>409235
FT                   /locus_tag="KLTH0B04972g"
FT                   /old_locus_tag="KLTH-ORF15272"
FT   CDS_pept        408153..409235
FT                   /locus_tag="KLTH0B04972g"
FT                   /old_locus_tag="KLTH-ORF15272"
FT                   /product="KLTH0B04972p"
FT                   /note="highly similar to uniprot|Q04894 Saccharomyces
FT                   cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
FT                   dehydrogenase family member with broad substrate
FT                   specificity may be involved in fusel alcohol synthesis or
FT                   in aldehyde tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21565"
FT                   /db_xref="GOA:C5DCQ4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ4"
FT                   /protein_id="CAR21565.1"
FT                   /translation="MSYPEKFQGIAVQDHNDWTHPKKISYEPKKFDDYDVDVEIEACGI
FT                   CGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKCHTGVKVGDRVGVGAQVSSCLDCD
FT                   RCNSDFEPYCAEFITTYSQPYPDGYVSQGGYASHIRAHEHFVIPIPEKIPTHLAAPLLC
FT                   GGITVFSPLINNDCGPNKKVGIVGIGGIGHMGLIFAKALGAEVYAISRSSAKKEDAMKL
FT                   GADHFIATKEEPDWEKKYASTLDLVIVCASSLTEINLEQLIKTMRIKGRIISICVPKET
FT                   EELNLKPFQLSGITIGNSQLGSRKELIQLLQLVADKDLKIWVETLPISEESVHDAFVRM
FT                   EKGDVRYRFTLTDFDKEFRN"
FT   gene            <409558..>411780
FT                   /locus_tag="KLTH0B04994g"
FT                   /old_locus_tag="KLTH-ORF15270"
FT   CDS_pept        409558..411780
FT                   /locus_tag="KLTH0B04994g"
FT                   /old_locus_tag="KLTH-ORF15270"
FT                   /product="KLTH0B04994p"
FT                   /note="some similarities with uniprot|P34218 Saccharomyces
FT                   cerevisiae YBL052C SAS3 Histone acetyltransferase catalytic
FT                   subunit of NuA3 complex that acetylates histone H3 involved
FT                   in transcriptional silencing homolog of the mammalian MOZ
FT                   proto-oncogene sas3 gcn5 double mutation confers lethality"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21566"
FT                   /db_xref="GOA:C5DCQ5"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037995"
FT                   /db_xref="InterPro:IPR040706"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ5"
FT                   /protein_id="CAR21566.1"
FT                   /translation="MGSKDVNSQRHQRLLRNIEITDNVHAVTANEIARNPDGYARQTRA
FT                   KLAYHPRDEKTELQVKPNLQWSLPDDAKEANALSSHVEFIKVDPVRGTFNKHIVKLRYD
FT                   PRKLLSFDNLINNAAPDPQKYHVDFEIREPETLFNRIDNECSKPYRCAIGDRRDYSTQR
FT                   TTPSLKDREFFQSLLHKAAPASYYNGNLLLAFNEAEEREITNPKKNKSRKAPSKIEYIY
FT                   FRDHEIKTWYTAPYPEEFNKNKILYICEYCLKYMNSRYVIHRHQLKCSLRHPPGNEIYR
FT                   EGNISIWEVDGRENVIYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLTEREDTGEESQFH
FT                   FVGYFSKEKLTSTDYNLSCILTLPIYQRKGYGHFLVDFSYLLTRREYKWGTPEKPLSDL
FT                   GLLSYRNFWKTKICEVLGELKEEINHAEKKGEILHCSIEDLSNLTGMIPTDVVFGLEQI
FT                   GALHYYKGESKLQFAIKIDNWSLIDEVNNARKSKGYRALVPEKLVWKPMIFGPSCGINA
FT                   MGTMIETTTGAARSTATGQQNGIDTFKNSVSVLVNFLRDDIEDPRSMEAICQQKIHDQQ
FT                   GRHFDTSKINLMTLAFNAPVSRRLKNSASSLVSVPNRYDDNETNNNTFSAPNGGADLGI
FT                   VDPELLEETEQIDEEDEDNDLNETLADGDTIGDEEVKFSSTSEDEEEDEDEEIPGRGVS
FT                   SSQGRFSRTRSGRAINSHRVIDSDEHEEEHIATRRLRSMDPLLKNL"
FT   gene            complement(<412037..>413824)
FT                   /locus_tag="KLTH0B05016g"
FT                   /old_locus_tag="KLTH-ORF15268"
FT   CDS_pept        complement(412037..413824)
FT                   /locus_tag="KLTH0B05016g"
FT                   /old_locus_tag="KLTH-ORF15268"
FT                   /product="KLTH0B05016p"
FT                   /note="some similarities with uniprot|P40059 Saccharomyces
FT                   cerevisiae YER088C DOT6 Protein of unknown function
FT                   involved in telomeric gene silencing and filamentation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05016g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21567"
FT                   /db_xref="GOA:C5DCQ6"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ6"
FT                   /protein_id="CAR21567.1"
FT                   /translation="MTTSKSAVSLAGAGGGLVAQSKNPSSWDPQDDVLLRHLKEIKKLG
FT                   WKDIAQYFKNRTPNACQFRWRRLKSGNLKTAGRPGEAPAVADAVGVAPAAGTQPAAATP
FT                   QAGAAAAAAVPHDLGQPVHPALLAATAAPASEAYPPRALSQPALGPLPNAGTLSAVPAP
FT                   SPAPHQPAVAAFPLRPTLTGATLANAQSRHSLQPAPGAGKFAKPRSYSHTMAPPSGFAM
FT                   ASASAPFSAAASVVTSNSTGHVPTIDVNESQDENLGLIPKVLVRSRRSSVAQQSLLPSS
FT                   STPNLSLALHTTLTTSKLRKNSFSSRPRRSSFNMAPPDRVFSTPSRRSSVVQAPSSIAS
FT                   ISRRESFNSSNSRRGSAIQTRRESFAHSTLDRRESVSNYTDIPKAPLQNFAPANASSLH
FT                   QATYPTEMKDWSLDEDKLLSGRQENHLSMDELSILLPHRSEQEIQWRIGALDKSTYSSS
FT                   SDSPLDSPERSLTEDIAVDEEGGEAVDDASRNPSQTPFNIKKEVSPSLSASSGSNDREH
FT                   SPVFSPRPVNRDQSPTTFDSSFRPNIVVNKSVGGSSYNCSPGLDGHRNPSFPPAAEPMA
FT                   PGSHGAQLPSLNSIFKNIL"
FT   gene            <415138..>416868
FT                   /locus_tag="KLTH0B05038g"
FT                   /old_locus_tag="Klth0B.mRNA.296.p"
FT   CDS_pept        join(415138..415176,415852..416868)
FT                   /locus_tag="KLTH0B05038g"
FT                   /old_locus_tag="Klth0B.mRNA.296.p"
FT                   /product="KLTH0B05038p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21568"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ7"
FT                   /protein_id="CAR21568.1"
FT                   /translation="MPLSMIEALSCSALTGFCKSDFDRVVEALKIPSYIGAYSFDAFEC
FT                   FFIFIARLKSGCTYTVLTSLCGREASTISRIITFVTCYLFHIASPCLSVTNASWLADRL
FT                   ANIDQSLLSSSRSISNSRIVGFIDGTHVKIARPHGNARLECVAYSGHKKTHTLKYQAVT
FT                   TPDGICIDLAGPFAGSQHDSFLFTNSGLYRRLKPALKVGGIQYRIFGDPAYRSSDLLTV
FT                   GYKGQNLTNGQKEYNTILSGSRVSIEWFFGEVKNNFQIFNILGRLKVGGVRFCGAYFTI
FT                   AVFLTNLKHCLEGSQGSKYFNISPPRFEEYMNGLKFPQYFDGFLIDVNGTSSFFSKQYE
FT                   HLSFDRLGNIL"
FT   gene            complement(<416976..>418274)
FT                   /locus_tag="KLTH0B05060g"
FT                   /old_locus_tag="KLTH-ORF15253"
FT   CDS_pept        complement(416976..418274)
FT                   /locus_tag="KLTH0B05060g"
FT                   /old_locus_tag="KLTH-ORF15253"
FT                   /product="KLTH0B05060p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ8"
FT                   /protein_id="CAR21569.1"
FT                   /translation="MESGKRQSINSPARPAPREISCSETLLNDGDDDAQANSTEIDNHD
FT                   METGRDVSPSPRNLVGTTSHDEMQQEQLYLEYFHSAIITEELGLIKHLKRAHGKMIKAI
FT                   QELIRVKGYRSADSGKEYRFKWTDNATYYLLKYCLEIGPFYGFEHLKRPSLTKLEQSSL
FT                   ISLKWSCVWYDLLMTLEFENSIIPTESQIKSKCRYLLDNAHPKLFAVTTGDERNPFSFT
FT                   GVDKVDNNLEMLTRLKNDAEQRKVEIQKLETDRQNNKRTLGQMLCSNSIPSVTEGLSNS
FT                   DSEEPSSIDDINQPNSITMRRNKRMGRLLDFKEIAQYSLSNSALVGDLQETLKELIEAA
FT                   AVEERKYKDKEQQRKDQELALKQKKLEISLQHNQRMLELELERQKREQFDHDAKKIDTL
FT                   VKMMDRAKSLEGDKSPSSEALQKLLHNFVSRYT"
FT   gene            complement(<419442..>420332)
FT                   /locus_tag="KLTH0B05082g"
FT                   /old_locus_tag="KLTH-ORF15246"
FT   CDS_pept        complement(419442..420332)
FT                   /locus_tag="KLTH0B05082g"
FT                   /old_locus_tag="KLTH-ORF15246"
FT                   /product="KLTH0B05082p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21570"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ9"
FT                   /protein_id="CAR21570.1"
FT                   /translation="MALKVGFIPEHFATPLCFAKTVGFFEDQGVEAELIPYPSGSGHLI
FT                   QSLNAGELDIAIGLTEAFVRGIADTEPGQKPQYQIAGTYVKSPLEWCVSTGANRDDLQD
FT                   LKALDGRRIGVSRIGSGSHVMSYVMALQLDFTKPFADFPVLDNFDNLRAAVNSGDADAF
FT                   MWEYYTSKKYLDSGEIKMLGHVESPWPSWVVVKRVDLDLGVFGRFVFAINSGIDYFNKN
FT                   PDEAVRFITENFGYSEEDAASWFKTVKFHDNCGDINDLHGVVTGTLHILGTAGVLQNKD
FT                   EVVIEENLRVGTLTG"
FT   gene            <420999..>423680
FT                   /locus_tag="KLTH0B05104g"
FT                   /old_locus_tag="KLTH-ORF15241"
FT   CDS_pept        420999..423680
FT                   /locus_tag="KLTH0B05104g"
FT                   /old_locus_tag="KLTH-ORF15241"
FT                   /product="KLTH0B05104p"
FT                   /note="similar to uniprot|P53550 Saccharomyces cerevisiae
FT                   YNL118C DCP2 Protein required for the decapping of mRNAs
FT                   functions to allow the production of active Dcp1p contains
FT                   a pyrophosphatase MutT motif and several alpha- helical
FT                   leucine-rich motifs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21571"
FT                   /db_xref="GOA:C5DCR0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR007722"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR036189"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR0"
FT                   /protein_id="CAR21571.1"
FT                   /translation="MSLPLRRPLESVTSLDRVLEDLIVRFIINCPPEDFSSVERELFHV
FT                   EEATWFYTDFVKLMNPKMPNMKIKSFAQHVIKLCPMVWKWDVRAEQALQKFSQYKRSIP
FT                   VRGAAIFNRSLTKLLLVKGIESESWSFPRGKISKDEGDVDCCIREVLEEIGFDISDYID
FT                   EDQFIERTIAGKNYKIFLVSGVPEDFDFQPQVRNEIEKIQWHDFKKLSRNNGNKQHVKI
FT                   YLVNTLMRPLAMWVKSHRQIDNDDKLKAHVETQLKLLLGIKKEETPDPGRELLNMLQSS
FT                   VAAPQEALAAAPQSPSELPPSSKSSQDSTPATNAAPPMKSPPPQLHHNFPFMLFQPFAP
FT                   FPFMAGAGMQTGGPVPGLDTSSSNSVQTQPPPTPSMNTLAKPTVAEEEEEEEEQQQQQR
FT                   DSQQFQLLEPPRPQSTTSKQLLDLLNRKSSEKAEPTEQQTTKPKFKILKRGESLTPTPS
FT                   APQNDNEADSKALLNLLKKPQEPSITRETEDAQPTTMIEKPIATPLEDLPHEEEASLHF
FT                   ANTHSAAAASESEYEDFESSSEEEDIGNDEEEAKASSLKGEGNFGQKFEHTSTNPNVGY
FT                   GHDQTRISGPMQGLKEQSSGAADVPHKDSSNLSEQSTGGTFITQSSKSQTKPKIKLLKR
FT                   GESLKDMIFTNGNKTLETSEASHVVKTTSHEGESNELLKLLKKDAISSTADFTNAEAAI
FT                   HRDSTSARRGTEGSSPLSTTVNQHVTPGQQPISSALTGSDDAKDLLNILHRKNQASQSY
FT                   QLQSTPEIQQALCTVDTSRGNSSMAAGDFLNMLPNGSSVSSPTAAGNFLPGMEAQFRNP
FT                   YYNQYPTSSGVPIPPQFPVQPPYAQSPPQNQNSSQQLLGMLKNPHAGIAASPAVNSAST
FT                   SDTPFVSEKGASHELLSLLQRR"
FT   gene            complement(<423735..>425168)
FT                   /locus_tag="KLTH0B05126g"
FT                   /old_locus_tag="KLTH-ORF15236"
FT   CDS_pept        complement(423735..425168)
FT                   /locus_tag="KLTH0B05126g"
FT                   /old_locus_tag="KLTH-ORF15236"
FT                   /product="KLTH0B05126p"
FT                   /note="similar to uniprot|P53923 Saccharomyces cerevisiae
FT                   YNL119W NCS2 Protein with a role in urmylation and in
FT                   invasive and pseudohyphal growth inhibits replication of
FT                   Brome mosaic virus in S. cerevisiae which is a model system
FT                   for studying replication of positive- strand RNA viruses in
FT                   their natural hosts"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21572"
FT                   /db_xref="GOA:C5DCR1"
FT                   /db_xref="InterPro:IPR019407"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR1"
FT                   /protein_id="CAR21572.1"
FT                   /translation="MGINQLCKRCKTAEAAVVSRKEPFCIACFRKFVSLKQRKQMMSDQ
FT                   YFQDIFKVMYPDKKKTAEEAERLNQGSRILVPLSFGSSSIVMLDVLNDTLTEQREMHRG
FT                   KTGFRIDVLVCYLKDDLEELKRKAEALMTVKLRDNKNSVKVHLVDIESSMNSPDFTRIH
FT                   LQDSTYMVRNASVSANEAQSVKELLSSCSNRSAREDLLNIIKTAIIKRFGVQGGYKAIL
FT                   WGHSTTRLADEIMSLVVKGRASQIANALNDSEEDFEYGEPLRNLHPMRDILLSEIDAYC
FT                   FVSDLTQYLHKYKPQDTLLVNKIPVAPDAQPPRAKLTKNMTINELARQYFDGIEGSYSN
FT                   VISTVVRTGAKLDDPENSLKSKVRCGICNNTVFCDGSHWLRNITVTSSHPIEDAEEEAM
FT                   FRAWSASEQGKVRGEYLKLTSEMEISGHEFPVCYGCILTLGEVKHKSLIWPSSQSNSVE
FT                   SVIEDFIISDESDSEHEGH"
FT   gene            <426037..>426372
FT                   /locus_tag="KLTH0B05148g"
FT                   /old_locus_tag="KLTH-ORF15234"
FT   CDS_pept        426037..426372
FT                   /locus_tag="KLTH0B05148g"
FT                   /old_locus_tag="KLTH-ORF15234"
FT                   /product="KLTH0B05148p"
FT                   /note="similar to uniprot|P38824 Saccharomyces cerevisiae
FT                   YHR116W COX23 Mitochondrial intermembrane space protein
FT                   that functions in mitochondrial copper homeostasis
FT                   essential for functional cytochrome oxidase expression
FT                   homologous to Cox17p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21573"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR2"
FT                   /protein_id="CAR21573.1"
FT                   /translation="MEKEPKTAPAENADPQLQVDKTKVDYAPKNTESGSFKFYPDNPES
FT                   SFNKYRFAAKDASQFYDPCQESSKMSMKCLELNNYDRSMCQEYFDAYRECKKQWLQARR
FT                   RNRSQWE"
FT   gene            <427608..>429389
FT                   /locus_tag="KLTH0B05170g"
FT                   /old_locus_tag="KLTH-ORF15233"
FT   CDS_pept        427608..429389
FT                   /locus_tag="KLTH0B05170g"
FT                   /old_locus_tag="KLTH-ORF15233"
FT                   /product="KLTH0B05170p"
FT                   /note="similar to uniprot|P07213 Saccharomyces cerevisiae
FT                   YNL121C TOM70 Translocase of Outer Mitochondrial membrane
FT                   70 kDa mitochondrial specialized import receptor of the
FT                   outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21574"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR3"
FT                   /protein_id="CAR21574.1"
FT                   /translation="MSSDNSFGQFVARNKTAIVASVAAGATAVGAYYYYQQLQRQPANK
FT                   KEPESESKSSKKKKKTKKKAPGPSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNE
FT                   FFKNKKYDEAIQYYSWAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSK
FT                   CLLRRASANESLGNFADAMFDLSAVSLYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQ
FT                   QEYKLPSNTSLASFFGIFQPETTFENYDDNSEADKYLLEGLTNLYKRTADGYETADLSF
FT                   AKARDAFKVLLEQNPEDADLKRKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPN
FT                   TYIYMALIMADKGQATEYFDNFEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKA
FT                   KELSESNIFPYIQLACLTYREGKFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLA
FT                   GARKQYDIAAKLEDALDGIHVGVSPLIGKATLLSREPSVENFVEATQLFEKACQNDPRS
FT                   EQAKIGLAQLKLQQEDIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPVV
FT                   SAKIEETLAAYRAQGMI"
FT   gene            complement(<429511..>429930)
FT                   /locus_tag="KLTH0B05192g"
FT                   /old_locus_tag="KLTH-ORF15231"
FT   CDS_pept        complement(429511..429930)
FT                   /locus_tag="KLTH0B05192g"
FT                   /old_locus_tag="KLTH-ORF15231"
FT                   /product="KLTH0B05192p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21575"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR4"
FT                   /protein_id="CAR21575.1"
FT                   /translation="MSFELQILNDVLDWARAPGGPAGDYIHPSHVSLWSYPREKAFQVH
FT                   EGNNNPSSARYGFDSPYGGLVTLESLYKERVDSSGKNYKIESGTSVENFTRKRKFEASA
FT                   EDDFFHLQKDIGVRERSFKKPRGYACKNCCMYSHI"
FT   gene            <430231..>430506
FT                   /locus_tag="KLTH0B05214g"
FT                   /old_locus_tag="KLTH-ORF15230"
FT   CDS_pept        430231..430506
FT                   /locus_tag="KLTH0B05214g"
FT                   /old_locus_tag="KLTH-ORF15230"
FT                   /product="KLTH0B05214p"
FT                   /note="some similarities with uniprot|P53921 Saccharomyces
FT                   cerevisiae YNL122C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05214g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21576"
FT                   /db_xref="GOA:C5DCR5"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR5"
FT                   /protein_id="CAR21576.1"
FT                   /translation="MLSNLMRSIMSYGRQITQLQQPFMMQTRNLMKTHKGTAKRWRKTS
FT                   TSYKRGRAGRNHGNAGWGKSTLKSLDGKTLAHPTHIKHLKRLLPYN"
FT   gene            complement(<430626..>433568)
FT                   /locus_tag="KLTH0B05236g"
FT                   /old_locus_tag="KLTH-ORF15228"
FT   CDS_pept        complement(430626..433568)
FT                   /locus_tag="KLTH0B05236g"
FT                   /old_locus_tag="KLTH-ORF15228"
FT                   /product="KLTH0B05236p"
FT                   /note="highly similar to uniprot|P53920 Saccharomyces
FT                   cerevisiae YNL123W shows protein sequence similarity to the
FT                   mammalian Omi/HtrA2 family of serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21577"
FT                   /db_xref="GOA:C5DCR6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR025926"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR6"
FT                   /protein_id="CAR21577.1"
FT                   /translation="MSLNAKRTHSELSDSECNGRTKLQAANGGHFDSSDEEVSFVEEEI
FT                   VEEPINNAQWQTTISKVVSSVVSIHFSQVAPFDCDSALVSEATGFVVDSELGIILTNRH
FT                   VVGAGPFVGYAVFDNHEECDVIPIYRDPVHDFGFLKFDPKNIKYMQVCALELKPSLAKV
FT                   GSEIRVIGNDAGEKLSILAGFISRIDRNAPDYGELTYNDFNTEYIQAAASASGGSSGSP
FT                   VVNIDGHAVALQAGGSTEASTDFFLPVNRILRALNCIRAKKAVTRGTIQTQWILRPYDE
FT                   CRRLGLTPDREADARKQFPDRIGLLVAETVLREGPGDNKIKEGDTLISINGELIASFIQ
FT                   VDDILDRSVGQTIELLIQRGGKDIKVSCEVGDLHAITPSSYLEVCGATFNELSYQMARF
FT                   YAIPVRGVFLSSASGSFNFDSKEKVGWIVDAIDNQETPTLETFIEVMKKVPDRKRVTVR
FT                   YHHLTDQHSPHVASVYIDRHWCSEFRIYERNDTTGIWDYKNVADPLPPLPEVSHEAKFI
FT                   DLSIDNKQLAKLSRSLVMVSSISPIPLDSLSAEPRKASGLVVDANQGYVVVSRRVIPHD
FT                   CLDVFVTIADSVILPAEVTFLHPTQNYAVVKYDPALVLAPVETPKLSFARMKRGDKAHF
FT                   IGYTHNNRLVSSDTKVTDISSLSVPSNLIPRYRATNLEAIGIDCNVSSRCNSGILADDD
FT                   GTVRALWLSFLGEIQDGKEKVYLMGLDMADLKSVIDLLKEGKKPRINIVDAGFGSISVA
FT                   QARIRGVPEEWISKMEQESENRLQFMNVTRVSFTNEKDKLYPGDVILCVGGKLVKEMRD
FT                   LDGIVTSGEGANEEQVLEFKLVRNGKIVDLSVKTREINETSHFAIFAGCILQAPHHAVL
FT                   QAMMDIPSSVYCTFRGQSSPATQYGIAATNFITHINEIETPDLDTFVKVVKTIPDNTYC
FT                   KIRLVTFDNVPFAISLKTNYHYFPTAELKKDPSSGKWIENELNKTDARSD"
FT   gene            complement(<433847..>435127)
FT                   /locus_tag="KLTH0B05258g"
FT                   /old_locus_tag="KLTH-ORF15224"
FT   CDS_pept        complement(433847..435127)
FT                   /locus_tag="KLTH0B05258g"
FT                   /old_locus_tag="KLTH-ORF15224"
FT                   /product="KLTH0B05258p"
FT                   /note="similar to uniprot|P38826 Saccharomyces cerevisiae
FT                   YHR118C ORC6 Subunit of the origin recognition complex
FT                   which directs DNA replication by binding to replication
FT                   origins and is also involved in transcriptional silencing
FT                   may be phosphorylated by Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21578"
FT                   /db_xref="GOA:C5DCR7"
FT                   /db_xref="InterPro:IPR008721"
FT                   /db_xref="InterPro:IPR016811"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR7"
FT                   /protein_id="CAR21578.1"
FT                   /translation="MSTQQVRRCVCDILSIEFDDPKNDWSQGRLKKLQTTTSTLYNVSL
FT                   SKVMLKQHEETARGHLCAFIAAEKLSEKYEPDLRYRRDKIPLEPRQATKLLDILKSSIL
FT                   TSSPVKSIGWSPSPVKQRSPVKNGGRFTAMDPKEMRKQLFGTPTKANLPPKALENQQTA
FT                   SPEPATEDEANKIRTTRRKLTFEVEDAEDERDLTLASRKVNSASSGEGEVREGTRYAEV
FT                   ENSSMPVTPRKRSASASAKTPSPKKRRIPDRGDAPNSARACLLYKKYYKMTAAEIVELC
FT                   NHFEIPSDLAYRILDQFFEHATYLVFPFQLVCGLILNCCQVIFNEKRRKDPRVNEYLYQ
FT                   KMSLLMKTNDVTEIKESMRIVRELIDGEKWYRNLKVQYDYFDGVVYEEAIAIRLGNMLQ
FT                   RATNIATDEQFEIWKHNIITDISLRDG"
FT   gene            <435558..>438518
FT                   /locus_tag="KLTH0B05280g"
FT                   /old_locus_tag="KLTH-ORF15220"
FT   CDS_pept        435558..438518
FT                   /locus_tag="KLTH0B05280g"
FT                   /old_locus_tag="KLTH-ORF15220"
FT                   /product="KLTH0B05280p"
FT                   /note="similar to uniprot|P38827 Saccharomyces cerevisiae
FT                   YHR119W SET1 Histone methyltransferase subunit of the
FT                   COMPASS complex which methylates histone H3 on lysine 4 and
FT                   is required in transcriptional silencing near telomeres
FT                   contains a SET domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21579"
FT                   /db_xref="GOA:C5DCR8"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017111"
FT                   /db_xref="InterPro:IPR024636"
FT                   /db_xref="InterPro:IPR024657"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR8"
FT                   /protein_id="CAR21579.1"
FT                   /translation="MSDYYGRGYDSPYQRYSRGHNGRRAGRRHGGRPPKRESHQYGYSR
FT                   RDEYLHGETYFPPSSRMSKPVNAVVEPLRPKPQLRFNNDSFREKYHYFDPVSEKLLHRD
FT                   EMKSWASEKLPKTGYVIVQDQSKDKTRAVMKPRCPDQKAVDPRSQSSPSPESGVYRKRR
FT                   NQLVSLPRLVYDKHSVGPPPPNEIVVYPVFRDHSSAVQDIAIKNYFSTFGEISHFQSFN
FT                   DPISALPLYVYVVRYTGPPGNLDAPFRAAYKAAKTFENSHYFVSGFKFAVSINRANYSQ
FT                   KIVDGFIQDNIKQAAKIKKEVERQNSQKQISSGPQAKRLPRDLERVVNGRPSLLVLKRF
FT                   ISIHGLTVEDFKIKLAKYKFSRVLNHSTGIYIVFNDISDARACMFVENDVLAMPSKRRR
FT                   TPVKVRFSLIESQPSIVATVKRDGLRDQKKTYASEEQLLETAADLIIDELGRALDRDIK
FT                   RRVIGPLVFDSLNPANYPAITAKKDEEEERKSEQRRVAAEQKQDQQSKSASFDIFNLYG
FT                   ARFRKKNYIKSQIGEQSEPEYESKLKFSSSLKDSGQEKPMAHLLNESSRSNTPLAAENF
FT                   KSDDEQAQSAVEDDEDEEGFSDVSELPEKKIKTGSSEATTPETESNKYVLNSSRIQELL
FT                   RIPEKYRPDASEEPKTIYPQDDFDSYEFSSVSLGDFQRAVKDEEDFETLKNILNPPSSA
FT                   LSSNEEYILHSLVHEVSTEAEERHKVSKLQTSANEVPFDESLRSSAGSFKAGGFKKIPD
FT                   KLKNCYLPHRRKLHQPLNTVYNHQDTPEAVTDVHRNESEKLDMDAHAQEVSSSRVNRAI
FT                   NRRFQQDIEAQKAMIGSESELLTLNQLTKRKKPVTFARSAIHNWGLYALEPIAAKEMII
FT                   EYVGEILRQPVAEMRERTYLKSGIGSSYLFRVDESTVIDATKKGGIARFINHCCDPSCT
FT                   AKIIRVGGRKRIVIYALRDIAANEELTYDYKFERETDDEERLPCFCGAPTCKGFLN"
FT   gene            <438719..>441667
FT                   /locus_tag="KLTH0B05302g"
FT                   /old_locus_tag="KLTH-ORF15217"
FT   CDS_pept        438719..441667
FT                   /locus_tag="KLTH0B05302g"
FT                   /old_locus_tag="KLTH-ORF15217"
FT                   /product="KLTH0B05302p"
FT                   /note="similar to uniprot|P25846 Saccharomyces cerevisiae
FT                   YHR120W MSH1 DNA-binding protein of the mitochondria
FT                   involved in repair of mitochondrial DNA has ATPase activity
FT                   and binds to DNA mismatches has homology to E. coli MutS
FT                   transcription is induced during meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21580"
FT                   /db_xref="GOA:C5DCR9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR9"
FT                   /protein_id="CAR21580.1"
FT                   /translation="MGRFLSYTKRLSIPNAGILGYCAARPKTGSLLSHLSGNIHQERRC
FT                   FSSVPSTEKLTVPIEHGPGTANADASRLNIELGLPLDNKSIKRSNRGNRTIKNSLPPSL
FT                   QYVRDTMDKYKDFVVLTQMGSFYELYFEHADIYAPKLNLTLTSREYAHGKVSFAGFPVQ
FT                   QVNRHLKVLVKELGYSVAIADQFKRTSAASNESNRFLRRVTRIVTPGTFLDEAFENLQE
FT                   NTYLLSIEFPESCVQKLVDINMKVGLCWCDISTGEIFVQQTLLKDTISAVARIGPREIL
FT                   LDEELFSFKLEEGEWYPEFVELKRFFIKYQKMPSNHRSMNTFRYLFNSGYLEGDFFRLE
FT                   NVLHDFSQKEVAALRNMLLYIEEHLPDTAVNLQEPQRQLTNSLMQIDSRSCSALEITST
FT                   MRANTKKGSLLSAIKRTVTPSGSRLLSQWLSAPSLDTAEIKRRQQLVTLFRNNHELTEL
FT                   LIRTLKQTYDMPRILQKFSFGKGDATELLQLSHSLQKAEFIGKSIKAKCRTKQGVLGNI
FT                   LSSVISPLEYDKQLIGRVLSSLDEDQLMKFTMLQSESESELCEKDQNLEKKDVDAFGES
FT                   SLWVIRPGAGTRISELHGKHQELLKRRRELCNRFESTISDSVQVKGVQLRLRHTGEYGL
FT                   YISATSTNIKLLCSLVKDGMLFRGSPLKILQKSSQSCWLDHRLWTELGQELEYIVMKIK
FT                   REENIVISSFKKEFIKKSFSIRRVSQVLDYLDVLTSFAKLSTEKNLSCPVVDTSSDLDI
FT                   KSGRHIVVEDGLLSKSLQKFTSNDCRLEASNLWVITGPNMGGKSTFLRQIAIIVIMAQI
FT                   GSYVPCESAKIGVVDKIFSRIGSADDLYNQMSTFMVEMTETGYILKGATKRSLAILDEI
FT                   GRGTSGKEGISLAYAALKYLVDRNQCRSLFATHFGQELKTLVDNHCDEAVRKKISYYRS
FT                   GVYDTGGDDFCYDHSLTPGICNNSDAIRVAMRAGFPKEALDNARKALKLSDT"
FT   gene            complement(<441709..>443148)
FT                   /locus_tag="KLTH0B05324g"
FT                   /old_locus_tag="KLTH-ORF15215"
FT   CDS_pept        complement(441709..443148)
FT                   /locus_tag="KLTH0B05324g"
FT                   /old_locus_tag="KLTH-ORF15215"
FT                   /product="KLTH0B05324p"
FT                   /note="some similarities with uniprot|P53919 Saccharomyces
FT                   cerevisiae YNL124W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21581"
FT                   /db_xref="GOA:C5DCS0"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="InterPro:IPR040309"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS0"
FT                   /protein_id="CAR21581.1"
FT                   /translation="MCVDTFSKALLNPEEKPTGIEDNVDVGEISSDEEAENVTHSAEAT
FT                   AAVEESERTSSGESSMLNGAHEVSKSQVSEELPSLDAGEGSSSSEDEDSDDSSSSSSKE
FT                   EGFLIDGLDEEDEEGDTVHGPIKSKNELNEEPIFEIPEDFELGPDTPIREIGFIKSAFD
FT                   YNIIVQSVSSAEQRVLKENSLLCLEDRQILGPLCEVFGPLQSPFYRVLLPKSKNEQFEA
FT                   LRSKAGAKVFYVAPEAHWLDTFELKRMRGTDASNGFDEELPEDEQEFSDDEKEAEFKKL
FT                   KKNSRKRKNENATNVGPIPSKKSVNSAHSKPKPRQVASAAFEYASSSSSYKPRNERQHE
FT                   TSRSTSAISQSQGSYPQQQHVPTPQPQYASQQTFGYPQQVYASHQMYSPPPQPAVQQFG
FT                   NPFTHPYSQYPQMLPPQHLMPHPQHLPQHPQGQFPGSYPYTQAQSPPQQPVAAQTQNMD
FT                   QVLQLQQILMNQQRQHQNQSQ"
FT   gene            complement(<443928..>446447)
FT                   /locus_tag="KLTH0B05346g"
FT                   /old_locus_tag="KLTH-ORF15212"
FT   CDS_pept        complement(443928..446447)
FT                   /locus_tag="KLTH0B05346g"
FT                   /old_locus_tag="KLTH-ORF15212"
FT                   /product="KLTH0B05346p"
FT                   /note="similar to uniprot|P53540 Saccharomyces cerevisiae
FT                   YNL126W SPC98 Component of the microtubule- nucleating
FT                   Tub4p (gamma-tubulin) complex interacts with Spc110p at the
FT                   spindle pole body (SPB) inner plaque and with Spc72p at the
FT                   SPB outer plaque"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21582"
FT                   /db_xref="GOA:C5DCS1"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS1"
FT                   /protein_id="CAR21582.1"
FT                   /translation="MELENEVSLVISELVSTSLPLALLRPLIKDIIAILNSPAASGEGV
FT                   SMILKKYRGLADIGQENLPKWQKLENVLRLIASSSSSEEALAYVRFVRTVLDEAPQRSP
FT                   FNGPAPPLSFNSLEKHDSIMTPVKNTLAYAESFENIDRYSDRRSILSSAYRGNLRETKN
FT                   TTSLASLSNPYYSGVPSEEEILKSVPYTLLATTSHLFKFDKGSVHIPDNVPNGESGILH
FT                   MLFEVALLYQYLQKRVEDYKASGTLSPLKTAFIAHINTQLHHYMSTVNTLSKNPQIQSL
FT                   RALYIEIHHFIFEFRIYHSFITNLQSLRGDQLLSQMHNLKNHGDVLVKEISTSAYQSLA
FT                   TLYYEYVINWLTRGQLEAHQEFFVEVVPSSQHNATALQYSAEKVPSFLPKLTADEIFMI
FT                   GKTRVFLERDCKEIQWVNDSSQKFSSIYRSLNGEGSTEFQSVVHSHYVEVISFCRKALE
FT                   EKYAFSGVLGLLKNVLLMGKGDFIDQMIQNSSEFLQEPSVSLPSYKLTRCLQESIKKSS
FT                   LKKFLQKPYLNSIVNGIDARVLEMGSGSIGWDVFTLDYLPAKPLTFVLDFNHNGGRKEY
FT                   LRLFNFLWRIKKNNFFFQEQWLRNNSLMRDFKRLRRNQPLVRDVMKKMDKINTLKHNVQ
FT                   HFNRKIEAYCFQSIIDKNFRNLQKKLSMEKPGSETQVNVTVLKSGLKVASGILRPQSQL
FT                   LHQLGVKRESSSCHNMQYTIDELKEMHDHYLQAMLGHELLDSSNKHKKLGTFTNQHYPS
FT                   SLIVILGEIFEFILQYSELNELVHELLIQLSLQNEDGISALLSRLNELLGKVVSRYRWI
FT                   QKTCYYFIKDLKADGDTELFSVSRILR"
FT   gene            complement(<446569..>449364)
FT                   /locus_tag="KLTH0B05368g"
FT                   /old_locus_tag="KLTH-ORF15210"
FT   CDS_pept        complement(446569..449364)
FT                   /locus_tag="KLTH0B05368g"
FT                   /old_locus_tag="KLTH-ORF15210"
FT                   /product="KLTH0B05368p"
FT                   /note="similar to uniprot|P53917 Saccharomyces cerevisiae
FT                   YNL127W FAR11 Protein involved in G1 cell cycle arrest in
FT                   response to pheromone in a pathway different from the
FT                   Far1p-dependent pathway interacts with Far3p Far7p Far8p
FT                   Far9p and Far10p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21583"
FT                   /db_xref="InterPro:IPR012486"
FT                   /db_xref="InterPro:IPR021819"
FT                   /db_xref="InterPro:IPR040185"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS2"
FT                   /protein_id="CAR21583.1"
FT                   /translation="MLRPAGCEVTKIRPAMPEGVKTRSPLIRSISSKDLRRKGGRRNGY
FT                   LSPENSSNKDANDSSSEAEEHLLQDLDNILYKKLHLGETSPNGGSVRGSPISSSPPNTH
FT                   DHSDDDQENNALDQDAEEEAENEDFANVDEIDGPISPSSSSGSLKDLAKANVNKGTDQT
FT                   LNNDIDYNLPVDKEFQNQLNKRAEEIEKDGSIFQSSRTTLEWSIQDFYSLYDELPDWFC
FT                   SVDYNMLGDAKRCFEKSFSPTRFTVEHSYAASVLEQLTSDLQNCNNEASCTLSLAYICM
FT                   GTFGNKKSLIEHIKAIKNNNFLLVPHLSVLLKSFKKFASHCREGKSHLKHYTNLFFNCS
FT                   TILFFLVNVLVESKAKGQCVTETEAAIEEIYREEILEFVVKYIEYWRWNSRLSMRIRIV
FT                   IILFHRLLLLQFGDMQYFEEVKEYVHKKHNIKKRENGPGALAISPLDYQAFREDVTSRF
FT                   PTFVPPESDIPASFDNSNSLSQFLEIPRPKSKSTLNSNLSAPECHIATPVPSPCSSPTS
FT                   QMRGSKSRKSFQTNLAYPSLYPCDDTDGSDPLSSRIRAPGCGEGETQIPFSVLEATDIL
FT                   HKNVEIKLSTRQLWHERELFMKQERGWGSTHESPSEFLYHYNNENNGEARTMVRIEEFY
FT                   KKCLPSLSSIAYVLLQTMESNLNNRTYVRDDTKDESSGLQTAPQLEIIRSKEIVLKSSC
FT                   SSLYLLMKWLKLSHILKFEQFCVILHDYKLIGIVTSLLNTYTDKYQERVFGNVLQPTHS
FT                   FWKACSSYNADSYDISTNKTVLSHENLDLRFLNTVVYLLRLLSKVTGCKTQRLKELPLA
FT                   IGTLLKTFYQIFNLDIYQPILKITQELTPFKNKKWKSEHMDLISGVYLYRRLKLSDNWV
FT                   TGKDITGELNDACGQEIALRALLQFYNFLHYKPSIEHLGYHDKSDFSFFSKEAEILTSV
FT                   H"
FT   gene            <449461..>449811
FT                   /locus_tag="KLTH0B05390g"
FT                   /old_locus_tag="KLTH-ORF15207"
FT   CDS_pept        449461..449811
FT                   /locus_tag="KLTH0B05390g"
FT                   /old_locus_tag="KLTH-ORF15207"
FT                   /product="KLTH0B05390p"
FT                   /note="some similarities with uniprot|P38828 Saccharomyces
FT                   cerevisiae YHR121W LSM12 Protein containing an Lsm domain
FT                   and an AD domain may bind RNA and have a role in RNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21584"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS3"
FT                   /protein_id="CAR21584.1"
FT                   /translation="MSISLEHILGFKVKVTNVLDVASAGNIYSYNSSNNTITLQLTKSA
FT                   HHAQQFKVIRLSFIKSLEVIGERPTKNSFRKDSMKPIEIRIENVREALQNKVQQAQGAT
FT                   AAIQEHIVTASK"
FT   gene            complement(<449900..>451240)
FT                   /locus_tag="KLTH0B05412g"
FT                   /old_locus_tag="KLTH-ORF15206"
FT   CDS_pept        complement(449900..451240)
FT                   /locus_tag="KLTH0B05412g"
FT                   /old_locus_tag="KLTH-ORF15206"
FT                   /product="KLTH0B05412p"
FT                   /note="similar to uniprot|P53916 Saccharomyces cerevisiae
FT                   YNL128W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21585"
FT                   /db_xref="GOA:C5DCS4"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029023"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS4"
FT                   /protein_id="CAR21585.1"
FT                   /translation="MPFSLQAFTPENILRSVYSSPIKVHKNDLGFSLDLSYITRELIVC
FT                   SYPVIKYPQLLYRNSLKDLISYLNLHHGAGNWKIYNFKAEKGASDYSDEDLVTALFELS
FT                   NFCEKASASAGPLLSTIYDPTKSPCKEGHDSASTQSLSSTRESLLERVGHYIQRYGWLD
FT                   HSPPPFTLLQEILDDMHEYLIQDSSRVVLLHCKLGKGRSGSVVVAYLMKYMRCSLREGR
FT                   EIFVNNRFKVGLTQGVTISSQLRYLGYHERFLQADHPSNWSKILSELTRAQFMINSFEI
FT                   IHLLSAAPVKLESKTYTMSIKIQIYNRNRDGLIDVFDTNNKEQSIDSKPHSNLNRVSVG
FT                   QRITESDIRISFGLRHKGSAFIDNVTQLTSISHFWINLYWETLACSRSESTDHYTLDKL
FT                   ANEQSRCRDRKNFAMFSIKWAELDGMKGLQSKGFKLFETFTLRWQLL"
FT   gene            complement(<451373..>452164)
FT                   /locus_tag="KLTH0B05434g"
FT                   /old_locus_tag="Klth0B.mRNA.vl.393.m"
FT   CDS_pept        complement(join(451373..452032,452105..452164))
FT                   /locus_tag="KLTH0B05434g"
FT                   /old_locus_tag="Klth0B.mRNA.vl.393.m"
FT                   /product="KLTH0B05434p"
FT                   /note="similar to uniprot|P53915 Saccharomyces cerevisiae
FT                   YNL129W NRK1 Nicotinamide riboside kinase catalyzes the
FT                   synthesis of nicotinamide nucleotide (NMN) from
FT                   nicotinamide riboside involved in a salvage pathway for NAD
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21586"
FT                   /db_xref="GOA:C5DCS5"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026681"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS5"
FT                   /protein_id="CAR21586.1"
FT                   /translation="MESPQVLLVGISGCSSSGKTTLAKLSAELLPTAVLIHQDDFFKHD
FT                   EDIPFNDKYQIRDWDSPEALDMNLFGKELDHIKKTGSVSTTLIHNNNHDNSGAAEVRPE
FT                   TQKEVKTKFAKAFEGTNTKVVFVDGFMMFNDQNIKSKFDLKLLVRAPYGTLKKRRAARS
FT                   GYQTLDSFWIDPPYYFDEFVYSSYARSHSQLFEDGNVEGVLKKGSGILDFINDDSTDIN
FT                   DALLWVCNCVVSMAQKK"
FT   gene            <454571..>455239
FT                   /locus_tag="KLTH0B05456g"
FT                   /old_locus_tag="KLTH-ORF15200"
FT   CDS_pept        454571..455239
FT                   /locus_tag="KLTH0B05456g"
FT                   /old_locus_tag="KLTH-ORF15200"
FT                   /product="KLTH0B05456p"
FT                   /note="similar to uniprot|P38829 Saccharomyces cerevisiae
FT                   YHR122W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21587"
FT                   /db_xref="GOA:C5DCS6"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR039796"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS6"
FT                   /protein_id="CAR21587.1"
FT                   /translation="MSEFINENPDILDENLLPSRKEEEGDAFQDEALNTVNLLRRKRLL
FT                   KIHQTTACKVYRNVELIDRLKAQEMALDQVPDLTASETEESDEGEPEDPIDAQEIYDMI
FT                   AHISDPEHPLTLGQLAVVNLPDIEVSESNDKSKISEVLVKITPTITHCSLATLIGLGIR
FT                   VRLERSLPSRYRITILLKEGSHQSENQVNKQLNDKERVAAACENDQLLGVVSKMLSTCK
FT                   "
FT   gene            <455601..>456638
FT                   /locus_tag="KLTH0B05478g"
FT                   /old_locus_tag="KLTH-ORF15199"
FT   CDS_pept        455601..456638
FT                   /locus_tag="KLTH0B05478g"
FT                   /old_locus_tag="KLTH-ORF15199"
FT                   /product="KLTH0B05478p"
FT                   /note="similar to uniprot|P17898 Saccharomyces cerevisiae
FT                   YNL130C CPT1 and similar to uniprot|P22140 Saccharomyces
FT                   cerevisiae YHR123w EPT1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21588"
FT                   /db_xref="GOA:C5DCS7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS7"
FT                   /protein_id="CAR21588.1"
FT                   /translation="MAPNLVTLSGLGFIIINVLTVLYYDPTLSEESPRWTYFSYALGLF
FT                   LYQTFDACDGQHARRTGQSGPLGELFDHCIDSLNTSLSMIVFASAVGSGMRFMTLMSQF
FT                   AILCNFYLSTWEEYHTHKLFLSEFSGPVEGILIIVAAFILTGIYGPQKLWHTLLGELTL
FT                   WGHTYRIESIHAVYAFCSVGLVFNILSARRNVVEHYKKVSDSTQEAVDDVRKATKGLVP
FT                   FFVYFGTVFVLVLIDPEIISLPFILSVGLTMAFTVGRIIVSHLTKQSFPMINPPMLTPT
FT                   IQLLIRILMVHVIGYDQSSVLTALNWFGFGLTMGIHLMFITEVIYEFTTYLDIYVLSIK
FT                   HPKTA"
FT   gene            complement(<456831..>457268)
FT                   /locus_tag="KLTH0B05500g"
FT                   /old_locus_tag="KLTH-ORF15198"
FT   CDS_pept        complement(456831..457268)
FT                   /locus_tag="KLTH0B05500g"
FT                   /old_locus_tag="KLTH-ORF15198"
FT                   /product="KLTH0B05500p"
FT                   /note="similar to uniprot|P49334 Saccharomyces cerevisiae
FT                   YNL131W TOM22 Translocase of Outer Mitochondrial membrane
FT                   Mitochondrial import receptor complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21589"
FT                   /db_xref="GOA:C5DCS8"
FT                   /db_xref="InterPro:IPR005683"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS8"
FT                   /protein_id="CAR21589.1"
FT                   /translation="MVELTEVREENISFEEEKVPSSSFSRQDTTAEHESSDEFSSDDEY
FT                   DEEETFLERLVALKDIIPPRQRQTISNVFNVTVSAVRNTFSKSGNVAWAVTTSALLLGV
FT                   PLSLSILAEQQLIEMEKSFDLQKDANEILVQGDATPAPAIA"
FT   gene            complement(<457520..>460687)
FT                   /locus_tag="KLTH0B05522g"
FT                   /old_locus_tag="KLTH-ORF15196"
FT   CDS_pept        complement(457520..460687)
FT                   /locus_tag="KLTH0B05522g"
FT                   /old_locus_tag="KLTH-ORF15196"
FT                   /product="KLTH0B05522p"
FT                   /note="highly similar to uniprot|P53914 Saccharomyces
FT                   cerevisiae YNL132W KRE33 Essential protein of unknown
FT                   function heterozygous mutant shows haploinsufficiency in K1
FT                   killer toxin resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21590"
FT                   /db_xref="GOA:C5DCS9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR027992"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="InterPro:IPR033688"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS9"
FT                   /protein_id="CAR21590.1"
FT                   /translation="MAKKAIDSRIPSLIRNGAQTKQRSFFVIVGDKARNQLPNLHYLMM
FT                   SADLKMNKSVLWAYKKKLLGFTSHRKKREAKIKKEIKRGTREVNEQDPFETFISNQNIR
FT                   YVYYKETEKILGNTYGMCILQDFEALTPNLLARTVETVEGGGIVVILLKSMTSLKQLYT
FT                   MTMDIHSRYRTEAHSDVVARFNERFILSLGSNENCLVVDDELNVLPISGGKNVQPLPPK
FT                   DEDEIPPRQQELIELKESLEDVQPAGSLVALSKTVNQAQAILNFIDAISEKNLNSTVAL
FT                   TAGRGRGKSAALGIAIAAAVSHGYSNIFVTSPSPENLKTLFEFIFKGFDALGYQEHMDY
FT                   DIIQSTNPSFNKAIVRVDIKKSHRQTIQYIVPNDSHVLGQAELVVIDEAAAIPLPVVKN
FT                   LLGPYLVFMASTINGYEGTGRSLSLKLIQQLRDQANSSGRETSETMVVSRDNKKQDFHA
FT                   SGRSLKEVVLDEPIRYAPGDPVEKWLNKLLCLDVTLIKNPRFAARGTPHPSECNLFVVN
FT                   RDTLFSYHPVSETFLEKMMALYVASHYKNSPNDLQLMSDAPAHQLFVLLPPINPKDGGR
FT                   IPDPLVVIQVALEGEISRDSVKSSLSRGQRAGGDLIPWLISQQFQDEEFPSLSGARVVR
FT                   VATNPEYSSMGYGSRAIELLRDYYEGKFADLNENSKPASHELKRVNDQELSKTNLLKDE
FT                   VKLRDAKTLPPLLLKLSEQPPHFLHYLGVSYGLTSSLHKFWKKNKFVPVYLRQTANDLT
FT                   GEHTCVMLNVLEGRESHWLSEYANDFHKRFLSLLSYEFRKFSAVQALNVIESVKKANGL
FT                   SGNAENKHAARPLTKEDIDQVLSPFDLKRLDSYANNLLDYHVIVDLLPLLSSLYFSGRM
FT                   GSSVNLSSVQSAILLAVGLQRKSVDDVSKELNLPFNQAIAMFAKIIRKFSIYFREVVSQ
FT                   SIERSMPEAKDDNIAEMNGEEVTALDASSVMEKMDDDLEKAGTRALTAMQEKQKELINS
FT                   LNLDKYAIDDNAEEWAQSKKDLDKAAKKNGTVAVKSNKKRKTENAEDIFNAEMSAVKKS
FT                   SKKKPKK"
FT   gene            <461312..>463489
FT                   /locus_tag="KLTH0B05544g"
FT                   /old_locus_tag="KLTH-ORF15193"
FT   CDS_pept        461312..463489
FT                   /locus_tag="KLTH0B05544g"
FT                   /old_locus_tag="KLTH-ORF15193"
FT                   /product="KLTH0B05544p"
FT                   /note="similar to uniprot|P38830 Saccharomyces cerevisiae
FT                   YHR124W NDT80 Meiosis-specific transcription factor
FT                   required for exit from pachytene and for full meiotic
FT                   recombination activates middle sporulation genes competes
FT                   with Sum1p for binding to promoters containing middle
FT                   sporulation elements (MSE)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21591"
FT                   /db_xref="GOA:C5DCT0"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR024061"
FT                   /db_xref="InterPro:IPR037141"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT0"
FT                   /protein_id="CAR21591.1"
FT                   /translation="MPDDANEETIQEFAYSLNAEDGLKDIAGGEVHDDLNEAIVENDSR
FT                   GKVENSGGSERSAQQRRTGKRRKAHGRMRNFVYNQESSSSRPHCRGVLSAKEKSENNVE
FT                   TITHEDGSTSNYFDKRRLKIAPRSTLQFKIGPSFETVGRYCQVLGHRDKRPVNFMLRPR
FT                   IDRGFDHIEDEWIGYKRNYFTLVTSFEVESLELPEFLNQSFEVDGVSGASSPLRPKYFA
FT                   VRLMAVCDEDESQVSLVQHTAKRDKGPQFEPPILALVPATLPSHQIIREASNVRNESKM
FT                   KKYDSLFFFYRNTDAQEFAPESVVHSYPKDRIKKVARYERVQFSSSINAKKQPNQCKHF
FT                   KLRVVLGCVVDGQHLNQDSFCAYQGLDCLVENGTGTFVPILEMETPPLVIRGRSPSNYS
FT                   AALATPSPKRAKACQNSISATRNSGPGKGVPTCGPLTRGTPRAVFKASEFQDSNEDGMQ
FT                   KRRGATKPLSFSSSNLKPSASVKTPDSNMPKKTPSSLTFSEKRLDMQTMSSIEAVMMRH
FT                   LPHILERGSVVEGLDLLSKHCSDSSYTIGMRDIELTPFLLGTPQDFGGHHSTSGFESDV
FT                   FGLGMSPEPAHPHSPSNACTIRETTKQLRPLRERKLNNKPASMDITFSGKPSSTNNDEA
FT                   TECTFSENSYQFHATINAKSSRGTANVPRSVEPNPMDISFRLNMGTDSASMPRPISNTG
FT                   LASRRMLTASGKPSDIFGASELFDEPSFYRH"
FT   gene            complement(<463528..>463620)
FT                   /locus_tag="KLTH0B05566r"
FT                   /old_locus_tag="Klth0B.tPhe.GAA.14"
FT   tRNA            complement(join(463528..463563,463584..463620))
FT                   /locus_tag="KLTH0B05566r"
FT                   /old_locus_tag="Klth0B.tPhe.GAA.14"
FT                   /note="tRNA-Phe (GAA) cove"
FT   gene            <463936..>464478
FT                   /locus_tag="KLTH0B05588g"
FT                   /old_locus_tag="KLTH-ORF15189"
FT   CDS_pept        463936..464478
FT                   /locus_tag="KLTH0B05588g"
FT                   /old_locus_tag="KLTH-ORF15189"
FT                   /product="KLTH0B05588p"
FT                   /note="weakly similar to uniprot|P53913 Saccharomyces
FT                   cerevisiae YNL133C FYV6 Protein of unknown function
FT                   required for survival upon exposure to K1 killer toxin
FT                   proposed to regulate double-strand break repair via non-
FT                   homologous end-joining"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21592"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT1"
FT                   /protein_id="CAR21592.1"
FT                   /translation="MSTRQENDLQSSRFVKEGNADIELQRQRERQESAKLDTDFRTKER
FT                   LTLQDQLRLNAITKQEEFSSLVKDRNSFNRLSKQDVEFYESLQRRAQLENQSLEEFLEK
FT                   NTREYDKKKAQVLAHESGRPESVPTRVQVPAKITKKRSMPSKNGIKGVIKKKKSKSNHE
FT                   VPENRDHSKVETSKGSN"
FT   gene            <464789..>465904
FT                   /locus_tag="KLTH0B05610g"
FT                   /old_locus_tag="KLTH-ORF15187"
FT   CDS_pept        464789..465904
FT                   /locus_tag="KLTH0B05610g"
FT                   /old_locus_tag="KLTH-ORF15187"
FT                   /product="KLTH0B05610p"
FT                   /note="similar to uniprot|P53912 Saccharomyces cerevisiae
FT                   YNL134C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21593"
FT                   /db_xref="GOA:C5DCT2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT2"
FT                   /protein_id="CAR21593.1"
FT                   /translation="MSVPKTMRAVVVDGDKAVVKRDVPVPKIFGTQMLVEIKAVAGNPT
FT                   DWKHVDFHIAPQGSILGCDVAGVVKELGPDVDKTRFAVGDTITGIVHGGSVKFPQNGGF
FT                   ADYALVDSVLSYKLKLNPTKQATISHGSVESFEAAASLPVSLLTAGVVLDLHLGNKLVW
FT                   EPKTPQHDFPVVLWGGATGVGLWLIQLAKQLNAYSKIVVVASKKHEEHLCHLGADEVFD
FT                   YHDSDVIDQIKAKYGGFRHLVDCVATPETFQQTYSLASDSADAIVMTLMMYSEKDIPEP
FT                   ERKSNVKVDWALLYLVSGSEVPFGKMTVPARPEYRTAVAEFIKFSEGRVLDGRLIHPRI
FT                   KVYEGGLDVVPQIMDDVKNGMNSGEKLVAKL"
FT   gene            complement(<466200..>466475)
FT                   /locus_tag="KLTH0B05632g"
FT                   /old_locus_tag="KLTH-ORF15181"
FT   CDS_pept        complement(466200..466475)
FT                   /locus_tag="KLTH0B05632g"
FT                   /old_locus_tag="KLTH-ORF15181"
FT                   /product="KLTH0B05632p"
FT                   /note="similar to uniprot|P43497 Saccharomyces cerevisiae
FT                   YKL096W-A CWP2 major constituent of the cell wall
FT                   containing GPI-anchor, plays a role in stabilizing the cell
FT                   wall, low pH resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21594"
FT                   /db_xref="GOA:C5DCT3"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT3"
FT                   /protein_id="CAR21594.1"
FT                   /translation="MQFSTVAFAAASVAVVSAASTVQAISQIGDGQIQATTSAPATEPT
FT                   TAPTTTASWTSSGNATIPTQTENGAAAMGSGFVAMAGLAAAGALLI"
FT   gene            <467957..>468301
FT                   /locus_tag="KLTH0B05654g"
FT                   /old_locus_tag="KLTH-ORF15174"
FT   CDS_pept        467957..468301
FT                   /locus_tag="KLTH0B05654g"
FT                   /old_locus_tag="KLTH-ORF15174"
FT                   /product="KLTH0B05654p"
FT                   /note="highly similar to uniprot|P20081 Saccharomyces
FT                   cerevisiae YNL135C FPR1 Peptidyl-prolyl cis-trans isomerase
FT                   (PPIase) binds to the drugs FK506 and rapamycin also binds
FT                   to the nonhistone chromatin binding protein Hmo1p and may
FT                   regulate its assembly or function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21595"
FT                   /db_xref="GOA:C5DCT4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT4"
FT                   /protein_id="CAR21595.1"
FT                   /translation="MSETIEGNVKIDRLSPGDGKTFPKTGDLVTIHYTGTLENGQKFDS
FT                   SVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATL
FT                   VFDVELLKVN"
FT   gene            complement(<468367..>469491)
FT                   /locus_tag="KLTH0B05676g"
FT                   /old_locus_tag="KLTH-ORF15171"
FT   CDS_pept        complement(468367..469491)
FT                   /locus_tag="KLTH0B05676g"
FT                   /old_locus_tag="KLTH-ORF15171"
FT                   /product="KLTH0B05676p"
FT                   /note="some similarities with uniprot|P53911 Saccharomyces
FT                   cerevisiae YNL136W EAF7 Subunit of the NuA4 histone
FT                   acetyltransferase complex which acetylates the N-terminal
FT                   tails of histones H4 and H2A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21596"
FT                   /db_xref="GOA:C5DCT5"
FT                   /db_xref="InterPro:IPR012423"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT5"
FT                   /protein_id="CAR21596.1"
FT                   /translation="MSEPWSIEDDIRLFRWITEFKPAGMHKHFHMINILERMNKPELFP
FT                   VVLLFDKQKSESKGLFTREELWAKLSKHYDLDMLDKVEDDHTGKEAGEAASVLPLSLRR
FT                   VTKQQREFHLPWDEYGELILENAQGAMEEEQEEFENPEQSEISKERGETAESEELQGDT
FT                   ARKEEEAAEENMVADEKEHDEEPEPKPQDEELSERVPRRVTRSAAVAKPAGRITRSHGP
FT                   ADQASGVDGHESAPSEEPTNGETPVTGEEKEEDSAMGDLDGEKDKDKDESAQGAETPAE
FT                   GEPAEAEEPEQPPSKRTRTTRSQPREAPAPAPASTAPAAGSASESRSARLGGAKESVSP
FT                   PSETEPAEDAEQAAKAPPAKRSSSRVANRRRARR"
FT   gene            <469761..>471203
FT                   /locus_tag="KLTH0B05698g"
FT                   /old_locus_tag="KLTH-ORF15166"
FT   CDS_pept        469761..471203
FT                   /locus_tag="KLTH0B05698g"
FT                   /old_locus_tag="KLTH-ORF15166"
FT                   /product="KLTH0B05698p"
FT                   /note="similar to uniprot|P27929 Saccharomyces cerevisiae
FT                   YNL137C NAM9 Mitochondrial ribosomal component of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21597"
FT                   /db_xref="GOA:C5DCT6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT6"
FT                   /protein_id="CAR21597.1"
FT                   /translation="MPRKAVLLKSLARGRIRSSFNKYNLFNLYKKGDVDFRSKTLYQQK
FT                   WTAKQETRAYHGEHMTEGRWQTTFTPKLDSVAQLDASLKGGEIDQTPILLQTFAVLEKR
FT                   LDFALFRAMFASSVRQARQFILHGNVFVNGIKITQPGYPLKAGDVFNVKPEKVLQALGA
FT                   KKPSLSEALKIDKLQIAVWNKYVKAIKENPREEWKRKQEKFRAMDDSNPKKQEYMEFVR
FT                   NYNKSLTAQMESEIKSATKEAILGKAVLAGSSAADPENPLVEEFLTHFYDDKALATKAV
FT                   ECFNELRNTKLIQPDAASKSVAELTEFARTLTNLTEELKNSMSDSSKKSLRAAKNIVSE
FT                   LLTSQDSVIRKLYESKKGSEETLSIPYDPLWAKRIQGHKPIDIKELAEDESKASQLINL
FT                   PWQKGLYGRQDPSKPYFTPWKPRPFLAPFAILPHHIEVSFKTCHAVYLRDPVARPGQSE
FT                   VISPFGLPVHERAYMYYVRNGK"
FT   gene            complement(<471311..>472903)
FT                   /locus_tag="KLTH0B05720g"
FT                   /old_locus_tag="KLTH-ORF15164"
FT   CDS_pept        complement(471311..472903)
FT                   /locus_tag="KLTH0B05720g"
FT                   /old_locus_tag="KLTH-ORF15164"
FT                   /product="KLTH0B05720p"
FT                   /note="similar to uniprot|P17555 Saccharomyces cerevisiae
FT                   YNL138W SRV2 Adenylyl cyclase-associated protein N-
FT                   terminal domain appears to be involved in cellular
FT                   responsiveness to RAS"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21598"
FT                   /db_xref="GOA:C5DCT7"
FT                   /db_xref="InterPro:IPR001837"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR013912"
FT                   /db_xref="InterPro:IPR013992"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="InterPro:IPR018106"
FT                   /db_xref="InterPro:IPR028417"
FT                   /db_xref="InterPro:IPR028419"
FT                   /db_xref="InterPro:IPR036222"
FT                   /db_xref="InterPro:IPR036223"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT7"
FT                   /protein_id="CAR21598.1"
FT                   /translation="MSDPSNFAIQGFNLSKLLKRLEDATARLEDVTLYQEGYIQTKLED
FT                   LSVRGSSNEVEQKKTDHVTVEIPKSLPEKAEEQTEEESASVKGFRSIIDSRIEPLYQLS
FT                   EKIDPVVAKSIKHLQGAFEAQLSFLRVVSLSKKPDFGSESFIKALQPLNEQIMAIGELK
FT                   DENRQSKYFAYLNSVAEGAPLLSWIGVETPMSLIGDFKDAAQFWTNRILKDFKELDPSS
FT                   VEWVKGFLAIFDDLKSYVKEYHTTGPSWNNASGIEFAEAVAKIEGQSSKAVPSSTAPNA
FT                   SQGSGAPPPPPPPPAPPASVFEAQADKSENAGISAVFDELNQGENITKSLKKVDKSQQT
FT                   HKNPALRASSATPSARTPPPKPKKPTTLKTKKPARKELVGNKWFIEGYENVETPITIEV
FT                   NKDESVYIGNCSNVFVKIEGKVNAVSVSETERCNVVLESSVSGMDIIKSVKFAVQVEQS
FT                   LPQISIDKSDDGTIYLSKESLNAEIFTSCTTSVNVNLPIGEEGDFVEFPVPEQLKHSFA
FT                   DGKLKTTVYEHAG"
FT   gene            <473057..>473707
FT                   /locus_tag="KLTH0B05742g"
FT                   /old_locus_tag="KLTH-ORF15161"
FT   CDS_pept        473057..473707
FT                   /locus_tag="KLTH0B05742g"
FT                   /old_locus_tag="KLTH-ORF15161"
FT                   /product="KLTH0B05742p"
FT                   /note="weakly similar to uniprot|P38833 Saccharomyces
FT                   cerevisiae YHR127W (H)igh copy (S)uppressor of (N)34
FT                   dominant negative allele of SEC4"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05742g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21599"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT8"
FT                   /protein_id="CAR21599.1"
FT                   /translation="MAVKRSARDKSHAKQQNSRGKSGQNNFKGKSLLERLTLPYDTKKH
FT                   VNARASSEKPGLRVVDGKLLSANDVGVLLRDAAKRTDAKKKPMKPRQGLKTTVRRTERV
FT                   VRRREPARASVPVPKPYGKDLHLSVSGHSSDARFLRIRNLPLGSNSQVLTTLVENVTGA
FT                   KVSKSSLVDLPSGSVTAELWLGNANNKLLADVRRQLDGANVDGRVVSVEISST"
FT   gene            complement(<473754..>474109)
FT                   /locus_tag="KLTH0B05764g"
FT                   /old_locus_tag="Klth0B.mRNA.1301.m"
FT   CDS_pept        complement(join(473754..474041,474107..474109))
FT                   /locus_tag="KLTH0B05764g"
FT                   /old_locus_tag="Klth0B.mRNA.1301.m"
FT                   /product="KLTH0B05764p"
FT                   /note="similar to uniprot|P0C074 Saccharomyces cerevisiae
FT                   YNL138W-A RCP10"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21600"
FT                   /db_xref="InterPro:IPR009846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT9"
FT                   /protein_id="CAR21600.1"
FT                   /translation="MSDKHRQKQLFQAMKQKHLGLGTEATTTEEWMTHVHRDTYYSLAS
FT                   HSSMLEYLALSQGDSSKRVTELRLIEKMCGGLSSKRARGENRAEIPFKQTK"
FT   gene            <474183..>479222
FT                   /locus_tag="KLTH0B05786g"
FT                   /old_locus_tag="KLTH-ORF15159"
FT   CDS_pept        474183..479222
FT                   /locus_tag="KLTH0B05786g"
FT                   /old_locus_tag="KLTH-ORF15159"
FT                   /product="KLTH0B05786p"
FT                   /note="similar to uniprot|P53552 Saccharomyces cerevisiae
FT                   YNL139C RLR1 Required for LacZ RNA expression from certain
FT                   plasmids suppressor of the Transcriptional (T) defect of
FT                   Hpr1 (H) by Overexpression (O) plays a role in
FT                   transcription elongation by RNA polymerase II Involved in
FT                   transcription"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21601"
FT                   /db_xref="GOA:C5DCU0"
FT                   /db_xref="InterPro:IPR021418"
FT                   /db_xref="InterPro:IPR021726"
FT                   /db_xref="InterPro:IPR032302"
FT                   /db_xref="InterPro:IPR040007"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU0"
FT                   /protein_id="CAR21601.1"
FT                   /translation="MHLFSNRAYQTFPNSTASLQTVIMSALCSRINALSNAHSSIFQEG
FT                   LQLAQIEDQNWELFTQEVINNLKSSSDQADKKNRVQSVLYEIVLLSSESNTQRPLDSEK
FT                   VLQLIKDMHAVEGAKTARLLSSLINSFPEKSEKLVEIMVSLDFMESELCTYITDDKLLE
FT                   RTAKFTVKERALFRKSLLDTRYIIQKYNLLSEHPIGFSELITLLVIAYSDPTSAERARS
FT                   YWQEACSIVGKYSLDPLRALDVILMVSSRYITKGYPFLLEFLKESDYWPATEANHTSFD
FT                   NLHIGGNMTASQLLSMHLNDTKVDVTFYDMTCLLVRANFVSFSSIFENLGPNEDQIQKF
FT                   ADQYFSDMEEDSMKGVLNPLAMAAALVDDSEESENPAPADSQKESDQEEELSDEEKQAR
FT                   KMREQEEILGSGKMFFMQRLLAHGIFTPFFSAFGRYQRFLLTSPELLKLYLKLFDHIIT
FT                   PIYETTAFFNSAKQSTAGKQNFSATHTALPPFDKKNSSEFYFSGRMQELPQVNNVEQLI
FT                   KVSHEWLSILGPHVAYDPVIVSKLCRIGLKDIERSSRNPDTLSIWLDFTRKFIFVSLPL
FT                   LTDNLVVINEVFVLLQSFDFEKRYFLYNEMISKTSQDNVFVKAKWNESSREAKSALKSL
FT                   SNDNIGEKGRFVAKLISKNPLSTLEPVMNQLENYDKVSDLVVETSLYYSPYAYDVLQYA
FT                   IILRLASGRQALQENGVYVTMWVQRLAFFIASLAKHSPKMDIGNIIQLVVKKLHKGDMV
FT                   GVTVIKELTSRVSGVKSINDLSPKQLVMLNSGQPLQESARSIIRDTRGENKGPALRLLS
FT                   VFIKQQSLSEVIILLYRMQSSMVDTDLHYKVLSSRIDEISLLLWSFIDMSKYFLGFEKF
FT                   SRNIASFDQLVNHYGVSIEWAFLIWRDHYDTCASEGTEAEREFRETIEKPNFVPTEFQN
FT                   GSRTLFTDFWRLSLYDLCFEKDLYDEEKHQLERSMQQLKLGKKKREISKMLENVMSSRI
FT                   AHQRAHNKCVERLRGQPMDIEQLKAPEVLKPFLQYCLIPRVLFSPSDALYAVSFLWEAF
FT                   ASSGSLDVFENMVSARILNALLFSSTSLEASNLGLFFATLLEKFEILRKSNKLSNDDLK
FT                   RIYVIQTIIVDDVIDLISEKNYMSIRNGIEFMKYLSTVFPVVKVHILQVIQAIEKLISI
FT                   DEREDIQLPSNALIGHLKARLKDSLKLEDFYQMSEEDKKIYRVDEKEEIAQYERAILEE
FT                   QEEAKLKQISEREIEDSKKSMNEQRLKVDDDEHSRTAYGARIRKEPLLPMHEVLNEMTD
FT                   VLKCLETTGTSYLNRHIRNRSVLTELRQIEQGTARRPREYKARLAELFEAYFMNLTSSP
FT                   NNEKFKQCLNDVIKACRSITNPHTIEKSQPGRRQPAIAYDDEAVPRAQASKRAGAKATT
FT                   EETKRTSRYEGSTETKLQKTISRPHQSEKEPQDDNSGSNAQRGARSQNSGPSNRTGSRY
FT                   DPTSSSRPQDNGIQKKAQSPILRGHSQNANPVDRGVPRSNAPVARGKVSSARGTPGSAT
FT                   SEKELSSRNAPPLDDRARPLKFQSSEKPTPKPAASFGSRYEASPNQIQIGERRKIGGSN
FT                   QEVIKRSRDESPSSYPSKRARQESDQGRDKFEGRSFGRRDTNYRDRYSGKQNDATSERR
FT                   TDKYSSTLSSRLRGQDYRQNKANQTNQGGQTPKAPESRYRK"
FT   gene            <479404..>480567
FT                   /locus_tag="KLTH0B05808g"
FT                   /old_locus_tag="KLTH-ORF15152"
FT   CDS_pept        479404..480567
FT                   /locus_tag="KLTH0B05808g"
FT                   /old_locus_tag="KLTH-ORF15152"
FT                   /product="KLTH0B05808p"
FT                   /note="weakly similar to uniprot|P53901 Saccharomyces
FT                   cerevisiae YNL152W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21602"
FT                   /db_xref="GOA:C5DCU1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037791"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU1"
FT                   /protein_id="CAR21602.1"
FT                   /translation="MSTVSASAFGGANGLLEVYVSRARDLPNLRKLDKQSPFVRLRISH
FT                   MTETSDVAFRGGQTPKFDYYAKFDLTPDVKPALAVEVFDDRSPPKLIGQCAVDLTPALY
FT                   KDPEDGHDDWFPLSFGSEEAGEIYLELTFHPLIPTSRLQRHRNDGISAFEESLASRPPP
FT                   PLPAKLPSFQLEKRHDEVTHNNTYSHASNLSQTLLSEPERISFGQSVSSKRMPNLDVSV
FT                   ASNSTFASQATNETHESHATVATSGTTEPLFAKLKQLKEKWNSIKNPGKDQQDHDKKVD
FT                   LEALQKVVGVEPEEFNQDERGFRRVTDVSTQASKLVTQPPLPRLPDQSSRRTSIESRAL
FT                   PTSRPNSCINETSPKLPPLPRSPSSRPDLRTRTAPNSPVRRKPPPKW"
FT   gene            complement(<480876..>481574)
FT                   /locus_tag="KLTH0B05830g"
FT                   /old_locus_tag="KLTH-ORF15151"
FT   CDS_pept        complement(480876..481574)
FT                   /locus_tag="KLTH0B05830g"
FT                   /old_locus_tag="KLTH-ORF15151"
FT                   /product="KLTH0B05830p"
FT                   /note="similar to uniprot|P17890 Saccharomyces cerevisiae
FT                   YNL151C RPC31 RNA polymerase III subunit C31 contains HMG-
FT                   like C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21603"
FT                   /db_xref="GOA:C5DCU2"
FT                   /db_xref="InterPro:IPR024661"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU2"
FT                   /protein_id="CAR21603.1"
FT                   /translation="MSFQRGGREGNSFAKNLPFGLSYSDVGVNENTELPSIPLPVNGLV
FT                   TSKERITSLKYMNFIKAVKEGPFYTGSMSLTIDGTGKQKQLVDEDGINDGIERYSDRYL
FT                   KKRKIGVSIDEHPFHLEFFPDELYQVMGINKKKLLALSNLNRQDDVFTGSAKDDDAEGL
FT                   SMLEKLKGLAEDEDETANADGKDDAHEAEDLDDDFGDSDEDDDYNAEKYFDDGDDDAEN
FT                   EDDYGDEPAF"
FT   gene            complement(<481757..>482137)
FT                   /locus_tag="KLTH0B05852g"
FT                   /old_locus_tag="KLTH-ORF15149"
FT   CDS_pept        complement(481757..482137)
FT                   /locus_tag="KLTH0B05852g"
FT                   /old_locus_tag="KLTH-ORF15149"
FT                   /product="KLTH0B05852p"
FT                   /note="weakly similar to uniprot|P53903 Saccharomyces
FT                   cerevisiae YNL149C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21604"
FT                   /db_xref="GOA:C5DCU3"
FT                   /db_xref="InterPro:IPR011431"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU3"
FT                   /protein_id="CAR21604.1"
FT                   /translation="MDFFDRAYQNLYDTFAGIDAAHAIRLVIIVGGYLLFRNLTQKHLA
FT                   KKQLEQKLRKSEEAKAAEKQKELIADPQDEETIQDNAFGWGNKTRKRVKRQEKILEERL
FT                   QELEKLQGSQDDDKDIEDLLED"
FT   gene            complement(<482270..>483013)
FT                   /locus_tag="KLTH0B05874g"
FT                   /old_locus_tag="KLTH-ORF15148"
FT   CDS_pept        complement(482270..483013)
FT                   /locus_tag="KLTH0B05874g"
FT                   /old_locus_tag="KLTH-ORF15148"
FT                   /product="KLTH0B05874p"
FT                   /note="similar to uniprot|P53904 Saccharomyces cerevisiae
FT                   YNL148C ALF1 alpha-tubulin foldin protein implicated in
FT                   folding of alpha tubulin cofactor B"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21605"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU4"
FT                   /protein_id="CAR21605.1"
FT                   /translation="MPQIQISSPLCSIVRELSPQWSWPQLCDKLSEITGVLPSDMQINV
FT                   IFKDRTSLLINAPLTEQKPLSSLLSKNAVELQVNDSNASSLANELARDFTEGEQSSEQT
FT                   YHLPEEDYQRRQDSVLQWKKDLQLGKFNPEYQARLQKDCEEQQSRAEELTINERCSVST
FT                   PNLPERRGWLRFVGSLTPLMDEPGIWCGVEFDEPVGKNDGSFKGRYFFGPVRPKYGAFV
FT                   KPSTVKTSAKFSPLLDDIEFSDSEI"
FT   gene            <483135..>483587
FT                   /locus_tag="KLTH0B05896g"
FT                   /old_locus_tag="Klth0B.mRNA.424.p"
FT   CDS_pept        join(483135..483146,483264..483587)
FT                   /locus_tag="KLTH0B05896g"
FT                   /old_locus_tag="Klth0B.mRNA.424.p"
FT                   /product="KLTH0B05896p"
FT                   /note="highly similar to uniprot|P53905 Saccharomyces
FT                   cerevisiae YNL147W LSM7 Component of small nuclear
FT                   ribonucleoprotein complexes involved in RNA processing
FT                   splicing and decay"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05896g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21606"
FT                   /db_xref="GOA:C5DCU5"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017132"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU5"
FT                   /protein_id="CAR21606.1"
FT                   /translation="MSEVQQSKRKFEGPKREAIVNLSKYADNKIRVKLAGGRLVVGVLK
FT                   GYDQLMNLVLDETVEHLRDPEDDTVILEGQTRELGLVVIRGTMLLTLSPMDGSEIISNP
FT                   HGPEEEF"
FT   gene            <484444..>485094
FT                   /locus_tag="KLTH0B05918g"
FT                   /old_locus_tag="KLTH-ORF15145"
FT   CDS_pept        484444..485094
FT                   /locus_tag="KLTH0B05918g"
FT                   /old_locus_tag="KLTH-ORF15145"
FT                   /product="KLTH0B05918p"
FT                   /note="highly similar to uniprot|P18562 Saccharomyces
FT                   cerevisiae YHR128W FUR1 Uracil phosphoribosyltransferase
FT                   synthesizes UMP from uracil involved in the pyrimidine
FT                   salvage pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21607"
FT                   /db_xref="GOA:C5DCU6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU6"
FT                   /protein_id="CAR21607.1"
FT                   /translation="MSTEPFKNVIMLPQTNQLTGLYTIIRDQNTKRPDFIFYADRIIRL
FT                   LVEEGLNHLPVQPRTVETSTNQKYEGVSFLGKICGVSIVRAGESMEQGLRECCRSVRIG
FT                   KILIQRDEETAQPKLFFEKLPEDIAERYVFLLDPMLATGGSAAMATEVLIKRGVKPERI
FT                   FFLNLICSKEGVDYYHSKFPGVKIVTGAVDPCLDENKYLVPGLGDFGDRYYCL"
FT   gene            complement(<485135..>486286)
FT                   /locus_tag="KLTH0B05940g"
FT                   /old_locus_tag="KLTH-ORF15143"
FT   CDS_pept        complement(485135..486286)
FT                   /locus_tag="KLTH0B05940g"
FT                   /old_locus_tag="KLTH-ORF15143"
FT                   /product="KLTH0B05940p"
FT                   /note="similar to uniprot|P38696 Saccharomyces cerevisiae
FT                   YHR129C ARP1 Actin-related protein of the dynactin complex
FT                   required for spindle orientation and nuclear migration
FT                   putative ortholog of mammalian centractin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05940g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21608"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU7"
FT                   /protein_id="CAR21608.1"
FT                   /translation="MSGSHGLYNQPVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYN
FT                   KVMAGGLASDSQLIGNEAQKMRGLLKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLANI
FT                   EEHPMLITEAPLNPMKNRNKMCEMLFETFGSPAVYVSIQAVLALYAGGRTTGCVIDCGD
FT                   GCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREIVRMIKEK
FT                   ACFVATDVGNEEQNYEGANSAELETRFKLPDGKILTLGAEKFRAPEVLFQPHLIGSEFC
FT                   SIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFGDRLLSEIRKTSEPNTKIKIFA
FT                   PPERKYSTWIGGSILAGLSTFEKLWVTRAEWQENPQCIHSRFM"
FT   gene            complement(<486413..>488239)
FT                   /locus_tag="KLTH0B05962g"
FT                   /old_locus_tag="KLTH-ORF15141"
FT   CDS_pept        complement(486413..488239)
FT                   /locus_tag="KLTH0B05962g"
FT                   /old_locus_tag="KLTH-ORF15141"
FT                   /product="KLTH0B05962p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21609"
FT                   /db_xref="GOA:C5DCU8"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU8"
FT                   /protein_id="CAR21609.1"
FT                   /translation="MSSKRTLKQILDSEYVEGSDEEADGISNAETAADVDDNEEEVDRS
FT                   FCIDCKDMKTEIICKDCEEHFCVVCFDMIHRSGRRKKHEYVKVSLQPEELPANEQEQQA
FT                   LQNSNNVVSEQNPLAGDGAEPGVTQGVNSLDLKMLAMLAKHARFIPMRLAPEERHLLRL
FT                   LEAALNVSEYTDRVDIISYKSKAKRIVEQLKEMCSVLCGLVIASNLRTGQKLLEMKNFS
FT                   DNAAWFQDVFEIGRRYKIMNPEKMRDTYGKLCYMIMDSRLPQIEEHMEFHLFKPLSTVH
FT                   SFLSSKPEDRGQALKIFEDKLILYATSQISPVGKSRPEINRLIKQKEAAIEKLASKYSS
FT                   RYFSKDDIRQVLYSIGDYNAYINMNRRPIMRMLERLEAFNNPTIATQYPIGIQYGRGGA
FT                   RLTHDHARQMHYVQQSLTLWSVIQREMIHLWYIADQDLYNPNEYRLASTGQGLNRIKAC
FT                   PMLYREMHNILSECRSKCDAWVGSSVVHLGDDAVPNALFFLDKYTQVPNILIPFDQALM
FT                   KINELVDNDPKLLEYIEGEYGSTDGLKLTILQDAFAHMFDGSGADNFYMSGSCIDGRLT
FT                   SAWNHTNMISKKKYYKIFLMTGFIGFNGQDGF"
FT   gene            complement(<489699..>491867)
FT                   /locus_tag="KLTH0B05984g"
FT                   /old_locus_tag="KLTH-ORF15135"
FT   CDS_pept        complement(489699..491867)
FT                   /locus_tag="KLTH0B05984g"
FT                   /old_locus_tag="KLTH-ORF15135"
FT                   /product="KLTH0B05984p"
FT                   /note="similar to uniprot|P38835 Saccharomyces cerevisiae
FT                   YHR131C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21610"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU9"
FT                   /protein_id="CAR21610.1"
FT                   /translation="MSEVANARKSKYIKHTSIGKTKSACSSTSISSTEGTGKIFEAIDK
FT                   PLKDPMVKVKKSKSDPGRGAEKAGASEEDIFAWIDPQPAKPPSYKSANPNRRITYPVYE
FT                   TQDSGVLPAYSPSVEEVTVVSMKMEWLDPYNCSPSRSWKNFIMEINSTQLNFYLIDPSL
FT                   TRNIKNYCNGKSHFGGESVDPDIEYEGHHSIFNSLASKGTYQFNKADQESISQRITKDK
FT                   AKYLTNNRLFRTYSLQFAKFGIPTDYSRKTFVLRLRCETEQFMLSFSHVDDMIMWSMYL
FT                   SIGIGVALDLDFRELPTYRTVPRRRRRRRRKRTNALTSSGGNDRSGSDRRSFSNSSTRN
FT                   GVLELHYPYKKRPNSMSNPDSHSNSSSRRGSNESIKSRLKSFFGSDKKAPCPSFRGPYP
FT                   RALSTVGLNAVTEDEEEEQVPSTSASASNSPQKTEIPVRPSLEQRSKSLGTLQSSSNAD
FT                   DYFGFNHRGEDARDIAVTTPGSPGSPGSEVSIGGATIASGELQLQSGYHNNVGLQNDLD
FT                   ELQQVIYEHNGEEGEETEDSPTFGNTDNDDEGEEEDDDDIDSLHPHTATAATSIYQEEG
FT                   IFHDSEDDYYYVVDRGDAFRRRASSVTSNLSSIPYGSCEVKWHPPRKEMSRRRYIRDSL
FT                   RCIRPLPEDEEWLGKVLICPTQAPAYETNNPPISGYILGGGKPGKSKAPKFRNFKTDKG
FT                   VILNKCKNHFVKPYIVGPVGFLKTNARC"
FT   gene            complement(<492629..>493867)
FT                   /locus_tag="KLTH0B06006g"
FT                   /old_locus_tag="KLTH-ORF15130"
FT   CDS_pept        complement(492629..493867)
FT                   /locus_tag="KLTH0B06006g"
FT                   /old_locus_tag="KLTH-ORF15130"
FT                   /product="KLTH0B06006p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21611"
FT                   /db_xref="GOA:C5DCV0"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV0"
FT                   /protein_id="CAR21611.1"
FT                   /translation="MLMRSVLFSLACANAVLASGTTVLEEDLEQMWGQDWPFSGIQTFA
FT                   HLPHEKCLMNRSLDFDIGVIGIPFDTAVTYRPGARFGPQAIRKSSQRQTSMRGFNFRAG
FT                   INPYQDWAKVLDCGDVPVTPMDNNLALQMMGAAYHNLLNRNSTLKQAELPPRFATLGGD
FT                   HSIILPILRQLHKIYGPISVIHFDSHLDTWAPSKYPSYWHSNNSDFTHGSMLWIAKQEG
FT                   LLSENSNVHAGLRTRLSGVGWDDYEEDKETGFHRIECDEILDIGVRGIARKILDIVPKD
FT                   KPVYISVDIDVLDPSAAPGTGTVEVGGLLTRELISIIRQLDGLSLIGADVVEVSPAYDQ
FT                   SDITSTAASQIVYELITNMVKKGPLDPAMIQANKNSEMDQGDKPQNLAENEYQSLGEGA
FT                   RQNFMESLLQGRV"
FT   gene            complement(<494230..>495027)
FT                   /locus_tag="KLTH0B06028g"
FT                   /old_locus_tag="KLTH-ORF15128"
FT   CDS_pept        complement(494230..495027)
FT                   /locus_tag="KLTH0B06028g"
FT                   /old_locus_tag="KLTH-ORF15128"
FT                   /product="KLTH0B06028p"
FT                   /note="some similarities with uniprot|P53895 Saccharomyces
FT                   cerevisiae YNL159C ASI2 Predicted membrane protein genetic
FT                   interactions suggest a role in negative regulation of amino
FT                   acid uptake"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21612"
FT                   /db_xref="GOA:C5DCV1"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV1"
FT                   /protein_id="CAR21612.1"
FT                   /translation="MTFFMLQKDNANCFKDLDQVLQIKTKSKVKTSCESKKECQGQPIE
FT                   EKMSEDLMHSLQNQNRQQRRAAAMRANPPFRVRVGPRHRQENPFRWPPGVQRRQYLRLF
FT                   LQNLLILDHLLMMVLFPFSVYNVLKILLTEVTFSNSDFVTDIASYCKFSSILSEDGRSV
FT                   ILFKSGFGLLGKFHNIIVYYSAPLFAWLSSNSSVSSFVMRTYTLVVKFTAVVLYTLYGV
FT                   SASTYVCFATFFFSLCLLMTCFRRYKGVAKIVGQLYRTTSGIF"
FT   gene            <495028..>495585
FT                   /locus_tag="KLTH0B06050g"
FT                   /old_locus_tag="KLTH-ORF15127"
FT   CDS_pept        495028..495585
FT                   /locus_tag="KLTH0B06050g"
FT                   /old_locus_tag="KLTH-ORF15127"
FT                   /product="KLTH0B06050p"
FT                   /note="weakly similar to uniprot|P53896 Saccharomyces
FT                   cerevisiae YNL158W Essential protein of unknown function
FT                   green fluorescent protein (GFP)-fusion protein localizes to
FT                   the nuclear periphery"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21613"
FT                   /db_xref="GOA:C5DCV2"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV2"
FT                   /protein_id="CAR21613.1"
FT                   /translation="MRIVPFFAALAFYICFSLANTESIVFKVPDTFSPAPQPIADENEP
FT                   LISLEGTNRALKTFDAPVDSQFDIELRDLSPGDTFFAKICWTAVDPIDITSLGYSIKPD
FT                   YTARGGHWQDAPLRFFLSFEAKSNSYPLFSKPTVPINISVSAMRMGVPVDLHATIIFMT
FT                   LLTGLIFIINRHYKLYNRFKNV"
FT   gene            complement(<495614..>496924)
FT                   /locus_tag="KLTH0B06072g"
FT                   /old_locus_tag="KLTH-ORF15126"
FT   CDS_pept        complement(495614..496924)
FT                   /locus_tag="KLTH0B06072g"
FT                   /old_locus_tag="KLTH-ORF15126"
FT                   /product="KLTH0B06072p"
FT                   /note="similar to uniprot|P38836 Saccharomyces cerevisiae
FT                   YHR132C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06072g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21614"
FT                   /db_xref="GOA:C5DCV3"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV3"
FT                   /protein_id="CAR21614.1"
FT                   /translation="MRAASAFLACLVAICSASRDYSGYKVCRFHTNNVTEVKTKIGQYH
FT                   AGSIDIWTRSSQFVDVQLPGDVADHLKECEVIIDDLNKTVKETYPVDQLEGAEKLQIFQ
FT                   QSPQLNEPAPVTMKRQDIFFDQFRDLDTIYAWLDLMQLTFPELVKIELVGQTFEGREMK
FT                   ALHISAGNHNLNPDKKTIIITGGIHAREWVGVSTACYFIYQLLTGYGTNKKETKYLNHL
FT                   DFLIVPVFNPDGYVYTWSHDRLWRKNRQQTYFPRCFGIDIDHSFDFHWTGTQDFPCSED
FT                   YSGESPFEALESESWNNYINESKSEYTIHGYLDLHSYSQEVLYPYAYSCDALPRDFENL
FT                   LELSWGLAKAIRRKSGKKYNVLSSCEDRGSDLKPGLGSGSALDYMYHHRAHWGIQLKLR
FT                   DTGNHGFLLPPKYIVPVGKESYAALKYFCDFILNPEL"
FT   gene            <497336..>497725
FT                   /locus_tag="KLTH0B06094g"
FT                   /old_locus_tag="KLTH-ORF15123"
FT   CDS_pept        497336..497725
FT                   /locus_tag="KLTH0B06094g"
FT                   /old_locus_tag="KLTH-ORF15123"
FT                   /product="KLTH0B06094p"
FT                   /note="highly similar to uniprot|Q9P305 Saccharomyces
FT                   cerevisiae YHR132W-A Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06094g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21615"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV4"
FT                   /protein_id="CAR21615.1"
FT                   /translation="MSKGNDLSPTSSNVDVKEGVDASKLTPQEAKLLKMYGRLPSKKDL
FT                   FKHKLQERKYFDSGDYALNKAGVKSDDLQSDSIGNNHLPVTNPSGLRESIIKRRLSSSA
FT                   GSVDAHDLRRQGSISSGPPPRSPNK"
FT   gene            complement(<497825..>498613)
FT                   /locus_tag="KLTH0B06116g"
FT                   /old_locus_tag="KLTH-ORF15122"
FT   CDS_pept        complement(497825..498613)
FT                   /locus_tag="KLTH0B06116g"
FT                   /old_locus_tag="KLTH-ORF15122"
FT                   /product="KLTH0B06116p"
FT                   /note="similar to uniprot|P53898 Saccharomyces cerevisiae
FT                   YNL156C NSG2 Protein of unknown function potential homolog
FT                   of mammalian Insig 1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21616"
FT                   /db_xref="GOA:C5DCV5"
FT                   /db_xref="InterPro:IPR025929"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV5"
FT                   /protein_id="CAR21616.1"
FT                   /translation="MARKKAQMANGNYSVSSESISNLTRPQLYGIYDADITHSEDAEVY
FT                   EEAKKSVGKFPEDMIKRSGAHGQRSMLQRATHILFSLTFLGVAGISYNELSKQLHDNHE
FT                   LHEEFASRPLALGVEICRTLSFGVVPTWMAYALEGVLFGALLPLMDTLWGSPVRTTTFT
FT                   SFLRSTNAMLGVAFGIRKIEWSSSLQASGAWFLLNIVLWMFFDGTPSMLLGCLGIGTIA
FT                   SVTSYRDVTEFSQMLYFMDFYFLGLLLFGKLGRYLYGHRA"
FT   gene            <498882..>499577
FT                   /locus_tag="KLTH0B06138g"
FT                   /old_locus_tag="KLTH-ORF15120"
FT   CDS_pept        498882..499577
FT                   /locus_tag="KLTH0B06138g"
FT                   /old_locus_tag="KLTH-ORF15120"
FT                   /product="KLTH0B06138p"
FT                   /note="similar to uniprot|P38838 Saccharomyces cerevisiae
FT                   YHR134W WSS1 weak suppressor of smt3"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06138g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21617"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV6"
FT                   /protein_id="CAR21617.1"
FT                   /translation="MTTQKNVHIGSLAVMQKKPNKDYALSILKDIAHRVSYLMREHKFK
FT                   VDQLVEFYPKNKRLLGMNVNRGAKIMLRLRQPFNEEEFLPREDILGTMLHELTHNVYGP
FT                   HNALFYKKLDELTARTWVIESQGLYDGFIGRGRKLGVKPAGRTPPRRLGTSGGHSVGSI
FT                   KSASEMAALAAQKRAFDAQWCASSSSTATPKPQDLQVIEIDSDGGEFTGRPKVKPERKP
FT                   EPIEVIDLT"
FT   gene            <499948..>500733
FT                   /locus_tag="KLTH0B06160g"
FT                   /old_locus_tag="KLTH-ORF15118"
FT   CDS_pept        499948..500733
FT                   /locus_tag="KLTH0B06160g"
FT                   /old_locus_tag="KLTH-ORF15118"
FT                   /product="KLTH0B06160p"
FT                   /note="similar to uniprot|P53899 Saccharomyces cerevisiae
FT                   YNL155W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06160g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21618"
FT                   /db_xref="GOA:C5DCV7"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV7"
FT                   /protein_id="CAR21618.1"
FT                   /translation="MTNVETGMLDVGTHCTFCRQLDFLPFHCKQCGGDFCSSHRSRTSH
FT                   RCASEQQQNSEQEPQSGSVSPVRNANGEYFATLLPEKGHIRVKQAEQNAQRPHRASDRS
FT                   VKDRLEASGNKSALEKLKSFFGRRSNSRAANPSKKGPANRLIQLAKLKQSAKGDPKIPM
FT                   ANRVYAFCFVIDAKDENVRHELFVNKIWPVGRALDYIANQLAVQNLNNSVQASVNEKLF
FT                   LYRDCDGVPAPLDTSCRVAAIIHDADTLYLVRGEQLPTV"
FT   gene            <500939..>502024
FT                   /locus_tag="KLTH0B06182g"
FT                   /old_locus_tag="KLTH-ORF15115"
FT   CDS_pept        500939..502024
FT                   /locus_tag="KLTH0B06182g"
FT                   /old_locus_tag="KLTH-ORF15115"
FT                   /product="KLTH0B06182p"
FT                   /note="similar to uniprot|P53183 Saccharomyces cerevisiae
FT                   YGL039W and similar to uniprot|Q12068 Saccharomyces
FT                   cerevisiae YOL151W GRE2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06182g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21619"
FT                   /db_xref="GOA:C5DCV8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV8"
FT                   /protein_id="CAR21619.1"
FT                   /translation="MDEKVLVTGCNGFVALHVLDILLSEKFHVIGTVRTPEKANRVKES
FT                   FKKLYPYANLEVEIVADITKKDAFDKIFQKYSDIQHVIHTAANVTFGNGGDRKETYLIP
FT                   ATEGTKNILESTYSLGKNVKKFVMTSSLASIMDRKHFGDPNFVHTESTWNPITWEEAEN
FT                   DDGNAYCASKKLSERLAWDFVKKHEKDIKFSLTTVCPPMIMGPQVFEWSLANETLNTSA
FT                   EKVNSALKTTPDSKGPFDSSNGLSCDVRDVALLHMLPLRNEALAGQRLFPLNGTSLKQH
FT                   NYEDARYTLQRILEILNKQFPEVRGKISAGADKSTLKTPDDLLYYNNDLTTKLTGVEFK
FT                   PFEVTVHDAAKQILDYRAAHK"
FT   gene            complement(<502282..>503778)
FT                   /locus_tag="KLTH0B06204g"
FT                   /old_locus_tag="KLTH-ORF15113"
FT   CDS_pept        complement(502282..503778)
FT                   /locus_tag="KLTH0B06204g"
FT                   /old_locus_tag="KLTH-ORF15113"
FT                   /product="KLTH0B06204p"
FT                   /note="some similarities with uniprot|P23292 Saccharomyces
FT                   cerevisiae YNL154C YCK2 membrane-bound casein kinase I
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21620"
FT                   /db_xref="GOA:C5DCV9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV9"
FT                   /protein_id="CAR21620.1"
FT                   /translation="MNGASASASQHVLGSSASSTARDDSTIVGLHYRIGKKIGEGSFGV
FT                   LFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTPGIPQAYYFGQEGLHNILV
FT                   IDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPG
FT                   TPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDME
FT                   ALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDLAQGLPVQFGRYLEVVR
FT                   SLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGGRGWDLNINKKPNLHGYGHP
FT                   NPPNDKNRRHRNKYAQGQGMDPQQQLRYQQQQLLHQQQQQQQQQQQQQQQQQQQQQQQR
FT                   QQQLQSQQQISQQQRLDPTSYEAYQQQTQQKYAQQQQKLQQQSRVHSYNQHAPQQQPNL
FT                   YGAQQPPTVKQHAQPPNKVAATDGKSVSSGKGFFSKLGCC"
FT   gene            <505357..>506424
FT                   /locus_tag="KLTH0B06226g"
FT                   /old_locus_tag="KLTH-ORF15107"
FT   CDS_pept        505357..506424
FT                   /locus_tag="KLTH0B06226g"
FT                   /old_locus_tag="KLTH-ORF15107"
FT                   /product="KLTH0B06226p"
FT                   /note="similar to uniprot|P53909 Saccharomyces cerevisiae
FT                   YNL141W AAH1 Adenine deaminase (adenine aminohydrolase)
FT                   involved in purine salvage and nitrogen catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21621"
FT                   /db_xref="GOA:C5DCW0"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW0"
FT                   /protein_id="CAR21621.1"
FT                   /translation="MPEYECTSVMREFLHELPKCEHHVHLEGTLEPDLLYPLALRNNVT
FT                   LPNQFPKTVEELEKRYVMFRDLQDFLDFYYIGCEVLLQEEDFFDLAWAYFKRAHAQGLR
FT                   HAEVFFDPQSHTPRGVAIETVVAGFKRACQKALDELQVTSKLIMCLLRHLPVEECKATL
FT                   ESSRVLFETQQLHGLGLDSAEQPFPPELFTECYELARQFHPDVKLTAHAGEEGSAKYVS
FT                   NALDLLQVTRIDHGVRSVEDPELVARLARDKTMLTICPLSSLKLQVVKDISDLPLTQLL
FT                   EAGVPFSINSDDPAYFGGYILDNYVAVQKKFNWDAATWAKVARQAIEGSWCDGKRKDEL
FT                   LTMLAAVVDKYSALI"
FT   gene            complement(<506590..>507123)
FT                   /locus_tag="KLTH0B06248g"
FT                   /old_locus_tag="KLTH-ORF15106"
FT   CDS_pept        complement(506590..507123)
FT                   /locus_tag="KLTH0B06248g"
FT                   /old_locus_tag="KLTH-ORF15106"
FT                   /product="KLTH0B06248p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21622"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW1"
FT                   /protein_id="CAR21622.1"
FT                   /translation="MTSFGTYRTMEDPELLFQFSTPLVGSSRTLPTGISAGEPSSRWPG
FT                   FDASPRAAAADDEERDGDAATLQGSGASICDEAATLYSHTVKRDTPAESGARSEAPWVN
FT                   AAAIGSGYAPHPLKSGTASVYRSNAALLSRFNNALSKSFSSDQLHQIERMVDEFWLRES
FT                   ALTEDMFEDSSDEE"
FT   gene            <508642..>510219
FT                   /locus_tag="KLTH0B06270g"
FT                   /old_locus_tag="KLTH-ORF15101"
FT   CDS_pept        508642..510219
FT                   /locus_tag="KLTH0B06270g"
FT                   /old_locus_tag="KLTH-ORF15101"
FT                   /product="KLTH0B06270p"
FT                   /note="similar to uniprot|P38840 Saccharomyces cerevisiae
FT                   YHR137W ARO9 Aromatic aminotransferase catalyzes the first
FT                   step of tryptophan phenylalanine and tyrosine catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21623"
FT                   /db_xref="GOA:C5DCW2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW2"
FT                   /protein_id="CAR21623.1"
FT                   /translation="MQALEEHYKPFLSSRVEARKFSPFWSQNLPEGLKPHPKPIDLGPG
FT                   LPHEGFFPIESMHLNVVEEPFQHTSAGTKSHKLHKPAPEGSKHFEERAFVTEKLSSDSA
FT                   VDVWRYEPNSPEVIPLSQGLQYTETAGMKQLLDFCRGFVSYAHPPAYNEWDVTLANGSS
FT                   DATFKIIETLCDSSVTVLVEEFTFSPTLAIITAAGGTTVPLKLDITADPDVQGINVEYL
FT                   TDLLDNWSQGPNAHLSKPKLLYTIPTGQNPTGMTLSFEKRKQIYALAEKHDFIIIEDDP
FT                   YGYLRYPFYDRKNPDYNPYALHEYTAKDYCEKVLSKSFITMDTSGRVLRCETFSKVFCP
FT                   GLRLSFIAGNKYLIKKIVDFAEVSSRAPSGLSQLIVNNVIQKWAKSYSSPQEAWLVWVM
FT                   KVAGHYTHRRNMFVQALEATEAFSEGLFSLAQTSAGMFLAVEINFDHFAKSLSITERSK
FT                   AMQRLSSISIEEGVGIIQGINMAADRKYSLARSFFLRLTFAFAADVEELQEAADRLGKS
FT                   VKRLAAEL"
FT   gene            <510493..>510947
FT                   /locus_tag="KLTH0B06292g"
FT                   /old_locus_tag="Klth0B.mRNA.486.p"
FT   CDS_pept        join(510493..510501,510567..510947)
FT                   /locus_tag="KLTH0B06292g"
FT                   /old_locus_tag="Klth0B.mRNA.486.p"
FT                   /product="KLTH0B06292p"
FT                   /note="similar to uniprot|P53900 Saccharomyces cerevisiae
FT                   YNL153C GIM3 Subunit of the heterohexameric cochaperone
FT                   prefoldin complex which binds specifically to cytosolic
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06292g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21624"
FT                   /db_xref="GOA:C5DCW3"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016661"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW3"
FT                   /protein_id="CAR21624.1"
FT                   /translation="MDLLPEGKKNTVQVLYEDQQKINEFSKLIMRKDAINQELAHYKQE
FT                   KGYLDDVSLEIELIDEDEQIQYRIGEAFVFMKQSEVVEQLEKDAEALDQKIEELEDADS
FT                   EISSRTSELKTVLYAKFGDNINLER"
FT   gene            complement(<511087..>511500)
FT                   /locus_tag="KLTH0B06314g"
FT                   /old_locus_tag="Klth0B.mRNA.1244.m"
FT   CDS_pept        complement(join(511087..511370,511440..511500))
FT                   /locus_tag="KLTH0B06314g"
FT                   /old_locus_tag="Klth0B.mRNA.1244.m"
FT                   /product="KLTH0B06314p"
FT                   /note="similar to uniprot|P38841 Saccharomyces cerevisiae
FT                   YHR138C Homologous to PBI2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06314g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21625"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW4"
FT                   /protein_id="CAR21625.1"
FT                   /translation="MRLLVIITACLSAMAYAATANNVKSYILTLDDNQPALAGKIQDLK
FT                   SFVQQVGGKITHEYSLIKGFSLQLPADDSSDILQKIESFGEKLSCKLNLEQDQEVHTFK
FT                   GPEPFEASAE"
FT   gene            complement(<511768..>513249)
FT                   /locus_tag="KLTH0B06336g"
FT                   /old_locus_tag="KLTH-ORF15097"
FT   CDS_pept        complement(511768..513249)
FT                   /locus_tag="KLTH0B06336g"
FT                   /old_locus_tag="KLTH-ORF15097"
FT                   /product="KLTH0B06336p"
FT                   /note="similar to uniprot|P41948 Saccharomyces cerevisiae
FT                   YNL142W MEP2 Ammonium permease involved in regulation of
FT                   pseudohyphal growth belongs to a ubiquitous family of
FT                   cytoplasmic membrane proteins that transport only ammonium
FT                   (NH4 ) expression is under the nitrogen catabolite
FT                   repression regulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06336g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21626"
FT                   /db_xref="GOA:C5DCW5"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW5"
FT                   /protein_id="CAR21626.1"
FT                   /translation="MSVNLTGTPTGTGTGGDSLTTDLNTQFQAADMVWIGTSAALVWIM
FT                   VPGIGLLYSGLSRKKHALSLLWASIMTVSVVSFQWFWWGYSLVFSHSTRGNGFIGTLQF
FT                   FGFKDVLGAPSSVSSVPDILFAFFQGMFAMVTGILMVGGACERARLFPMMVFLFLWITI
FT                   VYCPIACWTWNAEGWLAALGALDYAGGGPVHICSGHGALIYALILGKRNDPIAKSGTPK
FT                   YKPHSVTSVVLGTVFLWFGWFGFNGGSAGNSTIRAWYSCVSTNLAASCAGLTWMFIDYF
FT                   RFGRKWTTVGLCSGAIAGLVGITPAAGFVPVWASVIIGIVTGAGCNFAVDLKNLLRIDD
FT                   GLDVYALHGVGGAIGSVLTGIFAADYVNATAGDEMAPIDGGWINHHWKQVGYQLAAICS
FT                   VIAWTCVVTSILLLVMDRIPFLRLRLRPEEEEMGTDGAQIGEFTYAEEEMYIPEPIRSH
FT                   NTANVPQPAAIDDHIGENHTDSTDLTGHPTEKVVV"
FT   gene            complement(<513940..>514731)
FT                   /locus_tag="KLTH0B06358g"
FT                   /old_locus_tag="KLTH-ORF15089"
FT   CDS_pept        complement(513940..514731)
FT                   /locus_tag="KLTH0B06358g"
FT                   /old_locus_tag="KLTH-ORF15089"
FT                   /product="KLTH0B06358p"
FT                   /note="weakly similar to uniprot|P38842 Saccharomyces
FT                   cerevisiae YHR140W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06358g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21627"
FT                   /db_xref="GOA:C5DCW6"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW6"
FT                   /protein_id="CAR21627.1"
FT                   /translation="MRLPRQPQPQYKKTAPAGGAGLDRPAYAVVHSRDYDFDSTTMRAN
FT                   GRTMTCAALNALCLCTSTWGLWRATEVRLPASLAGAGHRQFLTILAVVATIITNVANLG
FT                   ALAAGGARARRAARQVALPVALVVETVVAVVYWPLRLFALPLIMHDVKDGSRMPLAVSV
FT                   DCAVHLAPVVLLGADYALVEQRPFEMSLGRAWVVVTALGLGYRRYLETMVDRAGGAAYP
FT                   YPFLDVAEPYQSGIFVVVTTAAWAVFWGYKKVHAGRASGRT"
FT   gene            <515228..>516265
FT                   /locus_tag="KLTH0B06380g"
FT                   /old_locus_tag="KLTH-ORF15082"
FT   CDS_pept        515228..516265
FT                   /locus_tag="KLTH0B06380g"
FT                   /old_locus_tag="KLTH-ORF15082"
FT                   /product="KLTH0B06380p"
FT                   /note="similar to uniprot|P38616 Saccharomyces cerevisiae
FT                   YNL160W YGP1 may be involved in cellular adaptations prior
FT                   to stationary phase YGP1 encodes gp37 a glycoprotein
FT                   synthesized in response to nutrient limitation which is
FT                   homologous to the sporulation-specific SPS100 gene"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06380g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21628"
FT                   /db_xref="GOA:C5DCW7"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW7"
FT                   /protein_id="CAR21628.1"
FT                   /translation="MRASLILSAICAAGAASPIAAVGDDTTYVVEAGPASLTPWNVWPS
FT                   WSNASNVSNYSNLSNATAQVAAPKLEVIVTGGQYTMSNWSSEVHVTRLFNQSTLNATQL
FT                   ARVAQSVEGALDGGEYTGVVVLGAGRALEALGFYLSVVVDTPENVVVASALEDGVATAW
FT                   SAWSWFRGALVVDGGVIYSGAAYSPSAPGWGALGSVIAGAPRYWFTPAWPTLLAPWGSL
FT                   RVNFTNFTDIVPAPAANATNSSSSMTVPVVFDGYYDPSIVSSLSTAIAGLVVVSSGNST
FT                   ASDLTSSNIPVVFTSDDGATILPEDVPAGAIAGGDLSPLKAQLLLSIALSKDVKETSSL
FT                   QQLFA"
FT   gene            complement(<516622..>517707)
FT                   /locus_tag="KLTH0B06402g"
FT                   /old_locus_tag="KLTH-ORF15075"
FT   CDS_pept        complement(516622..517707)
FT                   /locus_tag="KLTH0B06402g"
FT                   /old_locus_tag="KLTH-ORF15075"
FT                   /product="KLTH0B06402p"
FT                   /note="similar to uniprot|P53183 Saccharomyces cerevisiae
FT                   YGL039W and similar to uniprot|Q12068 Saccharomyces
FT                   cerevisiae YOL151W GRE2 NADPH-dependent methylglyoxal
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06402g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21629"
FT                   /db_xref="GOA:C5DCW8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW8"
FT                   /protein_id="CAR21629.1"
FT                   /translation="MDEKVLVTGASGYIAMHIINILQSERYHVIATVGTPEDANKIAYS
FT                   FEHYYPYAVLDVVVVEDVAAEDAFEEVFEQHPDIQHVIHTAPPALLGQGKTNEEAYLVP
FT                   TREGTKNVLESIRKRGHNVKRVVVTSSFSALMDLDNAANPQCVITEKSWNPVTWEVAKD
FT                   KESKAYAASKKIAEQLVWKFYEDNKDCVPYTLTTVNPPYVFGPHVFEWELGRAEWNTTA
FT                   LFIKKALEMSADEQGPFAKPRGICCDVRDAALLHILPLRNAALAGHRLFPVNGTGIKQN
FT                   SYEDGKFNMQRIVDVLNARFPELQGKIPQGLPTENQQYMGQLTRYNNDNTCELTGMEFK
FT                   SFETTVVDATRQIMRFQERHT"
FT   gene            complement(<518184..>520328)
FT                   /locus_tag="KLTH0B06424g"
FT                   /old_locus_tag="KLTH-ORF15072"
FT   CDS_pept        complement(518184..520328)
FT                   /locus_tag="KLTH0B06424g"
FT                   /old_locus_tag="KLTH-ORF15072"
FT                   /product="KLTH0B06424p"
FT                   /note="similar to uniprot|P53894 Saccharomyces cerevisiae
FT                   YNL161W CBK1 Protein kinase involved in cell wall
FT                   biosynthesis required for efficient apical growth proper
FT                   mating projection morphology bipolar bud site selection in
FT                   diploid cells and cell separation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06424g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21630"
FT                   /db_xref="GOA:C5DCW9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCW9"
FT                   /protein_id="CAR21630.1"
FT                   /translation="MFGGVNNSYGKPGATYSPGAGKNDSYQSPNRYSAASNGSHNTGSG
FT                   MARPPAAAFSSNYLREQGSHQSLQDHLQKEVPMRGTSPIHGGFTDVPNLNYPSTPTNST
FT                   GFLSAQNPPVLSTPPTSNFGTAQSTYNHNNNSQSNLRNNVFSNPHVSPGQYSLGSDYGA
FT                   ESHTLQSPHAQQQFTPVPPAQSSPVRSLRGVTQPQPLMDQQQRPQNPANPVSNYMYFER
FT                   RPDLLSKSTQDKAATVKLKIENFYQSSVNYAIERNQRRVELESQLVSQDWSDERKSRQL
FT                   STLGKKESQFLRLRRTRLSLEDFQTVKVIGKGAFGEVRLVQKRDTGKIYAMKTLLKSEM
FT                   YKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIF
FT                   TEDVTRFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDS
FT                   NYYKKLLQQDEVNAASGNLQKPQMGIAAGNDTSNGSNRNTMFVDAIHLTMTNRQQIQTW
FT                   RKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQET
FT                   YRKIMNFEQALQFPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKNHPFFRGVDWN
FT                   TIRQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAARQREQMMKQGVTGSASKED
FT                   LPFIGYTYSRFDYLTRKNAL"
FT   gene            complement(<520647..>521302)
FT                   /locus_tag="KLTH0B06446g"
FT                   /old_locus_tag="Klth0B.mRNA.1227.m"
FT   CDS_pept        complement(join(520647..520963,521299..521302))
FT                   /locus_tag="KLTH0B06446g"
FT                   /old_locus_tag="Klth0B.mRNA.1227.m"
FT                   /product="KLTH0B06446p"
FT                   /note="highly similar to uniprot|P02405 Saccharomyces
FT                   cerevisiae YHR141C RPL42B and highly similar to
FT                   uniprot|P02405 Saccharomyces cerevisiae YNL162W RPL42A
FT                   Proteins component of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21631"
FT                   /db_xref="GOA:C5DCX0"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX0"
FT                   /protein_id="CAR21631.1"
FT                   /translation="MVNVPKTRRTYCKGKQCRKHTQHKVTQYKAGKASLYAQGKRRYDR
FT                   KQRGFGGQTRPIFHKKAKVTKKVVLRLECVVCKTRAQLALKRCKHFELGGEKKQKGQAL
FT                   QF"
FT   gene            <522154..>523107
FT                   /locus_tag="KLTH0B06468g"
FT                   /old_locus_tag="KLTH-ORF15063"
FT   CDS_pept        522154..523107
FT                   /locus_tag="KLTH0B06468g"
FT                   /old_locus_tag="KLTH-ORF15063"
FT                   /product="KLTH0B06468p"
FT                   /note="similar to uniprot|P38843 Saccharomyces cerevisiae
FT                   YHR142W CHS7"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06468g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21632"
FT                   /db_xref="GOA:C5DCX1"
FT                   /db_xref="InterPro:IPR022057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX1"
FT                   /protein_id="CAR21632.1"
FT                   /translation="MGFGDFRSICSKTPLPLCSVIKSSKHLVLGAHQKVEDFDTKDFRT
FT                   GVLPKCYARSIDVANTVVFQIGNAFVNIGALGVIMFMIYSTRQKYTAIGRSEYGFFFEL
FT                   CLALICFTLVVDCGVSPPGSDSYPYFVAVQIAFAGACCWTMAVLGFLGFRFWEDGTRKS
FT                   MALVRGMAFIGFIINFLVAVFSFKAWKAVDSYAESNTTGLFVVMYLLNAIAIFLYIVCQ
FT                   LIVSLFVINNLWAAGAVLLGLFFLVAGQVITYAFSDAICVGVKHYLDGLFFGSLCNIFA
FT                   LMMVYKNWDMTTDDDLEFSVSVNKGNELGFMSDFNF"
FT   gene            complement(<523220..>523429)
FT                   /locus_tag="KLTH0B06490g"
FT                   /old_locus_tag="KLTH-ORF15060"
FT   CDS_pept        complement(523220..523429)
FT                   /locus_tag="KLTH0B06490g"
FT                   /old_locus_tag="KLTH-ORF15060"
FT                   /product="KLTH0B06490p"
FT                   /note="similar to uniprot|Q3E7A8 Saccharomyces cerevisiae
FT                   YNL162W-A Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06490g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21633"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX2"
FT                   /protein_id="CAR21633.1"
FT                   /translation="MSEKSCPQCGEELKKCLIQQNYSLIICPNEGCCYPFNEREAIDNI
FT                   VYTKDAEILNAAKRRLEEEEQQKR"
FT   gene            <523580..>526882
FT                   /locus_tag="KLTH0B06512g"
FT                   /old_locus_tag="KLTH-ORF15059"
FT   CDS_pept        523580..526882
FT                   /locus_tag="KLTH0B06512g"
FT                   /old_locus_tag="KLTH-ORF15059"
FT                   /product="KLTH0B06512p"
FT                   /note="similar to uniprot|P53893 Saccharomyces cerevisiae
FT                   YNL163C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21634"
FT                   /db_xref="GOA:C5DCX3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX3"
FT                   /protein_id="CAR21634.1"
FT                   /translation="MSRVGPETSKRLQKDPSCIRNICILAHVDHGKTSLSDSLLASNGI
FT                   ISQKLAGKVRFLDSRPDEQLRGITMESSAISLYFRVLRKQEGKDEPLVNEHIINLIDSP
FT                   GHIDFSSEVSAASRLCDGAVVLVDVVEGVCSQTITVLRQCWIEKLKPVLVLNKIDRLVT
FT                   ELQLTPQEAYVHLNKIIEQVNSIIGSFFNGQRLLDDLSWREQLENNTNAEFVEKDDTDI
FT                   YFKPENNNVVFTSAVDGWGFNIGQIAKFYESKLGAKRENLQKVLWGDFYIDPKTKKFIN
FT                   SKGLKGRTLKPLFVSLILDNIWKIYNNVLVERNADVLEKITQTLNIKVSQRDLRSKDLK
FT                   NLLRTIMGQWLPVSTSILLTVIEKVPSPLESQSEKMEIIIGNAPGSDLIDKGLYKSMES
FT                   CDKDGPVCAYVSKMLSIPKEELPINNGKPLSQGELMERSRAAREQALKAAKAAELAESL
FT                   SRTNASKDEGRGFYERAQETVATPQLGTANHSADNTTSKPSETDTFKIVNEPAQEFDLG
FT                   LDLGDEDYEDEDDINLEPEFSPAVIDPNDPLSSMFEYEEEDPFETNNEAELEEDDAGDF
FT                   EESDEVMIGFARLYSGTLKVGQKVSVLGPKYDPRFPADHIEQVEITDLFIFMGKELVPL
FT                   TECPPGNIVGIGGLAGKILKNGTIVDPQVQGANLAGVNLHVTPIVRVALEPTNPTQMGR
FT                   LARGLKLLDQADPCVQTYVEDTGEHILCTAGELHLERCLKDLRERFAGIGITSSKPAIP
FT                   YKETFLSTSDMNPPKNAELGRGVCQRYLGEYAFKFRSAPLPENITQYLTEQEANIKSLV
FT                   EEKQQSNESSEFSKNLKNLFTEAAAKNKIWDQCNSCISAFGPKRAGPNILIAENVLSGQ
FT                   KDGEETSDTFEYKSSIINGFELAVSGGPLAKEPVSGMCVIVEDIHKMSQEEIDQLEVQN
FT                   YQAEVPNFSGRLITTARDIIHSTFLDWSPRIMWAMYSCEIQASVEVLGKVYAVVQQRRG
FT                   KIVSEEMKEGIPLFQIEAQIPVVEAFGFSEDIRKKTSGAAQPQLVFAGFECIDLDPFWV
FT                   PTTEEELEELGDTADKENIARKHMNMIRRRKGLFVDEKIVQNAEKQRTLKRN"
FT   gene            <527044..>527943
FT                   /locus_tag="KLTH0B06534g"
FT                   /old_locus_tag="KLTH-ORF15057"
FT   CDS_pept        527044..527943
FT                   /locus_tag="KLTH0B06534g"
FT                   /old_locus_tag="KLTH-ORF15057"
FT                   /product="KLTH0B06534p"
FT                   /note="weakly similar to uniprot|P53892 Saccharomyces
FT                   cerevisiae YNL164C IBD2 Component of the BUB2-dependent
FT                   spindle checkpoint pathway interacts with Bfa1p and
FT                   functions upstream of Bub2p and Bfa1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21635"
FT                   /db_xref="GOA:C5DCX4"
FT                   /db_xref="InterPro:IPR026231"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX4"
FT                   /protein_id="CAR21635.1"
FT                   /translation="MCPSNNTSIEVVSKDGPVDFNVMMQEGVKALTKVLADHLQDHPDY
FT                   LKQQSMKLVFNNDIDKSGENGEAAGTSEEDAKQITATKSAGDEEIEEADLRNKSNYHMC
FT                   KEMSPQTHKLSSLYSPSKNKQSPSIAQPSEFDCEEGELVFDYGEQDLMSLPGEFGDSIK
FT                   KMVASSMAQDPSGRHSNINIDLDVDDTLSDNNDSPEPNSFSDQPSQKQHGHQKHRRCRH
FT                   GGDSNREHEFEYPHHPKVTPDFASLITYDQPLCMFCEYYFVFGEPPKNMIKWFQRTGGR
FT                   DTSAHCRSYQRHSNSTQH"
FT   gene            <528699..>529601
FT                   /locus_tag="KLTH0B06556g"
FT                   /old_locus_tag="KLTH-ORF15056"
FT   CDS_pept        528699..529601
FT                   /locus_tag="KLTH0B06556g"
FT                   /old_locus_tag="KLTH-ORF15056"
FT                   /product="KLTH0B06556p"
FT                   /note="some similarities with uniprot|P38844 Saccharomyces
FT                   cerevisiae YHR143W DSE2 daughter-specific expression
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21636"
FT                   /db_xref="InterPro:IPR026225"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX5"
FT                   /protein_id="CAR21636.1"
FT                   /translation="MQFKLSTIATALTFLSSMVCADSNVRYITSDGVVYSFAVITSTIK
FT                   PATTYVTTRYYTTTEVVPVTLSNQVVSSSTKAVTKTSTLEVVSSTAPAESSSLTPESTS
FT                   TLSSSQQPDTTSSQSQSSNTRSTLSTAIQSSSAASASSTFSLISSSIPASSSPRSTFVS
FT                   STDVSSSVSSATYSASSASSSSSSSAIASSTSSAFSSTSNTPGISSSSASATSASSASK
FT                   SSSTITKSSPSVTSIASSTLSLEGEAFTTEYDEDGSCTVYYEDDDDYYTTVYLTDSSQS
FT                   VDAYTTYTSTRTVYETIST"
FT   gene            complement(<529673..>530818)
FT                   /locus_tag="KLTH0B06578g"
FT                   /old_locus_tag="KLTH-ORF15054"
FT   CDS_pept        complement(529673..530818)
FT                   /locus_tag="KLTH0B06578g"
FT                   /old_locus_tag="KLTH-ORF15054"
FT                   /product="KLTH0B06578p"
FT                   /note="similar to uniprot|P53891 Saccharomyces cerevisiae
FT                   YNL165W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21637"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX6"
FT                   /protein_id="CAR21637.1"
FT                   /translation="MDRVRNLVRRSNGSRANRENNASVLRDPVASDSDQATLVESKRSD
FT                   ERRSHNEEGVTLQRRNSETSTIGDLRVSGFVNRCPLFHDLRHIVFASTVMGKGFYAFPS
FT                   IESFQKFRENKRRLDELHDEQALGFPLFHAVPVNVFRTIIKRSLPMMKIYRFVLVDTSV
FT                   PGEAEKYQENETCTLMAQLGATCVYKLEFCQVYQRIHTNTSFVEYKFTFRIDNRPENNL
FT                   FSMRMVNHVHRRDTDSRINDLNLRWLGTSGLASPFGSGTFQLAVLDDGIASYLDELPGS
FT                   SREQLGRAADQPRSPWQMPVWATYSDGKATFIPKKRTLRVADFKIKELAQCCQGLQDVP
FT                   WDTLVLTCMCMVLHDLEARKDRRSMNVTAGNDMALASFSFM"
FT   gene            <531018..>532247
FT                   /locus_tag="KLTH0B06600g"
FT                   /old_locus_tag="KLTH-ORF15052"
FT   CDS_pept        531018..532247
FT                   /locus_tag="KLTH0B06600g"
FT                   /old_locus_tag="KLTH-ORF15052"
FT                   /product="KLTH0B06600p"
FT                   /note="weakly similar to uniprot|P53890 Saccharomyces
FT                   cerevisiae YNL166C BNI5 Protein involved in organization of
FT                   septins at the mother-bud neck may interact directly with
FT                   the Cdc11p septin localizes to bud neck in a septin-
FT                   dependent manner"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21638"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX7"
FT                   /protein_id="CAR21638.1"
FT                   /translation="MDQETLRKRMSQIELEIDEMNQVIDENLQLAEPHGDEPPEHEKKK
FT                   RWDSGTSKDPETGPEEPETQQVIEAELFLRSATRPVPPSIPAATELGKEQRTKPALENE
FT                   PTHSEHMNQPPAERVPLEQTPSDGGVSLAPSQYVDAPEAVPAQSSSKSEAAPADIGLRE
FT                   TQPLNGISSRQAGSVGSAGSPRESQPSTETAETPSSEVDREQPDEHLQPPSEEFTTTAS
FT                   RGFKAASREDARKEMPQQSTLGNNEPQEASAGMSFDENSPSTQSSAGSKQPVSPDSTQS
FT                   SPQLNLPKTRNPAFPGKRATSNPNPFRVVSVTSKQTEDVSPAQKLQTRHDYLARKCIKL
FT                   QREIQYLSDLRDRGAVAPEDARKINSALEKLQEYLDLKTKERYEIGVLLSRQLRREIDR
FT                   GENGQFWVGH"
FT   gene            <532482..>532694
FT                   /locus_tag="KLTH0B06622g"
FT                   /old_locus_tag="KLTH-ORF15048"
FT   CDS_pept        532482..532694
FT                   /locus_tag="KLTH0B06622g"
FT                   /old_locus_tag="KLTH-ORF15048"
FT                   /product="KLTH0B06622p"
FT                   /note="highly similar to uniprot|P40422 Saccharomyces
FT                   cerevisiae YHR143W-A RPC10 RNA polymerase subunit ABC10-
FT                   alpha common to RNA polymerases I II and III"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21639"
FT                   /db_xref="GOA:C5DCX8"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR039747"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX8"
FT                   /protein_id="CAR21639.1"
FT                   /translation="MSREGFQIPTNLDAAAAGTAAARTATLKYICAECSSKLSLSRTDP
FT                   VRCKDCGHRILLKARTKRMVQFEAR"
FT   mobile_element  complement(533009..535201)
FT                   /mobile_element_type="transposon"
FT                   /locus_tag="KLTH0B06666s"
FT                   /old_locus_tag="dnatranposon.9"
FT                   /note="DNA transposon of KLTH part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:degenerate
FT                   copy"
FT   gene            <537899..>538249
FT                   /locus_tag="KLTH0B06688g"
FT                   /old_locus_tag="KLTH-ORF15039"
FT   CDS_pept        537899..538249
FT                   /locus_tag="KLTH0B06688g"
FT                   /old_locus_tag="KLTH-ORF15039"
FT                   /product="KLTH0B06688p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21640"
FT                   /db_xref="GOA:C5DCX9"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX9"
FT                   /protein_id="CAR21640.1"
FT                   /translation="MVSPVITIFRIVLAMALSNLFLGFVLFSPLRDNGLGASDLMDLWT
FT                   TIAAVEPRGDTRGWDRIASYINEYLITNGAPGRLAQFYDGEDCIQRFKKRYSASLLKKK
FT                   RRGGGKFEDLRS"
FT   gene            <538970..>540142
FT                   /locus_tag="KLTH0B06710g"
FT                   /old_locus_tag="KLTH-ORF15038"
FT   CDS_pept        538970..540142
FT                   /locus_tag="KLTH0B06710g"
FT                   /old_locus_tag="KLTH-ORF15038"
FT                   /product="KLTH0B06710p"
FT                   /note="weakly similar to uniprot|P38723 Saccharomyces
FT                   cerevisiae YHL048W COS8 Nuclear membrane protein member of
FT                   a family of conserved often subtelomerically-encoded
FT                   proteins regulation suggests a potential role in the
FT                   unfolded protein response"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21641"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY0"
FT                   /protein_id="CAR21641.1"
FT                   /translation="MRGTFKEDPEAHELRNPKTHYRNKASWELAQMATGLSIPKWMSSG
FT                   LIICMFIAAHDVYYERAPARSWHRQQLYNVLLSSFAMLFESPYQKIKRTIKLQMEQLCR
FT                   EVLEGNPGMQIEQWDLVAQRLNDFLHAEGHWPVTNPLFDGHMCHSLFRKLVVHPVNKKL
FT                   LATRVQRATVDAREGELSTRTSAASEPAKDTIACYESGMREWWARNAKPEKQEGIDVAC
FT                   RKLPKEVVWSKVGWQFSVAMAALVQTRAFIPISFLSFIGLGTVYSIDTIFRLTPVVLSN
FT                   VFWGIILSPALRDTDVNARDLMELWATIVAVEPRGDTSEWDRVASHMNKYLVTASAAGR
FT                   AAQFYDGENCMQRFKKWYSASLLPKEGQVDARFEDLQPYIEAAMDAASED"
FT   gene            <541428..>543518
FT                   /locus_tag="KLTH0B06732g"
FT                   /old_locus_tag="KLTH-ORF15034"
FT   CDS_pept        541428..543518
FT                   /locus_tag="KLTH0B06732g"
FT                   /old_locus_tag="KLTH-ORF15034"
FT                   /product="KLTH0B06732p"
FT                   /note="some similarities with uniprot|Q02100 Saccharomyces
FT                   cerevisiae YNL167C SKO1 Basic leucine zipper (bZIP)
FT                   transcription factor of the ATF/CREB family that forms a
FT                   complex with Tup1p and Ssn6p to both activate and repress
FT                   transcription cytosolic and nuclear protein involved in the
FT                   osmotic and oxidative stress responses"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21642"
FT                   /db_xref="GOA:C5DCY1"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR020956"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY1"
FT                   /protein_id="CAR21642.1"
FT                   /translation="MNECQTGTALQRKCHAHSYWLRHTLALITRSSSPTGQLGTYCSAK
FT                   HVPASTVLSSSARTDYRVAPERAQLSATRSSLPAARAQETVAATYRQAQPVTSPSAMRA
FT                   SDPPANDASLVSSFDLEPNPFEQSFASSDKPHGAGGAGVAGHQQVQRARQQSQSQSQSQ
FT                   PQSQPQSQPQLQGQSQQPTPSQPTLPSVHSAQSAASAQPKLPVIPTTPGGSRRLPPLLL
FT                   ANPAPAPATATTAVTATNALATPSAPQHGASAGGSQQAPQVPQASAGSATPGFFINLSK
FT                   TGLTPNESGLRTGLTPGILTAAAPPHPPPPVSLPSGQFTPGLSSLLGLPLGQQPGQQQQ
FT                   AAQQPQQPQQTQQVSQQPAQQQQQQQQQQQQQQQQQQQQQQLPPHPAMSWSHSSSTAVS
FT                   SDPSTTSSQNVKPRNNTSSSSSSSLAQDGTSALSLSEPAQKRQKLSSALPAKKPKNSEP
FT                   SPLDVKDEQERKRKEFLERNRVAASKFRKRKKEYIKKIESDLQFYEAEYDDLSQCMDKL
FT                   CGISKQTINSSLVGMLKQALLRHDVTSSLTVCNHIEQVLLQTKYVQRGGRNPRREEEEK
FT                   RRMESPDADINSDSTYPRRASLATASTDGYHTSQLQPHQLQSHIRPDAGPQLSAADHAT
FT                   GTINNLPLVINGNTLLGLGDIQDPSHNAGAGTVTMSRPTSLTSLQPENNRSVPLHEYPN
FT                   SN"
FT   gene            <543748..>544752
FT                   /locus_tag="KLTH0B06754g"
FT                   /old_locus_tag="KLTH-ORF15030"
FT   CDS_pept        543748..544752
FT                   /locus_tag="KLTH0B06754g"
FT                   /old_locus_tag="KLTH-ORF15030"
FT                   /product="KLTH0B06754p"
FT                   /note="similar to uniprot|P53889 Saccharomyces cerevisiae
FT                   YNL168C FMP41 The authentic non-tagged protein was
FT                   localized to mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21643"
FT                   /db_xref="GOA:C5DCY2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY2"
FT                   /protein_id="CAR21643.1"
FT                   /translation="MFKVFYILILWFYCFTCFRCAPIRPVGTGRWRLGILRGCTYLGIF
FT                   SRLFGSSHKGSLTTTHQQKLGKGCHQSKMDYSYLKAARKIVCIGRNYAAHVKELNNPFP
FT                   KQPFFFLKPSSSIVTPHDKQAPQETRQHAECSYRGLNADGTNPGAIMIPEGVKVHHEVE
FT                   LALIIGDYISNASPSAFGPKELRRAISGIALSLDLTARNVQDEAKRKGLPWSIGKGFDT
FT                   FLPMSKFIPEARLGKNLDLQDAFRLKCTVNSITRQDGTTGLMLTPLHTIVQHISTMMSL
FT                   EPGDIILTGTPAGVGELKPGDSVYSELFFNGEPLVNMQFDCVKRPGPYVYRET"
FT   gene            complement(<544782..>545789)
FT                   /locus_tag="KLTH0B06776g"
FT                   /old_locus_tag="KLTH-ORF15029"
FT   CDS_pept        complement(544782..545789)
FT                   /locus_tag="KLTH0B06776g"
FT                   /old_locus_tag="KLTH-ORF15029"
FT                   /product="KLTH0B06776p"
FT                   /note="similar to uniprot|P06773 Saccharomyces cerevisiae
FT                   YHR144C DCD1 Deaminase required for dCTP and dTTP synthesis
FT                   expression is cell cycle regulated"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21644"
FT                   /db_xref="GOA:C5DCY3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY3"
FT                   /protein_id="CAR21644.1"
FT                   /translation="MLLYVSETAGSGAWRLVEVLEKKFGFKRCFAEGGSVDLVVEEATA
FT                   RFTENWILSGELGLEELQKLEKRPFFAHITIDAALKLRVAGFGVEKNAGTGPATGADAT
FT                   AGTEASVGSQLQALIEHTEQQLERNPSLPLVLGRADIKFYVRTRDKLEFDCLAQELDRH
FT                   LREINQGRDVRVPYHNTTPLRPDWDTYFMKLATLAASRSNCMKRRVGCVIVRDCRVIAT
FT                   GYNGTPRHLVNCHSGGCPRCNNGDAQLHACLCLHAEENALLEAGRDRVGPNAILYCDTC
FT                   PCLTCSVKIVQTGIREVVYSQSYRMDEASFKVLQEGGVLVRQFSVLESPRYTVL"
FT   gene            <546016..>547554
FT                   /locus_tag="KLTH0B06798g"
FT                   /old_locus_tag="KLTH-ORF15027"
FT   CDS_pept        546016..547554
FT                   /locus_tag="KLTH0B06798g"
FT                   /old_locus_tag="KLTH-ORF15027"
FT                   /product="KLTH0B06798p"
FT                   /note="similar to uniprot|P39006 Saccharomyces cerevisiae
FT                   YNL169C PSD1 Phosphatidylserine decarboxylase of the
FT                   mitochondrial inner membrane converts phosphatidylserine to
FT                   phosphatidylethanolamine"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21645"
FT                   /db_xref="GOA:C5DCY4"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033661"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY4"
FT                   /protein_id="CAR21645.1"
FT                   /translation="MMNVKLGIMKGGTGMKSRLGMYKLGGAAGTRIRNRTASLWNRRFY
FT                   SSRANHMLRISGYDRQVVVKLVVVTGVTLVLGSLLLNFAEREPEADEGHEGDEVDENGA
FT                   RKRGPKIKIFNNNWLFFWYSTLPLNAMSRLWGQVNSLTLPVWMRPWSFKLYAAMFGANL
FT                   DEMEDPVLEHYQNLSEFFYRGIRPETRPVAPGDDVVVCPSDGKVLQLGVIDAHTGDIEQ
FT                   VKGMTYSVREFLGTHAHPQMTRSESHDSIKNSATADKDHIEFARINNIPYTFNDMIGET
FT                   PGEDSSHLQKIKYTSEGDKSLPDASPSRPKIMKLLSQLSTHYISKMSDMKPENNKLFFA
FT                   VIYLAPGDYHHYHSPVNWVCKLRRHFPGELFSVAPYFQRNFPNLFILNERVALLGHWKY
FT                   GFFSMTPVGATNVGSIKLNFDKELVTNEKRNRRTKPHTCYEATYENTSSILGGVPLVKG
FT                   EEMGGFMLGSTVVLCFEAPSDFNFDIKVGQAVKMGQPLGKTSQTAQESLGDGQE"
FT   gene            complement(<547625..>552751)
FT                   /locus_tag="KLTH0B06820g"
FT                   /old_locus_tag="KLTH-ORF15026"
FT   CDS_pept        complement(547625..552751)
FT                   /locus_tag="KLTH0B06820g"
FT                   /old_locus_tag="KLTH-ORF15026"
FT                   /product="KLTH0B06820p"
FT                   /note="similar to uniprot|P53886 Saccharomyces cerevisiae
FT                   YNL172W APC1 Largest subunit of the Anaphase- Promoting
FT                   Complex/Cyclosome (APC/C) which is a ubiquitin- protein
FT                   ligase required for degradation of anaphase inhibitors
FT                   including mitotic cyclins during the metaphase/anaphase
FT                   transition"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21646"
FT                   /db_xref="GOA:C5DCY5"
FT                   /db_xref="InterPro:IPR024990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY5"
FT                   /protein_id="CAR21646.1"
FT                   /translation="MPKIPSVFLQNSKHGEVWVFDTRIVEWRLGGKCLRKLEFGGEKVL
FT                   NAGFVDFESVKECLVVVLEDRAHVYYVGKGDFSIVSFPFSVSKAFFHVNGVLLERKLEE
FT                   ENAVGSKSPFAATKHRFITLSDPLNLFGSLVISSNLPEQQDSKATILHFPRAWDDHVSV
FT                   LHDCNAKTLYFYNCKILAPARASGSSSSSKSHNHESAPYPANSRKKSYASLAGDAATYG
FT                   KTSASNKRMLSNEHGSLASSSSSVPHATNAHPNNTATLSTELTNNLRKISIMNRRSASA
FT                   TMGIDLDQPSQTTGPSQSHPGVDYMKRSASATLDRMGSGSALDITPSNSSQFSQELFDH
FT                   AVLTKDVVLTRISQTPLSIDISPNTHVESCRFEDKEAIILHDPDSQWGKIWIFDLNSSM
FT                   TESMKFKAFNNTPIALTKIIDIKWSLIRNYCIHNSKLLPGYLMLLSSSGEEITLYNPFL
FT                   NLTSNPMLIPSREHERALYFSRENLVITSEKASPVNLAILPQIEAVKHCFTAIRYLCDS
FT                   FTYNYILLLWQVARSSVGEKQAACADFTALKLALLSLLQLERCPVNIKAHMEHIRQSPI
FT                   FDARFDGARFLPKIVMGMHLISEEYKLNLLQKQNVEMLEGILYLLTTLMKWPRLWKEFY
FT                   GANEKEDTSFEYKLSNRHFAHPLDEPPSILKSLYSVSDESTIPITPFITFSRLLEDGSS
FT                   VDHIITPRTNKILQLFESLDAIKFSQSNLLDIMNSLNIDSYELETYPLGVFAPLKRVLK
FT                   SVENHVSEVNTGSDFTLIDRPDLQKNQEVLKSVQCDTTQTRKPLQPLVSLGPKGRENSK
FT                   LQGCQPRSIRTIIDDILCLTENQPSDNLSGTNINEEVGEGQVLKRNASLIFSEDRRFFD
FT                   VVELLLYNIPHKLAVLINEKSYTRALKKKRLFSQILALRTFTSGIGWGAVAFSTEKPLA
FT                   TQKWPQPKMNLHCIFTDKTTVTVDPKECDPSLLSWGEFHGGVSSGLRISRKSTGITGSW
FT                   ITFTKPPELNAQHGGFLLGLGLNGHLKNLEEWHVYNYLSPKQTHTSIGLMLGMSASLRG
FT                   TMDLKLTKVLSVHIVALLPHGSSDLNVNYRVQTAGLIGVGLLYQNSQHRRMSDMLFAEV
FT                   SSFVSIDEEAVPDEGYRLAAGIALGLVNIGAGAKAAEAQFKKMAHAETYTSDEDDEDSE
FT                   FAEFRANNGNLDPKIINGLMNIVNSVHDTEESWMPANSQIGAVVALMLIYLKTNNRTVA
FT                   EKLAPSSEEINLKARPYTRPELYMYREWAHHMILWDHIASNTEWLFKGINIACALQVNT
FT                   DFLPIYYCIAGRALALGLKFASSGNSEARDNILALVDKLLPLYQCPIDARLDFQLTIKA
FT                   INVLLNVLLVSVSMIMSGTGDLAVFRRVKFLHETVSGKNSDLFRTPLRKRQQKRNHTED
FT                   EMSVDLTEEPEDGVQAEGNDLGEELEEEEANSTINEELESDDASDESRRYKDEENHFGK
FT                   FMATSLSLGFLFLGSGQYAFKVSKLENLAYLIMSVLPTYMCPYYLQETKHFWSMAVEYR
FT                   SLLVCDSRTGASLNKVPVDVTFKGSKSSNTFSTLKMVSPCLLPDVRLIRSIKILSPDYY
FT                   PVSLDFRSDEDRINFFNNGCVLYVPPREDDGNGWQQNQEAADKSCEVRQILKKKVMSLS
FT                   SPSASTSKSKCTDDILKHLGLANQESLEIENEVLKLKENQDPLLDENLMMSCQNQSKSY
FT                   HLELWRRRHKF"
FT   gene            complement(<552939..>553048)
FT                   /locus_tag="KLTH0B06842r"
FT                   /old_locus_tag="Klth0B.tPro.TGG.13"
FT   tRNA            complement(join(552939..552974,553013..553048))
FT                   /locus_tag="KLTH0B06842r"
FT                   /old_locus_tag="Klth0B.tPro.TGG.13"
FT                   /note="tRNA-Pro (TGG) cove"
FT   gene            <554835..>557513
FT                   /locus_tag="KLTH0B06864g"
FT                   /old_locus_tag="KLTH-ORF15015"
FT   CDS_pept        554835..557513
FT                   /locus_tag="KLTH0B06864g"
FT                   /old_locus_tag="KLTH-ORF15015"
FT                   /product="KLTH0B06864p"
FT                   /note="weakly similar to uniprot|P38845 Saccharomyces
FT                   cerevisiae YHR146W CRP1 Protein that binds to cruciform DNA
FT                   structures"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21647"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY6"
FT                   /protein_id="CAR21647.1"
FT                   /translation="MAEYTFRWPEGPQDVILTGDFDNWSGSLPLVKSPRGDFAITMPIP
FT                   PSSKNKFHFKFIVDGQWMVSDNYDVDHSSEGIENNFLVVSSLPTPSSNKAAAAGGKIPE
FT                   IGLNLVAPEVAAPVLGTQAPQKAQPAPRSNKKSKKKRIQIKRRIRRNKKTGERTVLSEE
FT                   RSELKSGTDDETYETEETATATNTSREDTPLSTDLDPLVNPTQRQNEFSSTVMPSTENR
FT                   QTTLGEPGIAIVKDAAQIKEFSEIRDVDADELNERLNRELAEKQNREASTVEETPAEKE
FT                   TEPLKSADEGVHVSPPEFPVVEKNISPPEFPVVEKDLSSPAVKGGEEESSSKAPVAAFA
FT                   AIPTGDHDVASESPVPESPTLKEESAPATLAAGKKDVKPLEASAAEEKGPKPALASGKQ
FT                   PVVAALPAPEKDTSSSKALVPENDDSSTRALAGDVSPAEVAAIATSPSALPVAEKEVEP
FT                   SSAVSEEISTPLVSQKAAYADSTSGVALASEDKEDGSEAPAAAGIFAVEQKSFIPAAAG
FT                   AGAVATTVAAVGAVEALPEEKDSSLKGNAFASSLDPIQGKSQKLFERDVSEEEPSTAGA
FT                   TKDTIDTFEAIEAPQQKGVAPIAVAEVDTVQDHSKKMPSNEFGTQPIDENAKPSKVVQE
FT                   ETIVAAPVTGLDESHPDTAEHVHAEKDFTETPIAEPKTGSGASQKSKVTSPANDYDIVV
FT                   VEGELGKLPAKSSAADASAAISEAPASHEKPADVVEGVPKESELVPKESADAFESNVSS
FT                   SEQKVNVVEEIGVITSPEQEAELIRKTLDPKASSPGETEELLIVEGDIPPSQIAEYQEA
FT                   SEAAAAKAMANQNPEEAVVREEPSTNAAPKEPVKETSNVAHAKKASPVKQKPAASSTSK
FT                   PAEKEKKKKKGLFSKIKKIFH"
FT   gene            <557856..>559046
FT                   /locus_tag="KLTH0B06886g"
FT                   /old_locus_tag="KLTH-ORF15010"
FT   CDS_pept        557856..559046
FT                   /locus_tag="KLTH0B06886g"
FT                   /old_locus_tag="KLTH-ORF15010"
FT                   /product="KLTH0B06886p"
FT                   /note="similar to uniprot|P53883 Saccharomyces cerevisiae
FT                   YNL175C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21648"
FT                   /db_xref="GOA:C5DCY7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034226"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY7"
FT                   /protein_id="CAR21648.1"
FT                   /translation="MASNNKSEEVVDKVEDKSAKEQEIEKALQDQTKKRKAEDEIEIDL
FT                   NQTVPLSKKQKRLLRRGKVTLEELNEKFNLDPSSVKEYQKEIEGKTQSEKKEGVEEGEE
FT                   EVQEDASSASQKAKKDKKFGVWIGNLTFDTSKEDLCRFFIAKTKELDPDSRVEESDILR
FT                   VNLPLAQNDGKQVKNKGFAHMNFRTQKQMDAVIALSESHLNGRNMLIKNSASFDGRPDK
FT                   NDLISMSKNPPSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCKGFAFV
FT                   DFKNEEGPTNALKDKTCRRIAGRPLRMEFGEDRSKRQVKRRVPQASETLSSTSGPSLRE
FT                   EPSTSAPPIRERKPVKKHREPSYKDKNNRLKSSVALASAPRASAAIVPSQGKKITF"
FT   gene            <559697..>560776
FT                   /locus_tag="KLTH0B06908g"
FT                   /old_locus_tag="KLTH-ORF15007"
FT   CDS_pept        559697..560776
FT                   /locus_tag="KLTH0B06908g"
FT                   /old_locus_tag="KLTH-ORF15007"
FT                   /product="KLTH0B06908p"
FT                   /note="weakly similar to uniprot|P53882 Saccharomyces
FT                   cerevisiae YNL176C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06908g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21649"
FT                   /db_xref="GOA:C5DCY8"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY8"
FT                   /protein_id="CAR21649.1"
FT                   /translation="MLFNATIVSFSSRSRVGTSSSSTQSSSEKEPQTSSSVWSSLELST
FT                   LESTSTQTIVSTSASITAVEPSATMLTSSDDSITTTTSDTSLPAATSSLPSSSVPAGKT
FT                   AVVYTRSYVFTASSTTFGTKLPMTTVMATKKAATFSAPTAAVTTDLSFYQNWLSGTLGS
FT                   TSSSSSGSLSKTHRNTIIGSVVGSVCGFLLVLGFLWFVLCRRRKNRASQSRSFSHEIGT
FT                   RLDYPVAPPRPSQTQVPEDDEAFLKSKYKSLGRKLPLWHKSESHPTRGGTAEAESAQGE
FT                   PKGNPFQDEFDFQRRLSRPPAPPPVPPRDVPNLSHFADDSDASSSSSENSVNDSSSSIQ
FT                   LTRPARAARSTQSFLHEVL"
FT   gene            <560847..>561848
FT                   /locus_tag="KLTH0B06930g"
FT                   /old_locus_tag="KLTH-ORF15004"
FT   CDS_pept        560847..561848
FT                   /locus_tag="KLTH0B06930g"
FT                   /old_locus_tag="KLTH-ORF15004"
FT                   /product="KLTH0B06930p"
FT                   /note="similar to uniprot|P53881 Saccharomyces cerevisiae
FT                   YNL177C MRPL22 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21650"
FT                   /db_xref="GOA:C5DCY9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY9"
FT                   /protein_id="CAR21650.1"
FT                   /translation="MIIKIFEDTSSQPWIAKAGKSRRDKLRGSLNMFPRPLLQCGRFSP
FT                   AVWLRRGFQSSVPALNNGSNGSLFGSITEATEAQNEDPNRISNRLTAASSVAESQESDP
FT                   KETVTVQNDKLLQSFIQRSQPAASAPQLLLSPLKRRIYEENCKMNGGFYKKDSVVTLTG
FT                   EDGKKLKYKLNLSREEMEALEPSIYVKSYRIKSSMKKTTQLLRLLGGLDAKVALTQCHF
FT                   SNKKVARDVAEVLTRGMADAEKLGLKADNLYIAQIWTGSDGYWQKRIDIKARGRNGVIT
FT                   HPYVHVRCILKTKDVTQRRLAYEQMLKQQRSKPWVQLRDQPVRGAMGGVYKW"
FT   gene            complement(<561932..>562537)
FT                   /locus_tag="KLTH0B06952g"
FT                   /old_locus_tag="KLTH-ORF15002"
FT   CDS_pept        complement(561932..562537)
FT                   /locus_tag="KLTH0B06952g"
FT                   /old_locus_tag="KLTH-ORF15002"
FT                   /product="KLTH0B06952p"
FT                   /note="similar to uniprot|Q02774 Saccharomyces cerevisiae
FT                   YDL212W SHR3 Endoplasmic reticulum packaging chaperone
FT                   required for incorporation of amino acid permeases into
FT                   COPII coated vesicles for transport to the cell surface"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21651"
FT                   /db_xref="GOA:C5DCZ0"
FT                   /db_xref="InterPro:IPR013248"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ0"
FT                   /protein_id="CAR21651.1"
FT                   /translation="MKLTYKDICTIGTGLILIGTSFIMGVFFANQTYDYHILFNTDLKP
FT                   SHFENSLRHYQTLYYTAPPVLYALGAVVSLGLIGCLIKVYKPNPDLKIFEYATLVMYVI
FT                   GVCMFITNIKTGIESSVSSNWGEVTENQGLAVIASSNVILLVIFIGVLVLQAGLWYSHW
FT                   EYQQRLEQFYAEEAKTAAAVTPTGETKPAKKTEAKKQK"
FT   gene            complement(<562821..>563567)
FT                   /locus_tag="KLTH0B06974g"
FT                   /old_locus_tag="KLTH-ORF14998"
FT   CDS_pept        complement(562821..563567)
FT                   /locus_tag="KLTH0B06974g"
FT                   /old_locus_tag="KLTH-ORF14998"
FT                   /product="KLTH0B06974p"
FT                   /note="highly similar to uniprot|P05750 Saccharomyces
FT                   cerevisiae YNL178W RPS3 Protein component of the small
FT                   (40S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21652"
FT                   /db_xref="GOA:C5DCZ1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ1"
FT                   /protein_id="CAR21652.1"
FT                   /translation="MVAVISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTK
FT                   TEVIIRATRTQDVLGENGRRINELTLLVQKRFKYQAGSIVLYAERVQDRGLSAVAQAES
FT                   MKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHSGQP
FT                   VADFIDTATRHVLLRQGVLGIKVKIMRDPARNRVGPKALPDAVKILEPKEEEYVESPSV
FT                   KDYRPAPQAQEAPEAQEAQAPAPVEA"
FT   gene            <565363..>566142
FT                   /locus_tag="KLTH0B06996g"
FT                   /old_locus_tag="KLTH-ORF14991"
FT   CDS_pept        565363..566142
FT                   /locus_tag="KLTH0B06996g"
FT                   /old_locus_tag="KLTH-ORF14991"
FT                   /product="KLTH0B06996p"
FT                   /note="weakly similar to uniprot|P53879 Saccharomyces
FT                   cerevisiae YNL180C RHO5 Non-essential small GTPase of the
FT                   Rho/Rac subfamily of Ras-like proteins likely involved in
FT                   protein kinase C (Pkc1p)-dependent signal transduction
FT                   pathway that controls cell integrity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21653"
FT                   /db_xref="GOA:C5DCZ2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ2"
FT                   /protein_id="CAR21653.1"
FT                   /translation="MRSVKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYTTTIA
FT                   LNDGKSIEPQVFRLNLWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFMNVKDKWF
FT                   PEIRHNTNYDNLELFRVCGKYPILLVGTKADLRDDEHEQDRLAEVNSDFVSRAEIDQCI
FT                   SQCGFMGYVECSAATQVGVAEVFERAVQCVIIEPERLLNQSKQRESTIDHPTNNQSNTA
FT                   ASSGAGAGTAGSSSNWNAPGSNPMKKRKKKSQKCTIL"
FT   gene            complement(<566364..>567581)
FT                   /locus_tag="KLTH0B07018g"
FT                   /old_locus_tag="KLTH-ORF14989"
FT   CDS_pept        complement(566364..567581)
FT                   /locus_tag="KLTH0B07018g"
FT                   /old_locus_tag="KLTH-ORF14989"
FT                   /product="KLTH0B07018p"
FT                   /note="similar to uniprot|P53878 Saccharomyces cerevisiae
FT                   YNL181W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21654"
FT                   /db_xref="GOA:C5DCZ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ3"
FT                   /protein_id="CAR21654.1"
FT                   /translation="MPVNIITAGLIEGFDTLPFYRQIKAIAPYAAGVIAVKLWSRGAKN
FT                   TWERNLNGKVYILTGATTQGMGTSVALEMAQKGAQLIILTRVVDEWSTEWVEDLRQRTG
FT                   NELIYLEQCDLSDLYEVRKFATKWLDNSPPRRLDGVVVMSGNLQPAGLVPGWSHGTRKS
FT                   SKDGLELQIATNFAGVFHLLNLLTPSFKAQPPDRDVRIIVTTCMLQAIGEVQVDDPLWE
FT                   DVKYDRPLKFFGSSKLQLSLCMLELQRRILSSTTKDGRSGKNVTVVLAQPGVMRSTSLR
FT                   QLISNGSVFVLVFIYSILLYPLLWLLTKSGYRGAQSILYALTTPELEEINWVDEQVKYV
FT                   VNCSMAKFARKEFADKELQEKLYETTEAKILEVEKKMAVKRNLSKKNTKNDAKGRTKDA
FT                   KGNRKD"
FT   gene            <567756..>569276
FT                   /locus_tag="KLTH0B07040g"
FT                   /old_locus_tag="KLTH-ORF14985"
FT   CDS_pept        567756..569276
FT                   /locus_tag="KLTH0B07040g"
FT                   /old_locus_tag="KLTH-ORF14985"
FT                   /product="KLTH0B07040p"
FT                   /note="similar to uniprot|P53877 Saccharomyces cerevisiae
FT                   YNL182C IPI3 Protein required for cell viability
FT                   computational analysis of large-scale protein- protein
FT                   interaction data suggests a possible role in assembly of
FT                   the ribosomal large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21655"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ4"
FT                   /protein_id="CAR21655.1"
FT                   /translation="MDEQLIFSTNTTCTVGSLHSPNQTNLKQCSNEFRNGSCLVGSKYL
FT                   LVAQARKALINVYRIEGSGKRESVEQRLPLPETVNCLEVVENNAEQNGNSQLPYLLLAS
FT                   TSSGKLYVWEMASGNLLTVKAMAHYQAITKIRSIIQGKYVITSGADARIMIWQTVDLVS
FT                   QQDPKPLFTLHDHTLAVTDFEVSNAHSSQLSGKLFTVSHDMTMRCYDLNMDVFDKPQLL
FT                   TTFTFPFPLECITLDPADRACYVGGAQGVYALPFYYPIGDRKVANLLSSDSSNILSCVE
FT                   QQPGDKNADLFTMGKVALAKITNAQTSQLACSLEGSLLVVGDSLGKCTVMDVYSKQPVK
FT                   EIQAIVANETAGEVTSIILNPVNVDNSNSLLGDGKTQSGFKIPNLQKNVFAREGLHDIL
FT                   FQIEDLQDSKVAPLDDFEAYLDQVAAEEGTFAQLGNVVSTVKVMSESEGANRNPENPDT
FT                   AQRPADDGELLTMKATVGQLTGAYKELREMYDKLFQEHESLRSTLGEN"
FT   gene            complement(<569322..>569627)
FT                   /locus_tag="KLTH0B07062g"
FT                   /old_locus_tag="KLTH-ORF14983"
FT   CDS_pept        complement(569322..569627)
FT                   /locus_tag="KLTH0B07062g"
FT                   /old_locus_tag="KLTH-ORF14983"
FT                   /product="KLTH0B07062p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21656"
FT                   /db_xref="GOA:C5DCZ5"
FT                   /db_xref="InterPro:IPR013957"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ5"
FT                   /protein_id="CAR21656.1"
FT                   /translation="MSSQSSPSKEASKPAAASPENPSAEKQKVESKPKGLQPASNESQP
FT                   QPADVASLMGFASFGTTKQKKVQGKGSGGKRVEKTAAKSSRKYRQYVNRKSKKLVQ"
FT   gene            <569812..>570441
FT                   /locus_tag="KLTH0B07084g"
FT                   /old_locus_tag="KLTH-ORF14982"
FT   CDS_pept        569812..570441
FT                   /locus_tag="KLTH0B07084g"
FT                   /old_locus_tag="KLTH-ORF14982"
FT                   /product="KLTH0B07084p"
FT                   /note="some similarities with uniprot|Q07623 Saccharomyces
FT                   cerevisiae YDL213C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21657"
FT                   /db_xref="GOA:C5DCZ6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ6"
FT                   /protein_id="CAR21657.1"
FT                   /translation="MVDEKKLTKKQLKAQQFRKTKEEREDDKIVKRKLEESEEAKPAED
FT                   EAPRKKRKTRRGKGGKGKKGNRFIVFVGNLPKDTSKTELQAHFKSSSPDEIRMRPDKNI
FT                   AFLEFDADKDQKNIQSRMDVALLQHKTEMKGRRINVELTVGGGGNSQARLEKLKNKNLK
FT                   LDDERKERTTKMIQDSKNKTAKSASAGTANVEASGGIHPDRLKLIK"
FT   gene            <571005..>573260
FT                   /locus_tag="KLTH0B07106g"
FT                   /old_locus_tag="KLTH-ORF14978"
FT   CDS_pept        571005..573260
FT                   /locus_tag="KLTH0B07106g"
FT                   /old_locus_tag="KLTH-ORF14978"
FT                   /product="KLTH0B07106p"
FT                   /note="similar to uniprot|P22211 Saccharomyces cerevisiae
FT                   YNL183C NPR1 Protein kinase that stabilizes several plasma
FT                   membrane amino acid transporters by antagonizing their
FT                   ubiquitin-mediated degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21658"
FT                   /db_xref="GOA:C5DCZ7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ7"
FT                   /protein_id="CAR21658.1"
FT                   /translation="MSSLTKLLQEKRKNEGGLSSGLAQTRSQMSSAGTAAGTSGGTGSA
FT                   ASEELSSSVGSNVLMNQEAFSSSFFNANSAHTAALSESYKDRDRPAPLTIESRGGNARL
FT                   SSQGFQPGSQPGPQSGPRPVPSLSSSIPYSVPNSNANGSSGSNAAGGAGSGGFHSSNGS
FT                   GVSSASSSWLESPGVMPSNVSAIDSNVISSPKVDTVEPRFVISKQKFQKASMDNAANSY
FT                   SNAQNGSISRSSSISSQLGNLFFTKNGKELSSSQNSQSRDIPTNSAQSAAYGSSIPKPM
FT                   RARRSSLYGSSRQPSNSYQDTFIGSPSSLHEQPPNQYMPRSRHSSIADLKRFFKKGQSV
FT                   NMSVSPGTPPVSSGGNISSHNSNASSFGPGSYSSNNGDTIYTSSASSTLPYSKRYTKTG
FT                   EVLGAGAGGSVRLVKRLQDNKVFAVKEFRTKFESEAKRDYVKKITSEYCIGTTLRHPNI
FT                   IETVEIVYDNNRILQVMEYCDYDLFAIVMSNKMSYEEICCCFKQILTGVQYLHSMGLAH
FT                   RDLKLDNCVINKQGVVKLIDFGAAAVFSYPFSKTLVESSGIVGSDPYLAPEVCIFSKYD
FT                   PRPVDVWSIAIIFACMVLKKFPWKIPKLKDNSFKLFCSGRNCDSLSALVTRTPDPPSYD
FT                   SATNTDENDKPKAEAPVSNNPANPENPNIGPQRLLHSLPEESQHIIGRMVELAPACRVS
FT                   IDDIMKDPWVESIDVCEVVEEGYSTKVVSGVDHKHTQVDQSEAHIAGLEKKKKKQNR"
FT   gene            <573530..>574060
FT                   /locus_tag="KLTH0B07128g"
FT                   /old_locus_tag="KLTH-ORF14974"
FT   CDS_pept        573530..574060
FT                   /locus_tag="KLTH0B07128g"
FT                   /old_locus_tag="KLTH-ORF14974"
FT                   /product="KLTH0B07128p"
FT                   /note="highly similar to uniprot|P53875 Saccharomyces
FT                   cerevisiae YNL185C MRPL19 Mitochondrial ribosomal protein
FT                   of the large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21659"
FT                   /db_xref="GOA:C5DCZ8"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ8"
FT                   /protein_id="CAR21659.1"
FT                   /translation="MPVNIKKNFKRLGYRIPIDLKKHRAKIMSKPLKNIIVKLIVGAGQ
FT                   AAPSPPVGPALGSKGIKAIDFCKEFNARTASYQPGTPVPVLITIKPDRSFAFEMKSPPT
FT                   GFLLLKSLGKDKGMGQPDVKSPAGTLGELSLKHIYEIAKIKKSDGRHASLGMESIVKSV
FT                   VGVAKSMGINVVP"
FT   gene            complement(<574195..>576465)
FT                   /locus_tag="KLTH0B07150g"
FT                   /old_locus_tag="KLTH-ORF14973"
FT   CDS_pept        complement(574195..576465)
FT                   /locus_tag="KLTH0B07150g"
FT                   /old_locus_tag="KLTH-ORF14973"
FT                   /product="KLTH0B07150p"
FT                   /note="some similarities with uniprot|P53874 Saccharomyces
FT                   cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
FT                   deubiquitinates ubiquitin-protein moieties may regulate
FT                   silencing by acting on Sir4p involved in
FT                   posttranscriptionally regulating Gap1p and possibly other
FT                   transporters primarily located in the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21660"
FT                   /db_xref="GOA:C5DCZ9"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ9"
FT                   /protein_id="CAR21660.1"
FT                   /translation="MQEHDAVKPLVERLLAQPLQFKPATAPDSVEGKPVSCVVIGSSRP
FT                   AAHHPTRRDGTNADASGRTQGDGRKANGTSGNANGRRPVPKNFSEALQMYTARKQIPSD
FT                   VELSDGKYQSSSDGEGAGEDVVDAPDAAGAQSESGESSDSAAEEFHEAHEYVEDGSSDP
FT                   GSGADAVASTGEDLGEDLGEDLGEDLGEDLGEDLGEDVGEGLGEDLGEDPEEGAKENAG
FT                   NSKPETDADEREASLGSVSDQDDQDEEDADFQDDGTEDSELEGPDGNITDSEKAGLMRE
FT                   AQEYAEMASLADARKKTEPAGEDNGNAEEESAHEENEEELKHKQPSSKRASPTPPTVLS
FT                   DMDRFYQFNEKANDRGANNSTRILKNWGPQLSTMKPKGLLNHGVTCYTNAAVQALIHIP
FT                   AIQHYLFDVLRGEYKSTISPNSVTQVLAETSKRMWSTDASKNQFINPKKLIGRLEDINC
FT                   MMSEWQQEDSHEYFMSLISRLQEDSVPRGHKLTESILYDIFGGMLRQEVTCKSCGEVSK
FT                   TEQPIYDISLHLKGKKNSDSADTAKNSSDFEEEPQRRFSIEKSIRDFFNPELIKVDKAN
FT                   KEGYVCEKCHKTTNASKHNFILRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDVTE
FT                   FCENSKTTLPVKYQLISVVVHEGRSLTSGHYIAHCKQPDGSWSTYDDEYINKISERQML
FT                   KEPGAYYLVYTRLTPRSVPLPQGPSVSSSSAAAATNRAEGTPKSSSKRKKSKNKNKKRC
FT                   YNK"
FT   gene            <578663..>581806
FT                   /locus_tag="KLTH0B07172g"
FT                   /old_locus_tag="KLTH-ORF14963"
FT   CDS_pept        578663..581806
FT                   /locus_tag="KLTH0B07172g"
FT                   /old_locus_tag="KLTH-ORF14963"
FT                   /product="KLTH0B07172p"
FT                   /note="similar to uniprot|P33327 Saccharomyces cerevisiae
FT                   YDL215C GDH2 NAD( )-dependent glutamate dehydrogenase
FT                   degrades glutamate to ammonia and alpha- ketoglutarate
FT                   expression sensitive to nitrogen catabolite repression and
FT                   intracellular ammonia levels"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21661"
FT                   /db_xref="GOA:C5DD00"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR016210"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD00"
FT                   /protein_id="CAR21661.1"
FT                   /translation="MLSSQNSKVPDISSLSISSISDYHNFDFPGKDAQREAVLDLVDQQ
FT                   GFIPDDVVEHEVEWFYDALGIDDLFFSKESPEMIANIIHTLYASKVESFAKLKIAGDSA
FT                   ASVEDGSSPSNFTVKNQVVTETHSVFMETGNDLDKEIDSMLLDNPTQRYRLISYTAESA
FT                   LKLTFVYRTVFAAEDQSGAELAPEQLCHGDIDSISDLTMSQVTSKENKKLYGLIMNQMR
FT                   QREGPVIKTLHSVADQDEVRIVVGFKRGTTKSYYAALSSLLHYYHLKPSKIYMETFTND
FT                   VMIYSLYLKQSQQSESVLNSLPMSIMQIEREASLLYAIPSNFFQDLYQQRSFSPQEAIY
FT                   AHISAIFINNFINRLGDDYQNLVAQISVSGANKNNNSAQEVLASLKKKLRNETYTQQMI
FT                   IDVLHKYKSIVSKLYKNFAQVHYVSSSSSKFGKTLSYQRLSKLEPFKDDNEFELYLNKF
FT                   IPNDSPDMLVLKTLNLFNKSILKTNFFITRKVAISFRLNPALIMPEVEFPETPFGIFFV
FT                   VGNTFKAFHIRFRDIARGGIRIVCSKTQDIYEVNSKMAIDENYQLASTQQRKNKDIPEG
FT                   GSKGVILLNPTLTSPEQTFVAFSQYVDAIIDILIQDPLKEKYVDLLGQEEILFFGPDEG
FT                   TAGFVDWATSHAKSRGCPWWKSFLTGKSASMGGIPHDDYGMTSLSVRAFVNGLYETLGL
FT                   QEKTIHKFQTGGPDGDLGSNEILLSSSNEQYVALVDGSGVLCDPSGLDMAELKRLANER
FT                   KMVTSYDKSKLKHHGFFVSVDEVDIILPNGVIVANGTTFRNRFHLEIFNFVDKVDLFVP
FT                   CGGRPNSIDINVLHFYVDEKTSRCKIPYIVEGANLFITQPAKIALENHGCILFKDASTN
FT                   KGGVTSSSMEVQASLALNDADFINKFIGKEPQQRTPLYAAYVEEVQDRIQKNARAEFNQ
FT                   LWQLNQSTGTPISELSNVLSQTINKVNDELINSNELWVNDLKLRNFLLLKKIIPKLLID
FT                   VAGPTSVLENIPVSYLKALLSSYLSSTYVYSYGIDVNIGKFLEYIGELKREAEDFALA"
FT   gene            <582064..>583302
FT                   /locus_tag="KLTH0B07194g"
FT                   /old_locus_tag="KLTH-ORF14958"
FT   CDS_pept        582064..583302
FT                   /locus_tag="KLTH0B07194g"
FT                   /old_locus_tag="KLTH-ORF14958"
FT                   /product="KLTH0B07194p"
FT                   /note="weakly similar to uniprot|Q12468 Saccharomyces
FT                   cerevisiae YDL216C RRI1 subunit of COP9 signalosome (CSN)
FT                   COP9 signalosome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21662"
FT                   /db_xref="GOA:C5DD01"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR037740"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD01"
FT                   /protein_id="CAR21662.1"
FT                   /translation="MRYSLETCRDLRARAHLVSQQLKDIEEGHGSMILGEREDCIDQPK
FT                   SLGDLIRKQVGVDVREESEQKHNSRHFKRVMLSNMASYKILQHALKGGDVEIMGMLVGS
FT                   TDRDSIIVFDCYPLPVEGTETRVNAQLESYEYMVQYMNEVYDSCSHPKNIVGWYHSHPG
FT                   YGCWLSGIDVQTQELNQTFQDPYIAVVVDPKKSAEDKRLSIGAFRTLNEDEIPENVDQY
FT                   GDSRYGHHSHKYYELEVKIFTSIFDTTLEQLQLRFDISASETPESSMVLEQLLESVRNW
FT                   NNFRKLTNPNQFLVQNSRQSDFSVQDHEVDMGAEFSSFSRRSSRASSVTSSKDESTGSD
FT                   VDMISNAIVGDYSTESSLPPASLAQPGMVTSEVEVPQVRSFEREYYLYKTNLSLIKLKE
FT                   YERLRYFKDTFTL"
FT   gene            complement(<583297..>584565)
FT                   /locus_tag="KLTH0B07216g"
FT                   /old_locus_tag="KLTH-ORF14957"
FT   CDS_pept        complement(583297..584565)
FT                   /locus_tag="KLTH0B07216g"
FT                   /old_locus_tag="KLTH-ORF14957"
FT                   /product="KLTH0B07216p"
FT                   /note="similar to uniprot|P53873 Saccharomyces cerevisiae
FT                   YNL187W Non-essential protein with putative leucine-rich
FT                   nuclear export signal (NES) sequence that fits the
FT                   consensus sequence recognized by Crm1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07216g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21663"
FT                   /db_xref="GOA:C5DD02"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DD02"
FT                   /protein_id="CAR21663.1"
FT                   /translation="MNRVRKVYDTLDTFDGRDVLQSWKREGSRWLDQVENSTYQFPELE
FT                   SSNYERTKGRVPTEHIDLRSPIICTKLSWSQDGTSLVAVFNDYGVRQYLLPEEEGTGLV
FT                   PFKRFFRAQPAVDCCIHPEYSLFNDSDACNVMLASSRDLPIQLLSLSPHAREHRPLFSY
FT                   SVVNAENERFETMFSLSFSHYSGFLAGTSRNKVVAYDLNYKSPIWSSDGYGKPLRGTSA
FT                   RRAIISCFDSPSDSESVLRYAGTYRCDIYGIDLRTKELNFLANKQTLELKENSAGVAEL
FT                   LFSVNKHYLYVIKRNSQTIDVLDARSSFAKINELYLSFRIGSQKIIATLDLINGLLIGT
FT                   HDGKILQWASNMVEFGGLLPRTPEGPAKDSAVSKVFDTSYAGSRINILASSPSNPHLIA
FT                   GSFSPDKFEADHTAKSGLFVVDL"
FT   gene            <584739..>585329
FT                   /locus_tag="KLTH0B07238g"
FT                   /old_locus_tag="KLTH-ORF14954"
FT   CDS_pept        584739..585329
FT                   /locus_tag="KLTH0B07238g"
FT                   /old_locus_tag="KLTH-ORF14954"
FT                   /product="KLTH0B07238p"
FT                   /note="highly similar to uniprot|Q12328 Saccharomyces
FT                   cerevisiae YDL217C TIM22 Mitochondrial inner membrane
FT                   protein involved in import of proteins of the ADP/ATP
FT                   carrier (AAC) family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21664"
FT                   /db_xref="GOA:C5DD03"
FT                   /db_xref="InterPro:IPR039175"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD03"
FT                   /protein_id="CAR21664.1"
FT                   /translation="MVYRGFGLEQVSPPPNKPFNEMTPEEQGEHGAQMMVNFMTSCPGK
FT                   TAISGVTGFALGGVFGLFMASMAYDTPLHTPTVPGESQLPSNVKHISDLPFKQQVKLQF
FT                   ADMGKRAYSSAKNFGYIGMIYSGVECVIESLRAKNDIYNGVTAGCLTGGGLAYKSGPSA
FT                   ALMGCAGFAAFSTAIDLYMRQENGTPPKNDFDE"
FT   gene            complement(<585375..>586334)
FT                   /locus_tag="KLTH0B07260g"
FT                   /old_locus_tag="KLTH-ORF14953"
FT   CDS_pept        complement(585375..586334)
FT                   /locus_tag="KLTH0B07260g"
FT                   /old_locus_tag="KLTH-ORF14953"
FT                   /product="KLTH0B07260p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21665"
FT                   /db_xref="GOA:C5DD04"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD04"
FT                   /protein_id="CAR21665.1"
FT                   /translation="MSPPGINQSNLPSREYRIASESRIARINELYNRSQRQQKHRDSII
FT                   SDNSTSVPYIQDEDDCQPLAYLAPNRVRRAPVAPPDSETIKPAPVKNPFRPKPTEERPF
FT                   SEDDVERELQFTPKLMSRRSIVSSRTPSHGTPLRREGPEDIVPDTPVQLPIWFSKQVVP
FT                   DFNNTNRAARRREAFKELKQKLGKPLPLGYLSDFQDEASRSTKKNVEERRKRMLSSKGR
FT                   DISWHDTRSLSDESSGIHSPHTSASSGDFIAGELSATSTDDGFHQNISEGLRTNSEKLD
FT                   QIMVLLETRKKAASKRECLAWIFCIIVLIALNLYLSNL"
FT   gene            complement(<586628..>588358)
FT                   /locus_tag="KLTH0B07282g"
FT                   /old_locus_tag="KLTH-ORF14952"
FT   CDS_pept        complement(586628..588358)
FT                   /locus_tag="KLTH0B07282g"
FT                   /old_locus_tag="KLTH-ORF14952"
FT                   /product="KLTH0B07282p"
FT                   /note="highly similar to uniprot|Q02821 Saccharomyces
FT                   cerevisiae YNL189W SRP1 karyopherin alpha homolog of 60
FT                   kDa"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07282g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21666"
FT                   /db_xref="GOA:C5DD05"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024931"
FT                   /db_xref="InterPro:IPR032413"
FT                   /db_xref="InterPro:IPR036975"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD05"
FT                   /protein_id="CAR21666.1"
FT                   /translation="MMEPNPSGTVRLQQLSASYKRTRSLSETLRPATQAMDSDSSSTNK
FT                   FVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFAAPPDGADSEDE
FT                   DEAASTADQQFYQQLQQELPQMIQQINSTDLQEQLNATVKFRQILSREHRPPIDTVIQS
FT                   GVVPNLVNFMNENQPEMLQLEAAWALTNIASGSSDQTKVVVEAGAVPLFIQLLYSGSIE
FT                   VKEQAIWALGNVAGDSTGYRDYVLSCGAMQPILALFDLSKTSLIRTATWTLSNLCRGKK
FT                   PQPDWGVVSQSLPTLAKLIYSMDTETLVDACWAISYLSDGPANNIQAVIDARIPKRLVE
FT                   LLNHQSTLVQTPALRAVGNIVTGNDLQTQVVINCGVLGALRNLLSSTKESIRKEACWTI
FT                   SNITAGNTDQIQAAIDANLIPALVKLLETADYKTKKEACWAISNASSGGLQKPEIIRYL
FT                   VSQGSIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLHINENADYIERAGGV
FT                   DKIFNCQQNENEKIYEKAFNIIEQYFGEDEDALDESMAPQTAGNTFGFGSNVNQQFNFN
FT                   "
FT   gene            complement(<588958..>589548)
FT                   /locus_tag="KLTH0B07304g"
FT                   /old_locus_tag="KLTH-ORF14948"
FT   CDS_pept        complement(588958..589548)
FT                   /locus_tag="KLTH0B07304g"
FT                   /old_locus_tag="KLTH-ORF14948"
FT                   /product="KLTH0B07304p"
FT                   /note="similar to uniprot|P53872 Saccharomyces cerevisiae
FT                   YNL190W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07304g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21667"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD06"
FT                   /protein_id="CAR21667.1"
FT                   /translation="MKVTSLTVGTIAAVSAVASASRGQKQHGDGKTTTITTTTGTHKWG
FT                   KFNHTSRTHAPKETGTHKWGKFNHTSRTHAPKETGTHKWGKFNHTSRTHAPKETGTHKW
FT                   GKFNHTSRTHAPKETGTHKWGKFNHTSRTHAPKETGTHKWGRFNKTHNPTSTVIAKNVA
FT                   ANAAAPAAGFDAAHKVLGMTVGSAALVGALMLL"
FT   gene            complement(<591369..>592292)
FT                   /locus_tag="KLTH0B07326g"
FT   CDS_pept        complement(591369..592292)
FT                   /locus_tag="KLTH0B07326g"
FT                   /product="KLTH0B07326p"
FT                   /note="weakly similar to uniprot|Q7LGR3 Saccharomyces
FT                   cerevisiae YDL218W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21668"
FT                   /db_xref="GOA:C5DD07"
FT                   /db_xref="InterPro:IPR008253"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD07"
FT                   /protein_id="CAR21668.1"
FT                   /translation="MLISLRALQFISSVIALGLLAYVLKGYSYHGSHKTNFGLAVAAIS
FT                   VFYLMLLSLLGVLLHKLLLPGLYLLFEIIITILWLCAFVVLAKTHGSRACGLQTTSTYN
FT                   PNYGSTSSFMSSGGRYDPYTSQYTTDSHMRPCRSAKASIAFAGLCTVLFMISTLIIGLN
FT                   VIRPIMQRGGGQRAMWTPYHNAGYKLNPWTGLRLSETNRSDLEGTGPHHNDAEGGAGVH
FT                   DQHTYSTGDSTYNGTNREKLGETDHRRNASGATEMGQDATNTGNAGALPQENVNTTYHR
FT                   TERIVTDTSPHPITETNRAQQTQGRM"
FT   gene            complement(<593005..>594142)
FT                   /locus_tag="KLTH0B07348g"
FT                   /old_locus_tag="Klth0B.mRNA.1104.m"
FT   CDS_pept        complement(join(593005..594050,594118..594142))
FT                   /locus_tag="KLTH0B07348g"
FT                   /old_locus_tag="Klth0B.mRNA.1104.m"
FT                   /product="KLTH0B07348p"
FT                   /note="highly similar to uniprot|P53871 Saccharomyces
FT                   cerevisiae YNL191W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07348g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21669"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD08"
FT                   /protein_id="CAR21669.1"
FT                   /translation="MCRFLIFKGKEPIRLSHLLTRPAHSIIKQSFDSRLRVDMRRPING
FT                   DGFGVAYYPLDQELSEDGPCLFKAITPAWNNQNLETLAEKTKSDLVFAHVRASTYGVLS
FT                   ETNCHPFTYHNITFMHNGGIGNFTKIKRRLLAHIGDEYFNLIQGSTDSECAFALFLDTL
FT                   EKMGSNPSESTGHFGHTTLRNCMLRTIEIIKDWTKEANGNDPDAEPSILNFAVTDGTDV
FT                   VVSRYITSRKYQGASLHFSCGSSFVEYAPGEYRMERLDRNQDVVMVASEPLTFERGDWI
FT                   TVPTNTILTIKNQTVLLHPIIDEYFQENPLYARNSSLAERKGLMGAVPVSKPTDKNVPP
FT                   LEREGRSRPQTSRLVA"
FT   gene            complement(<594459..>594969)
FT                   /locus_tag="KLTH0B07370g"
FT                   /old_locus_tag="Klth0B.mRNA.at.2.p"
FT   CDS_pept        complement(join(594459..594846,594905..594969))
FT                   /locus_tag="KLTH0B07370g"
FT                   /old_locus_tag="Klth0B.mRNA.at.2.p"
FT                   /product="KLTH0B07370p"
FT                   /note="highly similar to uniprot|Q07648 Saccharomyces
FT                   cerevisiae YDL219W DTD1 D-Tyr-tRNA(Tyr) deacylase functions
FT                   in protein translation may affect nonsense suppression via
FT                   alteration of the protein synthesis machinery ubiquitous
FT                   among eukaryotes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21670"
FT                   /db_xref="GOA:C5DD09"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD09"
FT                   /protein_id="CAR21670.1"
FT                   /translation="MRVVLQKVSKAAVTVDSEVVSAIKEGYMLLVGISVHDTIEDAEKI
FT                   SRKVLNLRIFEDENGAFWKKNVKEAGGQILSISQFTLQAVTKKGTKPDFHLAQKGPIAK
FT                   GLYDEFLGLLRKDMGDENVKDGVFGAMMSCELVNEGPVTIVLDTKE"
FT   gene            complement(<595129..>598293)
FT                   /locus_tag="KLTH0B07392g"
FT                   /old_locus_tag="KLTH-ORF14933"
FT   CDS_pept        complement(595129..598293)
FT                   /locus_tag="KLTH0B07392g"
FT                   /old_locus_tag="KLTH-ORF14933"
FT                   /product="KLTH0B07392p"
FT                   /note="similar to uniprot|P08004 Saccharomyces cerevisiae
FT                   YNL192W CHS1 Chitin synthase I requires activation from
FT                   zymogenic form in order to catalyze the transfer of N-
FT                   acetylglucosamine (GlcNAc) to chitin required for repairing
FT                   the chitin septum during cytokinesis transcription
FT                   activated by mating factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21671"
FT                   /db_xref="GOA:C5DD10"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD10"
FT                   /protein_id="CAR21671.1"
FT                   /translation="MSYRYNHGYGNDQTNNGENPFMSSRGERSDQSYEEDQREQEYKDF
FT                   VKQYPTTYQAQQTTPYNTSSGVFQGNSQQNSEPYPPHDGHQLPQSYNVPTINVYQAPQT
FT                   IPFAPNTVAPMTSMNHETSNDQIYHMDYEPRNSSANSSTGAEYYPQETQPILDHRRPPP
FT                   APQPDFLSSNLNSSSVFYDYDPEDPVGFVDQNGDDYQINTFYNNENEMANPYSSAFNLG
FT                   DYADNVDSGDEYSNTNYDDRQERDLGEYSYDNDANTLAKIRSSTNLLEDGASGDVLMNS
FT                   AEKLGDNSSASSHNRPSRRLTTVRKFKLSMGNFIFDCPISEHLISQYVRAVDDPEKLSN
FT                   EFKFMRYQAVTCEPEMFQSNNFTLRQLKYGLPRQTELMIVITMYNEDDVLLARTLKGVM
FT                   DNIRHFTKKTNSSTWGPDAWKKIVVCIVSDGRSKINERSLALMSALGCYQDGFAKGEIN
FT                   DKKVIAHVYEHTSKVNIRGIRDGKVDLLCGENTVPIQLLFCLKENNQKKINSHRWALEA
FT                   FAEVLQPTVINLLDAGTMPGKDSIYELWREFKDPQVGGACGEIKTDLGRGYKKLLNPLV
FT                   ASQNFEYKLSNILDKTTESNFGFISVLPGAFSAYRFEAIRGEPLRKYFLGDDLNARLFM
FT                   TNMYLAEDRILCFEVVTKKDSNWTLKYSRSSYGSTDVPEKIPEFILQRRRWMNGAFFAA
FT                   LYSFLHFYKIWSSGHSFIRKLMLNLQFVYLFLSTLISWFSLSSFFLVFRILTMSIAVSN
FT                   NDQKVFRVLSVLFLWLYGVSILITFILSLGNKPKGTSKFYLSTFIFFAILMVYMIFCSI
FT                   FMSVHSIRNIIDNGNVTFVSLMKQETFRDLIVSMGSTYCLYLLSSVIYLQPMHMLTSFV
FT                   QYLLLSPSYINVLNIYAFCNVHDISWGTKGFVAKPLGKIHSKEDGTVKLEIPVSAREID
FT                   ANFNKHREILMSEAPEEGQEEVSFEEKKTNYYAMVRSLVIILWVISNFIIVAVVLETGG
FT                   IGQYESLDKMQSSTSTETTVSILPQRSTVYFSVILWLVAFMAAFRFIGCCLYVVQRFFR
FT                   KLRFGK"
FT   gene            complement(<598488..>599999)
FT                   /locus_tag="KLTH0B07414g"
FT                   /old_locus_tag="KLTH-ORF14931"
FT   CDS_pept        complement(598488..599999)
FT                   /locus_tag="KLTH0B07414g"
FT                   /old_locus_tag="KLTH-ORF14931"
FT                   /product="KLTH0B07414p"
FT                   /note="similar to uniprot|P53870 Saccharomyces cerevisiae
FT                   YNL193W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07414g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21672"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD11"
FT                   /protein_id="CAR21672.1"
FT                   /translation="MRRNVSKKHVLTTEEDFYVDATSKEEQAERWALSDIKKTIGQYMA
FT                   AVNAYEQGLHAPDRTEIGSYHIYYNQTRLLLKLHTDFIACDGINILQYVNIRDLGDVSP
FT                   LFLPLDSIIDRFEFAITKFGDLCSWDLFFNLLTCYLSILEESQEELTGEVLLKIFERFV
FT                   ELAQNLIQLHLRELETWDVSFENKDDDFQSMDLSQQSFDSTTGKGIKEVHDTSTAEYVE
FT                   MQDEITHLTLVETLSVCFRFVSTLMEILGEAAHGKRATINPIQSNYLGDAALQFTSQLK
FT                   LFASEIDRSKVGNEIMELDLAMSLVQGLEIAISADYDSLQRFIEESGENLDKLMICIDI
FT                   LRLCLTNQNSTFSQKWSFCSEIGRLLSRVESQLVQKRLDIMSGHLKGLENELSPTVFKL
FT                   CDVMITRSDNELLRWTMKESESGSSSNQNASKTSEILLKNAGVLLKNATAIAQKPCGFR
FT                   EYVSDKLKRNYIYKQAAERLEFINTGKITGVIEDLVSEHPFFAKR"
FT   gene            <600260..>603043
FT                   /locus_tag="KLTH0B07436g"
FT                   /old_locus_tag="KLTH-ORF14930"
FT   CDS_pept        600260..603043
FT                   /locus_tag="KLTH0B07436g"
FT                   /old_locus_tag="KLTH-ORF14930"
FT                   /product="KLTH0B07436p"
FT                   /note="some similarities with uniprot|P32797 Saccharomyces
FT                   cerevisiae YDL220C CDC13 Single stranded DNA- binding
FT                   protein found at TG1-3 telomere G-tails regulates telomere
FT                   replication through recruitment of specific sub- complexes
FT                   but the essential function is telomere capping"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21673"
FT                   /db_xref="GOA:C5DD12"
FT                   /db_xref="InterPro:IPR011564"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR031749"
FT                   /db_xref="InterPro:IPR041028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD12"
FT                   /protein_id="CAR21673.1"
FT                   /translation="MNSNLPSGLKYICDPLELKGFFSEGEVLRQDIEFVSVLTSIDFNP
FT                   KSRCLFQFSNFRPGESVSPDYTCKITCNNVETLNLTKLTLSLVSQQFDLDFPDLNDAEG
FT                   FYMKDIHLEKLCFVCCKGTFVTCDNKGGIFLQGLRIIDIHSSLFDPTKRDERSSISETV
FT                   RVIFDNLVKLNDNSKAQFKFVKLQNYDTAMRKYIQSRQESMLSLKEKNPLFGLLKPRAD
FT                   HDSQNDFDSQLPDPDSNLDNAIFYGHRIPSESLDSQTPNLVSSEIIEEGQSPSVAGAAG
FT                   TPAALSGSNKPSSYQGSGSLSISQISPPRETEYVRLSRDFETSAIESNKRSAVVTSDQE
FT                   IRDDSSLDDDILEFSLSTHSVDKNELSQTSRGSQPTSKRQRIQMLGNISQKDPNSYMFH
FT                   ASLDEPLIISGVVFGLRINDAASSPSIALYIHAGSLQNESVSANLYPYKNCTEVLAYAS
FT                   DSIELNSKLFPAENSAEMLEALRWYVEDKKVELKVKKSSILLADGYFTFAWTLVSVKTA
FT                   GDAPKLSTSQTSHTPRSSQIVGSSQEASQDSLDPLKTFGEISISGNEVEFIRTFALLVS
FT                   AKTFGSKMHKFVFTDFTSHPKNKLSAFDSFLGSYTNRLPQDMAFPFVIYNDHFREFTTR
FT                   LQRHTGYNFNQLYSGNDNNLSNRGIVCRLSLKVKLYSGGIDGIIRRCEPIVVTKRLPKD
FT                   EERHITEFYDRAIREIPQIVLLNNFDSYKTFFPIAMFRGLVVLDTSDAQNQHRTPPSSQ
FT                   PALGALQPLPQRPPPKLHIELEHFTVNRHMEIPVLYGLDATDSSHLFELRAKVVAAIRT
FT                   GELLAFYVTNDWISQDMLDPTRVLRVEIPGRSNMDYFFGTYASQETRPDLAARDAQLGT
FT                   MIGETFTFRLVTFAVPVSPSRFLRTWCPVECTIQELSYELAARRGQAAARVKLEDS"
FT   gene            <603685..>604638
FT                   /locus_tag="KLTH0B07480g"
FT                   /old_locus_tag="KLTH-ORF14926"
FT   CDS_pept        603685..604638
FT                   /locus_tag="KLTH0B07480g"
FT                   /old_locus_tag="KLTH-ORF14926"
FT                   /product="KLTH0B07480p"
FT                   /note="similar to uniprot|Q07651 Saccharomyces cerevisiae
FT                   YDL222C FMP45 The authentic non-tagged protein was
FT                   localized to the mitochondria cell cortex protein not
FT                   required for growth on nonfermentable carbon sources
FT                   required for viability in stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21674"
FT                   /db_xref="GOA:C5DD13"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD13"
FT                   /protein_id="CAR21674.1"
FT                   /translation="MDRKGFFNNSLSRLNSKSNLASNNQRSENMRFKQSVTFVFLVLLL
FT                   GAGLLSFLAILGGARNTGVLRNLYWLEANTSGFGNAPATTRWYNYEWCGYEGGSAQDCS
FT                   SRRPAQPFSPRDNFGASDAMPATFVNNRKTYYYLSRVAWAMLLVGLVFIVMAIVPLLAT
FT                   VFAASTWVASLSTVWLWSALFFVTLAACLYTGCYVKARNAFADNGRRAKLGSKNFAFIW
FT                   TSVALLLICALWSTITTAVFGINKVRSNRRDSHGYDSYEGDKATTMDTYGDSDHPASSP
FT                   TKFKYFKRIRRYQAPAAPPATMATNYDEENIPAAPR"
FT   gene            <604448..>607777
FT                   /locus_tag="KLTH0B07502g"
FT                   /old_locus_tag="Klth0B.mRNA.597.p"
FT   CDS_pept        join(604448..604460,604791..607777)
FT                   /locus_tag="KLTH0B07502g"
FT                   /old_locus_tag="Klth0B.mRNA.597.p"
FT                   /product="KLTH0B07502p"
FT                   /note="weakly similar to uniprot|Q07653 Saccharomyces
FT                   cerevisiae YDL223C HBT1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21675"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD14"
FT                   /protein_id="CAR21675.1"
FT                   /translation="MVMIRNSHKDESSTTQDYESSRQNVSAQGNTSTTATRDTSSGSSN
FT                   NPFAPQRAVRGIKAFDVGSEHNSTTQEHSSQTQEYGSHQSQHSQRQAPVSSSSGGNGQP
FT                   SDDSSRGAQQPHFHRADAPVAGVPGVRNHQSGPSLEESSHSQGHGGFLSSTGHHERHEQ
FT                   GSTHQAKSQEIYGHQSGAPSTSAQGNDDSLRGFQHTSGHQHGTEQAVLGTAPVSHSKHT
FT                   TGVTSGANLEQETGARNPQQGHTSNESAGHDTNRPSDNSYSKSTETRAPQTGPRTTEKG
FT                   TSFSTTLPIGALGQERSTSSPTNPTESSDQHKRGVFRLKSSKSGTETSGKESEGRKNSE
FT                   GRKNSLIQEAIGLKNKINEQRKHLGRKNSSGESGQKTSSTGTASGAPEPGIRHTQDRDS
FT                   SLSSSNREHKPSIPGSFTTEPESGGQSYGTQFSGTTAAAGESRTSGTADTSRHQRQGLS
FT                   EPQEISETEGRPHAHTQKQSLPAHYISANEVTGPGAQIIAAPSGGQKQQPGNEQEQLLG
FT                   SEQHRLLSSHQDRQTGGERGQHLASEHSQHLGSEHNRQLGSEHAQPTHHHQNLGTEHNR
FT                   SSGRDTSRGHEMGKVESGLTGIPERSHDVGADVPQGEGLNLSRDEKAGYEEYNPSGKGS
FT                   MDAEARRRSSLAESNDSYNERNRTKSRSMSLGTGPTAGVSKTQSDQSNSPTSPTEGNKE
FT                   PSTLTGTIKDAWDAVTGKRHTSESEPQQKQAKESTGKRSSDVENEGFSSRQNENNTGIG
FT                   GKPLTRSGGEYATGVGESHLTHERPEKPSSAMKGSRSTKPEGETHGYSQRKNQGESANK
FT                   HLGDLEGRKTKENRSSGSHHDDVDPKTRSSETSHPQMETRYERHTTTSPSQSPQEGIQR
FT                   YEEENVYAKEVVNMPSLVDPSQPTYGSGDRNRTSTSETTSYVTHGSQGKRNVSVGSAGG
FT                   HEQMTEPSQMPVEKNEHSYEERIPRSERERFDKLKEEHIENRNKNEPHLQPAKAAASAA
FT                   YPPKTQQGAT"
FT   gene            <608293..>608811
FT                   /locus_tag="KLTH0B07524g"
FT                   /old_locus_tag="KLTH-ORF14914"
FT   CDS_pept        608293..608811
FT                   /locus_tag="KLTH0B07524g"
FT                   /old_locus_tag="KLTH-ORF14914"
FT                   /product="KLTH0B07524p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21676"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD15"
FT                   /protein_id="CAR21676.1"
FT                   /translation="MHHNKDKSSEARFSYLQLAVGPIKGSAAKERQQGNLTSDGQKREE
FT                   HNATEQASIRDGKQASGLEPNREGRRKVQAWGGSKSKKTRSQEFMFKEIRKDPADSSIL
FT                   VDPNSDKLESAQAQLQLLFDDLAGDREGSAARQQSTIAKMQTDFNKIQHCEIDPRELDS
FT                   APSYSSARY"
FT   gene            <609954..>611873
FT                   /locus_tag="KLTH0B07546g"
FT                   /old_locus_tag="KLTH-ORF14910"
FT   CDS_pept        609954..611873
FT                   /locus_tag="KLTH0B07546g"
FT                   /old_locus_tag="KLTH-ORF14910"
FT                   /product="KLTH0B07546p"
FT                   /note="some similarities with Saccharomyces cerevisiae
FT                   YDL224C WHI4 and to uniprot|P34761 Saccharomyces cerevisiae
FT                   YNL197C WHI3"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21677"
FT                   /db_xref="GOA:C5DD16"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD16"
FT                   /protein_id="CAR21677.1"
FT                   /translation="MSVVNSTSPLDNSGFSLHRGFSTSSENLGGIGTPGNSSPAHQGSL
FT                   GIAGSSSSNNSPLHLATMLNNLALTGSASQGNSSSSGQGPFLLRLKNVPQDITLRECYA
FT                   IFALAHGVNTVELARQPSDINNFDKICEVVARFDSLHLVSQYATILDSKPHIFGPAFPY
FT                   KPQVEVLDELTQQHIPFDKSLSPRHQLHTLPQPNLQHSQTLDQRQHPQPQPPSLQQRSQ
FT                   QQQPQQPQQQQQQQQQQQQQQQQQQQQQQQQPNAFQLPGSSNVVSPPQSASSAKRPGLY
FT                   GQRSRFSFSDSFNADSSQQSQGTNQDIASAPFKSQDVGKSFLLMENDEINESIWGSNGG
FT                   VPSSISGLATTSQPPTPSMEWGPPQRRQSSSFFSSVNTGTVPANELASMHIASAIPHQM
FT                   GSALQQHPNLPYGLVGQGSTSTATTATDLTIAPNSQNQQPPQSQIISGTQQQQETQANN
FT                   GTPKASAQRSSTSKSSQPNVNASQKTPSSTSISSSGGISQVDLSLLARVPPPANPADQN
FT                   PPCNTLYVGNLPPDATEHELRQLFSTQKGFRRLSFRNKNTNGNGHGPMCFVEFEDVAHA
FT                   TRALAELYGRQLPRSGTSHNNKGGIRLSFSKNPLGVRGPNSRRSGNGGSVSNGNYSYAT
FT                   AFSK"
FT   gene            complement(<612453..>614087)
FT                   /locus_tag="KLTH0B07568g"
FT                   /old_locus_tag="KLTH-ORF14903"
FT   CDS_pept        complement(612453..614087)
FT                   /locus_tag="KLTH0B07568g"
FT                   /old_locus_tag="KLTH-ORF14903"
FT                   /product="KLTH0B07568p"
FT                   /note="similar to uniprot|Q07657 Saccharomyces cerevisiae
FT                   YDL225W SHS1 Component of the septin ring of the mother-
FT                   bud neck that is required for cytokinesis septins recruit
FT                   proteins to the neck and can act as a barrier to diffusion
FT                   at the membrane and they comprise the 10nm filaments seen
FT                   with EM"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21678"
FT                   /db_xref="GOA:C5DD17"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD17"
FT                   /protein_id="CAR21678.1"
FT                   /translation="MYRRKKEHKRGINYSLMLVGDSGTGKTTFANNLLESPIFPHRFAM
FT                   DAPQLAFNPRVQIAKPTMVVSYNSKNGIPSHMAQFDASREHFEPGITITSTSVEIATGA
FT                   EQPPSRSSMSSEASSSAQSNSHSQDKISFNLVKTHGLGENLDNTMCFDEITAFLEQQFD
FT                   QVLAEETRVKRNPRFEDTRVHVTLYFIPPTGHGLREMDVEMIKRLSRYTNVLPIISRAD
FT                   SFTPEELIKFKRQIMDDVERFHVPVYKFEVDPEEDDIETIEENQALAMMQPFAIMCSDE
FT                   KNENGEYVRLYPWGEMRVDDDSISDLRVLKNVLFGSHFQEFKDTTQNFLYENYRAEKLS
FT                   SVSEWDMDKEKGESSKRDSAAPSLSNFASLITTGQFKSTNSLAMPPQSETPTTPDSKEI
FT                   SQGVSDSPALRQMSQSIRRGNEEIIQNIKNSPRTSTPGSPDKSKLRNISETVPYVLKHE
FT                   RIIAKQQKLEELEAQSAKELQKRIQDLEKRAAELKLREKLLRQQHLNSSNTSLNSRQSA
FT                   QQSMAPQSKLKKEESVTDLASIVSGKA"
FT   gene            <615240..>616430
FT                   /locus_tag="KLTH0B07590g"
FT                   /old_locus_tag="KLTH-ORF14896"
FT   CDS_pept        615240..616430
FT                   /locus_tag="KLTH0B07590g"
FT                   /old_locus_tag="KLTH-ORF14896"
FT                   /product="KLTH0B07590p"
FT                   /note="weakly similar to uniprot|Q01722 Saccharomyces
FT                   cerevisiae YNL199C GCR2 Transcriptional activator of genes
FT                   involved in glycolysis functions and interacts with Gcr1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21679"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD18"
FT                   /protein_id="CAR21679.1"
FT                   /translation="MSYVRRDSSGSVTSAGIMHHQSKLDVFIIKAHRLLSNGAAINGDD
FT                   VSLVNTGSSSSSPQGGAGAAGGTGAGSAAASGASPQQDLALFQRLSQLYNATISTSLLD
FT                   DNSTSPKSAIELYQRFQQILKELELSYDVSPYGKYFRRLENGMWQIRDDSELVSDQLWQ
FT                   LVSVSISTVYDAKTGQMLNQTRRRVNSMATSSKNSPSEVIDHTLPQQLQKRLQKLQQDN
FT                   KHNYYTTPASPSLAVAPNSNGSGNANGGANGMANGMVNGTTNGIGIGIGTGAGAVNRSS
FT                   SSGSTPLGKRKYVGIGTPDEDAVEELLQLATKKPRTDLPTIDEDIPQQTLPSRALTSKE
FT                   ADLYDRLLREKDDRVKQLEADLESQRQETLWLRKMLLEDLACIRSMLHKKASPGRS"
FT   gene            <617509..>618234
FT                   /locus_tag="KLTH0B07612g"
FT                   /old_locus_tag="KLTH-ORF14888"
FT   CDS_pept        617509..618234
FT                   /locus_tag="KLTH0B07612g"
FT                   /old_locus_tag="KLTH-ORF14888"
FT                   /product="KLTH0B07612p"
FT                   /note="highly similar to uniprot|P40165 Saccharomyces
FT                   cerevisiae YNL200C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21680"
FT                   /db_xref="GOA:C5DD19"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR032976"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD19"
FT                   /protein_id="CAR21680.1"
FT                   /translation="MALRTISSQLAAQLDKELMGPEVGFTLEQLMELAGLSVAQAVVKE
FT                   FPYSETRKSQVLVIAGPGNNGGDGLVCARHLALSGFQPVVYYPKRTTKTPFYAQLVNQL
FT                   KFFKVPVLGAGDNWAQYLDHTKTLCVVDAIFGFSFKPPVREPFGSILQQLRHAQQNLPI
FT                   VSVDIPTGWDVDEGPADSDCIIPSVLVSLTVPKPCAAKIDTCETHHYVGGRFIPRDFAL
FT                   KYGFEPFPYENLDQVLRLH"
FT   gene            <618664..>621033
FT                   /locus_tag="KLTH0B07634g"
FT                   /old_locus_tag="KLTH-ORF14883"
FT   CDS_pept        618664..621033
FT                   /locus_tag="KLTH0B07634g"
FT                   /old_locus_tag="KLTH-ORF14883"
FT                   /product="KLTH0B07634p"
FT                   /note="similar to uniprot|P40164 Saccharomyces cerevisiae
FT                   YNL201C PSY2 Nuclear protein of unknown function deletion
FT                   results in sensitivity to anticancer drugs oxaliplatin and
FT                   cisplatin but not mitomycin C deletion is synthetically
FT                   lethal with a chitin synthase (CHS1) null mutant"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21681"
FT                   /db_xref="InterPro:IPR006887"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD20"
FT                   /protein_id="CAR21681.1"
FT                   /translation="MNGVRQDELRETESKRVKVYILEQNEWKDTGTGFCIGKVDKEERQ
FT                   AEQNAPPEDALAAYLVVNDEEAPEKTLLWSKLEGNIEYQRQEETLIVWKDLSGQDIALS
FT                   FEESTGCDALCDFIIKIQKSSENNISLVAVRSNDDGMGSVHEIITGPVNLPCNDAEQDE
FT                   KQLMEALKILNENTAFEYLRSETMEFVLKSNYVATLIKLFEKAEAGHKLRELLLLSNIL
FT                   KTLTLYNQRELLEQMVGDEYIMGVVGILEYDTEFPTSKANHREYLLHSGPHFKEVVPLN
FT                   SDDMKRIIKKTYRLQFFKDVVLVRFLDEHSFNIISDIILDLQTCIINFIQDETFLPKLI
FT                   ALYTAASPDTPIETKRDGIRMLHQCVQITKNLEHSEKSRFFKALVRAGLFKIFDFAFGQ
FT                   ETDSGIRILATDMVISIIEHDILLINSVQNELINQPEGLDQEQQHSHKQPAENGNCTVS
FT                   SDVSLLAILSKILLTDKSLGLKEQVVQALNTLLHPEGCMGMDPDYNDSGGVDMMMNFND
FT                   ARSNGMNEENLIDNMNFQMTDYFNNFYTQVAPQLFAPLITNSLSTPDDDVLLIYLVKLI
FT                   NFVSTEHNRRLSREFIMENNILKNIAKLLDPQRMLQLRLTVVRCLKSIVCLNDEFYHRY
FT                   LISENLYAPVMDLLRENLHEDNLANSSILDFFKIVSSQCMQALELKASDKRNFIMLNKH
FT                   LVKNYRDILLEVDYVPFTKDMIRMYDEGEGQLRESVTESTSMVYAKEGKRTFSETLETT
FT                   KVSTSEETTTFKKAMEKITSAPPQSFIKEDVLGTEF"
FT   gene            complement(<621077..>621979)
FT                   /locus_tag="KLTH0B07656g"
FT                   /old_locus_tag="KLTH-ORF14879"
FT   CDS_pept        complement(621077..621979)
FT                   /locus_tag="KLTH0B07656g"
FT                   /old_locus_tag="KLTH-ORF14879"
FT                   /product="KLTH0B07656p"
FT                   /note="highly similar to uniprot|P32573 Saccharomyces
FT                   cerevisiae YNL202W SPS19 late sporulation specific gene
FT                   which may function during spore wall formation peroxisomal
FT                   2 4-dienoyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21682"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD21"
FT                   /protein_id="CAR21682.1"
FT                   /translation="MPNSLGDSFVKDGPWKADLFQGKVAFVTGGAGTICRVQTEALVLL
FT                   GCKAAIVGRNPEKTLEAAREISKLSPRRDSTENDSVGGDSVLAIHSVDVREIGQLEQAV
FT                   ARTVERFGRIDFVIAGAAGNFIAPFSQLSANAFKSVVSIDLLGSFNTAKACLAELKKNK
FT                   GAILFVSATFHYYGVPFQSHVGAAKAGVDALSNALAVELGVSGIRSNCIAPGVIEGTEG
FT                   VSRLTGNVSEEQIRSKIPLQRFGTTRDIAETTVYLFSDAAKYVTGTVHIVDGGMWHLGT
FT                   HFGRDLYPQNLLTEENAKL"
FT   gene            <622309..>623451
FT                   /locus_tag="KLTH0B07678g"
FT                   /old_locus_tag="KLTH-ORF14877"
FT   CDS_pept        622309..623451
FT                   /locus_tag="KLTH0B07678g"
FT                   /old_locus_tag="KLTH-ORF14877"
FT                   /product="KLTH0B07678p"
FT                   /note="similar to uniprot|P35197 Saccharomyces cerevisiae
FT                   YDL226C GCS1 ADP-ribosylation factor GTPase activating
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07678g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21683"
FT                   /db_xref="GOA:C5DD22"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD22"
FT                   /protein_id="CAR21683.1"
FT                   /translation="MSGEWKVNPDNRRRLLQLQKIGSNKKCVDCEAPNPQWASPKFGIF
FT                   ICLECAGIHRGLGVHISFVRSITMDQFKPEELERMEKGGNEPFSDYLASHGVDLKLPPK
FT                   VKYDNPIAADYKDKLTASVEGTEWQEPDRSDFDPASLSDTGSAVSGSNKGASIDASAAG
FT                   SALGAGAALGPKASDGTPLGSRRGSPQIPDSQREKNEAYFAELGKKNQSKSDTLPPSQG
FT                   GKYQGFGNTPANPQKKDLNSSMATLSLGNLQKDPLGTFSKGWSLFSSAITKSMEEVNES
FT                   MIKPGVQQIQSKELSEEAKRAAAQFGQKFQETSTYGYQAFSNFTKNLQEQYQQGPATDS
FT                   QFTKLFDSISQEREQQVKDSATGASGAKAKKSEEDEWDEF"
FT   gene            <623851..>625155
FT                   /locus_tag="KLTH0B07700g"
FT                   /old_locus_tag="KLTH-ORF14870"
FT   CDS_pept        623851..625155
FT                   /locus_tag="KLTH0B07700g"
FT                   /old_locus_tag="KLTH-ORF14870"
FT                   /product="KLTH0B07700p"
FT                   /note="weakly similar to uniprot|P40161 Saccharomyces
FT                   cerevisiae YNL206C RTT106 Regulator of Ty1 Transposition -
FT                   same phenotype as RTT101 - RTT105 disruption causes
FT                   increase in Ty1 transposition. Isolated from the same
FT                   screen as the other named RTT genes."
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21684"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013719"
FT                   /db_xref="InterPro:IPR040770"
FT                   /db_xref="InterPro:IPR040993"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD23"
FT                   /protein_id="CAR21684.1"
FT                   /translation="MATNFLDNIPQDLSKRIKTVCERDGSALKIFEDLYNYARQDPELR
FT                   KKPKGEEFLSEVPQDAVIFQLKDVSVLTPFRKKLNLVISVSPVTGKPALSLSKDMIPQL
FT                   SITQLNTSVKFATFLPFPEKKNMAYLFIRYVPEGDPAANEYVLVTLNKDATVKQFQAAG
FT                   LLNSESAEFSSCVEYIRKQAILVGFRISDPFSATSGAAPSFHVEAHRGTKEGTLYFLPD
FT                   HVLFGFKKPILLFSSQEIESITYSSITRLTFNVTLITKSGDKFEFSMIDQNEYTLIDDY
FT                   VKRKQVIDNSMSEENKAKSAHKDQNAAEHASLLEEAAQQLKGEGNVGDIPLESDDEEAD
FT                   VDFEGDSNLSDGSDSGSGSDQEDQEDEEENSGSAAEEKTEETAVPENENRPQTHDIALA
FT                   TGEEEEEEEEIAENEQGEEEEEQYEDEEDSGVEYD"
FT   gene            complement(<625231..>626517)
FT                   /locus_tag="KLTH0B07722g"
FT                   /old_locus_tag="KLTH-ORF14867"
FT   CDS_pept        complement(625231..626517)
FT                   /locus_tag="KLTH0B07722g"
FT                   /old_locus_tag="KLTH-ORF14867"
FT                   /product="KLTH0B07722p"
FT                   /note="similar to uniprot|P40160 Saccharomyces cerevisiae
FT                   YNL207W RIO2 Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21685"
FT                   /db_xref="GOA:C5DD24"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD24"
FT                   /protein_id="CAR21685.1"
FT                   /translation="MKLDISNMRYMTAEDFRVLQAVEQGSRNHEVVPTQMIHQISGMRS
FT                   QSGTNRSIGDLAKLKLVSRMRNIKYDGFRLTYNGFDYLGLRAMLSRDTIYSVGNVIGVG
FT                   KESDVYRVSAKDGSARVLKIHRLGRTSFTTVKNNRDYLKRNQSGSWMFLSRLAANKEYQ
FT                   FMSLLHSKGFTVPEPFDNSRHMILMELIDGYPMRNMRLHKNLPKLYSDLMLFIVKLANH
FT                   GLIHCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFFKK
FT                   KLKFEPRVDESMLDVDGFGDGYKYPYPVFERDVKRCDNLDELVQASGFSKKHPGDRRWE
FT                   EAAEQMRKEVSEQDVVEGDPNDLLEAEESSEGYSEGYSDDEYYSSEEEEESEEGEDSLE
FT                   EENERIVEALSSGVANLKMDKLGNYVLED"
FT   gene            complement(<628224..>630065)
FT                   /locus_tag="KLTH0B07744g"
FT                   /old_locus_tag="KLTH-ORF14860"
FT   CDS_pept        complement(628224..630065)
FT                   /locus_tag="KLTH0B07744g"
FT                   /old_locus_tag="KLTH-ORF14860"
FT                   /product="KLTH0B07744p"
FT                   /note="highly similar to uniprot|P40150 Saccharomyces
FT                   cerevisiae YNL209W SSB2 Ribosome-associated molecular
FT                   chaperone heat shock protein of HSP70 family proposed to be
FT                   involved in the folding of newly synthesized polypeptide
FT                   chains homolog of SSB1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21686"
FT                   /db_xref="GOA:C5DD25"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD25"
FT                   /protein_id="CAR21686.1"
FT                   /translation="MAEGVFAGAVGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVA
FT                   FTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQSDMKTWPFKVIDVNDAPM
FT                   IEVEYLGETKTFSPQEISSMVLTKMKETAEAKIGKKVEKAVITVPAYFNDAQRQATKDA
FT                   GAISGLNVLRIINEPTAAAIAYGLGAGKSDKERHVLIFDLGGGTFDVSLLHIAGGVYTV
FT                   KSTSGNTHLGGQDFDTNMLDHFKAEFKKKTGLDISNDARALRRLRTAAERAKRTLSSVT
FT                   QTTIEVDSLFEGEDFETSITRARFEDINAALFKSTLEPVEQVLKDAKIAKSQIDEVVLV
FT                   GGSTRIPKVQKLLSDFFEGKQLEKSINPDEAVAYGAAVQGAILTGQSTSEDTKDLLLLD
FT                   VAPLSLGVAMQGNVFAPVVPRNTTVPTIKRRTFTTVADHQTTVQFPVYQGERVNCSENT
FT                   LLGEFDLKGIPPLPAGEPVLEAIFEVDANGILKVTAVEKSTGKSANITISNAVGRLSSD
FT                   EIEKMVNQAEEFKAADEAFAKKHEARQRLESYVSSVEQTVTDPVLSSKMKRGAKSKIES
FT                   ALSDAMAALEIEDSSADDLRKAEVGLKRVVTKAMSTR"
FT   gene            complement(<630469..>631470)
FT                   /locus_tag="KLTH0B07766g"
FT                   /old_locus_tag="KLTH-ORF14852"
FT   CDS_pept        complement(630469..631470)
FT                   /locus_tag="KLTH0B07766g"
FT                   /old_locus_tag="KLTH-ORF14852"
FT                   /product="KLTH0B07766p"
FT                   /note="some similarities with uniprot|P16523 Saccharomyces
FT                   cerevisiae YNL210W MER1 Protein with RNA- binding motifs
FT                   required for meiosis-specific mRNA splicing required for
FT                   chromosome pairing and meiotic recombination"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21687"
FT                   /db_xref="GOA:C5DD26"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD26"
FT                   /protein_id="CAR21687.1"
FT                   /translation="MDVCLEPPTVHQDQEAWQSYSLDQGEVGDPSTPRTAGSRAAAKGV
FT                   LKGPVSRDSNEKEASQGTVSRLEQVFRGARDSVSVRVACTVRADAPRARFLVSRLRVRS
FT                   FLEALALAGGGRERRLTGTLTITADSYHSATVECPLDVELLTSVVGDAPVCMLLPRELV
FT                   HVIRSGGLELRSQVRALSARAITLESIKSAPVFADLASLAAHSFYKCPHAPFCPIPARA
FT                   TPRCISATLVAPAACSRAPSEITTHTVRLNKPEITFLIGRQGARIEQLRLQSRAVIKIL
FT                   PIPARLSANQLANPACIEQCLSITGDIESVARAVCLVGALLETFRQAPRHVR"
FT   gene            complement(<631704..>632702)
FT                   /locus_tag="KLTH0B07788g"
FT                   /old_locus_tag="KLTH-ORF14847"
FT   CDS_pept        complement(631704..632702)
FT                   /locus_tag="KLTH0B07788g"
FT                   /old_locus_tag="KLTH-ORF14847"
FT                   /product="KLTH0B07788p"
FT                   /note="similar to uniprot|P25044 Saccharomyces cerevisiae
FT                   YDL230W PTP1 Phosphotyrosine-specific protein phosphatase
FT                   that dephosphorylates a broad range of substrates in vivo
FT                   including Fpr3p localized to the cytoplasm and the
FT                   mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21688"
FT                   /db_xref="GOA:C5DD27"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR016277"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD27"
FT                   /protein_id="CAR21688.1"
FT                   /translation="MASETVPWYLKQSAQELVSKFRFIQHQEDLRLRDATLNPAKSRWS
FT                   LGSSVDESNDDRNRYVNIMPYERNRVKLRTQAGNDYINASYVKVQVPGQSVRPGHYIAT
FT                   QGPTQNSWPQFWQMCYQQCTGSDIVIAMVTPLVEGGRQKCFEYWPHDAAAPLKIPRTQS
FT                   SSCSASGPESSCTTFDVDLEVHFQCSERENDYTLSTLELAPADPAFPKKTVHHFYFDRW
FT                   RDMSKPDEIVPILKLSRHAHSLNSSENPMVVHCSAGVGRTGTFITLDHLFHDTLDFTAA
FT                   QPVQDYSHDLVEQIVLQLRTQRLKMVQMVDQFLFIYHAARYVFDLARTRDQ"
FT   gene            <632854..>636033
FT                   /locus_tag="KLTH0B07810g"
FT                   /old_locus_tag="KLTH-ORF14843"
FT   CDS_pept        632854..636033
FT                   /locus_tag="KLTH0B07810g"
FT                   /old_locus_tag="KLTH-ORF14843"
FT                   /product="KLTH0B07810p"
FT                   /note="similar to uniprot|Q07660 Saccharomyces cerevisiae
FT                   YDL231C BRE4 Zinc finger protein containing five
FT                   transmembrane domains null mutant exhibits strongly
FT                   fragmented vacuoles and sensitivity to brefeldin A a drug
FT                   which is known to affect intracellular transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21689"
FT                   /db_xref="GOA:C5DD28"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="InterPro:IPR023244"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD28"
FT                   /protein_id="CAR21689.1"
FT                   /translation="MVDSKVSKGSYKHKSFLSLKELGQSSKNKGPPSSRTSLSQLKLNL
FT                   LADGKHWEILEDYGLEELRDGFFDPIFTRHENVVPSEEDSDSAVSKTAGRLTVASWVAH
FT                   NLEGLKQSWQPMLKFWLAFFIAVCICLIHPSGSWLGHRFRYFMPVAVLIHHPARNIGVQ
FT                   LEITLWSITGAAFGMGWSALAWYISVATRPTANHQGGILFASMFLAVFLSTWLRSSKQR
FT                   LLYFSLSYGIAICFLHTVDLVNAKSMLDWKLYWDFGIPYLFGLLISMVVCAAVFPHSGQ
FT                   SEIISRFSTSINNIKQLLVTFLELDECGNTDRHHLLQKEIGTSIDFDVSEGMREFLNQL
FT                   TITRISEESLLSFRNSITIAAAPLRSMPTDHKLLTKLELQDFYEAYQDKHKEGQTVDKS
FT                   HGDTHMPVSGNATPLPKSNNFVGLGGHTNSELFTSMLRSTFSSSLLSLLVEMIALLETI
FT                   ESGLDNFANGKLFDNENLGIEEKLKSHISKLIRRIYNIDVCYKEFTKSNLFCKELLSDS
FT                   QAIDSFLFLRYLRQSAKNLIPVATCVVEMSANLRWRVELPHYPWRRALNRLPHRCSIDQ
FT                   GAKSLLHYFETKSDVDDLFEQLYNSYTSRHKVSAEGPEKGKIRATVRAIDHKDFSLHTT
FT                   SHPLRYKLWLLSTEITSYESRWALKIAIVMTFFALPAWLPQSNRWYQEYQCWWAPLSFL
FT                   LLSNRRHSGNWPSMGRRLASALLGIFWGWCSNQARHFGSPYVVATFAGLLCAVLSFNFF
FT                   ANNHTKSSFTGLLCFVVIALEPYSKRSSLNTAFIWKNTWVTGVALLCGILLSIPINWIL
FT                   WSFTARHELRISISSLLAHISQSYQSVTDRYLYRDADDAPTELTLKYSSIREVRLSQSL
FT                   IAVKRLLQKAREEPNYIFEFKADLYEQLLDACEYLLEKMVEARLSGQHFEVWDQDSNSE
FT                   ISRALLSLRRDSVASVIFIFYMLSNCFLSKNRIPMYLPNVIMSRKKLYDFISKFESNFA
FT                   SRSSTAVSNSESSDSEIKEHDTNPSSDDYEKSHWTQIHGMAFARAFTDIAEVVQKLANL
FT                   SREILGEEDCC"
FT   gene            <636698..>636958
FT                   /locus_tag="KLTH0B07832g"
FT                   /old_locus_tag="KLTH-ORF14840"
FT   CDS_pept        636698..636958
FT                   /locus_tag="KLTH0B07832g"
FT                   /old_locus_tag="KLTH-ORF14840"
FT                   /product="KLTH0B07832p"
FT                   /note="similar to uniprot|P53869 Saccharomyces cerevisiae
FT                   YNL211C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21690"
FT                   /db_xref="InterPro:IPR020301"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD29"
FT                   /protein_id="CAR21690.1"
FT                   /translation="MMRGSPRSIEEFLYRTLMNSEGFHRFVRRIYYKVNGLEEPMSGRP
FT                   AAHVEQVFRPTRLQKFKAYRILFWDEMRAVVGLNRRFNRHL"
FT   gene            complement(<637131..>639578)
FT                   /locus_tag="KLTH0B07854g"
FT                   /old_locus_tag="KLTH-ORF14839"
FT   CDS_pept        complement(637131..639578)
FT                   /locus_tag="KLTH0B07854g"
FT                   /old_locus_tag="KLTH-ORF14839"
FT                   /product="KLTH0B07854p"
FT                   /note="similar to uniprot|P40157 Saccharomyces cerevisiae
FT                   YNL212W VID27 Vacuole import and degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21691"
FT                   /db_xref="InterPro:IPR013863"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR040458"
FT                   /db_xref="InterPro:IPR040768"
FT                   /db_xref="InterPro:IPR040979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD30"
FT                   /protein_id="CAR21691.1"
FT                   /translation="MNIIKKIMDSGSKPELVSIPAGQFFLLRPESSPKSTLECLYNDAT
FT                   LAIRESGSHRFELVVRKEVDDTELTSGDGGEDFEDDGLSVLSGQSKKEEEWSFNLDKSL
FT                   HFRKSWSEQGEVAFVWRNTKGDAGEKFQFVVNSEIPLTDVGHFLHTVNVCEYEHKFKKQ
FT                   PSTATRENLRQFEFSHRHDEEAISDEDGDENDENNEDSQLGSKMGLLDLGNSSSESDDG
FT                   FDSQEFEDAKDNFGSPKHPKQSVKVPNPPSAKTLLREHAALLVYDPTQQQFSLQDPDCG
FT                   VSILDHGKFEYWLQINGKVLELGVDLTPLVNPFFQEETLCFIFNYSYETITLSYMLKFS
FT                   DEATFSEFQQQWSKSLWEALNKQKWSAISEKEQRCISNANRDVDKELSLFLQDDDDSSS
FT                   ADSEESDENDEEEEEEEAEREIQSDVDSFDEDKKEEEYRSSTTLSGNKSLTVSYKNDRS
FT                   FVVRGDKIGVFKVDDENNEVNFVTAINNVSSLKGRNFEPENPMLYTEDRAMIVQDKENP
FT                   SLVFKMDLERGKVVEEWSAGGKDVLKYSHSKKFDQLTNEQTFLGVSGKSVFRLDPRISG
FT                   ANKLVTEQNKDYATNNKFSSLGTTQEGFLAVGSEKGEIRLFDKIGLRAKTLIPALGEPI
FT                   NHICNSADGKWLLATCDSSLLLIDLTIKEGKNAGSVGFVKSFSKEEMPNIFVLKIHPKT
FT                   AAYMRTSAKQPIKFTKAYFNTGLNQKEQTIVTSTGPFAITWSLKKVLKGEKMSYRIKRY
FT                   NSMVMEDNFRYGSDKNVILALKDNVKMAKKTGFKEPSKEMTRQNNWNEFLELSEKAAKR
FT                   RNQ"
FT   gene            <639886..>640557
FT                   /locus_tag="KLTH0B07876g"
FT                   /old_locus_tag="KLTH-ORF14835"
FT   CDS_pept        639886..640557
FT                   /locus_tag="KLTH0B07876g"
FT                   /old_locus_tag="KLTH-ORF14835"
FT                   /product="KLTH0B07876p"
FT                   /note="weakly similar to uniprot|P40156 Saccharomyces
FT                   cerevisiae YNL213C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21692"
FT                   /db_xref="GOA:C5DD31"
FT                   /db_xref="InterPro:IPR010487"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DD31"
FT                   /protein_id="CAR21692.1"
FT                   /translation="MKPVLQGALAWIYAGYKTASRGHLLPYTRHQKFHSSSLISEQAKR
FT                   AKDLIKLVNSSSLSNSESQSLDWRSDLKVPEWKRQKLALKDKFKGQQWNPKKKLSREQM
FT                   ENVRLLKRHFPETSATELSERFQVSPEVIRRILKSKWQPNEEEQLQLQTRWKRRSERVN
FT                   EILGSPEHQKLPPKKLVLGSGRTDTDLQVKSVRRTAVKAGRNSSSPKGKQKLNLLSKLI
FT                   S"
FT   gene            complement(<640619..>641242)
FT                   /locus_tag="KLTH0B07898g"
FT                   /old_locus_tag="KLTH-ORF14833"
FT   CDS_pept        complement(640619..641242)
FT                   /locus_tag="KLTH0B07898g"
FT                   /old_locus_tag="KLTH-ORF14833"
FT                   /product="KLTH0B07898p"
FT                   /note="similar to uniprot|P40155 Saccharomyces cerevisiae
FT                   YNL214W PEX17 Peroxisomal membrane protein component of the
FT                   peroxisomal translocation machinery required for peroxisome
FT                   biogenesis binds Pex14p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21693"
FT                   /db_xref="GOA:C5DD32"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD32"
FT                   /protein_id="CAR21693.1"
FT                   /translation="MNHKGYSGIEWPSEATIRERAKKNNTVDFVQRVFYNAGVVVSLVY
FT                   VIIVSIIEPLLRSQFNQRLQLSADMLIRVRKFVSLLEQRLKSTSISAIGFNEKVDPESC
FT                   VSTIERCTQTEELLESSGVEEKATEWTKIIARLRYAREMLSRANEGKNDNNASGRITPL
FT                   KFQAQSLSAYISSLDTRDETFRNHKNSVQAIRDMKGWVINGRVR"
FT   gene            complement(<641583..>643160)
FT                   /locus_tag="KLTH0B07920g"
FT                   /old_locus_tag="KLTH-ORF14830"
FT   CDS_pept        complement(641583..643160)
FT                   /locus_tag="KLTH0B07920g"
FT                   /old_locus_tag="KLTH-ORF14830"
FT                   /product="KLTH0B07920p"
FT                   /note="weakly similar to uniprot|Q07684 Saccharomyces
FT                   cerevisiae YDL233W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21694"
FT                   /db_xref="InterPro:IPR029005"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD33"
FT                   /protein_id="CAR21694.1"
FT                   /translation="MNSQQPHQGSQHMYGYQAPLRKQVPNFTPGVNMGQMMMGPQVNAH
FT                   MGQQQPELGLHPTARQGHVQYSGAQISVPQPRKQQQQVQPQSQSNDLSNSTSAIPSPFA
FT                   TSMPTPTGPASAPPMNMHVGAPVSGAAQMPGATRSAGPVSATASTANHISGPGLTPASP
FT                   QVGAMPSNQFYPVASAYQPVSKRHIASNMIPYPIRKYLSNMAILRLHEIINLVNVSTDR
FT                   VDDFGYWQRFTNDLFTPYGILRYSTQGGEETRQFEFTTPIIPLICNSLGSVGIVRLEMI
FT                   PQQLRAQVLSNGTIFFDCPRCTTTFYYPDGSYMTNFSQVKGIFDSNLKIEWVEISSYSF
FT                   VPGIEWSSLERLISSEPVCHEIFKDLSNSRKKPESTEDPKNQEPARNQDPKVPDNFSAI
FT                   TKLRSQFGVFHNISSFGIQESFMRALQVSDAISYLKNLKVYQKVHNLQSPLTSLESFVA
FT                   SSQAEKASSMAPGAPFKYGNSSSPAATPSNPRPKVPNSSKPRPKKRRQSDLSPLSTGDR
FT                   GLQGFGQI"
FT   gene            complement(<643482..>644171)
FT                   /locus_tag="KLTH0B07942g"
FT                   /old_locus_tag="KLTH-ORF14823"
FT   CDS_pept        complement(643482..644171)
FT                   /locus_tag="KLTH0B07942g"
FT                   /old_locus_tag="KLTH-ORF14823"
FT                   /product="KLTH0B07942p"
FT                   /note="some similarities with uniprot|P40154 Saccharomyces
FT                   cerevisiae YNL215W IES2 Protein that associates with the
FT                   INO80 chromatin remodeling complex under low-salt
FT                   conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21695"
FT                   /db_xref="GOA:C5DD34"
FT                   /db_xref="InterPro:IPR006880"
FT                   /db_xref="InterPro:IPR029523"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD34"
FT                   /protein_id="CAR21695.1"
FT                   /translation="MDSDLSSVGSEDEIYEETPEVAEEELIGSEPEDDEYQYTPDDYEE
FT                   DEETGQRSKSGSRSSRRAATNEPRASNRKRAPTDEFEEPGSSPAKRARRNGAIDLQNLD
FT                   DDDDDDDDTSSASQQKLNSRNKMISELMDNTSRRSSKLTDQELQLRRAENARKRKNLSE
FT                   KKLEEEKQDTINKLLRRRAGKSRAAMPAAQEQENDAANYVKPRRAYNAQGLVRTLRKKD
FT                   VDIYATY"
FT   gene            <644343..>646580
FT                   /locus_tag="KLTH0B07964g"
FT                   /old_locus_tag="KLTH-ORF14820"
FT   CDS_pept        644343..646580
FT                   /locus_tag="KLTH0B07964g"
FT                   /old_locus_tag="KLTH-ORF14820"
FT                   /product="KLTH0B07964p"
FT                   /note="similar to uniprot|P48365 Saccharomyces cerevisiae
FT                   YDL234C GYP7 GTPase-activating protein for yeast Rab family
FT                   members including: Ypt7p (most effective) Ypt1p Ypt31p and
FT                   Ypt32p (in vitro) involved in vesicle mediated protein
FT                   trafficking"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21696"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD35"
FT                   /protein_id="CAR21696.1"
FT                   /translation="MSTELLFCKSKVYVHCSKKAEDNIAGFLLITRDAQQPSLEATLSW
FT                   IPERELSKLQLNELNRADGNTAKLAKIKKELILQAQYAAWAFCIKINSIYSIQFRAPSP
FT                   SGWWYGSIAINSKNSHDQGSIPILFFHDKECASTQAKQKALNKSFDPFSGTDVYWGASD
FT                   FRDAIMQLVDFKQTLVDPTVWLVNATLDDLRNFSPQDKKVEAEASTKDSTSPKFWDMLD
FT                   QARWNVMSKFADFTSKSTNKVVNIWSQHPLVQFVDKHNNNPYVKKIMTNPKVQEIQDDF
FT                   DSARIYLAKWALGVKEQAEKYQTANGLDDTYRRLLFNELGSDGEDVKLTDEELNIAMQR
FT                   SHPLTRQKWDSFFDSEGRLLMTVQEVKDYIFHGGVADMELRKDVWLFLLEVYPWDSSLE
FT                   ERQVLTQTLRESYRANYKSKWEYRQPHSDEDEESYWHDQVLRVEKDVKRNDRDLSLYKY
FT                   NTETGEAPASPQQDFDQGAEQVDSDVWTVKNPHLQSLRSILLSYNIYNNDLGYVQGMCD
FT                   LLSPIYYILQDEELSFWAFVNFMRRMERNFLRDQSGIRDQMMALTDLCQLMLPKMSAHL
FT                   AKCDSSNLFFCFRMLIVWFKREFEFEDVCSIWEVFLTDFYSSQFQLFFMLAVLQKNSAP
FT                   VMNNLDQFDQVLKFFNELKGTMDWSDLMIRSELLFVKFKKIMDTLERRAELAEYTLLTS
FT                   DGSVINESSAAASEQNALATQTSLITENLKQLMSKKIVIKREPARNKHSIR"
FT   gene            complement(<646727..>648892)
FT                   /locus_tag="KLTH0B07986g"
FT                   /old_locus_tag="KLTH-ORF14818"
FT   CDS_pept        complement(646727..648892)
FT                   /locus_tag="KLTH0B07986g"
FT                   /old_locus_tag="KLTH-ORF14818"
FT                   /product="KLTH0B07986p"
FT                   /note="similar to uniprot|P11938 Saccharomyces cerevisiae
FT                   YNL216W RAP1 DNA-binding protein involved in either
FT                   activation or repression of transcription depending on
FT                   binding site context also binds telomere sequences and
FT                   plays a role in telomeric position effect (silencing) and
FT                   telomere structure"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21697"
FT                   /db_xref="GOA:C5DD36"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015280"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR021661"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR038104"
FT                   /db_xref="InterPro:IPR039595"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD36"
FT                   /protein_id="CAR21697.1"
FT                   /translation="MSQQDDFETPSTNAFEDALEHQSQHYEDGKPDTRSDKDASGKDEG
FT                   AGSGGDDQQDIFQDLGFFIAHDESRQELEQLVSGHGGTVLSELPSGKSNKEFVVSTINA
FT                   SDLPTVTPTYIKTCCENNVLMKVQPFLVPYNEFRAVIDTQLQNESGEKPTAPADDASET
FT                   AEQPVESPSTKPGEDKRPDADTPQPSETNGGPMASVTAESNAGSEDQGAGARRESVDSA
FT                   KNSISGDESDVVKTPVAPSPPSARQPAASHNKSSFTEEEDEFILDVVRKNPTRRTTHTL
FT                   FDEISHYVPKHTGNSIRHRYRVYLAKRLNFVYQVDSTGKLVRDDNGDLIKTTVLPKSLK
FT                   NKFTASEDYALSVEVKKQFYRDIYQMDPDTGESLIKDINAPDGNLKGSFGAGSDERQNP
FT                   GPSFKDFRVGERRGPVPREFFKKYADENPNHTENAWRDRFRKFLLTFGIDRYIEYYENE
FT                   IAQSRVPQAMKNMTNRPKRPGVPTPGNYNSFAKKVKTLSQQQQQQAAAIIAANGGAIDP
FT                   AALAFAIPEGDFLDEETLNFISGLRRDLSKIESAGGAAFAYPQEIAESIRNDFTNEEAQ
FT                   FDEIDPDKIPFPPALVTNELFMPQFFHFGSTREFLDKINEVISRDYEPSQAEKLVQDLC
FT                   DDVGVRKTFSTSILTALSGDLMVFPRYFLCMFHFGSNPPMNIPGIWTREDDEMLRSGEE
FT                   SNIKKLTQKHGAGRIEMRKRFIASDLV"
FT   gene            complement(<649859..>650608)
FT                   /locus_tag="KLTH0B08008g"
FT                   /old_locus_tag="KLTH-ORF14810"
FT   CDS_pept        complement(649859..650608)
FT                   /locus_tag="KLTH0B08008g"
FT                   /old_locus_tag="KLTH-ORF14810"
FT                   /product="KLTH0B08008p"
FT                   /note="weakly similar to uniprot|P40152 Saccharomyces
FT                   cerevisiae YNL217W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21698"
FT                   /db_xref="GOA:C5DD37"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD37"
FT                   /protein_id="CAR21698.1"
FT                   /translation="MFEEFAKLMAKVNAKDENTHVVLLGDFTSKGPQSRAVVDYMREHQ
FT                   DSTHCILGNHEVNVMFAYLNHVGLEQRLSSGHARWRPLEFSSESYIPPRGQVNRMHRDV
FT                   ARELGEERLDWVAKHCPAELAIEFGPQTLVAVHAGLDPDLSREDVPKVKDITTMKYMLP
FT                   EDHSKTSKFKFKHSRRWYKFWDGQHAPRNTTVFYGHDSSNGLTLRKRTKGLDSACVSGG
FT                   QLSALEVVYRDGEYQEFLHQVECREMR"
FT   gene            <652379..>652795
FT                   /locus_tag="KLTH0B08030g"
FT                   /old_locus_tag="KLTH-ORF14803"
FT   CDS_pept        652379..652795
FT                   /locus_tag="KLTH0B08030g"
FT                   /old_locus_tag="KLTH-ORF14803"
FT                   /product="KLTH0B08030p"
FT                   /note="similar to uniprot|Q07688 Saccharomyces cerevisiae
FT                   YDL235C YPD1 Phosphorelay intermediate protein
FT                   phosphorylated by the plasma membrane sensor Sln1p in
FT                   response to osmotic stress and then in turn phosphorylates
FT                   the response regulators Ssk1p in the cytosol and Skn7p in
FT                   the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21699"
FT                   /db_xref="GOA:C5DD38"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD38"
FT                   /protein_id="CAR21699.1"
FT                   /translation="MNTVPIPAGVINWNTLNEIVSMDEDSPDFSKNLIIQYLEQANTTF
FT                   DQIEQELQGNCDLEQLASLGHFLRGSSAALGLQRISWACERIQNLGRKREGGVEGQQLP
FT                   DSHYAQLITNALQCARNEFKAAKAELSAFYKSEL"
FT   gene            complement(<652928..>654538)
FT                   /locus_tag="KLTH0B08052g"
FT                   /old_locus_tag="KLTH-ORF14800"
FT   CDS_pept        complement(652928..654538)
FT                   /locus_tag="KLTH0B08052g"
FT                   /old_locus_tag="KLTH-ORF14800"
FT                   /product="KLTH0B08052p"
FT                   /note="similar to uniprot|P40151 Saccharomyces cerevisiae
FT                   YNL218W MGS1 Protein with DNA-dependent ATPase and ssDNA
FT                   annealing activities involved in maintenance of genome
FT                   interacts functionally with DNA polymerase delta homolog of
FT                   human Werner helicase interacting protein (WHIP)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21700"
FT                   /db_xref="GOA:C5DD39"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD39"
FT                   /protein_id="CAR21700.1"
FT                   /translation="MNTSKSEQLISCPVCNLKVKYSAINSHLDKCTGDGKTSKKEPTLS
FT                   SFLKGKRKQASDEPEIIEVEEKVKKPKSQPSKGENADVRNLQKIAHQPLSEKLRPKELA
FT                   EYVGQQHIISSEHGVLYKFVQQGIIPSMILWGPPGVGKTSLARLLTKAVNQSHANGVTY
FT                   TLIQTSATKATAQELRKIFENSRREFSLTKRITVVFIDEIHRFNKGQQDLLLPHVEAGD
FT                   IVLIGATTENPSFQLNNALMSRCQIFVLTKLSTDEMCLVLSRGIAMLNKCRHLIWKVNH
FT                   PLKLDRSVLEFVVDISMGDTRRALNLLEMIEVSTRDDAKELKEEDIREIINGNSTELRT
FT                   YYDRQGENHYDTISAFHKSVRGSDENAALYYLARMLQGGEDPLYIARRMIRIASEDIGV
FT                   LDNSLLPLAVAAHDAVMKVGLPEADLALAQCSVALARAPKSVQLYRAWKQVNAKLRENQ
FT                   NSFASCGIPMHLRNAPTKLMAELGYARDYKYNPDFENGEVAQDYFPDEVIAACDRQELK
FT                   FMAGLHLGSQKDPEIAKQP"
FT   gene            complement(<654730..>655731)
FT                   /locus_tag="KLTH0B08074g"
FT                   /old_locus_tag="KLTH-ORF14797"
FT   CDS_pept        complement(654730..655731)
FT                   /locus_tag="KLTH0B08074g"
FT                   /old_locus_tag="KLTH-ORF14797"
FT                   /product="KLTH0B08074p"
FT                   /note="similar to uniprot|P19881 Saccharomyces cerevisiae
FT                   YDL236W PHO13 Alkaline phosphatase specific for p-
FT                   nitrophenyl phosphate involved in dephosphorylation of
FT                   histone II-A and casein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21701"
FT                   /db_xref="GOA:C5DD40"
FT                   /db_xref="InterPro:IPR006349"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD40"
FT                   /protein_id="CAR21701.1"
FT                   /translation="MKTKYLFQSADCTRYLQKRANTIKKMTQTNSPVKVNSKEVAQELL
FT                   DQYDTFLFDCDGVLWLGSHLLPHINETLEMLLSRGKKLYFVTNNSTKSRAAYTKKFASY
FT                   GIKVTEDQIFTSGYASALYVRDTLKLTPGKDKVWVFGEAGITEELKLMGIESLGCNDPR
FT                   LDEPFDISSSPFLKNGLDPDVKCVIAGLDTKINYHRLAVTLQYLQQPDVKFVATNIDST
FT                   YPSKGHILPGAGSMIECVAFSSGREPAACGKPNPNMLNAIVSSKKIDRSKCCMVGDRLN
FT                   TDMRFGIEGKLGGTLLVLTGIETEEKALDSTGDHPLPKYYAEKLGDLYELTK"
FT   gene            <655912..>657567
FT                   /locus_tag="KLTH0B08096g"
FT                   /old_locus_tag="KLTH-ORF14794"
FT   CDS_pept        655912..657567
FT                   /locus_tag="KLTH0B08096g"
FT                   /old_locus_tag="KLTH-ORF14794"
FT                   /product="KLTH0B08096p"
FT                   /note="similar to uniprot|P53868 Saccharomyces cerevisiae
FT                   YNL219C ALG9 catalyzes the transfer of mannose from Dol-P-
FT                   Man to lipid-linked oligosaccharides mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21702"
FT                   /db_xref="GOA:C5DD41"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="InterPro:IPR039484"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD41"
FT                   /protein_id="CAR21702.1"
FT                   /translation="MNSNWTSVILFGAFVACRFYLQPTYSLISDCDETFNYWEPLNFLL
FT                   RGFGKQTWEYSPEYSIRSWAFLIPLYSVLNPSMRILEAFHLPMFNLFYIARFFLGLFSL
FT                   VMEWLFFEEIKSTLSTQTATFWLFFQVFNPGWFHASVELLPSSFAMISLLGSLKFTLRY
FT                   LSTGAQDAFVKALLFNFVGGILGWPFVMILSVPLVVHYIFSHRILNTLKAGISAASRLA
FT                   VVTAVVFAVDSMFYGKFTPVAWNIVMYNVIGANEKSGPNIFGVEPWYYYIFSLLLNIPL
FT                   PVLLGSIVGLSNLRLWPVWGALATWLTVFLLQPHKEERFLYPIYGFVTLASSVGFSSFW
FT                   RKWSGSKLTRNTVFLILLCSTASQALLRMFALVQNYKAPLDVYSHLPEASGPQTVCVGR
FT                   EWFHFPASMFLPDNYRLGFVPSGFDGLLPGDFKETDSILNSIRDKPVGMNNQNLFDSSK
FT                   LVVTEQCDYFVDFMLHSDNEKDAFDPTNLPQGWKKLYSALFVDAPESKFFGRALLLPEG
FT                   LTRLIPQQLQSRWSKIYQVKYLEYCIFERHREEV"
FT   gene            complement(<657626..>658930)
FT                   /locus_tag="KLTH0B08118g"
FT                   /old_locus_tag="KLTH-ORF14789"
FT   CDS_pept        complement(657626..658930)
FT                   /locus_tag="KLTH0B08118g"
FT                   /old_locus_tag="KLTH-ORF14789"
FT                   /product="KLTH0B08118p"
FT                   /note="highly similar to uniprot|P80210 Saccharomyces
FT                   cerevisiae YNL220W ADE12 Adenylosuccinate synthase
FT                   catalyzes the first committed step in the 'de novo'
FT                   biosynthesis of adenosine"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21703"
FT                   /db_xref="GOA:C5DD42"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DD42"
FT                   /protein_id="CAR21703.1"
FT                   /translation="MVNVVLGSQWGDEGKGKLVDLLVGKYDIVARAAGGNNAGHTIVVK
FT                   GVKYDFHMLPSGLVNPNCQNLIGNGVVMHVPSFFAELEQLEAKGLTDARERLFISSRAH
FT                   LVFDFHQRTDKLREAELSGASTDGKNIGTTGKGIGPTYATKASRSGLRVHHLVNDEPGA
FT                   WEEFETKYRRLVQTRQQRYGDFEYDADAELARYKKYREELKPFVVDSVVFMHNAIRDNK
FT                   KILVEGANALMLDIDFGTYPYVTSSNTGIGGVCTGLGLPPRVIDEVYGVVKAYTTRVGE
FT                   GPFPTEQLNESGEKLQNIGAEFGVTTGRKRRCGWLDLVVLKYSTLINGYTSLNITKLDV
FT                   LDTFKEIPVGVSYTLRGKKLDLFPEDLNVLGKVDVEYVTLPGWEQDITKITEYEDLPEN
FT                   AKKYLKFIEDFVGVPIEWVGTGPARESMVYKQVSK"
FT   gene            complement(<659691..>661397)
FT                   /locus_tag="KLTH0B08140g"
FT                   /old_locus_tag="KLTH-ORF14782"
FT   CDS_pept        complement(659691..661397)
FT                   /locus_tag="KLTH0B08140g"
FT                   /old_locus_tag="KLTH-ORF14782"
FT                   /product="KLTH0B08140p"
FT                   /note="similar to uniprot|P32837 Saccharomyces cerevisiae
FT                   YDL210W UGA4 Permease that serves as a gamma- aminobutyrate
FT                   (GABA) transport protein involved in the utilization of
FT                   GABA as a nitrogen source catalyzes the transport of
FT                   putrescine and delta-aminolevulinic acid (ALA) localized to
FT                   the vacuolar membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21704"
FT                   /db_xref="GOA:C5DD43"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD43"
FT                   /protein_id="CAR21704.1"
FT                   /translation="MEKAQAVANSTDVSSSLEQAVGDIHQIGSLRTITSKRAGEVNFID
FT                   AKRAHGDAELLAEIGYKQELNRHFSTVQVFGVAFSIMGLLPSIASVLAIGMPGGMVSLV
FT                   WGWFIAGIFILAVGCGMSELASAIPTSGGLYYYTYYYAPQKYKAFFSFVIGYSNSLALV
FT                   SGLCSITYGLAEEILSIVVVSKDGDFTITNGKTYGVFVAGIAATTVVTSIATVAVSKLQ
FT                   TVSILANVGLIVLFFIVLPIGVANTKGLDFNDGSFIFGKWLNETTWPDGWQFMLAGLQP
FT                   AIWTIGAFDSCIHMSEEAKNATKAVPLGIISSISVCWILGFLICIVMAACMGPDIDAIL
FT                   GSSFGSPLPQILYNALGKKWTIAIMTLIAACQFLMGCSILTAISRQIWAFARDDGLMFS
FT                   KYIKVVNKKLSSPLRATWFGAVCALVIGLLCLIGGTASNALFSLGIGGNYLAWMAPNLL
FT                   RMTTGKDLFRPGAFYMGKTWSPIVNWTAIVFQIFILIMIMFPAESKGITPDAMNYTVVI
FT                   CGGVWIGSMIYFFVYKKKAFNGPKSNLSDDEYVDAVGQDVIDQILSHQKSG"
FT   gene            <661997..>664531
FT                   /locus_tag="KLTH0B08162g"
FT                   /old_locus_tag="KLTH-ORF14778"
FT   CDS_pept        661997..664531
FT                   /locus_tag="KLTH0B08162g"
FT                   /old_locus_tag="KLTH-ORF14778"
FT                   /product="KLTH0B08162p"
FT                   /note="similar to uniprot|P41812 Saccharomyces cerevisiae
FT                   YNL221C POP1 Subunit of both RNase MRP which cleaves pre-
FT                   rRNA and nuclear RNase P which cleaves tRNA precursors to
FT                   generate mature 5' ends binds to the RPR1 RNA subunit in
FT                   Rnase P"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21705"
FT                   /db_xref="GOA:C5DD44"
FT                   /db_xref="InterPro:IPR009723"
FT                   /db_xref="InterPro:IPR012590"
FT                   /db_xref="InterPro:IPR039182"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD44"
FT                   /protein_id="CAR21705.1"
FT                   /translation="MSGKKPRSQNQLYRRRKVQDARNIRTEALKSGAQASQELSESGGM
FT                   MRVPEFMASREFEVKQLQVAMHKSKSASSTRVFQSLPRKLRRRTASHNVKRIPKRLRNR
FT                   ALREMQKSDQAVTRGTEKPSRQRRSGLTAKQLYKARMTVKLLRLAARSKSMKLALPAQV
FT                   TGSQTKLRQRIRALQKTLRAEAKPGTAQLRNNQMGSYDCTGIGKLAPRPVGRIKYMKRQ
FT                   RVFTWLPTHVWNAKRSHMLKRWGYQMPWSPTQKCFKLTHRIGGNTAASDGALCCDSSYM
FT                   GTMIVASADTEALRLLAHQLTNKRATLPKYRVSGHWFEGLIYDENAEAVGPGEILWISS
FT                   NKLLLRLHPAIYSRVFEQISLANSEKKFVIQDCRFSIGSITLSGGKSLNALSQVLRSTT
FT                   ASKSYNQFKTVAYVTDTNVLPQRTVFAFEAIDPRHLSNPRALPKANINANDVLKLQAEY
FT                   PREEIAEVLEKLCNPDKREMSYKNQQTLKQLAYRRRMLLESTARTNAIPHDSKEDPFIP
FT                   IAIFKRPKQESWVVLLPWFWLLPLWYQLNRVSRVYHMGLRQLQQLSFEQRRLYFPDDYP
FT                   FTQAGYDENSTFKRLSQEALWKRKPAGKRVNFDKISGIHTENPVRFPGEIGDPFSCDWR
FT                   LLQVLRNGIDFLRTRDQGPIRMYDPKRTSQFDELNMRKLMYVNDIIDLYSDVQDKKLTP
FT                   SALPISIFTKSVKGANSGCPQYGNSPRMQIVTTPLQVAAVSCVLQEQGHPKDFARVYAI
FT                   PAQDMDYWLSIVNIKARSNGKRDHDTAQPTPGVQDLIGFVTSGTFHLGDGRGACTAFIA
FT                   AQEACKSPNEYVLIRNVGTNVYRVAKWEQIAL"
FT   gene            <664746..>665234
FT                   /gene="SNR19"
FT                   /locus_tag="KLTH0B08184r"
FT                   /old_locus_tag="Klth0B_ncRNA_210"
FT   ncRNA           664746..665234
FT                   /gene="SNR19"
FT                   /locus_tag="KLTH0B08184r"
FT                   /old_locus_tag="Klth0B_ncRNA_210"
FT                   /product="U1 RNA"
FT                   /note="SNR19 (U1 RNA)"
FT                   /ncRNA_class="snRNA"
FT   gene            complement(<665390..>666679)
FT                   /locus_tag="KLTH0B08206g"
FT                   /old_locus_tag="KLTH-ORF14773"
FT   CDS_pept        complement(665390..666679)
FT                   /locus_tag="KLTH0B08206g"
FT                   /old_locus_tag="KLTH-ORF14773"
FT                   /product="KLTH0B08206p"
FT                   /note="similar to uniprot|Q6B312 Saccharomyces cerevisiae
FT                   YDL237W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21706"
FT                   /db_xref="GOA:C5DD45"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DD45"
FT                   /protein_id="CAR21706.1"
FT                   /translation="MKYLSYTITFVKNTHRSCQRINKSASFGMIGSLAIGFVLMIVSFW
FT                   AGTYVNVRGNPVMLDFSDGASSTRGDSNAHNNLGLTGANLLHFFKNRMSDTKDLTDARG
FT                   VQVSRFYDEVVRYLTAENAGASTAEGTCFPEGSIVSKLTRNVNVVPKVHSHNDYWRDLP
FT                   LFEALCHGIPSVEADVWLVDNDTQLAVGHNEAFLDHAHRTLHSLYTGPLLTMLNEVNCN
FT                   LGDKDHKYGVFYSSPETTLNLYIDFKSPDSTQTYALLMDLYLKPLIDMGYLTYFDMDEE
FT                   KVVWNPVTVILTGDYPTDPTVLDGQEQKGYYNTTQRFVFLDAPMHKLDEHYSGISVVAS
FT                   ASLQQLLGNCKDLSQEADRSLLRQGSLPTESVTCVAKQVQKAQSLGLKTRIWGAPTWPE
FT                   SSKQKLWSQQIFDIGIDFLNTDDLEEVTHL"
FT   gene            <667368..>668792
FT                   /locus_tag="KLTH0B08228g"
FT                   /old_locus_tag="KLTH-ORF14772"
FT   CDS_pept        667368..668792
FT                   /locus_tag="KLTH0B08228g"
FT                   /old_locus_tag="KLTH-ORF14772"
FT                   /product="KLTH0B08228p"
FT                   /note="similar to uniprot|Q07729 Saccharomyces cerevisiae
FT                   YDL238C GUD1 Guanine deaminase a catabolic enzyme of the
FT                   guanine salvage pathway producing xanthine and ammonia from
FT                   guanine activity is low in exponentially- growing cultures
FT                   but expression is increased in post- diauxic and
FT                   stationary-phase cultures"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21707"
FT                   /db_xref="GOA:C5DD46"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD46"
FT                   /protein_id="CAR21707.1"
FT                   /translation="MILKLTVYHGNFVDTPSLGDVRIRPQTTIGVGTDGKILFIKEKSQ
FT                   DPLRDALDFDQTLQPSEVAVVKISGSQDGSFFFPGFVDTHVHASQYPNAGIFGSSTLLD
FT                   WLQTYTFPLEASLKDADTARAVYNRVLDRTLANGTTTASYYTTIDAASSNLMARICAEK
FT                   GQRAFIGKVCMDQNSPDYYVELFKECKHSTRQVVDYIKKELKDEKIQPVLTPRFAPSCS
FT                   RELMSWLGQLAHEEDLNVQTHLSENLAELELVAELFPECENYSQVYDNHHLLTKKTLLA
FT                   HCVHLSDKEIELLKLRGCGVSHCPISNSSLASGECRVRLLLDNGINVGLGTDLSGGYSS
FT                   SILAVARQALLVSRHLAMKETDAKKQEHVNLSVEDVLFLASLGGAQALSLGSVVGSFEV
FT                   NKQFDAQLINLDPVSSNVDVFEWQRTSWNDSPKEGENQKLARNLLAKWLFTGDDRNTAR
FT                   VWVAGRLVHSYPASAT"
FT   gene            complement(<668789..>669409)
FT                   /locus_tag="KLTH0B08250g"
FT                   /old_locus_tag="KLTH-ORF14770"
FT   CDS_pept        complement(668789..669409)
FT                   /locus_tag="KLTH0B08250g"
FT                   /old_locus_tag="KLTH-ORF14770"
FT                   /product="KLTH0B08250p"
FT                   /note="highly similar to uniprot|P53538 Saccharomyces
FT                   cerevisiae YNL222W SSU72 Transcription/RNA-processing
FT                   factor that associates with TFIIB and
FT                   cleavage/polyadenylation factor Pta1p exhibits intrinsic
FT                   phosphatase activity affects start site selection in vivo
FT                   Nuclear zinc-finger motif containing protein."
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21708"
FT                   /db_xref="GOA:C5DD47"
FT                   /db_xref="InterPro:IPR006811"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD47"
FT                   /protein_id="CAR21708.1"
FT                   /translation="MSNEPTKSLKFCTVCASNNNRSMESHRVLREAGYDVSSYGTGSAV
FT                   RLPGLSEDKPNVYAFGTPYNDIYNDLRSQSVERYRSNGLLEMLDRNRKLKKAPEKWQEG
FT                   FKVFDFVFTCEERCFDAVCEDLMNRGGQLNKIVHVININIRDDNENAKIGSKAILKLAD
FT                   MLSQETVRCEKTGEPLEDCIISLLAQWQEMYPQLPLLYSPAYY"
FT   gene            complement(<669610..>671061)
FT                   /locus_tag="KLTH0B08272g"
FT                   /old_locus_tag="KLTH-ORF14768"
FT   CDS_pept        complement(669610..671061)
FT                   /locus_tag="KLTH0B08272g"
FT                   /old_locus_tag="KLTH-ORF14768"
FT                   /product="KLTH0B08272p"
FT                   /note="similar to uniprot|P53867 Saccharomyces cerevisiae
FT                   YNL223W ATG4 Cysteine protease required for autophagy
FT                   cleaves Atg8p to a form required for autophagosome and Cvt
FT                   vesicle generation mediates attachment of autophagosomes to
FT                   microtubules through interactions with Tub1p and Tub2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08272g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21709"
FT                   /db_xref="GOA:C5DD48"
FT                   /db_xref="InterPro:IPR005078"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD48"
FT                   /protein_id="CAR21709.1"
FT                   /translation="MFKFAKCQCFNHNTLFRQQEYSRATAMEFLQKVSQQLFEPENADQ
FT                   DNELVVLGRRYEANGSNERKPDEGEAVSTGVFSQLFHRERGWNPEFLLEVHSLLHFTYR
FT                   TKFEPIPKDPNGPSPMNFGTLFRDNPLNSFESAINHPDCFCSDIGWGCMIRTGQALLGN
FT                   ALARLRSPPEEKQLIGWFEDRSSAPFSLHNFVREGNALSRKPPGEWFGPSATSRSIQSL
FT                   VHAFPQCGLNHCIISTDSGDVYEEDVGPILEREPQATILLLLGVKLGLNNVNSRYWPDV
FT                   KHILGSSFSVGIAGGRPSSSLYFFGYQGDYLFYLDPHTSQLDLASCATDNEKYESVHSA
FT                   RFNKVHFSELDPSMLIGVLIQGLDDWDAWKSYIDRSQILHVLPHRPRDYFMDEPDDSAS
FT                   ENDGIPGSRDSQDSQGPAIDGDYVDVAPMVQHAGSCRDDEFQDVKCKNQKILVVGDHDS
FT                   TTADTEIERVLVEHETVPLIASTRP"
FT   gene            <671104..>673350
FT                   /locus_tag="KLTH0B08294g"
FT                   /old_locus_tag="KLTH-ORF14767"
FT   CDS_pept        671104..673350
FT                   /locus_tag="KLTH0B08294g"
FT                   /old_locus_tag="KLTH-ORF14767"
FT                   /product="KLTH0B08294p"
FT                   /note="similar to uniprot|P53866 Saccharomyces cerevisiae
FT                   YNL224C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21710"
FT                   /db_xref="GOA:C5DD49"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD49"
FT                   /protein_id="CAR21710.1"
FT                   /translation="MAKRHSHYKARGTGRGSRGRNSGGKPKGAAKKSHKRVNNANHTPV
FT                   GGGDLSNIDMMDDYYFGHNYRGDSMRMGGFRPGRQQEDDTRDGQRNLPLRKRPVEFIKA
FT                   KDVFDPSHDLILRLREANKKRQQQCSEESLGTQPSDSSELTTNTRDVSGTGSSKSVEED
FT                   KTPGQGAEKLKNVGATRTISVEKLPDEELYFVDDEPSAPVEPIPVHIESEPTRRFNEQQ
FT                   TKATEFEPVLTIGKTLLNLNEDNDGTVSVQLPKWKSHPFQPRESEESELSSEEAVEVEW
FT                   ESEDESEDVPVVELESDFDDRSDFGSEYEVDDGAELASNSNSTRSRPSPLLSNDIKSLS
FT                   IEDSDRQIPGAVQNTLKEQTDAGPEFGFLEEDFAVNISEVNVTNIRIGAYDNSYFLRSY
FT                   RYFGDYEPRWVDQDDLVEFITELGLPDHRIDAYLQFVMSSIVPQKNEEDALEDRIAKEA
FT                   ALIASESESDSCSEQSLAAGFSSDEELGEDLDDLVAYTTKYETVRNQTFDTKSLETTGR
FT                   GLKKKLLFTEQMDLDQGIQDVLQDKFSTRKAKKASKKLAKQDYISEQNSNSEDLFLKYP
FT                   FGFHVQNFKDEFELFLQRNKPSMAFPPLDPHGNRTLMKFAEAYFIKGKKAGKGGKTHVI
FT                   VEKVKKTKWSFPNYNYINQLMAQRPVFMRIDVRKPREDRIPSEKFSGKGKFQVKEGGIV
FT                   GEDAPEIGTDNIGRRMLEKLGWSRGQGLGAHGNEGISEPIFAKIKKNKSGLRHA"
FT   gene            <673602..>676454
FT                   /locus_tag="KLTH0B08316g"
FT                   /old_locus_tag="KLTH-ORF14763"
FT   CDS_pept        673602..676454
FT                   /locus_tag="KLTH0B08316g"
FT                   /old_locus_tag="KLTH-ORF14763"
FT                   /product="KLTH0B08316p"
FT                   /note="some similarities with uniprot|P25386 Saccharomyces
FT                   cerevisiae YDL058W USO1 involved intracellular protein
FT                   transport coiled-coil protein necessary for protein
FT                   transport from ER to Golgi Integrin analogue gene"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21711"
FT                   /db_xref="InterPro:IPR021750"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD50"
FT                   /protein_id="CAR21711.1"
FT                   /translation="MLGLGSGHIYSMANQSTVSNMSKDEKYDYEDEVSDENEDSGISLT
FT                   KVRAEQGFSLRSFIDQINAKTKALAIARELDAQRGVTHQDATMSAGSIDSATSASTETQ
FT                   RTQEISSHPTATVRRIPSGARASTAEPNLGSSTPMKEVSRSDNTHNQTINDLLVQSTPI
FT                   NSSKSAPTSRNTQPRDLLKEKFMESHKAQNERSATGNADELQFENVRLREELEFYKKAH
FT                   DSQEENIQVLQETLQKQDQTAQALREKLQELQDQVEESAQALKVAQDDRRSEFEGHQRV
FT                   AEELAKCKGQIRLKEDEIVTVTENADKACQDLRTDNAGLHKKAIEIQSALTESELYVQQ
FT                   LKSKVDLMKKHNDDLSQTVHDKIEELNECNTRIDELYKENIAQENSLRSRVKEYDSELS
FT                   SLRNRNEELQKKLELQDHEFISKSSSYEARISSLKSANEDLEKGIELERTKSSKEAHVL
FT                   GDTVVTLRQQLADAEKENEKILVRFNMLEKQHLEAENLRDGLEETNQELKSVVTRLEKI
FT                   SSDQLQTIGRLEEEVERKSKKEANSLSSVRKHSKQLEEKVRHLQDVIVAKNSELEMQKQ
FT                   ELNQFESYLKSVSLFQIQAGDLIVEQYRLNKYATQMDAAFKERNPDILGFFTQDQLQTT
FT                   ENSAVRLEALDNELHKLEESIKDEWTVKVQQLEEKLKNQELKESTIAKQLAGNNIRIEE
FT                   LNSMVGTLSAEKRDLLHEKEKSMEMQQRLNDQVNSLKGELVDGEHKAFISLSNRIESLG
FT                   EERLDLQQNLQALESKIKSTETLLNEANALLNQERSEHATSQDEAAQLRKDLARLKGKA
FT                   SRKITFQMASQSRPHLSRKTYDSLMVDAVNDMDMVELQNIIKNIILLLEIPLAKITKKM
FT                   PLVGIYLRYEKNICLHFANKIHYLMFRETIDIKRYTNVAYGQYLDHHDICHLDHPLESC
FT                   LDNLYKEVSARLSLSPLTNG"
FT   gene            <676591..>678363
FT                   /locus_tag="KLTH0B08338g"
FT                   /old_locus_tag="KLTH-ORF14762"
FT   CDS_pept        676591..678363
FT                   /locus_tag="KLTH0B08338g"
FT                   /old_locus_tag="KLTH-ORF14762"
FT                   /product="KLTH0B08338p"
FT                   /note="similar to uniprot|P53863 Saccharomyces cerevisiae
FT                   YNL227C JJJ1 Protein that may function as a cochaperone as
FT                   suggested by the presence of a DnaJ-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21712"
FT                   /db_xref="GOA:C5DD51"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD51"
FT                   /protein_id="CAR21712.1"
FT                   /translation="MKTCYYELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVEEATT
FT                   VFATIRSAYEVLADPQERAWYDSHKQQILSDDFGAENGDDYDEYEVDAAVSGVTTDDLL
FT                   KFFNTGLYSRVDDTPAGFYQIAGKVFAKLASEEVRFGRMQGLPKFAKYQDDFFEADMGT
FT                   QGYRKAFEKYSTQETLLFPPFGDSSAGFQYLRAFYRDWSSFNTVKTFSWKDEYMYSRNY
FT                   DRRTKREIKKRNEKLRQQARSEYNKTVKRFVVFIKKFDKRMKEGAAKFEQEKRKKLQED
FT                   LRKQIEKDRLANSRDVGDPFKLQSWQTVDDLDWDEMEAYFDESKTADDAPEGSEDEVLV
FT                   YECFICNKTFKSPNQLENHNNTKSHKKMLRQIQREMHKDNMVLGLDAVSDVDEFNSADE
FT                   EFGSNAEDLQKMDELDMINAELERIQKELEEISDKGDDSLSPSDSEVPESATVGSKEGK
FT                   STLPDDQIDEEKHSFTVDDEVDSDFEISDGTKSPSASKQEEDVDELSKLLASLQGGAGE
FT                   DTESDSWDNNKKPKKKQKGKNKATSSVQPSPPPTYQCGTCSDQFTTRNTLFKHIKKSNH
FT                   AAPVKATKAKKSKR"
FT   gene            <678693..>679772
FT                   /locus_tag="KLTH0B08360g"
FT                   /old_locus_tag="KLTH-ORF14756"
FT   CDS_pept        678693..679772
FT                   /locus_tag="KLTH0B08360g"
FT                   /old_locus_tag="KLTH-ORF14756"
FT                   /product="KLTH0B08360p"
FT                   /note="similar to uniprot|P23202 Saccharomyces cerevisiae
FT                   YNL229C URE2 Nitrogen catabolite repression regulator that
FT                   acts by inhibition of GLN3 transcription in good nitrogen
FT                   source altered form of Ure2p creates [URE3] prion"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21713"
FT                   /db_xref="GOA:C5DD52"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR017298"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD52"
FT                   /protein_id="CAR21713.1"
FT                   /translation="MVGEKQTSVGGSVSAAVSNLSSALRQVNLGNSNTTTDQSNINIDF
FT                   HNRMNRQQLMGEAQRNNLNAQQAEELLRQQEAHQQQQLQQAQQQQQQQQQYVGPAQIDS
FT                   SRISKFFQNQPEEGYTIFSHRSAPNGFKVSIVLSELNLQYNTIFLDFNIGEHRAPDFVA
FT                   INPNARVPALIDHSMDNLAIWESGAIILHLVNRYYRETGEPLLWSENMGEQAHITAWLF
FT                   FQTSGHAPMIGQALHFRYFHSQKIQSAVDRYTDEVRRVYGVVEMALAERREALIMELDT
FT                   ENAAAYSAGTTPLSRSRFFDYPVWLVGDKITVADLSFVPWNNVVDRIGINIKLEFPEVY
FT                   KWTKHMMRRPAVIKALRGE"
FT   gene            <680750..>681883
FT                   /locus_tag="KLTH0B08382g"
FT                   /old_locus_tag="KLTH-ORF14752"
FT   CDS_pept        680750..681883
FT                   /locus_tag="KLTH0B08382g"
FT                   /old_locus_tag="KLTH-ORF14752"
FT                   /product="KLTH0B08382p"
FT                   /note="some similarities with uniprot|P53861 Saccharomyces
FT                   cerevisiae YNL230C ELA1 Elongin A F-box protein that forms
FT                   a heterodimer with Elc1p and participates in transcription
FT                   elongation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21714"
FT                   /db_xref="GOA:C5DD53"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD53"
FT                   /protein_id="CAR21714.1"
FT                   /translation="MPISENEEEFTMEHKQTKIKSLSSLCEISLMRNHLMLQNVANVPY
FT                   RLVRNVLLKLKMEHLCKLEESNVLLIFEDEEAWVELLKKDFPMHVHDTYHRKRDEIVAF
FT                   YADFVEKHDPPKLRDEELMRGFLRFAVRKEPATHKYKVPSRMLYFKYQEDMLRKQELST
FT                   QRLRMRMQEMQQEKEKKQIVPLDDPVYCERRTKAAARAGAGERSGLFAKSYKEHQKRQL
FT                   HFKSGGYDAKSRPVKRLAFGGQVGRPAPSPAAPAPCAAPAPPVAAPAPLPATMQDTSQP
FT                   KRSTPAVAPSARRKPTPEQNLFLKRRRPLPKPKTPPTPRAEPSVKRKPTVVKVNSTKIH
FT                   RKNTKTSIFAAPSPQQQVLSQHSNTSSAYIFDQPRQG"
FT   gene            <682222..>683262
FT                   /locus_tag="KLTH0B08404g"
FT                   /old_locus_tag="KLTH-ORF14748"
FT   CDS_pept        682222..683262
FT                   /locus_tag="KLTH0B08404g"
FT                   /old_locus_tag="KLTH-ORF14748"
FT                   /product="KLTH0B08404p"
FT                   /note="highly similar to uniprot|P53860 Saccharomyces
FT                   cerevisiae YNL231C PDR16 Phosphatidylinositol transfer
FT                   protein (PITP) controlled by the multiple drug resistance
FT                   regulator Pdr1p localizes to lipid particles and microsomes
FT                   controls levels of various lipids may regulate lipid
FT                   synthesis homologous to Pdr17p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08404g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21715"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD54"
FT                   /protein_id="CAR21715.1"
FT                   /translation="MFRRNKDKAKESTVDPSKLIKIETPIEKPPASVKPPAEKELDEGQ
FT                   TKKYQEVLKHFSDPELRISTSEKEKDAELQPLSDLEKAWLTRECFKRYLRATKWDVKEC
FT                   IERIALSLAWRRQFGINNFGEENGDRLTSDAVAVEEETGKQVVLGFENDARPILYLKPG
FT                   RQNTKTSHRQVQHLVFMLERVIDFMPEGQDSLALLIDFKDHSDVPKVSGNSKIPPIGVG
FT                   KEVLHILQTHYPERLGKALLTNIPWLAWTFLKMIHPFIDPLTREKLVFDEPFPKYVPED
FT                   QLDKLYGGYLDFTYKHDVYWPKLKEIAAKNRSHYLSRFEKFGSKVGLSESDLRGNHEEL
FT                   LHPVEA"
FT   gene            complement(<683397..>684242)
FT                   /locus_tag="KLTH0B08426g"
FT                   /old_locus_tag="KLTH-ORF14746"
FT   CDS_pept        complement(683397..684242)
FT                   /locus_tag="KLTH0B08426g"
FT                   /old_locus_tag="KLTH-ORF14746"
FT                   /product="KLTH0B08426p"
FT                   /note="similar to uniprot|P53859 Saccharomyces cerevisiae
FT                   YNL232W CSL4 Subunit of the exosome which is an essential
FT                   complex present in both nucleus and cytoplasm that mediates
FT                   RNA processing and degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21716"
FT                   /db_xref="GOA:C5DD55"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019495"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD55"
FT                   /protein_id="CAR21716.1"
FT                   /translation="MVYYAQSTHSAYPGQLICPVYELEKGTDSQQVIRYIAGAGVAEQD
FT                   YELNGQKIIALAATVVGEVKFDEELKEMVPSGEVAESNENEEEETVSTEEERHFIVSVT
FT                   DKRQDGQAVTADFANNLPREGDIVLARVTRISQQRANVEILAVENKTTPVDSGVGSNGA
FT                   GIVAAGGGSGGATFSVSQASSDLGETFRGLISSRDVRATDRDKVKIIDSFRPGDIVRAQ
FT                   VISLGDGSNYHLSTARNDLGVVFAKACNGAGGMMYAIDWKTMVAPSTGFTEARKCAKPF
FT                   "
FT   gene            complement(<684529..>687123)
FT                   /locus_tag="KLTH0B08448g"
FT                   /old_locus_tag="KLTH-ORF14744"
FT   CDS_pept        complement(684529..687123)
FT                   /locus_tag="KLTH0B08448g"
FT                   /old_locus_tag="KLTH-ORF14744"
FT                   /product="KLTH0B08448p"
FT                   /note="weakly similar to uniprot|P53858 Saccharomyces
FT                   cerevisiae YNL233W BNI4 Targeting subunit for Glc7p protein
FT                   phosphatase localized to the bud neck required for
FT                   localization of chitin synthase III to the bud neck via
FT                   interaction with the chitin synthase III regulatory subunit
FT                   Skt5p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21717"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD56"
FT                   /protein_id="CAR21717.1"
FT                   /translation="MNQSLEEANNDGESYLNDTFYSSTSTDNLEHARTFRNSVLMQDMS
FT                   GEKPYNPEQEQIPSDPSDTQGKQYLKSNTNDANDRETETKTLTVTASPSLSALAGILNE
FT                   KAIQAEKKMRSSMILDNSIQESIPEEEHSVHNSPVLIDIDGTSDGSYRLKFPPQMAHLQ
FT                   NEIEQPDFLTTPRLDPPTPRVEPADSDLPNGGQQEKPQEQVSNVSSEREIETQNSNSPK
FT                   ATAERADNSRPLPRKQASLRSFSGMSVGSFASNEQPLKESSSGKKRKSIFSFLKKKPRK
FT                   NSSLLSQDNSSSATLPTSATFSVSKSYHENDLPASTRLTKNSPSNGSIFSTFRKNKASK
FT                   KEAAAAADRTLHVPKQRATSGDSNSSNTGGASQQKRGVQTRKPTPLDFEHVSQKAPSTQ
FT                   HNSPILTEPSTELQNTPQLVVKSPVPSENKVPDDVGESLLKADSGGVLFPKSLSAHEVE
FT                   SIVSLERSRSVKSAKRNSLNSHRVSLTDNMSAKINNDGMFITEPSAPKLSTPDLTKSPT
FT                   SSILRNGTFDTLESSTQRGSYAEPNNLGISSAGLRAQDRDFSFTSIEQKLNDITLDSES
FT                   EDELAVNTKKASTSAGENFDTELMSDIMEFANIIDFGKDLDLNLDLSQEDINYKSLNPS
FT                   DVKQSEKLPRDEMSADSFNFNSVAQVPLSSSGDRQSFSQHSYRSSIERNDTTNTDRTSF
FT                   RRHSTLLSPPLNEDTRTEQMRNILSADDDDDEFEGEDFNELEEKLESQTIGSPTWQPPL
FT                   DNRNRPISISFKGLRANQLNSSSNLSALRLSPSDYTVSNSHDLMSERKSVSFSSSIVLF
FT                   STYTEDEYDRHPEVATCNQLTPQLAQIIKEELNTLKAEMEVHEESRCYTHFF"
FT   gene            complement(<687524..>688819)
FT                   /locus_tag="KLTH0B08470g"
FT                   /old_locus_tag="KLTH-ORF14740"
FT   CDS_pept        complement(687524..688819)
FT                   /locus_tag="KLTH0B08470g"
FT                   /old_locus_tag="KLTH-ORF14740"
FT                   /product="KLTH0B08470p"
FT                   /note="some similarities with uniprot|P53857 Saccharomyces
FT                   cerevisiae YNL234W Similar to globins and has a functional
FT                   heme-binding domain involved in glucose signaling or
FT                   metabolism regulated by Rgt1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21718"
FT                   /db_xref="GOA:C5DD57"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD57"
FT                   /protein_id="CAR21718.1"
FT                   /translation="MEENRSFYSPLDRSQIAFIPADLESISENDPSVEPSPGLPRLSGD
FT                   SHIFKESFRDSYVPSVTSQSIFSEAHPPSSLSSVDELDRLSSLSSGSSCGTNMSYAARY
FT                   KIVLKLTSREIKLIRESWSMMLNDELSGDNLRTFIRKIVHEIGGLPWVRASGRRTRNNS
FT                   QNTSLSANSSASSPGSGSPPSPKHASAIPTGNTGAFASSIFCQQFYGNLLYMAPSIEAM
FT                   FPSIRHQAVSFAGVLTMTVNNLDNLSALEAYLCALGKRHARILSIEPPHFELMGLAFLK
FT                   TIKERFGVHCTLELEETWSRLYSYLANSILQFGIDPVLKIDALKNEMIFPVLDVTKGLP
FT                   STKSMFQPLQPSALNAHALATQKLRNNSRPENISPLTKPPISSKKSLPISTSNRNISGS
FT                   ALPQQHKKEQQKPKPLGASALKRDSDKDCVIM"
FT   gene            <689075..>691468
FT                   /locus_tag="KLTH0B08492g"
FT                   /old_locus_tag="KLTH-ORF14737"
FT   CDS_pept        689075..691468
FT                   /locus_tag="KLTH0B08492g"
FT                   /old_locus_tag="KLTH-ORF14737"
FT                   /product="KLTH0B08492p"
FT                   /note="similar to uniprot|P38863 YHR172W Saccharomyces
FT                   cerevisiae SPC97 Component of the microtubule-nucleating
FT                   Tub4p (gamma-tubulin) complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21719"
FT                   /db_xref="GOA:C5DD58"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="InterPro:IPR042241"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD58"
FT                   /protein_id="CAR21719.1"
FT                   /translation="MEVRRGVDDVCELESFPNSSFLSRLVNYQPLTHAHLKVKSYPLDQ
FT                   IKSQRVQESLVVRDLLFVLVGLEGVYIRYNNSYEPQTGMEGDEIRGPDFKIAKSMDLSL
FT                   KNFAKWIVKLGKMFVVLTQFGERYSDPVYGAVLHRLCCEIRAFLVHEYMRCLVDVAEED
FT                   FKTNAEFGIRELGQLLSKSCVYKMQLLYELVQDVSQEMARRALMDRDEADFQNFIKDLK
FT                   MEKETTDHSGLLFMTDSRISAHARGGAILQMVQDKLKANWGDQRNVEFLQGLLRKISAQ
FT                   YCSMLEEWLTNGSLEDPYDEFMVADTARASQGQAQVAVTALNSERLWDTRYVIRKDGLL
FT                   EQFNEGDVAFKVLMTGKSLHLFRTCCELQDLKNLLPLGPSHGLQELPHGTQLTLYVDAH
FT                   YARANHLVWKLLYEGYNLPRVLQEMQHNFLMHNNPTFFRTFFCRSLVELTKTRHETVQS
FT                   KLRRLFEDYQKARCAERGSLVLPLMNLQLDRRSFSSTIEQFSSEAAADRGNVDLLQARD
FT                   FGNLRDMLLRDLELQDSSGAGGGPRADSQYSIHYLQFELLVPFPLNTVVSKTCVMQYQM
FT                   MQRHMLLLHYYNEILQNTWFEINKNKVWRHTGFGPDLARWIRRCRVVHHRMSQFMKLLL
FT                   EYTTQDVVHDGWRTLEPRVHAYDAAGFDLHQCQAQLEQFLANLVSHSLLTSASLVRLLV
FT                   QITDSVHKFCKFVTSLRKTLCLLDLRLYTRYEAQLRGEHYYDEAAALAKLREMQNYLAV
FT                   VSDHFRQLSAAFAEGVRYYGDHGSSRFGVNPLLALAERLNDIVT"
FT   gene            <692293..>693606
FT                   /locus_tag="KLTH0B08514g"
FT                   /old_locus_tag="KLTH-ORF14728"
FT   CDS_pept        692293..693606
FT                   /locus_tag="KLTH0B08514g"
FT                   /old_locus_tag="KLTH-ORF14728"
FT                   /product="KLTH0B08514p"
FT                   /note="highly similar to uniprot|P00924 Saccharomyces
FT                   cerevisiae YGR254W ENO1 Enolase I and to uniprot|P00925
FT                   Saccharomyces cerevisiae YHR174W ENO2 Enolase II"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21720"
FT                   /db_xref="GOA:C5DD59"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD59"
FT                   /protein_id="CAR21720.1"
FT                   /translation="MAISKVHARQVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGAYE
FT                   AIELRDGDKSKWLGKGVLKAVDNVNSVIAPALVKANVDVKNQKAVDELLLSLDGTPNKS
FT                   KLGANAVLGVSMAAAKAAAAEKNVPLYKHLADLSNSKQDSYVLPVPFLNVLNGGSHAGG
FT                   ALALQEFMIAPTGAESFSEAMRMGSEVYHNLKSLTKKRYGPSAGNVGDEGGVAPNIQTA
FT                   EEALDLIVDAIKAAGYEGKISIGLDSASSEFYKDGLYDLDFKNPDSDKSKWLTGKQMAE
FT                   MYASLVSKYPIVSIEDPFAEDDWEAWSHYYKTAGIQIVADDLTVTNPLRIKTAIEKKAA
FT                   DALLLKVNQIGSLSESIEAAQDSFAAGWGVMVSHRSGETEDTFIADLVVGLRTGQIKTG
FT                   APARSERLAKLNQLLRIEEELGSKAVFAGKKFHNGQNL"
FT   gene            <693870..>694322
FT                   /locus_tag="KLTH0B08536g"
FT                   /old_locus_tag="KLTH-ORF14724"
FT   CDS_pept        693870..694322
FT                   /locus_tag="KLTH0B08536g"
FT                   /old_locus_tag="KLTH-ORF14724"
FT                   /product="KLTH0B08536p"
FT                   /note="similar to uniprot|P38865 Saccharomyces cerevisiae
FT                   YHR175W CTR2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21721"
FT                   /db_xref="GOA:C5DD60"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD60"
FT                   /protein_id="CAR21721.1"
FT                   /translation="MEHSMMDHGDMGHGDMGHDDMCSMNMLFTWNYKNTCVVFKWWHIR
FT                   TLPHLLLSMIVVAASAYLYEYMKYYSAKSTASRAAGAANLSHTKAAKMKSASWYGAQVG
FT                   FSFMLMLVFMTFNGWLMLAVVAGAAWGHYSWGHLTEGLAHNSLACH"
FT   gene            <694496..>695806
FT                   /locus_tag="KLTH0B08558g"
FT                   /old_locus_tag="KLTH-ORF14722"
FT   CDS_pept        694496..695806
FT                   /locus_tag="KLTH0B08558g"
FT                   /old_locus_tag="KLTH-ORF14722"
FT                   /product="KLTH0B08558p"
FT                   /note="similar to uniprot|P38866 Saccharomyces cerevisiae
FT                   YHR176W FMO1 Flavin-containing monooxygenase localized to
FT                   the cytoplasmic face of the ER membrane catalyzes oxidation
FT                   of biological thiols to maintain the ER redox buffer ratio
FT                   for correct folding of disulfide- bonded proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08558g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21722"
FT                   /db_xref="GOA:C5DD61"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD61"
FT                   /protein_id="CAR21722.1"
FT                   /translation="MTRSVEKVAIIGAGPGGLAAARVFLANSNFDIVLYERSQNVGGVW
FT                   YYPPNAPHKDTAMYDELETNLCKEIMQFSGFPFPETAPTFPNRTHVEDYLQAYFHTFIE
FT                   PNSRVDVRLGCNVERLEKINGSWHIYAKHSLQAVDYVVVANGHFDVPYIPWHLPGLEQW
FT                   ISQDPMSILHSKGFESCKFCRGKNVLVVGNGSSGSDITNQVSTTANHVFHSVTDISKTN
FT                   WEANTAVTAVTTISELDYAHERSVRLQDGSILTHIDYIIWATGYMYDLPFLRSYRPLIL
FT                   GADCDSKPARRLYNVWEQLAFTEDPTLAFSLLCKNVVPFPLAELQAAVMVKVFKGELEV
FT                   PPSGGQAALSGESPSDAANSSKNYHSLITPRDIEYCRELQALLDAHDSADDPFQPVRWD
FT                   ERMAALRYQTGAMKQERTKLLVKNAKEFREQNQPYRL"
FT   gene            <697066..>698970
FT                   /locus_tag="KLTH0B08580g"
FT                   /old_locus_tag="KLTH-ORF14720"
FT   CDS_pept        697066..698970
FT                   /locus_tag="KLTH0B08580g"
FT                   /old_locus_tag="KLTH-ORF14720"
FT                   /product="KLTH0B08580p"
FT                   /note="similar to uniprot|P38699 Saccharomyces cerevisiae
FT                   YHR178W STB5 binds Sin3p in two-hybrid assay Zinc finger
FT                   (6-Cys)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21723"
FT                   /db_xref="GOA:C5DD62"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD62"
FT                   /protein_id="CAR21723.1"
FT                   /translation="MEDGLSTEINDNGKRYESYSCSRCRKLKKRCSKESPVCVSCAKAG
FT                   ETCTYPGRAPRRTKRELEMVRRKTSTSLQPGNKRSRSSESASRYETADEEYDSNDPGRT
FT                   YGLAESDAERESVNSSEPASILSMLTGINDASPPPQVHAQGVLEHELHKPDSIPIKASS
FT                   IQIETVTAVFKGGRTTPMVEPNGSFKHIERPLYDRFIAAYFKHNHRSYPLLNKIEFLNK
FT                   VSTIRDFKEMDEKYDSTFIFELYMVMAIGCTTLQRAGILSKNEEHLSEHFAYIAMKKFC
FT                   TVMHQQNVNTITCLLLLGIYSFFEPQGVSSWTISGVIMRLTIGLGLHRALTARKMKSMT
FT                   VVEVEMRYRAFWSFYSFERLVSTSLGRISAIDDDDISVPLPRALYAEEAEDIEVTIMMI
FT                   SLRKMGGTIYKKVHSVGAGKQKLSSDEKQCIIDDLRHQLDTLYEREREKIRVANSASFP
FT                   SKASSCISFHTSDIWLAMRYAQLQIMLYRPSALIPKPPMESLSILGDFCLQALKHTYTL
FT                   YKKKLQPLNWITLFRTLTICNTMLYCLCQWSIDLIESKIEIQQCVEILQHFGEKWVFAA
FT                   KCADVFQTISTAILDISLSNGQVPNMDKLTRELFGASNEYQDILDDNNVDISWVDRLV"
FT   gene            <699089..>699160
FT                   /locus_tag="KLTH0B08602r"
FT                   /old_locus_tag="Klth0B.tThr.TGT.8"
FT   tRNA            699089..699160
FT                   /locus_tag="KLTH0B08602r"
FT                   /old_locus_tag="Klth0B.tThr.TGT.8"
FT                   /note="tRNA-Thr (TGT) cove score=84.23"
FT   gene            <699412..>700092
FT                   /locus_tag="KLTH0B08624g"
FT                   /old_locus_tag="KLTH-ORF14719"
FT   CDS_pept        699412..700092
FT                   /locus_tag="KLTH0B08624g"
FT                   /old_locus_tag="KLTH-ORF14719"
FT                   /product="KLTH0B08624p"
FT                   /note="highly similar to uniprot|P38869 Saccharomyces
FT                   cerevisiae YHR181W SVP26 Component of Sed5p vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21724"
FT                   /db_xref="GOA:C5DD63"
FT                   /db_xref="InterPro:IPR007277"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD63"
FT                   /protein_id="CAR21724.1"
FT                   /translation="MILQALSYAGTVLGFLFLTLSIASGLYYISELVEEHSEPTKRFLT
FT                   RAIYGIIILYVFLLILDSFPFKLSVFSIVSYLVYLQNLKHFPFISLKSPTLLASCVLVA
FT                   LNHYFWFKHFNDTEVPPQFRYDPNYIPRRRASFTEVASFFGICVWFVPFALFVSLSAGD
FT                   NVLPTTTAGLAKKSDSADANSPRFRKKATGLVRVVIDSIRAYFYSAARVFGYDIDPNRG
FT                   RLVV"
FT   gene            <700331..>702544
FT                   /locus_tag="KLTH0B08646g"
FT                   /old_locus_tag="KLTH-ORF14718"
FT   CDS_pept        700331..702544
FT                   /locus_tag="KLTH0B08646g"
FT                   /old_locus_tag="KLTH-ORF14718"
FT                   /product="KLTH0B08646p"
FT                   /note="weakly similar to uniprot|P38870 Saccharomyces
FT                   cerevisiae YHR182W Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery and cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21725"
FT                   /db_xref="GOA:C5DD64"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD64"
FT                   /protein_id="CAR21725.1"
FT                   /translation="MTTEASRATFWSEDYTSGIAVLLGNIDNDVSELQEFIEDVETFDN
FT                   KTVSPAIKSLDSLVRSIPSDTDESLCNKLKQQRKGLLAEILEKLQIANRSNLETACLSQ
FT                   LQALLFEFEEYQQESKELIEKNYGLYSKHLSLAKRARVDVTTRAQRIREASQKPLLRSE
FT                   ETPLSSEEERDYANESSIQFPLTLDAKLSFSSEESFFGFCNKLKKLTKTSKRLIYIPGV
FT                   SNEYFSSSALFESLKRIEPRMDASLYNLERLGQTLINNEIISPYNGILGAKVSFARDGY
FT                   YVWGENSSPVIRPAEEKPLRRADVFNGLFKKIGRSSGSSEQIETTEELGLRQRELVDRE
FT                   DHFFQECQNLDYWRTQLELELQKCMNQYHKMLRHKIQILNKASLQFSSLLKEALSTQSS
FT                   LTPVGADQEIRRIYRANYGIVGHYVPQPGVVFAKHNQLGELTGVAMFHADLQEFPTNEL
FT                   GVAIILHILLEYLWGCDALEVLQAWQLPLDLRRVSRLRRECIVEFKETDGSHSASLANI
FT                   LASKPRPLADVVGLLQSWLLELPDSLIPMICYEEISRTQSIEGMSMAPAEHLVNLAAVC
FT                   DHFRWLVQRCGGEKVRTAFDSRTDFPLYHVFARTRTRNPQEAPVVSGVVHEILCKDESA
FT                   ERLREMAKNSNARTDARAEARADLQAGSSKHSSPPSTSRLATPAVFVPRPLKAAHSDAS
FT                   SSRPSSKRISGLDLAVVGQSDSESETEPKESKEPSTLAAGVAD"
FT   gene            <703013..>704491
FT                   /locus_tag="KLTH0B08668g"
FT                   /old_locus_tag="KLTH-ORF14713"
FT   CDS_pept        703013..704491
FT                   /locus_tag="KLTH0B08668g"
FT                   /old_locus_tag="KLTH-ORF14713"
FT                   /product="KLTH0B08668p"
FT                   /note="highly similar to uniprot|P53319 Saccharomyces
FT                   cerevisiae YGR256W GND2 and to uniprot|P38720 Saccharomyces
FT                   cerevisiae YHR183W GND1 6-phosphogluconate
FT                   dehydrogenase(decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08668g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21726"
FT                   /db_xref="GOA:C5DD65"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD65"
FT                   /protein_id="CAR21726.1"
FT                   /translation="MAQPKGDMGLIGLAVMGQNLILNAADHGYTVVAFNRTVSKVDHFM
FT                   ENEAKGKSIIGAHSIQELVDNLKRPRRIVLLVKAGAAVDAFIEQLLPYLEKGDIIIDGG
FT                   NSHYPDTNRRYEELKGKGIYFVGSGVSGGEEGARYGPSLMPGGAEEAWPHIKEIFQAIS
FT                   AKSDGEPCCDWVGPAGAGHYVKMVHNGIEYGDMQLITEAYDIMKRVGGFSDKEIGDVFA
FT                   KWNTGVLDSFLVEITRDILRYDDKDGTPLVEKIMDSAGQKGTGKWTAINALDLGMPVTL
FT                   IGEAVFARCLSSLKSERIRAASILPGPEVSKDAIKDKQQFVDDLEQALYASKIISYAQG
FT                   FMLIREAGKTYNWKLNNPAIALMWRGGCIIRSVFLAEITKAYRENPELENLLFNKFFTD
FT                   AITKAQSGWRKTIALASTQGIPTPAFSTALSFYDGYRSERLPANLLQAQRDYFGAHTFR
FT                   VLPECASEDLPEGQDIHVNWTGRGGNISASTYQA"
FT   gene            <704855..>706639
FT                   /locus_tag="KLTH0B08690g"
FT                   /old_locus_tag="KLTH-ORF14707"
FT   CDS_pept        704855..706639
FT                   /locus_tag="KLTH0B08690g"
FT                   /old_locus_tag="KLTH-ORF14707"
FT                   /product="KLTH0B08690p"
FT                   /note="weakly similar to uniprot|P38871 Saccharomyces
FT                   cerevisiae YHR184W SSP1 Protein involved in the control of
FT                   meiotic nuclear division and spore formation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21727"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD66"
FT                   /protein_id="CAR21727.1"
FT                   /translation="MSDYYREQEQIYSKPPYLEDSSVMHSNYEMPNNERAYSRGRGFLA
FT                   DSHSFFDRVKSKLSMFRGYDSQEYLADQDSAAERQSQLWNAIKRKPIQLIVEDSMEKSQ
FT                   VAEPQQFDQAPESANTFLTDNQNDNYVRSTASPKRKDLASGVPLSGSPFASGGISDFIG
FT                   LERDAILSKNSTSWEKVTAKSPLRSATTLGTIQKRLLQISSKKNEVSKGYQKLLKELNE
FT                   WWQETIEAEENMSLISDLQQMFHEDLVFEQRLSDKLKEVSKALEFTKMREEEMLQERKE
FT                   LQHTIKKYGQMRAKKGNHSEEAHFLKEKVITKQNSLSVITGHYQQSLSTTARELFVNAS
FT                   VEYFEAASDIKDTSKTFFQNSVEYLRTVRADNIEQHIEDLRRKRADKHWSKLNAQERDD
FT                   PNRLVEIMSGMYNGQDSLMRCVERRGHMKAPEKSPANCKENQPRFDSQPDLKLEFKTGL
FT                   DESLSVFPSESAQKKDLKQTSTRSSELTEGYSKTNANGFSFDSHRTLRCEGLAGKGPSL
FT                   KTRLPYPETNETIRAPNLKLNFDNNNIRLKNLSPNAATNSEDGTLIKFPPHGENVSRFA
FT                   YEPEQDLDRNKWAESPRT"
FT   gene            complement(<706712..>707746)
FT                   /locus_tag="KLTH0B08712g"
FT                   /old_locus_tag="KLTH-ORF14704"
FT   CDS_pept        complement(706712..707746)
FT                   /locus_tag="KLTH0B08712g"
FT                   /old_locus_tag="KLTH-ORF14704"
FT                   /product="KLTH0B08712p"
FT                   /note="similar to uniprot|P53320 Saccharomyces cerevisiae
FT                   YGR257C MTM1 Mitochondrial protein of the mitochondrial
FT                   carrier family involved in activating mitochondrial Sod2p
FT                   probably by facilitating insertion of an essential
FT                   manganese cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21728"
FT                   /db_xref="GOA:C5DD67"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD67"
FT                   /protein_id="CAR21728.1"
FT                   /translation="MSNEKKEGIGLKERLLSAVAGSLLTSLILTPMDVVRIRLQQQKML
FT                   PSCDCDANGKLSLKTTAPKGVFWQDACFADVHCQTSSVNYNSTWDAFTKIARIEGARSL
FT                   WRGLSITLVMAVPANMVYFIGYESLRDNSFLQNKYSRLNPLLCGAIARVLAATTVAPLE
FT                   LFRTRLQSIPRSSPNSTAAMMVKDLIKESRYEISRVGYKALFRGLEITLWRDVPFSSIY
FT                   WGCYEFYKSNISIKSERSIVNSSNTNWNHFVNSFVGGSFGGAVAAILTHPFDVGKTRMQ
FT                   ISFLNNTPGKSPSKNMFKYLNQIRKSEGLGALYTGLVPRVIKIAPSCAIMISTYEVCKR
FT                   LFST"
FT   gene            complement(<707994..>708773)
FT                   /locus_tag="KLTH0B08734g"
FT                   /old_locus_tag="KLTH-ORF14703"
FT   CDS_pept        complement(707994..708773)
FT                   /locus_tag="KLTH0B08734g"
FT                   /old_locus_tag="KLTH-ORF14703"
FT                   /product="KLTH0B08734p"
FT                   /note="weakly similar to uniprot|P38872 Saccharomyces
FT                   cerevisiae YHR185C PFS1 Sporulation protein required for
FT                   prospore membrane formation at selected spindle poles
FT                   ensures functionality of all four spindle pole bodies of a
FT                   cell during meiosis II not required for meiotic
FT                   recombination or meiotic chromosome segregation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21729"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD68"
FT                   /protein_id="CAR21729.1"
FT                   /translation="MKAQKSHQQSSRVLAANGSIANIERTGHFPSAKPVCERSPKRRES
FT                   FKVTKSKRLEPGELYSPHADASDKTTGFMSSPVGNIPDSSAVRRVGYANRAYAPGDSPF
FT                   AQYALMNYCNSNSHLNTSIYANPNISSLTGVDHVEQDVNNIFDDFEHFSFQTFPSYFNP
FT                   REASNMPHQEKVNKWIESVPTFNVSGELWESECYSVNTDLDWEEKEFDRGLVCHESLPF
FT                   SLATADEILHLQAKRLDTLVRRNYELTPEVPLTPRAF"
FT   gene            complement(<708976..>712047)
FT                   /locus_tag="KLTH0B08756g"
FT                   /old_locus_tag="KLTH-ORF14700"
FT   CDS_pept        complement(708976..712047)
FT                   /locus_tag="KLTH0B08756g"
FT                   /old_locus_tag="KLTH-ORF14700"
FT                   /product="KLTH0B08756p"
FT                   /note="similar to uniprot|P07276 Saccharomyces cerevisiae
FT                   YGR258C RAD2 Single-stranded DNA endonuclease cleaves
FT                   single-stranded DNA during nucleotide excision repair to
FT                   excise damaged DNA subunit of Nucleotide Excision Repair
FT                   Factor 3 (NEF3) homolog of human XPG protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21730"
FT                   /db_xref="GOA:C5DD69"
FT                   /db_xref="InterPro:IPR001044"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD69"
FT                   /protein_id="CAR21730.1"
FT                   /translation="MGVHALWDIVGPTAKPVRLESLSNKRLAVDASIWIYQFLKAVRDK
FT                   EGNAMRYSHVVGFFRRICKLLYFGIKPVFVFDGGAPALKRRTIQQRKERRQGRRDNAVS
FT                   TAKKLLALQMQNGDRTKNKENASRSTSQTHVHRQDDEYDLPKIPGFKYEEGDARINADD
FT                   FKTIMENIDELDGVDLDAVNPASREFEELPKSTQYMILSALRLKSRLRMGYSKEQLEEI
FT                   FPDSMEFSKFQIDMVKRRNFFTQKLMSATNTHDGGASKSDTEPYKRVAGQRGKEYQLIR
FT                   TENGWALSLTGNDGSEISKAIVVDEPQRKMEGESRTRSEPQGEDDEDEDIDWEDVDVEK
FT                   KKSEKELDYSIKASMLSVKANTVRSGGGQSFLDRRTTETRDKGPQSKFVYVSNEPELID
FT                   DEDEDEDDFSELTKEIQLMEDVKNGRGKRIEEIQTDNSIPQRQEQQKAESKKPSSSAPF
FT                   SYENEPASVKDRIEVADNSDEVGEQEMITEDEVREKSQQNSRFGEFIAPSYPQNKASHD
FT                   GHPKVSSSQAENKKSSNSEQNLQFVLDKINNLEQMQDQRVEIAPANENPEGHNSDVIHA
FT                   HSRAPEHDERPVQETPAWFRSAPDFNPHLGTSFLTSTTEKEPEQTDDEQLGLLTGSKAA
FT                   ELLYERDVLNKENEANGDQSSAEEDVIEIAPPESLSADKPSEGGEEEEIDSAGTQGKAH
FT                   VPVVDYDFSEDEEDALVHQLREEEQDYNAFKTSLNPSSVNATFVDEELHDQHLRDKRDS
FT                   DEVTAAMVAEVQDLLTRFGIPFMTAPMEAEAQCAELLMLGLVDGIITDDSDIFLFGGDK
FT                   VYKNMFQEKNYVEYYYSDLMKKELGLDREKFIELAQLLGSDYTTGVKSVGPVSAMEILA
FT                   EFGNLHNFRNWYSDGQFNKKKQEEEPTFEKRLRKKLVTSEVILDTEFPSDLVKEAYLRP
FT                   EVDHDATRFTWGVPDLDRLRSFFQSTIGWPQEKTDEVMIPLIREVNNRKKTGIQNTLTN
FT                   FFPSEYIKASKDIKLGKRIKNASGKLKMKKQRTE"
FT   gene            complement(<712345..>712417)
FT                   /locus_tag="KLTH0B08778r"
FT                   /old_locus_tag="Klth0B.tVal.CAC.12"
FT   tRNA            complement(712345..712417)
FT                   /locus_tag="KLTH0B08778r"
FT                   /old_locus_tag="Klth0B.tVal.CAC.12"
FT                   /note="tRNA-Val (CAC) cove score=75.70"
FT   gene            complement(<712793..>717340)
FT                   /locus_tag="KLTH0B08800g"
FT                   /old_locus_tag="KLTH-ORF14698"
FT   CDS_pept        complement(712793..717340)
FT                   /locus_tag="KLTH0B08800g"
FT                   /old_locus_tag="KLTH-ORF14698"
FT                   /product="KLTH0B08800p"
FT                   /note="some similarities with uniprot|P38873 Saccharomyces
FT                   cerevisiae YHR186C KOG1 Subunit of TORC1 a rapamycin-
FT                   sensitive complex involved in growth control that contains
FT                   Tor1p or Tor2p Lst8p and Tco89p contains four HEAT repeats
FT                   and seven WD-40 repeats may act as a scaffold protein to
FT                   couple TOR and its effectors"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21731"
FT                   /db_xref="GOA:C5DD70"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD70"
FT                   /protein_id="CAR21731.1"
FT                   /translation="MPTTYGPQPLRKLNTETRHGFGDQYSSEQYLENLENDFMFYFDDK
FT                   RHRTNGNPTSPEVKAKDESHYYQPIPDWKIVKERQKTVSAALLLCLNLGVDPPDVAKTH
FT                   PCARLESWVDPLNFQDSKKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFCNSL
FT                   RRASKDERILFHYNGHGVPQPTASGEMWVFNRGYTQYIPVSLYDLQTWLGAPCIYVYDC
FT                   NSAGNIVANFQTFVQKRIKDDQDGNHDPAAPSPTQAYTECIQLASCRANELLPMKPELP
FT                   ADLFTCCLTCPIKISVEIFLMQSPLRESKYSVLFQDYDSRTHRSGEQSSSAKPNVTIPG
FT                   KLSDRRTPLGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMVAALFRNFLLAKRIMPW
FT                   FNCHPVSDPELPDSIADHPMWKSWDLAIDEVLTKLVDDLQNVPLASADLELQPSLQEQQ
FT                   VSDTSIDDPLHSKAAAGTLSTMSLANHQAGSLSQVSQHLSQQQLLQHQHQQQQLQQQQQ
FT                   QQQFTGFFEQNLTAFELWLKYGSNTRHPPEQLPIVLQVLLSQVHRVRALVLLSRFLDLG
FT                   PWAVYLSLSIGIFPYVLKLLQSPAPELRPILVFIWARIMSIDYKNTQAELIKEKGYLYF
FT                   VKILVPELGMHPQPGSAPQLQRTISGGGLTMNASTSIGTQRYQFYQNFQNANNPGVAMA
FT                   NNTTDEQKAMAMFVLSSFLRDFSLGQKYCSSLELLGKICYYVETSDVPLLRQWCIVLMG
FT                   QLYLKNPFNKYLCMTCGFLDKIYTSMKDPIPEIRCAALLAFSMFISEKNDAEMALQMQQ
FT                   EMQQQAQQLQVQLQTLQGGQMQRQQAQAERQLQQLQASLSQMRTMDSRKLKQDEIKMTI
FT                   EALGLVNDGSPLVRKELIISLSRIVHRYINFFFVIAFNELCDEISQLESTGDSAALESK
FT                   QSIAHGSIFNTVWKSLLILAEDPYLENKTLAQQVVDYVFTKLNVHSQLNEVVLLMELYL
FT                   VKHTSCNATGHGATTVSILPTAKRPLSLSANKREATSNSETPKSGIFKRSISLNGLLKA
FT                   LGWEQDQEDSSQETPSNRSFGRLQGNNLLTVPYGVSPSATTPRYKKPKGPIDMPLKSSF
FT                   LDYSREYFQEPQMKKQEADEPGSVEYTSRLWRRNRNESIIQRTQAQKRLALYGDWSNKI
FT                   GTLDNKTQPKLLKFSQFENYIACSDDRDNISIFDWVDKSKLSTFSNGNPFGTKITDMSY
FT                   LNEDDVPLLLAGSSDGIVKIYKNFQDLEELELVSSWRGLTDLLLTPRSTGLLTEWQQSR
FT                   GSLLVTGDAKIIRVWDALTETIEVDIPAKSSSLITSITSDQLSGHMFVTGFSDGSLRAY
FT                   DRRVDPRDSMVRLWRSGDGKSNFGINNIHLQRGGYRELVSGTENGLVELWDLRYQNSIG
FT                   KFKDEGDKSSSMTTMTSMKVHEHAPVIATGTKSLKIWTTSGDLLSSFKNNTPAHAGGVA
FT                   GTLATGISASRISSSFISTMAFHPHEMILAAANSHNSSINIYECYEGKTDYLYY"
FT   gene            <717544..>718431
FT                   /locus_tag="KLTH0B08822g"
FT                   /old_locus_tag="KLTH-ORF14695"
FT   CDS_pept        717544..718431
FT                   /locus_tag="KLTH0B08822g"
FT                   /old_locus_tag="KLTH-ORF14695"
FT                   /product="KLTH0B08822p"
FT                   /note="similar to uniprot|P38874 Saccharomyces cerevisiae
FT                   YHR187W IKI1 Subunit of the Elp4p-Iki1p-Elp6p- subcomplex
FT                   of RNA polymerase II elongator complex which is a histone
FT                   acetyltransferase iki1 mutations confer resistance to the
FT                   K. lactis toxin zymocin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21732"
FT                   /db_xref="GOA:C5DD71"
FT                   /db_xref="InterPro:IPR019519"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD71"
FT                   /protein_id="CAR21732.1"
FT                   /translation="MASSSHNPAVLLKRVLSLRESSPFILCVDCIERSASSIVEEVSRE
FT                   VGDSATIIYVSYETNNKPRYATHFVEGTGSEARLLDTIKSYLPSKPSPRKHLVIIDTLN
FT                   LIPNNKLSQFISSMVSPSVVLLGIYHKQQPEVRPSSMENYPSSLQLLQFMATSILDCQP
FT                   ITEDAAAEEMLDSKIQKLVIPRGLNSPVFKLVLTNRRKSGRALTYSFQFDSRNHTYNVL
FT                   QEQAENENTEDDKEVFEGLTTFNLNISNRQKAARENVALPFLEAQSFNAGGAIVYEYEK
FT                   DDDYDEEDPYEDPF"
FT   gene            complement(<718586..>720562)
FT                   /locus_tag="KLTH0B08844g"
FT                   /old_locus_tag="KLTH-ORF14693"
FT   CDS_pept        complement(718586..720562)
FT                   /locus_tag="KLTH0B08844g"
FT                   /old_locus_tag="KLTH-ORF14693"
FT                   /product="KLTH0B08844p"
FT                   /note="similar to uniprot|P38875 Saccharomyces cerevisiae
FT                   YHR188C GPI16 Transmembrane protein subunit of the
FT                   glycosylphosphatidylinositol transamidase complex that adds
FT                   GPIs to newly synthesized proteins human PIG-Tp homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21733"
FT                   /db_xref="GOA:C5DD72"
FT                   /db_xref="InterPro:IPR007245"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD72"
FT                   /protein_id="CAR21733.1"
FT                   /translation="MRALLVLFWAFLVAKAQEVRSSIDEELLIPNETESAGSADETCIA
FT                   EDSSFGLDSGNSTSNDKEDPVEEELLNEALQKPVFFEKQDAIKYPFAEQLTLKPLPRNY
FT                   MVASFQFQMASNNLSVGQSETDFDAYRHYTVFPKAISPILEYTNTRQLHLRFTHGLWDS
FT                   ESWGQLPHKGSKSGGNGVELWAVIEADSKEIAFRHWVSLANSLSGLFCSSINFIDSERT
FT                   TYPVSSFQPQGDGGLPVFNATNGLFLIRAALANEPICTENLTPFLKLLPTRGKSGISSL
FT                   LDGHKVFDSNWHSMSLDVETTCDGNDCKYHMEELIEIVFNVPNTLARAEKPIPKPVKES
FT                   DLKCDESKPHDNFECFPLPQSKEIKFRLSELFGKQIVGSSLISESPSQICADVSDNWKA
FT                   YIDVDNMLFATDNNCFSVKENKLHDLYLESDDTTQVTPPESVPLYVSRSLTGYGQDSGG
FT                   LRTVFKNPGNESVNAIYFEALPWYMRIYLSSLKIESADGLEIEDVVRGTYYLPAIDRER
FT                   PTHLEYNLTIPANTTIALSYQFDKALLKYAEYPPDANHGFEIESAVVTVLEPVRYEMRT
FT                   ATLLLSLSTPDFSMPYNVIILTSTVMGLAFGTLFNLMVKRLVPLEEADRQASLRPGLKG
FT                   KVARMLKAFSLKRKKVDEVKKRQ"
FT   gene            <720807..>723716
FT                   /locus_tag="KLTH0B08866g"
FT                   /old_locus_tag="KLTH-ORF14690"
FT   CDS_pept        720807..723716
FT                   /locus_tag="KLTH0B08866g"
FT                   /old_locus_tag="KLTH-ORF14690"
FT                   /product="KLTH0B08866p"
FT                   /note="similar to uniprot|P49955 Saccharomyces cerevisiae
FT                   YMR288W HSH155 U2-snRNP associated splicing factor that
FT                   forms extensive associations with the branch site-3' splice
FT                   site-3' exon region upon prespliceosome formation;
FT                   similarity to the mammalian U2 snRNP-associated splicing
FT                   factor SAP155"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21734"
FT                   /db_xref="GOA:C5DD73"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR038737"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD73"
FT                   /protein_id="CAR21734.1"
FT                   /translation="MKDLESVENMDSNQKHCLTAAYTMPQELKTELEVHGKDDALTERM
FT                   RAKAASARESDYQRKRYDLQLKEGAGNGQENDKKRHLEVDITSEPRQGAVVKRSRWDVV
FT                   EAYQMPESSREEIQNLSKELITEVPGVRDLQFFKPSDKNHFGELLSDKKELSEEEEKDR
FT                   QFLRLLLRIKNGRPQTRKSAMRALRDRASEFGAPRIFNRVLPILMDRSLEDQERHLMIK
FT                   VVDRILYQLQDLVKPYTHRILVVIAPTLIDEDIVTREVGREIISRLAHSVGFATIIMNV
FT                   RADIDNQDEYVRNITSRVLAVVAKALSVSNMIPFLKAVCNSRKSWRARHTGVRTIQRIG
FT                   ILMGIGVLPYLQSLIECISDKLNDEHLPVRIATAQSIASLAQSSYPYGIDAFNYVLEPL
FT                   WRGIRTHRGKALASFLRALGFIIPLMDAEYAGYYTQEVMRIVKREFHSPDEEMKKAVLL
FT                   VLQKCCGTEGVSRLQLKEEIVPDFFRNFWTRRTALDRQISKLVVYTTTILSEKVGCAFP
FT                   VGYLLNPLRDESEPLRTMAARAVNQIVKSQGTQDIDQRLETRMIDALLIAFQEQTNEDN
FT                   IVLRGFGTVINSLDTRMKPYLAPIVSTVLQRLRHKSPIIRQHSADLCAMLASAVKHCGE
FT                   EAMLNKLNIIMYESLGEVYPEVLGSMIGAMCEIVSCADFSRMQPPANQILPNLTPILRN
FT                   RHRKVQHNSILLIGKIADKGPDSVPPKEWMRICFELLEMLKSPSKSIQRSANSTFGSIA
FT                   KTIGPQDVLVALLNNLKVQERQLRVCTAVAIGIVAETCGPITVLPALMNEYKTPETNVQ
FT                   NGVLKAMSFMFEYIGGIAKDYIYTTVPLLQDALTDRDLVHRQTAAAVTRHLALNCMGKG
FT                   YEDAFLHLLNLLMPNVFETSPHVITRIVEGLEALRNALGPGVALNYVWAGLFHPAKGVR
FT                   KSFWGLYNNAYIQHLDSIVPFYPQVESGPFTVEELNEIL"
FT   gene            complement(<723793..>726174)
FT                   /locus_tag="KLTH0B08888g"
FT                   /old_locus_tag="KLTH-ORF14687"
FT   CDS_pept        complement(723793..726174)
FT                   /locus_tag="KLTH0B08888g"
FT                   /old_locus_tag="KLTH-ORF14687"
FT                   /product="KLTH0B08888p"
FT                   /note="similar to uniprot|P46682 Saccharomyces cerevisiae
FT                   YGR261C APL6 beta3-like subunit of the yeast AP- 3 complex
FT                   which functions in transport of alkaline phosphatase to the
FT                   vacuole via the alternate pathway suppressor of loss of
FT                   casein kinase 1 function putative beta adaptin component of
FT                   the membrane-associate clathrin assembly complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21735"
FT                   /db_xref="GOA:C5DD74"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="InterPro:IPR026740"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD74"
FT                   /protein_id="CAR21735.1"
FT                   /translation="MVDSISRITSALESARELTLEAAAVAASRLGESSYHRYSQSITPE
FT                   GLRSLLNSRNSREVRDGMKRVASLMACDDPTINLESYFADVVKNVSSDDVKVKRLVAIY
FT                   MLRYAEKDPGLALLAVNSIQRSLSDPDPEVRSLALKAISDIRIPSLYPIVLHSVKKAIT
FT                   DVAAEVRCAVGFALLKLYREQREELTDDILPLLQDLLADSDPEVVSSAIILMKEAFPDH
FT                   LELLHGHFRRYCGLLPQLCEWSQLYLIELSVKYCKHFIPRPILMDSSDAARAVPLSDDF
FT                   ADIPFAIYDVSFHPDLSMFLDSLQKLLHSQNAAVVVAISKAYFELSPSLTFKNSKATDA
FT                   LVRLIGGPSIADGRALIFQCILVYCAVDPSTFSRFLNKFFLLPSDDTNTAVAKLKILST
FT                   LVDLNNVKRVVSEIKYYIINDQRPAVIQEALNSLAGCGQLSRSLSLHITKWLLTRMVDS
FT                   ISSASLDSFVSVLRSLIQENPAEHLHTMLNLSQVLRTENYLSGTAKAGIVWLFGEFSSI
FT                   NFTICPDVLRILIPNFSREPKEVRLQIVLLAAKLLSWEVDNSKNSSTEVGAFDIDNSRT
FT                   AQMARSVFYLAKFDDDFDIRDRSRLFCSLFDNERYEIASLLLQAPKPSSIAPMALNMSS
FT                   SANASSFASLGLDPGMEDYLSFSSWTFDGDADESSALRVPAQTKDYSRMKTSFSSSTFF
FT                   GGKNSDDFGGTSPVSETSDDVHTQSSRGFTSSAGRKYKLQSLDEFFSDIPARGQRRRRV
FT                   LVEEESSDEEETSQEDSESDDTSISSSSESEAESNIEVNT"
FT   gene            complement(<726326..>726398)
FT                   /locus_tag="KLTH0B08910r"
FT                   /old_locus_tag="Klth0B.tLys.CTT.11"
FT   tRNA            complement(726326..726398)
FT                   /locus_tag="KLTH0B08910r"
FT                   /old_locus_tag="Klth0B.tLys.CTT.11"
FT                   /note="tRNA-Lys (CTT) cove score=77.79"
FT   gene            <726546..>727685
FT                   /locus_tag="KLTH0B08932g"
FT                   /old_locus_tag="KLTH-ORF14685"
FT   CDS_pept        726546..727685
FT                   /locus_tag="KLTH0B08932g"
FT                   /old_locus_tag="KLTH-ORF14685"
FT                   /product="KLTH0B08932p"
FT                   /note="similar to uniprot|Q03266 Saccharomyces cerevisiae
FT                   YMR289W ABZ2 4-amino-4-deoxychorismate lyase catalyzes the
FT                   third step in para-aminobenzoic acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21736"
FT                   /db_xref="GOA:C5DD75"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD75"
FT                   /protein_id="CAR21736.1"
FT                   /translation="MEGADGNGLTAMQQQISEIVQHGVIDPNFKFSDADFEILSTLRYD
FT                   PGFTHTNGGGSSGTAEDELDPRLSAADVREALGESPLSDSGEYSIDTIAQMLGEMQKDT
FT                   LPLSPPPEAEEELETSEYGLKKIFYNRFLLLGEQFKRLNLALSFFKWNFSIPFELLLEK
FT                   LIQALPCPLELATDLSSRMQALLSVKKCYKMRVLVSSSGRMRVEAHELPQNWGNFATAS
FT                   QYFVNTVLRGFLPQQDEVWDVFVDTQAIVASPFTTFKTTRRGHYNAARERMTELSERVH
FT                   NPARKSEILVYNSAFELMEGSISNAALLLNGNETSNSLYQTPFLTSGCLCGVMRYYLLK
FT                   KNLITEGNIDVRHLNVGDQVLLFNGVMGCVRGVIRNSLE"
FT   gene            complement(<727687..>728484)
FT                   /locus_tag="KLTH0B08954g"
FT                   /old_locus_tag="KLTH-ORF14684"
FT   CDS_pept        complement(727687..728484)
FT                   /locus_tag="KLTH0B08954g"
FT                   /old_locus_tag="KLTH-ORF14684"
FT                   /product="KLTH0B08954p"
FT                   /note="similar to uniprot|P53323 Saccharomyces cerevisiae
FT                   YGR262C BUD32 Protein involved in bud-site selection
FT                   diploid mutants display a random budding pattern instead of
FT                   the wild-type bipolar pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21737"
FT                   /db_xref="GOA:C5DD76"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD76"
FT                   /protein_id="CAR21737.1"
FT                   /translation="MSKEVIEQVVTYLTPNVPIVPISQGAEAFVFTTNVHPYNASACKT
FT                   AGDIPVKYIIKYRPPKKYRHPSIDKTLTKHRTLSESRILAKLSQVPGLHVPKLIACDVY
FT                   NGCIWIEFIGEDLPESHGFSNLKNFLWMYKTDPYNIAVEKVLFKVGEQIGLLHWNDYCH
FT                   GDLTTSNLVLHQENGDWSPYLIDFGLGSASTLVEDKGVDLYVLERAIISTHSKFADKYN
FT                   EWILMGFKSVYENEGKKGQQKLKDVIKRFEEVRLRGRKRSMLG"
FT   gene            complement(<729231..>731486)
FT                   /locus_tag="KLTH0B08976g"
FT                   /old_locus_tag="KLTH-ORF14681"
FT   CDS_pept        complement(729231..731486)
FT                   /locus_tag="KLTH0B08976g"
FT                   /old_locus_tag="KLTH-ORF14681"
FT                   /product="KLTH0B08976p"
FT                   /note="highly similar to uniprot|P00958 Saccharomyces
FT                   cerevisiae YGR264C MES1 Methionyl-tRNA synthetase forms a
FT                   complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p
FT                   which increases the catalytic efficiency of both tRNA
FT                   synthetases also has a role in nuclear export of tRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21738"
FT                   /db_xref="GOA:C5DD77"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR018285"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD77"
FT                   /protein_id="CAR21738.1"
FT                   /translation="MAFNLSFDRSKDHSYALQLANNIKLALAQELAGKEIKISVNDESV
FT                   KPELTVASTDFRLFNTNAILRYVLNDFEGLESSETHFAVSSLEAMLYHPSAPQEHVKEN
FT                   VSKALENYLQELREPFCATNLITFANAYALSPESLESKFANLPASLSKALSAAKSYTPR
FT                   LSSSFKRTGAVKINSNFAVKKQDAEILPIEGERNILITSALPYVNNVPHLGNIVGSVLS
FT                   ADIYARYCKARNYNTLFVCGTDEYGTATETKAIEEGCTPRELCDKYHKIHSDVYKWFQI
FT                   GFDYFGRTTTEKQTEIAQDIFNKLNNNGYLEEHSMKQLYCEEHKAYLADRYVEGECPKC
FT                   HYEDARGDQCDKCGGLLDPFELINPRCKLDNSKPIPRNSDHIFISLDKLEPRIKEWVEK
FT                   SSREGGWSKNSRTITQSWLKEGLQPRCITRDLVWGTPVPLEKYKDKVLYVWFDATIGYV
FT                   SITANYTDGWKKWWKDPENVQLYQFMGKDNVPFHSVIFPGSQLGTNENWTMLHHLSTTE
FT                   YLQYEGGKFSKSRGVGVFGNNAKDTGVSPSVWRYYLASVRPESSDSHFSWSDFVARNNS
FT                   ELLANLGNFVNRLVKFVNAKYNGVVPEYDQKQLADFVKLEKDINSILSSYVSEMEQSHE
FT                   RRGLEIAMSLSARGNLFLQENKLDNSLFSEFPAKSDAVVGVGLNIVYSVASVIYPFMPE
FT                   AAETIYKMLNAPAKKIDDKFYLCIEGGHNINKAEYLFKRIDEKEIENWRSKYGGQQK"
FT   gene            complement(<731722..>733200)
FT                   /locus_tag="KLTH0B08998g"
FT                   /old_locus_tag="KLTH-ORF14679"
FT   CDS_pept        complement(731722..733200)
FT                   /locus_tag="KLTH0B08998g"
FT                   /old_locus_tag="KLTH-ORF14679"
FT                   /product="KLTH0B08998p"
FT                   /note="highly similar to uniprot|Q03532 Saccharomyces
FT                   cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
FT                   localizes to both the nuclear periphery and nucleolus
FT                   highly enriched in nuclear pore complex fractions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21739"
FT                   /db_xref="GOA:C5DD78"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD78"
FT                   /protein_id="CAR21739.1"
FT                   /translation="MGEVEEKAHSKKRSADAVEASENDGYKEKFAELNLSPPTMKAIDK
FT                   MGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLLPAIEMLHSLKFKPRNGTGVI
FT                   VITPTRELALQIFGVAKTLMEFHSQTFGIVIGGANRRQEADKLAKGVNLLIATPGRLLD
FT                   HLQNTKDFVFKNLKALVIDEADRILEIGFEDEMRQIVKILPSEERQTMLFSATQTTKVE
FT                   DLARISLRPGPLFINVDSEKQTSTADGLEQGYVVCDSDKRFLLLFSFLKRNQKKKIIVF
FT                   LSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGTLVCTDVAARGLD
FT                   IPAVDWIIQFDPPDDPRDYIHRVGRTARGSKGKGKSLMFLTPNELGFLRYLKAAKVPLN
FT                   EYEFPSNKIANVQSQLEKLIKSNYHLHQIAKDGYRSYLQAYSSHSLKTVYQIDKLDLAK
FT                   VAKSYGFPIPPKVNITIGASGKTPPSKKRKPSRN"
FT   gene            <734001..>736115
FT                   /locus_tag="KLTH0B09020g"
FT                   /old_locus_tag="KLTH-ORF14675"
FT   CDS_pept        734001..736115
FT                   /locus_tag="KLTH0B09020g"
FT                   /old_locus_tag="KLTH-ORF14675"
FT                   /product="KLTH0B09020p"
FT                   /note="similar to uniprot|P53326 YGR266W Saccharomyces
FT                   cerevisiae probably contains a single transmembrane span"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21740"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD79"
FT                   /protein_id="CAR21740.1"
FT                   /translation="MQEFYDPWDTQALYQDKVQGCDTCTDKCAVPERGIVCGPILRLVG
FT                   VDYERNLYRGSLLLVCRDIAAPQVSFVAGPSDSGIGAGAAGSSASASASQSHSYFPRVL
FT                   FFEEQGLQFYRYTIEFEMQDYEQLIKYAIDTEIKPHYRFFVPAKTANFNTISYSCNGFS
FT                   LSVDTTKFKGSMWFDILNKHAKTHYHVMLGGGDQIYSDGVKIFCDKFNDWLTEKNPSVK
FT                   ARAKLTPELRADLDKFYLKEYIEWYGYGYWKGSTPKSKTTQACFPIAMASIPSINIWDD
FT                   HDIIDGFGSYSHSFMKNEVFSGVGKAAYKYYMLFQHHVSIHEREAYLENPSWLLGHKES
FT                   DYIGERSHSVFTRIGPTWGMLGLDCRTERKIKQIVSWDTYALVFKRLEEEVAKGKMDHL
FT                   MVMLGVPIAYPRLVWLEWLFSSKFLAPLKYLSKKGLIARSLVNEFNGDVELLDDLNDHW
FT                   CARHHKKERNFLVSKLQDFGAKHGVRITILSGDVHLTTIGRFRSKLHSHHITSSKDSEV
FT                   ERVLDEPENDVRLMFNVISSAVVNTPPPTAMSGLLQKRSGIHHFDRETDEDVVPLFKKD
FT                   VDGTNRKFFSFMNRRNWSDLLPVQNVLQNEYLRNLYQVSEGDKCVPGIISDSGLEKRTS
FT                   DNSPEEKQDVLYPVTSQGFIATIHAEKDALSVESKSVGYAVVVPELKRANISLSHKGIK
FT                   HLDATNPSEA"
FT   gene            <736520..>738112
FT                   /locus_tag="KLTH0B09042g"
FT                   /old_locus_tag="KLTH-ORF14670"
FT   CDS_pept        736520..738112
FT                   /locus_tag="KLTH0B09042g"
FT                   /old_locus_tag="KLTH-ORF14670"
FT                   /product="KLTH0B09042p"
FT                   /note="similar to uniprot|Q03533 Saccharomyces cerevisiae
FT                   YMR291W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09042g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21741"
FT                   /db_xref="GOA:C5DD80"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD80"
FT                   /protein_id="CAR21741.1"
FT                   /translation="MSTASVADASWPQGSVSPNAGDVSRCKYVIKDSQLGDGYFSVVKE
FT                   CMNVYTRDRFAMKLVSKKTVEGKLWLIQREVKLLKAVSAKIRELEQSEAACKDTFEGHH
FT                   HVLQLFDYFETNQNIVLVTQLCSHGDLYEKIIEAGSLDVTRQVKSYTACLLSAINFLHE
FT                   NGVVHRDLKAENVLFRCRVTELSEYSRRGSHYDHHAHDLILADFGLATNLNGNEDELRE
FT                   CVGTISYIAPEVVRCYGISRLAPSEAKAIPAYGAAIDIWALGVLAYFMMTGYMPFDCET
FT                   DAETKKCISEGDYYVDEELKSDKSLDSKHFWNFVHLCFTINASDRPTSQDLKKHPFVQQ
FT                   FFSTDNQAEPFGDRIALVKSTSSSSLHNLGTPSRSSSSSSLAALGRSESGSNLISIDSR
FT                   DLKLDRVRETLKKTLSMTSIAPARNNFVDPATQNKKNSTFKLEPMPPSNSLMNGCFSLT
FT                   PESKSNFTTSPSVSRTHSSTEMGRIMSTGESNGTSLTRQSSGLGNEVTEDECSKAAGTT
FT                   QRSSRKSGAQFDF"
FT   gene            complement(<738472..>739206)
FT                   /locus_tag="KLTH0B09064g"
FT                   /old_locus_tag="KLTH-ORF14668"
FT   CDS_pept        complement(738472..739206)
FT                   /locus_tag="KLTH0B09064g"
FT                   /old_locus_tag="KLTH-ORF14668"
FT                   /product="KLTH0B09064p"
FT                   /note="highly similar to uniprot|P51601 YGR267C
FT                   Saccharomyces cerevisiae FOL2 GTP-cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09064g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21742"
FT                   /db_xref="GOA:C5DD81"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD81"
FT                   /protein_id="CAR21742.1"
FT                   /translation="MENKHLAGLIERQDTPLRTRPASPYTLNPPVEADGLSWPSLGSRV
FT                   RSEESPEETQQRTDRIAEAVKVILSELGEDVSREGLLETPQRYAKAMMYFTKGYQHNII
FT                   NDVIKNAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVLGLSKLARLA
FT                   EMYARRLQVQERLTKQIAMALSEILKPRGVAVVIEAAHMCMVSRGVQKTGSSTMTSCML
FT                   GCFREAHKTREEFLNLLNRRSI"
FT   gene            complement(<740501..>741178)
FT                   /locus_tag="KLTH0B09086g"
FT                   /old_locus_tag="KLTH-ORF14663"
FT   CDS_pept        complement(740501..741178)
FT                   /locus_tag="KLTH0B09086g"
FT                   /old_locus_tag="KLTH-ORF14663"
FT                   /product="KLTH0B09086p"
FT                   /note="weakly similar to uniprot|P40325 YGR268C
FT                   Saccharomyces cerevisiae HUA1 uncharacterized ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21743"
FT                   /db_xref="InterPro:IPR038910"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD82"
FT                   /protein_id="CAR21743.1"
FT                   /translation="MVHNEDPPPPSYDEAIKESALPFGPEERPPAMPARPSTYTHRPPA
FT                   RPPRPVSSAGPSGPSAYGASSPGPSAASSSSFQSYGGSSYTAPAASQSTRPSLPWTYPR
FT                   GYYCTKCGNTGYKIKNGHSCKRCWRKFAHSSPSQNVQVTYGGYAPSYALYGGAPTFGTV
FT                   PMAMGVSPASPAPASGGAPLVLRPGDPRIGGVTCGECRGSGRVRFLLDKEICPLCHGVG
FT                   RVL"
FT   gene            <741971..>742474
FT                   /locus_tag="KLTH0B09108g"
FT                   /old_locus_tag="Klth0B.mRNA.688.p"
FT   CDS_pept        join(741971..741992,742080..742474)
FT                   /locus_tag="KLTH0B09108g"
FT                   /old_locus_tag="Klth0B.mRNA.688.p"
FT                   /product="KLTH0B09108p"
FT                   /note="similar to uniprot|Q03554 YMR292w Saccharomyces
FT                   cerevisiae GOT1 evolutionarily conserved non-essential
FT                   protein present in early Golgi cisternae that may be
FT                   involved in ER-Golgi transport at a step after vesicle
FT                   tethering to Golgi membranes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21744"
FT                   /db_xref="GOA:C5DD83"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD83"
FT                   /protein_id="CAR21744.1"
FT                   /translation="MWLTESQKFGVAFTFGGCLFFLFGVLTFFDRALLALGNILFLVGV
FT                   LLIIGPQKTYTFFTRPSKRRGSFFFCLGILMILLKWTFMGFIVESLGIVGLFGDFFAVI
FT                   VQFLRSLPLIGPVLSHPAVAPYVDKIAGVRVLPV"
FT   gene            <742805..>746806
FT                   /locus_tag="KLTH0B09130g"
FT                   /old_locus_tag="KLTH-ORF14657"
FT   CDS_pept        742805..746806
FT                   /locus_tag="KLTH0B09130g"
FT                   /old_locus_tag="KLTH-ORF14657"
FT                   /product="KLTH0B09130p"
FT                   /note="similar to uniprot|P40340 Saccharomyces cerevisiae
FT                   YGR270W YTA7 Protein of unknown function member of
FT                   CDC48/PAS1/SEC18 family of ATPases potentially
FT                   phosphorylated by Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21745"
FT                   /db_xref="GOA:C5DD84"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD84"
FT                   /protein_id="CAR21745.1"
FT                   /translation="MTRPLRPRHHEPLKNELDESSRGIKDENGIIHTTTRSLRKVNYAD
FT                   VENNYDFIDEVVDEDDEDEAAAPAGSRRRGHAIKSDSEEFEPAEKTEDEPEPPIEDHTA
FT                   QEVSGPETRNSKSRGGPDEDGDESFHEEDAEDEDEDALAGSEDEYLSEESIRRSRRRAD
FT                   RNFVVSDEDDEDEDTIGASKRTRRGYRTTTTIDTDEDDPPSRRNFRSSTIQARQGRRSE
FT                   ISPPRKLRRRARSAYGSEERQSRSDRLSLADELRELRDDSPVREKRSLRERTKPVNYTL
FT                   PPPIGDTAMDETAKLGNANGILPYPSPKARRGLHAGQSFGPLRRLFPTGGPFGGNDVTA
FT                   IFGTNTNYYDNAGQGTANNKLLLDSDSSEDEILPLGAVSTKPNESTHKKKKPEIADLDP
FT                   LGVDMNIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTL
FT                   MARALAASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEID
FT                   GLAPVRSSKQEQIHASIVSTMLALMDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDRE
FT                   FFFPLPDLSARSKILEIHTKKWDPPLPKPFIDRLASLTKGYGGADLRALCTEAALISIQ
FT                   RKVPQIYQSEMKLSINLASVNVKARDFMMALEKIVPSSARSAGNSAQPIPETVEALLDS
FT                   QFEEIKKKLKSIIPSDSKFQRNGASTIKHYLEYEVEDSDEESDGFSKAEFLRNMEKARV
FT                   CKPRLIVTGSRGNGQQYVGAAILHYLEDFNMQMLDVGTLASDSTRSFETAIVQIFTEAR
FT                   RRQPSVLYIPNSEIWLQAVPENAILMLASLLRSLRSDEKVLLLAVANGLSKSDILEGSL
FT                   SHLEFEKFIHKIRKPSSSQRAKYFLSLKQILKTKPSSFEQGKKRTKPLPQLPVVESSKK
FT                   SEGLDKNGNPLSEEAKLIQTLKSFQNHDMKLKNTLKLKLSGLMDLFKNRYKRFRKPPID
FT                   DALLIHLFETNAALQGNPDYQPAYIKENNMILECATGRRFFNMDLDIVEERLWNGFYSE
FT                   PRQFLKDIELIYKDAHTSGDRERIIKASEMFVNAQMGIEEISAPDFVMECRDSRQRELT
FT                   RQKLNLEKQAKLKSQELSEELQVRANEVDISENDLSSSSEKFERNSLNGSHALQVGVGS
FT                   GGQLQCQAQKNPQEELQVEDATNDEQGNNTERQLPNDDINPLQIGNNEYKKDDAEAAEI
FT                   EGAIDGKHAESETPRNSSPENSKSSEQSSLSEEALIEEGGPQVAEFILDDNKLNDLLSL
FT                   LEHRSEGFTVQKLEELYAFALNIIWEDRLLWDRTTTLHKLLTHIENWGN"
FT   gene            complement(<746833..>748230)
FT                   /locus_tag="KLTH0B09152g"
FT                   /old_locus_tag="KLTH-ORF14651"
FT   CDS_pept        complement(746833..748230)
FT                   /locus_tag="KLTH0B09152g"
FT                   /old_locus_tag="KLTH-ORF14651"
FT                   /product="KLTH0B09152p"
FT                   /note="similar to uniprot|Q03557 Saccharomyces cerevisiae
FT                   YMR293C Uncharacterized ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21746"
FT                   /db_xref="GOA:C5DD85"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD85"
FT                   /protein_id="CAR21746.1"
FT                   /translation="MSFKSAISRLEKLPLIQKQYNAFTHLNPNCKELLIKDVSSSPKKS
FT                   LTNLLYGIKDNIATSDMPTSCGSKVLHNYQSPFDATIVELLESAGAISVGKTNLDEFGM
FT                   GSGGLFSHFGPTKNPLFPFQDTVVGGSSSGSAAAVAADAVDFSIGTDTGGSVRLPAAYT
FT                   SLFGFKPSYGRISRFGVIAYAQSMDTVGIFSKNVSIIKSVFDVLDKHDKKDPTSLSENL
FT                   RGKLRQLSSPQSSYKIGIPQELLQDNMPLELQDGFLLALEKLEANGHEIYGVSIPQMVN
FT                   SLPIYYTLAPAEAASNLARFDGLRYGYRDDVADSRDDTLFAPTRSAFGDEVKSRIVLGN
FT                   YNLCSESFNNHYIKAQRLRVDLINEFDNTFTHPNILTGFPGNQNGVDFLISFSSINLPP
FT                   AMSDYDSDCTSNPTNSYVNDVFTTPMSLAGLPAINVPVMASNPIGIQLVGQYGDDSRLL
FT                   DLAAELL"
FT   gene            <748355..>749449
FT                   /locus_tag="KLTH0B09174g"
FT                   /old_locus_tag="KLTH-ORF14650"
FT   CDS_pept        748355..749449
FT                   /locus_tag="KLTH0B09174g"
FT                   /old_locus_tag="KLTH-ORF14650"
FT                   /product="KLTH0B09174p"
FT                   /note="weakly similar to uniprot|P36224 Saccharomyces
FT                   cerevisiae YMR294W JNM1 Component of the yeast dynactin
FT                   complex consisting of Nip100p Jnm1p and Arp1p required for
FT                   proper nuclear migration and spindle partitioning during
FT                   mitotic anaphase B"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09174g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21747"
FT                   /db_xref="GOA:C5DD86"
FT                   /db_xref="InterPro:IPR028133"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD86"
FT                   /protein_id="CAR21747.1"
FT                   /translation="MALDIIEWDEEAAVGGIPNDSFKDGKEVFETSDIEETESETSVPA
FT                   LMNDDINAIKDDYDRSRELFENQVLENIGSDFSGRTDRLQSAHMVSGSCLETRAQKLAR
FT                   IRRELQEIELSEESGEANSTELVSLRQLLDQLDSKAKSESQNIKQLLCESDKVREQVEL
FT                   PKINLELGLARRLAELENKVSKLESVLGLSGYSSQKTITTTMDELYRQIKLLRNNDKLL
FT                   NEFRSKLESISANYEKTLIARKASRNSSLQKQISSDLISSETKVSELYESFSILRRYKD
FT                   VVPHITTRMKTLNSLHMEIGDCVSTVKTVDSSVKWMTDQNEKWQKMLIDMDEKLESVEK
FT                   KAEANKQEVTKWLTNVESRLQEMS"
FT   gene            <749587..>755451
FT                   /locus_tag="KLTH0B09196g"
FT                   /old_locus_tag="KLTH-ORF14649"
FT   CDS_pept        749587..755451
FT                   /locus_tag="KLTH0B09196g"
FT                   /old_locus_tag="KLTH-ORF14649"
FT                   /product="KLTH0B09196p"
FT                   /note="highly similar to uniprot|P53327 Saccharomyces
FT                   cerevisiae YGR271W SLH1 SKI2-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21748"
FT                   /db_xref="GOA:C5DD87"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD87"
FT                   /protein_id="CAR21748.1"
FT                   /translation="MSTQYSIDSVRSYMDAMSTMVSAAQNFKLGENIAVAPEIDNEIEK
FT                   SKDESYVQLTTLSQDRNEWDDIFDSFGELSRANVTNAIESAIAEDSSSVTNELKSYMKG
FT                   INSSEMDEETLLETLLLLLQSENQDSLQSELLDLLGDENIEFISFLVQNREELISIPPE
FT                   EIKIALKFENSDGDFLTHREIRKQYLKNAKDAKNTELNPLQKQAEYPHVFRKSEVGSSF
FT                   ALSFTGQKFALPVGTTRSSFATREEIIIPAAEAGLRNSMRFKNIVIKDLDVFCTSVFTY
FT                   ETLNAIQSLVYPVAYETNENMLICAPTGAGKTDIALLTILNTVKQFSEVDQKGNIDIEY
FT                   DSFKVVYVAPLKALAAEIVEKFSKRLAVFDMKVRELTGDMQLTKAEILETQVIVTTPEK
FT                   WDVVTRKANGDNDLVSKIKLLIIDEVHLLHEDRGSVIETLVARTLRQVERSQSMIRILG
FT                   LSATLPNFIDVADFLGVNRQIGMFYFDQSFRPKPLEQQLLGCRGKAGSKQARENIDNTA
FT                   YEKMVDMIQRGAQVMVFVHSRKETVRSARNFISIATSHHEIDLFTEASSIREFYQKEMT
FT                   KNKDKDVKELFQSGFGVHHAGMSRSDRNLTERMFKDGAINVLICTATLAWGVNLPADVV
FT                   IIKGTQVYDSKKGGFTDLGISDVIQIFGRAGRPGFGSSNGTGILCTSSDRLDDYVSLIT
FT                   QQHPIESKLATKLVDNLNAEISLGSVTNVEEGIQWLGYTYLYVRMRKNPFSYGINWDEI
FT                   RDDPQLYERRKNMIISAARRLHTLQMIVFDEVSLHFIPKDLGRISSDFYLLNESVEIFN
FT                   QLCNPSATEADVLSMISMSSEFDNMKFREEEATELSRLMDNAAQCQIGGEVESAQGKTN
FT                   ILLQSYISRTRIFDSALSSDSNYVAQNSIRICRALFLVGVNRRWGNFAKVMLDVCKSIE
FT                   KRLWAFDHPLCQFELPEPVIRQLRDKNPSMESLLDLESEELGDLVHNRKVGHKLYSILS
FT                   RFPRLEISADIFPITTNVMRIHVALTPAFIWDMRIHGNAQFFWLFVEESDKSQILHVEK
FT                   LILNKRQMSNPHEMDFMIPLSDPLPPQVVVKVVSDIWIGSESTQVISFQHLIRPHNETL
FT                   QTKLQRLRPLPTSAMKNPLLEQIYPFRYFNPMQTMIFHTLYNTNESVFVGSPTGSGKTV
FT                   VAELAMWHAFKEYPGSKIVYIAPMKALVRERVTDWRKRVTPVTGDKVIELTGDSLPDPR
FT                   DVKDATIIITTPEKFDGISRNWQTRKFVQEVSLIIMDEIHLLASDRGPILEMIVSRMNY
FT                   VASQTKRPVRLLGMSTAVSNAYDMGGWLGVKDNGLYNFSSSVRPVPLKMYIDGFPDNLA
FT                   FCPLMKTMNKPAFMAIKQHSPDKPVLIFVASRRQTRLTALDLIHLCGMESNPRRFLNID
FT                   DEGELQYYLSQVSDETLKLSLQFGIGLHHAGLVEKDRYISHELFQKNKIQVLVATSTLA
FT                   WGVNLPAHLVIIKGTQFFDAKIEGYRDMDLTDILQMMGRAGRPAFDTSGTAIVYTKQAK
FT                   KMFYKHFLNIGFPVESSLHKVLDDHLGAEIASGSIANKQEAMDFLSWTFLFRRAHHNPT
FT                   YYGIMEDTSAAGINKHLSNLIDDTLKNLEESSCVALRGNEIEALPFLSISSYYYISHKT
FT                   IRQLLKHIKNTASFQEVLKWLSLAFEFNELPVRNGEIIMNVEMSAQSRYSVESTFVGED
FT                   ELPMWDPHVKAFLLLQAYFSRVDLPIADYHQDTISVLDQALRILQAYADVAGELGYYST
FT                   VLTIIKAMQCVKQGCWYEDDPVSLLPGVGLKRITDCEFSETGFPLEKSHSMNLDKIGRL
FT                   KFKQLEQVARKLNVEKEKIKDFIGECQKLPVLDNIRVEPQSDPNELVITAVHANPRHNR
FT                   NFEVYCERFPKTQKELWFVIGYQGEELMMVKRFQPRRKNNGVAISGEFVVAEELHGQTL
FT                   RFTIINDALDIKYDFEHTLAR"
FT   gene            complement(<755504..>756172)
FT                   /locus_tag="KLTH0B09218g"
FT                   /old_locus_tag="KLTH-ORF14645"
FT   CDS_pept        complement(755504..756172)
FT                   /locus_tag="KLTH0B09218g"
FT                   /old_locus_tag="KLTH-ORF14645"
FT                   /product="KLTH0B09218p"
FT                   /note="similar to uniprot|P53328 YGR272C Saccharomyces
FT                   cerevisiae Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09218g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21749"
FT                   /db_xref="GOA:C5DD88"
FT                   /db_xref="InterPro:IPR019310"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD88"
FT                   /protein_id="CAR21749.1"
FT                   /translation="MDRKQRRRTNKSAGAPIQLARVLGSGSNKIKRKIRDIERLLQKKK
FT                   DVLPDTVLIEKERALEALRLELHNAEQRVKIQNNAKKYHMVRFFERKKALRRYTKSVKE
FT                   GDADAVRERSIDLCYVVNFPKTEKYIALYPSEESESRDTDDKKGVAKTEARRAQFRDLV
FT                   AAKMDAGTLPVPLKDILKGKKLDRDDTGVQLETGESRASKEASISESEKEDEDEDDFFE
FT                   "
FT   gene            complement(<756449..>757042)
FT                   /locus_tag="KLTH0B09240g"
FT                   /old_locus_tag="KLTH-ORF14642"
FT   CDS_pept        complement(756449..757042)
FT                   /locus_tag="KLTH0B09240g"
FT                   /old_locus_tag="KLTH-ORF14642"
FT                   /product="KLTH0B09240p"
FT                   /note="similar to uniprot|Q03559 YMR295C Saccharomyces
FT                   cerevisiae Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21750"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD89"
FT                   /protein_id="CAR21750.1"
FT                   /translation="MGLFRKSSNASTGAGHLHAPDTKLTKEDREHFKLRASSVHDPVLE
FT                   AVQEAQPFEQAADVSQDDPNRKSYYSGDGPDHLTRDVFGQPIQQPDISNPMRARDERPL
FT                   DTIRGFEYSISGDPSWGQRLETHQYGFRVRPDFPQFGNSGDAMAASGPGGMPSSQFMMQ
FT                   EQAIYSAPAPGSALNPSKKKKKRGLFGRKKDTAE"
FT   gene            <758773..>761235
FT                   /locus_tag="KLTH0B09262g"
FT                   /old_locus_tag="KLTH-ORF14635"
FT   CDS_pept        758773..761235
FT                   /locus_tag="KLTH0B09262g"
FT                   /old_locus_tag="KLTH-ORF14635"
FT                   /product="KLTH0B09262p"
FT                   /note="weakly similar to uniprot|P39961 Saccharomyces
FT                   cerevisiae YER184C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09262g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21751"
FT                   /db_xref="GOA:C5DD90"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD90"
FT                   /protein_id="CAR21751.1"
FT                   /translation="MKVSKDTKKPAERAARACLNCRRRKVKCSGQSPCANCRNYNCACT
FT                   YAVSEAQPQQEHCFNHPRDVTRMIGRMEKSLESLDELLHNNSESCAVLSEMSAKIEHLK
FT                   SLLDTGINAKWVTAYRGEKSLEYEITYRNHSLFRRYQPSISNLKSASGTTYELYSPIMS
FT                   LSVKGVSSVMHKLLSYADNEAARETFYLFLKSFDAANTFYLTSAAFWSMPLSTNLNQFS
FT                   SAPARGTTPLRLLVSQIPAELWPSPEAREKVDLTNATQACCELVRVLEKHYRINGDLPF
FT                   GDGNLHSFVQFVGMDQLITTACAELLTRSTLSEFLSIEYADALLSFLECKTALETSDRL
FT                   CKIAAIAVRMLIDLGLDRWEYYVSVDEHTANRRRKLWWRAYWWDRLLSCYSGRAPKVND
FT                   AHVTCLFPREVMALGIDDSMDHTTILENIPKSGTDLEAVMLAAYLAAGRHTSYMFTNVL
FT                   HARRFTHYKLHSDVGVAASDLIEELNVEVDGILRFQARLDAQIGPYREALTAHPIYQPV
FT                   LPHLACVSLCLLLAVENLIRRVREAVATARPLPAAKSLARCRNQTLDSARALLVDVAHC
FT                   KTLRQFLADKLASTVAFLVAVDHFIHGEPNAVDPALLALICSFAHQLTRFSVTHKSEGD
FT                   EGAHTELRYPSSILLVLARICLQIHNARHSPSGADTLSSALAEVLPAITVPEVRATVAE
FT                   LLTVTSRIWRPVLSCKDVSAYHGAILRHLDSGDPAVAETARSAGSSFTRTDSVDQHADA
FT                   NRGGSAMGTAAAADVDDGPTDRGHVYQSTAFDAQLLELEALLDFSRLPDLASVLCDYAG
FT                   NSEAPADL"
FT   gene            <761694..>762773
FT                   /locus_tag="KLTH0B09284g"
FT                   /old_locus_tag="KLTH-ORF14628"
FT   CDS_pept        761694..762773
FT                   /locus_tag="KLTH0B09284g"
FT                   /old_locus_tag="KLTH-ORF14628"
FT                   /product="KLTH0B09284p"
FT                   /note="similar to uniprot|P40100 Saccharomyces cerevisiae
FT                   YER185W Hypothetical ORF and to YGR213C uniprot|P53047
FT                   Saccharomyces cerevisiae YGR213C RTA1 involved in 7-
FT                   aminocholesterol resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21752"
FT                   /db_xref="GOA:C5DD91"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD91"
FT                   /protein_id="CAR21752.1"
FT                   /translation="MSATVKEKVMFAATVSLKPSSYTAANGTIVHYLQRPYYTYTPTVG
FT                   GAAVFAVLFGISLVVLSVQLWQYSKQRTSMERQIMADGSVSRDQTEDVESHDDGGLGLA
FT                   APAAVQPCSNARLIGKFVPLMVGIAVEIGGYAARIASRNDLYSIGPYVAQAVMLLVAPA
FT                   LMAATIYMNFGRLLTLLRATQLSIVPARFNTTIFVMGDILSFVLQGAGGGILGASDNHQ
FT                   LGSNIVIGGLAIQVFVFGFFVATEVRFLMCARRMSPVAYRISRHWKVLNINLFVSSLLI
FT                   LARSIVRLVEFAQGFNGYIMEHEWFIYVFDAVPMFLVVVSFIVFFNNGNLFRVEFECTS
FT                   MISDSRKYSMDTMTGCIDK"
FT   gene            complement(<762842..>764500)
FT                   /locus_tag="KLTH0B09306g"
FT                   /old_locus_tag="KLTH-ORF14625"
FT   CDS_pept        complement(762842..764500)
FT                   /locus_tag="KLTH0B09306g"
FT                   /old_locus_tag="KLTH-ORF14625"
FT                   /product="KLTH0B09306p"
FT                   /note="similar to uniprot|P25045 YMR296C Saccharomyces
FT                   cerevisiae LCB1 Component of serine palmitoyltransferase
FT                   responsible along with Lcb2p for the first committed step
FT                   in sphingolipid synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21753"
FT                   /db_xref="GOA:C5DD92"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD92"
FT                   /protein_id="CAR21753.1"
FT                   /translation="MRQPPEVLPSSIPVPEAVLRSSSYVWYYCQRAAHAIPGMRYVVSY
FT                   VRKSHQDDPYRTLFELFLIIYGIIYFFRKPRKQGEQAAPKLSEREVEALLDEWEPEPIA
FT                   QQNIKLEWRAKSTPVLMGNSSAPTRVNLTRDEGRESYSDVLNCASTSFLQISSDPEFVK
FT                   AAKDTIHQYGVGACGPAGFYGNQDVHSELEYNLARFFGTERAVLYGQDFCIAASVIPAF
FT                   TKRGDVIVADDRVNVALQNALQLSRSTVYYYNHNDMEALEELLEQLQERELNEKLPSLP
FT                   RKFIVTEGLFQNLGDIPDLPRLVELKRKYKYRLLVDETFSLGVLGANGRGIAEYYNMKR
FT                   DASVDITIGSLAVALGSSGGFVLGDNVMSMHQRIGSHAYTFSAALPAFAVTTASRVLDH
FT                   LEHDNSAVQKLRSLSQLMHQLFIDDSELSPYIEVTSSKESSILHFRLTDEYRSRVFHTT
FT                   EESLFQELSAMHAKNLSEKYIEGCEREEKLLQRIVDMALKEHKVLLTRNTFVLKHETLP
FT                   VTPSLKLCCSAKMTEDELRSACESVKSAVLACTSE"
FT   gene            <765494..>767071
FT                   /locus_tag="KLTH0B09328g"
FT                   /old_locus_tag="KLTH-ORF14621"
FT   CDS_pept        765494..767071
FT                   /locus_tag="KLTH0B09328g"
FT                   /old_locus_tag="KLTH-ORF14621"
FT                   /product="KLTH0B09328p"
FT                   /note="similar to uniprot|P00729 Saccharomyces cerevisiae
FT                   YMR297W PRC1 Vacuolar carboxypeptidase Y (proteinase C)
FT                   involved in protein degradation in the vacuole and required
FT                   for full protein degradation during sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21754"
FT                   /db_xref="GOA:C5DD93"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR008442"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033124"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD93"
FT                   /protein_id="CAR21754.1"
FT                   /translation="MKTSTLLAGALAASAQAASVQNVFQANTLLDKAIDALGLSSEDVL
FT                   DSLPKSLKSVWGEMGMLFPKETSQLEFVTKPKFKTNRRPDSQWDFVVQENPSHKLRVNK
FT                   IKDPQVLGVDPGVKQYTGYLDVEEEDKHFFYWFFESRNDPKNDPVILWLNGGPGCSSLT
FT                   GQFFELGPSHIGPEIKPIYNPYSWNSNASVIFLDQPVNVGYSYSGSSGVSNTVAAGKDV
FT                   YAFLQLFFKQFPEYASGQDFHIAGESYAGHYIPVFASEILSHPEEERSFNLTSVLIGNG
FT                   LTDELTQYQYYEPMACGEGGEPSVLEPEECEGMLDTLPRCLSLIEACYDSQSVWTCVPA
FT                   SIYCNNAQMGPYQKTGKNVYDIRKECEGELCYAEMSYMDEYLNLDVVKEAVGAEVDKFE
FT                   SCNFDINRNFLFAGDWMKPYHKAVTDLLNQGLPVLIYAGDKDFICNWLGNQAWSNVLPW
FT                   KYGDEFQDAPVKDWISSTTGDTAGKVKNYEHFTFLRVYGGGHMVPYDQPENSLAMVNDW
FT                   IQGRYSFE"
FT   gene            <767386..>767808
FT                   /locus_tag="KLTH0B09350g"
FT                   /old_locus_tag="KLTH-ORF14617"
FT   CDS_pept        767386..767808
FT                   /locus_tag="KLTH0B09350g"
FT                   /old_locus_tag="KLTH-ORF14617"
FT                   /product="KLTH0B09350p"
FT                   /note="similar to uniprot|Q03579 Saccharomyces cerevisiae
FT                   YMR298W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21755"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD94"
FT                   /protein_id="CAR21755.1"
FT                   /translation="MAQRTPQIYKLFQYVCAGLALIAAVEYFKYSTRINYEWFHCTLVE
FT                   EPWEQGSSLSRLYAVGGPSCDKRGELKTIMKKITRGFDLQKEGISFCIKEDLEVPSVHY
FT                   PIHDKKGAPGYVAYASYDSDSRDIREVCEDAPVLHI"
FT   gene            complement(<767865..>770873)
FT                   /locus_tag="KLTH0B09372g"
FT                   /old_locus_tag="KLTH-ORF14615"
FT   CDS_pept        complement(767865..770873)
FT                   /locus_tag="KLTH0B09372g"
FT                   /old_locus_tag="KLTH-ORF14615"
FT                   /product="KLTH0B09372p"
FT                   /note="similar to uniprot|P46677 YGR274C Saccharomyces
FT                   cerevisiae TAF1 TFIID subunit (145 kDa) involved in RNA
FT                   polymerase II transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21756"
FT                   /db_xref="InterPro:IPR022591"
FT                   /db_xref="InterPro:IPR040240"
FT                   /db_xref="InterPro:IPR041670"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD95"
FT                   /protein_id="CAR21756.1"
FT                   /translation="MSSRKQTKKQLPGKGDLTNEDDAYDAVFSGEFGSMEIGNYIGPSE
FT                   GQTEHLPDAIDFEDEDELAEEELPEETQPSMRNMTQEDDDYLNMMSNGAILGEQADGYS
FT                   DRNNTLFMGVDGHEATFPEEHHPFGEFADENQIALEEQRKLLEKERVAREEKELLNYYF
FT                   PKFQKGKVLSLMSIVPKQISKYQWQRDLYLTNRHIKPMLPLKLRVEVQPDSRRLFKSKS
FT                   KSWQFMSELYKKKKPGLVTVPLEDMFADGKQSTQRRKMDGSIPSELMMIADEWDYKKII
FT                   GDSDDEQESQSGKSTRSVAVSSETPTIQQDWNWDEENLVEGKVDQIKVCLDMNDERLLF
FT                   VKDKHQEHQESKAKPALLPFNEKSLLQKFNISNDDKYKILKENYQTKIRSTISNLSIEH
FT                   SQPAFRLQSPFFKVVPPKGYIRHFHRPHFGGQVRPGTNIVFSKVKTRKRKRDKGKDVRE
FT                   LFARSPDLTLGDSAPIFLMEYSEESPVALSKFGMGNKLINYYRKTDEKDLSRPKLPVGE
FT                   THVLGVQDKSPFWNFGFVEPGNVVPTLYNNMIRAPVFKHEVSGTDFLLIKSTGNGMGNR
FT                   FYLRNINHLFTVGQTFPVVEVPGPNSRRVTSMGKNRLRMIVYRILNKSAEHRLLVKQVA
FT                   RHFPDQNDMQNRQRLKEFMKYQRDGDDHGFWKLKESEILPDNENVKKMITPEDVSLTES
FT                   MYQGQQFQEDNEFFNCDEKLIKLEENLIPWAATKNFLNATQMRAMVQIHGAGDPTGCGE
FT                   GFSFLKTSMKGGFTRSGDDSGQPQISGGHSYNVAQQQKAYEEEISKTWYTQAKSLRITN
FT                   PFEEMEDPDVVNKTNKKVKSHRDDNKVLRIIRKKRDENGIIQRQTIIIKDPRVIQGYLR
FT                   AYKKKREEAEANLGLEELMNDNIDLVSGGNTEEKQLKQKKLLEEQLAKLQKSQERRQAR
FT                   KLAKEKTKDGKVTKARNTNRRCATCGMVGHIRTNKTCPMYNGGTGAAIANPPTPGPAPG
FT                   SENSVENAENAEA"
FT   gene            <771104..>771655
FT                   /locus_tag="KLTH0B09394g"
FT                   /old_locus_tag="KLTH-ORF14613"
FT   CDS_pept        771104..771655
FT                   /locus_tag="KLTH0B09394g"
FT                   /old_locus_tag="KLTH-ORF14613"
FT                   /product="KLTH0B09394p"
FT                   /note="weakly similar to uniprot|P53330 Saccharomyces
FT                   cerevisiae YGR275W RTT102 Regulator of Ty1 Transposition
FT                   regulator of Ty1 transposition"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09394g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21757"
FT                   /db_xref="GOA:C5DD96"
FT                   /db_xref="InterPro:IPR018304"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD96"
FT                   /protein_id="CAR21757.1"
FT                   /translation="MEASALISRANNASTHTFSNSNPKYWKFDWYTPVKPKQAQSNEKS
FT                   SGENDSEEKFSFKYKTWLPSEKPAWKQLEAEVEEIIDLEQYDRTKQPKTLQPGSAPVVN
FT                   GQAAADGLTADDIRGAVGGQETMIGFSASDATTKNDTKPAQANHEGPDGRVDPTASLDA
FT                   NGEQKPESEKKDADGDLDLQ"
FT   gene            complement(<771758..>773746)
FT                   /locus_tag="KLTH0B09416g"
FT                   /old_locus_tag="KLTH-ORF14611"
FT   CDS_pept        complement(771758..773746)
FT                   /locus_tag="KLTH0B09416g"
FT                   /old_locus_tag="KLTH-ORF14611"
FT                   /product="KLTH0B09416p"
FT                   /note="similar to uniprot|P53331 Saccharomyces cerevisiae
FT                   YGR276C RNH70 3' exoribonuclease required for 5S and tRNA-
FT                   Arg3 maturation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09416g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21758"
FT                   /db_xref="GOA:C5DD97"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR034922"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD97"
FT                   /protein_id="CAR21758.1"
FT                   /translation="MGFNLSKSQEANAAGESPIKDGHIQNGQAGARKIGSKTQDGKDET
FT                   SFRSSVARLSICEDENTKAKILDKLQRKDSDDIIVNEKNSGDQKAGSKRRRRRSSGVAG
FT                   PSLGNLKKTLEEQHSSSSLNIPKRKKKSSQPASLSISQKALQKRVSIKDLRDLVLYIFQ
FT                   DSNNAPGWIQVGNRASMNKMIVLFAPGLQADDFEKNKKHAWGDQTENPRATSLISLDDD
FT                   ELLDTIQRVPISAPGSKSTLYSAYNSFINVGLSKKEKEEKKQALNQKAITLNDLVLRPD
FT                   QLLENEYPVHEETPGLSEQEKQILSKTHAECDAAWKSTKSFEHGGSHTFALDCEMCMSK
FT                   DGLVLTRVSLVDFDCNLVYDSLVKPDVPIVDYLTRYSGITEEKLENVTVTLEDVQNQLL
FT                   KLVSADDILIGHSLQSDLNVLKLRHPKIIDTAVIFEHKAGPPFRPALKYLASEYLSQTI
FT                   QNSEGLGHDSFEDARACMELTKLKIVNGLAFGVGVNTENLFQRLARAGVRSLCLNDYAP
FT                   KYTELTSSRNASEVNLRCANDEEIFDNIRSSLKEYDLFVGRLRELEFAREYAESPKGVT
FT                   KEDFTAARERFVQRLKGLYHASPPSTVILVCSGTGDTRDWANIMRELNKLNKDEKFEER
FT                   KKRESEIQAAVYKARDAIGLLMTKKAE"
FT   gene            complement(<774127..>775104)
FT                   /locus_tag="KLTH0B09438g"
FT                   /old_locus_tag="KLTH-ORF14610"
FT   CDS_pept        complement(774127..775104)
FT                   /locus_tag="KLTH0B09438g"
FT                   /old_locus_tag="KLTH-ORF14610"
FT                   /product="KLTH0B09438p"
FT                   /note="weakly similar to uniprot|Q04949 Saccharomyces
FT                   cerevisiae YMR299C DYN3 Dynein light intermediate chain
FT                   (LIC) localizes with dynein null mutant is defective in
FT                   nuclear migration"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09438g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21759"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD98"
FT                   /protein_id="CAR21759.1"
FT                   /translation="MATNLWNNLLETNADLSAGSKTETAVVISAESQGVLQDFLVRVLE
FT                   VPDANASLSSIGYYCKDYGLDSGRPNDTVLHIYTLGWPVTPMNLDLLSIFVKPGARSIK
FT                   WVFLLDWLDGNKKLWLRSLQEGFELVNKKLQRDPCEIDDSSIVCMQSQCCKNLEVATAA
FT                   WSSLKMEFINQALRSVAFLKHASLLALETYTSKKDIIEIGKVATGQNTSKAPEYIQLNK
FT                   LFIPKNSDSEGKIKTMGEKFPVHMVLEESFISGQFERLIPGEPNSEPITDPGSPRKVVQ
FT                   LEEVDIQKELTEAYNLQKASLLENKTTSPASQIEPLNNSDLAGP"
FT   gene            complement(<775299..>776831)
FT                   /locus_tag="KLTH0B09460g"
FT                   /old_locus_tag="KLTH-ORF14608"
FT   CDS_pept        complement(775299..776831)
FT                   /locus_tag="KLTH0B09460g"
FT                   /old_locus_tag="KLTH-ORF14608"
FT                   /product="KLTH0B09460p"
FT                   /note="highly similar to uniprot|P04046 YMR300C
FT                   Saccharomyces cerevisiae ADE4 Phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09460g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21760"
FT                   /db_xref="GOA:C5DD99"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD99"
FT                   /protein_id="CAR21760.1"
FT                   /translation="MCGVLGIALGDQTSAVAPELFDGCLFLQHRGQDAAGIATCGQRGR
FT                   LYQCKGNGMARDVFTQQRMANLVGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGILLGH
FT                   NGNLVNTLSLRRYMDEDVHRHINTDSDSELLLNILAAELEKHNKYRVNNDDIFHALEGV
FT                   YRLCRGGYACVGMLAGYAMIGFRDPNGIRPLLFGERTRPDGTKDYMLASESVVLKAHNF
FT                   NNFRDLAPGEAVIVPKDCGNTAPEFKQVVPINSYRPDLFEYVYFARPDSVLDGISVYHT
FT                   RLAMGVKLAESIRKEIDPNDIDVVVSVPDTARTCALQCANTLQIPYREGFVKNRYVGRT
FT                   FIMPNQKERVSSVRRKLNAMDSEFKGKRVLVVDDSIVRGTTSKEIISMAKEAGASKVYF
FT                   ASAAPAIRYNHIYGIDLADTKQLVAFDKSTEEVSQELGCDRVFYQSLEDLVDCCKTDKI
FT                   SKFEVGVFTGNYVTGVEDGYLQELEKVRALNAAKQNFAKADSDIGLYNSADF"
FT   gene            complement(<777282..>779366)
FT                   /locus_tag="KLTH0B09482g"
FT                   /old_locus_tag="KLTH-ORF14604"
FT   CDS_pept        complement(777282..779366)
FT                   /locus_tag="KLTH0B09482g"
FT                   /old_locus_tag="KLTH-ORF14604"
FT                   /product="KLTH0B09482p"
FT                   /note="similar to uniprot|P40416 Saccharomyces cerevisiae
FT                   YMR301C ATM1 Mitochondrial inner membrane transporter
FT                   exports mitochondrially synthesized precursors of iron-
FT                   sulfur (Fe/S) clusters to the cytosol member of the ATP-
FT                   binding cassette (ABC) transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21761"
FT                   /db_xref="GOA:C5DDA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA0"
FT                   /protein_id="CAR21761.1"
FT                   /translation="MRPVDSIKLGGLVFRSLKPLPVRTSLCSRAFSLSPTARVSSTIPT
FT                   INSLRLYSTKNSPKIQENTVKSSPAPAKPKANEASKTPTIGELKILKDLFKYIWPNGDN
FT                   KVKARVLIALSLLVGSKVLNVQVPFFFKQIVDSMNIEWADPTAVLPIAVTAMILSYGAA
FT                   RFGSVLFGELRNAIFASVAQSAITRVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTK
FT                   GISYVLSAMVFHIIPITVEIGAVCGILTYQFGASFAAMTFTTMLLYSIFTFKTTAWRTE
FT                   FRKSANKADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAF
FT                   LNAGQNFIFTSALTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELK
FT                   QSLIDMESLFQLQRNKVKIQNKEKPLMLSSQRPSKIVFENVSFGYDPDRMILKNSSFTM
FT                   PAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQD
FT                   TPLFNDSIWENVRFGKISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGGE
FT                   KQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTI
FT                   ADADKIIVIQQGQVKEEGKHAELLAKPGSLYAELWNVQENLDVLNEELQREETQEKGDK
FT                   "
FT   gene            complement(<779619..>780320)
FT                   /locus_tag="KLTH0B09504g"
FT                   /old_locus_tag="KLTH-ORF14602"
FT   CDS_pept        complement(779619..780320)
FT                   /locus_tag="KLTH0B09504g"
FT                   /old_locus_tag="KLTH-ORF14602"
FT                   /product="KLTH0B09504p"
FT                   /note="highly similar to uniprot|P40302 Saccharomyces
FT                   cerevisiae YMR314W PRE5 20S proteasome alpha-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21762"
FT                   /db_xref="GOA:C5DDA1"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035144"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA1"
FT                   /protein_id="CAR21762.1"
FT                   /translation="MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAV
FT                   LVALKRNADELSSYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLS
FT                   LEKAGNLLSDKAQKNTQSYGGRPYGVGLLLAGYDNSGPHLLEFQPSGNTLELYGSAIGA
FT                   RSQGAKTYLERTLQDYLELDDADDLIRVAVEALRQCLKDEVLSTKNLSIAVVGQDKPFT
FT                   ILDDEAVSPYL"
FT   gene            <780915..>782657
FT                   /locus_tag="KLTH0B09526g"
FT                   /old_locus_tag="KLTH-ORF14601"
FT   CDS_pept        780915..782657
FT                   /locus_tag="KLTH0B09526g"
FT                   /old_locus_tag="KLTH-ORF14601"
FT                   /product="KLTH0B09526p"
FT                   /note="similar to uniprot|P40308 YMR313C Saccharomyces
FT                   cerevisiae TGL3 Triacylglycerol lipase of the lipid
FT                   particle"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09526g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21763"
FT                   /db_xref="GOA:C5DDA2"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA2"
FT                   /protein_id="CAR21763.1"
FT                   /translation="MFKLYILSFFYLFLNHIPPFVWALGHVVSDIFQFWMRRLMNYLRP
FT                   RSRNLYHGAISDLEQCDNFSDWYQKAAIVDEITGADLWRRNFYSQRYDVNSVLEQYAVL
FT                   DEALDENDAHTIVHRFSTTGPSMLRNFAGIVDKRLFTKSLIGTKLLIEQYLDKVLECLQ
FT                   FLCQTPGVARTSFFQRCKLSLGTTAFILQGGSLFGLFHLGVIRGLLEQKLLPNIISGSS
FT                   MGACIGSLCSVLTNEELSVLLSGDNLLNAIKSDLDLLKQCGYGNIDQDLNLGSLLQNVV
FT                   HRGYSKDVFLFINFVNKVIIKDLTFEEAFQRTGKILNIIVHPTDQNRCPSLLNYVTTPN
FT                   VLIACAIDCSLGSEVVSSGTKLMCKNLKNEIVDYIPDTGSSRLVFLTPQNASETGLIES
FT                   PYTRLTELFNVNNFIVSLARPYLAPLVMNDLKHEIKTSKYYYYKHYPTTDMSNFTPLQL
FT                   SNMNEVEPLGFKFRYHLERKLKHIVTMELRHRVEVMDNLGILSHWIKRLAIDEKTPRSA
FT                   TEITIVPNLKSLSLSRVIEGQLDNIPYWIKCGEQSCWPVLALIKTRCAVEFGLDEIIKS
FT                   KKNT"
FT   gene            complement(<782708..>783535)
FT                   /locus_tag="KLTH0B09548g"
FT                   /old_locus_tag="KLTH-ORF14597"
FT   CDS_pept        complement(782708..783535)
FT                   /locus_tag="KLTH0B09548g"
FT                   /old_locus_tag="KLTH-ORF14597"
FT                   /product="KLTH0B09548p"
FT                   /note="similar to uniprot|Q04868 Saccharomyces cerevisiae
FT                   YMR312W ELP6 Elongator protein part of the HAP subcomplex
FT                   of Elongator which is a six-subunit component of the RNA
FT                   polymerase II holoenzyme required for Elongator structural
FT                   integrity and histone acetyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21764"
FT                   /db_xref="GOA:C5DDA3"
FT                   /db_xref="InterPro:IPR018627"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA3"
FT                   /protein_id="CAR21764.1"
FT                   /translation="MSMAQKQDLVIFSDHSVLSRELFSKDLHHVLFVTHKLGTSPSWLI
FT                   NALVETQVLGFPATLNESHAAAVNRASNRKITDSKCATVASFIHNRGFFTSALKKLKVD
FT                   AECYNIIDYMTDFVLKNYGKPASKVLSSLLEELSNESATSELLILEQPELLVHLLNITS
FT                   DQLHLELINPLIKKFPLLVVVSYTEAYENVPSDSNEKLSSDMIEQIRFCNSCFFKSAAV
FT                   LGLKPLATGHASDVSGTLTITRGGASLSHLAVHVVENEYLFLTQKDTTKLFYR"
FT   gene            <783747..>785033
FT                   /locus_tag="KLTH0B09570g"
FT                   /old_locus_tag="KLTH-ORF14596"
FT   CDS_pept        783747..785033
FT                   /locus_tag="KLTH0B09570g"
FT                   /old_locus_tag="KLTH-ORF14596"
FT                   /product="KLTH0B09570p"
FT                   /note="highly similar to uniprot|P32527 Saccharomyces
FT                   cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
FT                   chaperone contains a DnaJ domain together with Ssz1p acts
FT                   as a chaperone for nascent polypeptide chains"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21765"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR032003"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA4"
FT                   /protein_id="CAR21765.1"
FT                   /translation="MISLPPLTSDINVNVNTSASKAASVRRPVEPVGRFFMHHAQRTLR
FT                   NHTWSEFEKIQASQNVQRVDESVDPDEELLDDELADESLLEHDPRDWKTADLYAAMGLS
FT                   KLRHKATDAQVIKAHRKQVLKHHPDKKSASGGLEQDGFFKIIQKAYETLTDPTKRKQYD
FT                   SCDYNADVEPPKKGSKYDFFEAWGPVFEAESRFSKKQPVVLLGGPDASKADVEKFYNFW
FT                   HRFDSWRTFEFADEEVPDDSSNRDHKRYIERKNKAARDKKKTADNARLAKLVERASNED
FT                   PRIKQFKEAEKKEKEKKKWEREAGARAEAEAKAKAEAEAKAKAEAEAAAAAGAKVDKKK
FT                   AKEAAKAAKKKNKRAVRNAPKDADYFGDAEKAAAIDEQTGLIVDSVDDEQLVQLAEKVK
FT                   ADAKAGLAEFAKVLSDSGKLPASLLSYFL"
FT   gene            <785306..>786223
FT                   /locus_tag="KLTH0B09592g"
FT                   /old_locus_tag="KLTH-ORF14591"
FT   CDS_pept        785306..786223
FT                   /locus_tag="KLTH0B09592g"
FT                   /old_locus_tag="KLTH-ORF14591"
FT                   /product="KLTH0B09592p"
FT                   /note="similar to uniprot|P53337 Saccharomyces cerevisiae
FT                   YGR284C ERV29 Protein localized to COPII-coated vesicles
FT                   involved in vesicle formation and incorporation of specific
FT                   secretory cargo"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21766"
FT                   /db_xref="GOA:C5DDA5"
FT                   /db_xref="InterPro:IPR002995"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA5"
FT                   /protein_id="CAR21766.1"
FT                   /translation="MSFRGNSGFSGIPTTHQGYKQNPYTASAAGKSSSLKKTVMDELDK
FT                   LSNKVDDLTDHPVVQKLKPYTPAISRFFIVATFYEDSFRIISQWSDQVFFLWNYRHLPY
FT                   FFVVLFLLAVVLSMTVGATMLILRKRTIVATGVLCACIVLQGLVYGLYGGSFVLRNVSV
FT                   IGGLLIAFSDSIVQSKTTFGMLPELHNKDGKTKGFLLLMGRLLLVVLFVTFTFTKNWLT
FT                   VLLVIIGTICISVGFKTKLASILLGLILAFYNITVNNYWFYDSGKRDLLKYEYFQNLSI
FT                   IGGLLLVVSTGAGELSIDEKKKIY"
FT   gene            <786773..>787390
FT                   /locus_tag="KLTH0B09614g"
FT                   /old_locus_tag="KLTH-ORF14587"
FT   CDS_pept        786773..787390
FT                   /locus_tag="KLTH0B09614g"
FT                   /old_locus_tag="KLTH-ORF14587"
FT                   /product="KLTH0B09614p"
FT                   /note="similar to uniprot|P41818 Saccharomyces cerevisiae
FT                   YMR311C GLC8 Regulatory subunit of protein phosphatase 1
FT                   (Glc7p) involved in glycogen metabolism and chromosome
FT                   segregation proposed to regulate Glc7p activity via
FT                   conformational alteration ortholog of the mammalian protein
FT                   phosphatase inhibitor 2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21767"
FT                   /db_xref="GOA:C5DDA6"
FT                   /db_xref="InterPro:IPR007062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA6"
FT                   /protein_id="CAR21767.1"
FT                   /translation="MVGILKNPLPDRNGESEEPESISEFRKQVYKNTQLNAKLTSKAQN
FT                   NGKSTSKANAASPKRPVVPRDTLSLKHQHDTLSQAEEEKLKWNQQNLAENDIAKLEYKD
FT                   INIDEPKTPYQGAVDPTGEYYRDDDDELESLSLGEPVVEMPQSDSDNSSSSGPSDAEPS
FT                   AEESAEAKHRRFEELRKKHYNVKEALKAQRQNLDDEELEDED"
FT   gene            <787602..>788771
FT                   /locus_tag="KLTH0B09636g"
FT                   /old_locus_tag="KLTH-ORF14585"
FT   CDS_pept        787602..788771
FT                   /locus_tag="KLTH0B09636g"
FT                   /old_locus_tag="KLTH-ORF14585"
FT                   /product="KLTH0B09636p"
FT                   /note="similar to uniprot|Q04867 Saccharomyces cerevisiae
FT                   YMR310C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09636g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21768"
FT                   /db_xref="InterPro:IPR003750"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA7"
FT                   /protein_id="CAR21768.1"
FT                   /translation="MAPKREGGVVGKGHNETAKKSKLSKPAKYTENNKKAANFTTKAPK
FT                   KKLKKTIKICSKTINYSLCIPVSVIDNCKNLEQATHVVYQIAKSAVLFNVGEIVVLDLG
FT                   RAEDVPKESRHRFQMSPVLLVASLLQYFVTPPYLVKSVFKKEYQECFKVAAKLPRITAL
FT                   PFMRHLHEDNGRYREGLAVRMQRPAQGARPAKKKAYDQTKYVNVGKDSALELRGQLVPA
FT                   NVRVTVDLIDCKVVSPAEAYGDFVGAQASYGFHVRVAKTFADIFTQSPAPNGYTQTVWV
FT                   NSGDFYFDPTTKKSLKLETKIPRIGKILKPTPEEVASGEAENPAHLLVVLGKWDHLKKS
FT                   FARSREMFAGCEGAHQFFDGQLELPGSAPEANIGIHDSCMIAMTMLASL"
FT   gene            <789016..>789939
FT                   /locus_tag="KLTH0B09658g"
FT                   /old_locus_tag="KLTH-ORF14583"
FT   CDS_pept        789016..789939
FT                   /locus_tag="KLTH0B09658g"
FT                   /old_locus_tag="KLTH-ORF14583"
FT                   /product="KLTH0B09658p"
FT                   /note="highly similar to uniprot|P15703 Saccharomyces
FT                   cerevisiae YGR282C BGL2 Endo-beta-1 3-glucanase major
FT                   protein of the cell wall involved in cell wall maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21769"
FT                   /db_xref="GOA:C5DDA8"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA8"
FT                   /protein_id="CAR21769.1"
FT                   /translation="MKFSTIASLAAVGVSYASAVGDLGFNLGVKNNDGTCKSTEDYAKD
FT                   LDILKGYTSTVKVYAASDCNTLQNLGPAAESAGFSVFVGVWPNDDAHFSAEKQALQSYL
FT                   PNIKTSTVKGILVGSEALYREDLTASELASKISEVKSLVADIKDSDGNSYSGTLVGTVD
FT                   SWNVLVDGGNADVIKASDMVMANAFSYWQGQTMDNASYSFFDDIMQAMQTIQTVKGTDI
FT                   PFWVGETGWPTDGTNFESSYPGTDNAAQFWQEGICAIRAWGVNVLVFEAFDEDWKPNTS
FT                   GTSDVEKHWGVWTSGDELKYSLDCKF"
FT   gene            <790481..>792934
FT                   /locus_tag="KLTH0B09680g"
FT                   /old_locus_tag="KLTH-ORF14578"
FT   CDS_pept        790481..792934
FT                   /locus_tag="KLTH0B09680g"
FT                   /old_locus_tag="KLTH-ORF14578"
FT                   /product="KLTH0B09680p"
FT                   /note="similar to uniprot|P32497 Saccharomyces cerevisiae
FT                   YMR309C NIP1 Subunit of the eukaryotic translation
FT                   initiation factor 3 (eIF3) involved in the assembly of
FT                   preinitiation complex and start codon selection"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21770"
FT                   /db_xref="GOA:C5DDA9"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="InterPro:IPR027516"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA9"
FT                   /protein_id="CAR21770.1"
FT                   /translation="MSRFFANSYDYESGSSSSEEDLLSTSEEELMSSSSSEEEQANDSF
FT                   FDESESESDVDSDGSGDRPYGPDWFKKPEFRKGGSTGANKFLKNADYSNSEDSDDEGRK
FT                   VVKSAKDKLLDEMRGVYDKIEDAEMTQDWITILAELDNMTRLSTRAQQQNYGVPNIFVK
FT                   VLAQVEDAVAATSLQDINNKAVARAYNTTKQRVRKVARDYEQALSSFRENPEAHADDEA
FT                   VQDNNSVSTFALAGKKTADLSSMATASSESDFFTALRIVIDSRGKKGTDFQAQIKTLEE
FT                   LLDIAKSPYETILAYLNLIPIRFDSSATLSYQPIDQWKASQQDIAKLFDTLEDSIDAYH
FT                   VSELAPHNDFIEEEPQPNEQGIKQVLGSVYSFVERLDEEFNKSLLNTDPHSSDFLDRLK
FT                   DEQGVYNLILRSQLYLEATSSDSELERRLARVLTRRFDHIYFKSVKLVEVSESKAWKSL
FT                   REGAKSKVTPLDGEVDESYTFGLIDTLHKMLSTQKDGAQRRRAGLYQIYFYALNNQFEK
FT                   AKHMLLSSHIQSSINNADAPLQILFNRTVVQLGLAAFKLCLIDDCHQILNEVSTSTHLR
FT                   DILGQQSLQRVAANNATNPGGASNEQLCLPFHQHINLDLIDVVFMTCSLLIEVPHMAAF
FT                   FSGIKVKRIPYSQKSIRRALEHYDKSSFQGPPETLRDHVLYAAKSMQRGDWDKSVEYLK
FT                   KVPTWSLLPNTAEVLTNLAHRVQVEALRTYIFTYKRFYSKLSLLKLSQLFGLSQETVVE
FT                   VVSAIISQYDIKGRLDEESKFLVFEKGYEITKLEEVAVKLAKETKYVSERLNEKKYVGS
FT                   SRKQE"
FT   gene            <793194..>794003
FT                   /pseudo
FT                   /locus_tag="KLTH0B09702g"
FT                   /old_locus_tag="pseudo-Klth0B-793194-794003"
FT   gene            complement(<796023..>800483)
FT                   /locus_tag="KLTH0B09724g"
FT                   /old_locus_tag="KLTH-ORF14558"
FT   CDS_pept        complement(796023..800483)
FT                   /locus_tag="KLTH0B09724g"
FT                   /old_locus_tag="KLTH-ORF14558"
FT                   /product="KLTH0B09724p"
FT                   /note="similar to uniprot|P53049 Saccharomyces cerevisiae
FT                   YGR281W YOR1 Plasma membrane transporter of the ATP-
FT                   binding cassette (ABC) family mediates export of many
FT                   different organic anions including oligomycin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21771"
FT                   /db_xref="GOA:C5DDB0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030244"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB0"
FT                   /protein_id="CAR21771.1"
FT                   /translation="MISSTSTSSDSGSEKDHVISIHAHNAPQARKLAAETGAGAGDTAG
FT                   VGAAIDAGVAAEAADASSVASSTVDQNRPETFLNSDDLERVTDSEIYPQKRLFSLLHTR
FT                   KIPQIPLPEERKTYPLYHTNPIYYAFFWWVFPIIRIGYKRTLQPNDLWAMDNRISIEAI
FT                   YATFTKYMDHYTEIARQNYAQEHPEASPEDVRENTTLSKHALFKALLRTFKLQYFFALI
FT                   AMSLSNATSAFIPMVTKRLIRFVEEKALVPGLKVNAGVGYAIGASIMMLLNAILLNHSF
FT                   HLAQLTGVQVKSILIKAILNKSFKLSGYSKHKFPNGKITSVMSTDLSRLELAIMFQPLL
FT                   GAFFVAVIICIVQLIVNLGPVALVGVGIFAAAMVGSAYAFKRMINVRKTTNQFTDARVT
FT                   LMREIMNSMKMIKFYAWEDAYEKNVNDVRTLEIRQTRIMQFTRNFVTALAVCLPSLASM
FT                   VTFLVMYKVNNNGRNPADIFSSLSLFQVLSIQMFFLPMALGTGVDGSIALNRVQEILEA
FT                   GEEDQDIEKTCLPMDDEKHALKLVNASFQWENFEVEEAKDVAKAKQAEDDKKNRKDKKH
FT                   NAHEVKTNDSDSTADSKKAPNVTFKGFDNLNIQITKGELVIVTGSVGTGKSSLLYALSG
FT                   FMKKTGGDIYKDGTMLLCGYPWIQNATVRDNILFGSPYNEARYNEIIRVCSLQADLELL
FT                   PAGDRTEIGERGITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLM
FT                   GKLEGSTRVLATHQLSLIARASKVIYIDLDGSVDVGSVEELKKRKPGFVNLMQYSNHSE
FT                   SEKKPGEVEEEKRQEAGAGAQPVRPEIDSRQSELEASELKKQVSKRSQLQDEQKGVAPD
FT                   GRLTSKEERAVNSISYKVYQQYITAGVGKKGFLMLPIYLMLLAVSTFSLLFSSVWLSFW
FT                   TENKFKHKKTPFYMGMYTFFVFFNYFVTTSQFSLICYIGLSAAKRLNLKAVQRLLHTPM
FT                   SFLDTTPIGRVLNRFTKDTDTVDTELTESVRLFVFQLSNIVGVIVMCIIYLPWFAIAVP
FT                   FLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIRAYRGERRFLTKSD
FT                   FLTNKMNEAGYLVVAIQRWVAIALDMIAMAFALIVTLLCVTRQFHISAASVGVLLTYVL
FT                   QLPGLLNMLLRAMTQGENDMNSTERLISYATELPLEAAYRRPEMSPPAEWPTDGRIEFD
FT                   HVSLAYRPGLPLVLKDVTLHVAAGEKIGICGRTGAGKSTIMSALYRMCELHDGSITIDG
FT                   VDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPFHERTDDELWHALVRGGAIPAESL
FT                   ATVRAQTHENAGSLSNMHKFHLQQEVEEDGTNFSLGERQLLALTRALVRQSKILILDEA
FT                   TSSVDYETDAKIQTRIVEAFSNCTILCIAHRLNTILDYDRILVLDQGRVCEFDTPAALY
FT                   ARGGVFTEMCDRSGITRDDFNTRHH"
FT   gene            complement(<801412..>803589)
FT                   /locus_tag="KLTH0B09746g"
FT                   /old_locus_tag="KLTH-ORF14544"
FT   CDS_pept        complement(801412..803589)
FT                   /locus_tag="KLTH0B09746g"
FT                   /old_locus_tag="KLTH-ORF14544"
FT                   /product="KLTH0B09746p"
FT                   /note="some similarities with uniprot|Q12180 Saccharomyces
FT                   cerevisiae YOL089C HAL9 Putative transcription factor
FT                   containing a zinc finger overexpression increases salt
FT                   tolerance through increased expression of the ENA1 (Na /Li
FT                   extrusion pump) gene while gene disruption decreases both
FT                   salt tolerance and ENA1 expression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09746g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21772"
FT                   /db_xref="GOA:C5DDB1"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB1"
FT                   /protein_id="CAR21772.1"
FT                   /translation="MSNVMEKSPSLGTKANKANEFKRILEKIESLEKEVVGLAEQLRSN
FT                   SLSASLQEKRRKRRARSSGKAWASKRRPTSISLQRVSSLDLLANVVLQVNSRGKPQGSK
FT                   SEADESSGALKYAENFSLKEVPNFAYFGDFGVFSSYAILTPKGLEWIRSKSINCEEEIG
FT                   YLGNWYSQFLQSKKSESLFPLPIALQPRPELAVLEALIQVFEKSRLHAMSFAFLDGIQA
FT                   LFKELLEGEAKSLKASKHIVLNVALALVCHFQQHSSKTPIEGMSSEVMETMQNLEALVE
FT                   MEDNFISNALFYYHQVSIMPEGILTLQAMLALLAYTDFTGALHASYIMVTLAIRLAQDL
FT                   GLHAEITYEGLDIAEDEKRRKMWGLCRYFDLKLSMILGRPPVVANYDTTTSFPNCGTYL
FT                   GLLAEVCAGTSANPPTCELSFAKKLLHLVVKETGFDLYGGFHIFRLVRVASRVYSQLYA
FT                   PSTAINLKKHLASAQALLTEMESFRLSLPDGVRPLSPVKKAVIADLFKVSNLPPTMTQV
FT                   LIYSIHFLFYMNLMFIQKALFKTQVYLKENGEYSETPFYESVRTARHALSLVAETFEPD
FT                   MNGYFKPFQWTISMAFFEVFVYTLSKQDDPQEFEHDVRLMAHVQCDFFTRYDSIDAVVG
FT                   PCTQAHRQNALPSPNLQNNFKHMINVLRKTFSARFGRNVQLTPAQHDCLQYSASDIATT
FT                   PDREMNSPSMNPFSGVDNMEFFGLDANMFGL"
FT   gene            <805761..>809039
FT                   /locus_tag="KLTH0B09768g"
FT                   /old_locus_tag="KLTH-ORF14534"
FT   CDS_pept        805761..809039
FT                   /locus_tag="KLTH0B09768g"
FT                   /old_locus_tag="KLTH-ORF14534"
FT                   /product="KLTH0B09768p"
FT                   /note="similar to uniprot|P32337 Saccharomyces cerevisiae
FT                   YMR308C PSE1 Karyopherin/importin that interacts with the
FT                   nuclear pore complex acts as the nuclear import receptor
FT                   for specific proteins including Pdr1p Yap1p Ste12p and
FT                   Aft1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21773"
FT                   /db_xref="GOA:C5DDB2"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="InterPro:IPR040928"
FT                   /db_xref="InterPro:IPR041389"
FT                   /db_xref="InterPro:IPR041653"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB2"
FT                   /protein_id="CAR21773.1"
FT                   /translation="MSALPDEVNTTLVNVLHGFSSPDNGIRAAAEETLNKDWITPDNIE
FT                   VLLIFLSEQAAYSPEPTLAALSAVLFRKLALRAPPSSKTVIIAKNITHISESALNQIRE
FT                   TLLKGFVTERQGGIRHKLSDAIAECAQEDLPEWPALLQGLFEAIKNPDANFRESSFRIF
FT                   TSVPHLINAVDINSVLPIFEAGFTDSDDNVKVAAVTAFVGYFKQLPKQHWAKLGILLPS
FT                   LLNSLPNFLDGGKDDALASVFESLIELVELAPKLFKNMFDQMIQFTDIVIKNKDLETSA
FT                   RTTALELLTAFSESAPQMCKSTPSYAQSLIMNTLLMMTEVSIDDDQASDWHDSDDTEED
FT                   DEEVTYDHARQALDRVSLKLGGKYLAPPLFQYLQQMVSSSEWRERFGALMALSSAAEGC
FT                   RDVLIGEIPKILDMIVPLINDPHPRVQYGCCNALGQISTDFAPLIQRTSHERILPPLIS
FT                   KLTPQSVDRVQTHAAAALVNFSEHATQTILEPYLDDLLTNLLTLLQSTKFYVQEQALTT
FT                   IAFIAEAAEKKFIKYYDTLMPLLINVLKTDTGNANRLLKGKCIECSTLIALAVGKEKFL
FT                   TQSQELIELFIAYQNQGIDDDDPMKSYLEHGWSRICRILREDFVPLLPVVIPPLLETAK
FT                   ATQDVSLIEEEDAANFQQYSDWDVVQIQGKHIAIHTSILDDKVSAMELLQVYTTILKNF
FT                   FAVYVPEIMKEIAVPSIDFYLHDGVRATGAGLIPVLLSALVSATGVQNSDVLQLWHLAS
FT                   TKLLNGIISEPMPEITQIYHTALVDGLAIMGENSLSDEQLLQYTKGLSANLSDIYERVK
FT                   QRRNQEDEYNEDVDDDFEDYTDEDLLDDINKSLAAVFKSTGGRYLNQFQTLWPLVVTYL
FT                   RDGEVILTLFALCAIGDMIETAGPATEVYKDSFINEVKEYLVSPEASIRQAAAYVIGVC
FT                   AQHSRDVYAQECSQSLDTLVRVISIPDAKSEENVTSTENASAAIAKILHSYGPNVPNFD
FT                   NYVSNWLKTFPIVQDEEAAAFNYRFLAHLIDSNSPAVHNSAAIPHILDSVVQALHHKSL
FT                   VGKNASAVVESTKKLLGTLPQSEAMNLFQRYPSDVVQEVQHWFA"
FT   gene            <809351..>810328
FT                   /locus_tag="KLTH0B09790g"
FT                   /old_locus_tag="KLTH-ORF14531"
FT   CDS_pept        809351..810328
FT                   /locus_tag="KLTH0B09790g"
FT                   /old_locus_tag="KLTH-ORF14531"
FT                   /product="KLTH0B09790p"
FT                   /note="some similarities with uniprot|P53335 Saccharomyces
FT                   cerevisiae YGR280C PXR1 Protein with a role in maturation
FT                   of rRNAs and small nucleolar RNAs required for cell
FT                   viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21774"
FT                   /db_xref="GOA:C5DDB3"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB3"
FT                   /protein_id="CAR21774.1"
FT                   /translation="MGLAATKNKQKLGLDPRNTAWSNDTSRFGHKHLEKMGWRPGSGLG
FT                   MMPNATTTHVKVSIKDDNLGLGAKLRKKDKADEFDSGECAGLDAFQRLLGRLNGKEDSV
FT                   SNELDIQKKQNIINGKWGIHFVKGDVLASTWDAKTKTLKLYSNESTKRKLDSEDEEYPS
FT                   SRESKRSKKSKESRKSDKKKDVSEEDKETVKKGDKSRKDKDKKLKKDGDTKDKKEKRVK
FT                   KEKKDKKDKKDKHKMKKTEDKKQKHKKSEKDRDEKHKNKKDKKREYKSSKSNKVSRESM
FT                   LKPRDPQENAIASRLSVRSKWIKQKRAAVMDAQALNEIFMVTTQ"
FT   gene            complement(<810486..>812117)
FT                   /locus_tag="KLTH0B09812g"
FT                   /old_locus_tag="KLTH-ORF14528"
FT   CDS_pept        complement(810486..812117)
FT                   /locus_tag="KLTH0B09812g"
FT                   /old_locus_tag="KLTH-ORF14528"
FT                   /product="KLTH0B09812p"
FT                   /note="similar to uniprot|P22146 Saccharomyces cerevisiae
FT                   YMR307W GAS1 Beta-1.3-glucanosyltransferase required for
FT                   cell wall assembly localizes to the cell surface via a
FT                   glycosylphosphatidylinositol (GPI) anchor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09812g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21775"
FT                   /db_xref="GOA:C5DDB4"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB4"
FT                   /protein_id="CAR21775.1"
FT                   /translation="MRFATSSLLLSLLSVLQLALADGNDTTPAIEVKGNKFFFSNNGSQ
FT                   FYMKGVAYQADTANSTAGDEDTIVDPLADYETCSRDLPYLLGVHTNVVRVYALNTSLDH
FT                   SKCMNAFADAGIYVIADLSEPSESINRDSPAWTLDLYERYTSVVDAVANYSNVLGFFAG
FT                   NEVTNNKSNTNASPFVKAAIRDTKKYMKDKGYRNIPVGYSSNDDEETRVSMADYFACGD
FT                   DDVKADFYGINMYEWCGSSTFQSSGYEDRTKEFSNLSIPAFFSEYGCNESPPRKFQEVE
FT                   ALYGDDMTDVWSGGIVYMYFEEANKYGLVSTSGNTVKTLDDYNNLKKEIASVSPSSVNK
FT                   NSYTPSTTSLKCPATGTNWNASTELPPTPDKDVCDCLKSSLSCVLADDVESKDYGDLFS
FT                   YLCDKIGCDEITADGSAGNYGEYSFCDADIKLSFLLDKYYQKNGKNKSDCSFSGSASLA
FT                   SSTSQASSCQAKLSSATASAKSTGSSNSNSSGSSASSSNSSSSASSSSNSKKSGGIQVK
FT                   PASPAGLWLVAIMVASASVGLGSIVF"
FT   gene            complement(<812816..>814456)
FT                   /locus_tag="KLTH0B09834g"
FT                   /old_locus_tag="KLTH-ORF14525"
FT   CDS_pept        complement(812816..814456)
FT                   /locus_tag="KLTH0B09834g"
FT                   /old_locus_tag="KLTH-ORF14525"
FT                   /product="KLTH0B09834p"
FT                   /note="similar to uniprot|P22146 Saccharomyces cerevisiae
FT                   YMR307W GAS1 Beta-1.3-glucanosyltransferase required for
FT                   cell wall assembly localizes to the cell surface via a
FT                   glycosylphosphatidylinositol (GPI) anchor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21776"
FT                   /db_xref="GOA:C5DDB5"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB5"
FT                   /protein_id="CAR21776.1"
FT                   /translation="MLFRKITALSVASLLTSRVVADDLPAIEVKGNKFFFSNNGSQFYM
FT                   KGIAYQQDTANTTSGESFNDPLADYETCSRDIPYMQAVDTNTIRVYALNNSLDHTKCMQ
FT                   ALNDAGIYVIADLSQPSQSINRDDPAWDLELYKRYTDVIDAMHNYTNILGFFAGNEVTN
FT                   NKSNTAASAFVKAAIRDCKKYIKDKGYRDIPVGYSTNDDEETRVSMADYFACGDEDVRA
FT                   DFYGINMYEWCGSSTFQSSGYEDRTKEFSNLTIPIFFSEYGCIESRPRKFQEVGTLYSD
FT                   DMTDVWSGGIVYMYFEEANNYGLVSVSGDKVSTLSDYSYYSEEIKSVSPTSVNSKTYTV
FT                   SNATLSCPATNSNWKAATSLPPTPNQQVCECMSGSLSCVVADDVDEDDYQDLFDYVCGV
FT                   ISCDGITASGSNGTYGSYSFCDAKSKLSFVLNKYYESNGSSKSACSFSGSASLQTASTA
FT                   STCSSILSQIGSQGTGSATGLSSATGVSSISTGSNSGSKSGSSSSSSSSSSSDKKNAAS
FT                   TNSPKSVAQILLTAFVAIGATAGVGFVIA"
FT   gene            complement(<815242..>820530)
FT                   /locus_tag="KLTH0B09856g"
FT                   /old_locus_tag="KLTH-ORF14517"
FT   CDS_pept        complement(815242..820530)
FT                   /locus_tag="KLTH0B09856g"
FT                   /old_locus_tag="KLTH-ORF14517"
FT                   /product="KLTH0B09856p"
FT                   /note="similar to uniprot|Q04952 Saccharomyces cerevisiae
FT                   YMR306W FKS3 Protein of unknown function has similarity to
FT                   1,3-beta-D-glucan synthase catalytic subunits Fks1p and
FT                   Gsc2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21777"
FT                   /db_xref="GOA:C5DDB6"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="InterPro:IPR026899"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB6"
FT                   /protein_id="CAR21777.1"
FT                   /translation="MEDEQFSAWYHDGEAPVTRTELRDIFDDLARKFGFQQSSKENMQQ
FT                   HMLAQLDSRARRSSARTALTSLHASYIGGDEANFKKWYFAAQLDLDEEIGFQNLKLHGK
FT                   ARKRNLKHAKERGVSIEEQIRLWKEQEEEFANSHPKLPFTQTQPKINESFATADYKWKL
FT                   RMRDLEPGQMARQLALYFLCWGEANQIRFTPECLCFIFKCALDHDVSEADVCQASKPEF
FT                   SYLDDIITPLYRFLRSQVYHVDETNGKMTRLEKDHKDIIGYDDVNQLFWYPEGIERLVL
FT                   ESGERLIDKPSHERYLSLKDVLWSKAFYKTYKETRTWMHCATNFNRIWIIHLSTFWFFT
FT                   SFNAPTLYTKDYVQLLNNPPTRQARLSAVALGGTLTCIIQIVATLFEWSFVPRKWPGGQ
FT                   HLTRRMIALLVCLAINFAPSVYVFGFFDLDVHSTYAYTASIIQLIIAIVTTFFFAIRPL
FT                   GGLFESYLFKGRKKRRYTSSQTFTAQFPKLMGRSRWFSWGLWFFVFLGKFIESYFFLTL
FT                   SLRDPIRVLSIMDMSRCNGDSLLGSHLCRLQPKITLIIMILTDLVLFFLDTYLWYIICN
FT                   CIFSIILSFSLGTSILTPWKNIYSRLPKRIHSKILATSEMDVKYKPKILVSQIWNAMII
FT                   SMYREHLLSIEHVQRLLYQQVDSANMNKRTLKSPTFFVAQDDSTFKSMDFFPENSEAER
FT                   RISFFAQSLSTPISEPIPVECMPTFTVLIPHYSEKILLSLKEIIKEESTKSRITLLEYL
FT                   KYLYPTEWECFVRDTKLIAVENCSINNDQGESESEVLKEGLLGVSKEYDDRSKFFQAKI
FT                   EDLPYHCMGFTNSDPEYTLRTRIWASLRFQTLYRTVSGFMNYSKAIKLLYRIENPTIIQ
FT                   KYGADFELLEEELDRLSREKFRMVVAMQRLKKFDRHEREAAEFLLKAYPDMCISYLEEV
FT                   PQENGEAIFYSCLIDGHCDFEDTTGERKPQFKIRLSGNPILGDGKSDNQNHSLIFYRGE
FT                   YIQVIDANQDNYLEECLKIRSILGEFEELDLDQSMPYIPGVDSGGDAPIAIVGAREYIF
FT                   SENIGVLGDIAAGKEQTFGTLFARTLAEIGGKLHYGHPDFLNGIFMTTRGGISKAQKGL
FT                   HLNEDIYAGMTAVCRGGRIKHSDYYQCGKGRDLGFGSIMNFTTKIGAGMGEQLLSREYY
FT                   YLGTQLPIDRFLSFFYAHAGFHLNNLFITMSVQIFFILLINLGSLNHEVIRCEYNKDLP
FT                   ITDLERPIGCYNILPVLHWVNIFVLSIFIVFFIAFAPLLIQELLEKGAWKAFSRLIHHL
FT                   FSLAPLFEVFVCQIYARSLLTNVTFGGAKYISTGRGFAITRLDFPELYSKFANTSIYAG
FT                   SKIFLMLLFATVSMWQPALLWFWITVVSMCLAPFLFNPHQFAFTDFFVDYRNFIHWLSR
FT                   GNSKYERKSWIEHVRSSRAVFTGYKRKIVGDISEESASETRRAQISDVFAAEVIIPLLT
FT                   AGLSFTAYTFINAQTGVPSATATSAVIRLGIVTFLPIFVNFIVLFVCFQLSFFAAPLLS
FT                   LCCKKVGATIAAIVHGFAVVIYLITFEVMWCLEGWSFTRALTLLIACISIQNFVFKVIT
FT                   IFFLTREYRNNKSQLAWWSGKWFTTGIGWIAVLQPSRELFVKTIECSLFAGDFILGHLI
FT                   LFVQLPLVFTPFVNYWHSMMLFWMKPKSLISNKLAYTKKQKLRRRRIVQKYLPIHCLIL
FT                   FLFIGLLVAPFYTAKNLPLGPDTFKNSFLDGLIQPKSQDNNDTGTRAPSYILTTTPPMP
FT                   VFRTVR"
FT   gene            <821778..>822995
FT                   /locus_tag="KLTH0B09878g"
FT                   /old_locus_tag="KLTH-ORF14507"
FT   CDS_pept        821778..822995
FT                   /locus_tag="KLTH0B09878g"
FT                   /old_locus_tag="KLTH-ORF14507"
FT                   /product="KLTH0B09878p"
FT                   /note="some similarities with uniprot|P53334 Saccharomyces
FT                   cerevisiae YGR279C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09878g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21778"
FT                   /db_xref="GOA:C5DDB7"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB7"
FT                   /protein_id="CAR21778.1"
FT                   /translation="MRFSQVLSSASMIGASLASPLGHEHAEHKRAVAYVTNVQTTTVYG
FT                   TAPQQIGGASTTVSLDASNTLAQQAATQTSSLSEVSRGVAAVPSEATSTVSESSSSSSA
FT                   ASSTSVASNSAAASSSASASSSASASSSASSSSSQASSTASSSVGSGGAKGITYSPYSD
FT                   SGSCKSSSQIASELSQLSGFDIIRLYGVDCDQVSAVLQGKSSNQKLFLGVYYVNAIEDG
FT                   VNAIKDAINSYGSWDDVYAVSIGNELVNGGEATVSQVGSYVEEGRTHLTAAGYNGPVVS
FT                   VDTFIAVINNPGLCDHSDFMAVNAHAYFDYNTAAEDSGTWVMEQIERVWGACQGNKNVL
FT                   ITESGWPSVGQTLGKAVASKENQKSAISSIKSVCGNSVILFTAFNDYWKADGAYGCEKY
FT                   WGIFSD"
FT   gene            complement(<823250..>825040)
FT                   /locus_tag="KLTH0B09900g"
FT                   /old_locus_tag="KLTH-ORF14504"
FT   CDS_pept        complement(823250..825040)
FT                   /locus_tag="KLTH0B09900g"
FT                   /old_locus_tag="KLTH-ORF14504"
FT                   /product="KLTH0B09900p"
FT                   /note="similar to uniprot|P53333 Saccharomyces cerevisiae
FT                   YGR278W CWC22 Essential protein component of a complex
FT                   containing Cef1p has similarity to S. pombe Cwf22p putative
FT                   spliceosomal component based on computational analysis of
FT                   large-scale protein-protein interaction data"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21779"
FT                   /db_xref="GOA:C5DDB8"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB8"
FT                   /protein_id="CAR21779.1"
FT                   /translation="MSQEDQDVVILQKESWDHLKSYIKQCFRSLTRSSVVEEYRKLFAV
FT                   NILWGERLVVSSVLQKQSAGDSSEILAALTSLLNAHIPQLGELLIEETTSRFLNAFKTH
FT                   NSKGCYAMAALIAELFNYEVLHEILILQILHLLMEGVNVDSACLAMFVLSKCGRQLMLV
FT                   AKTAHDLAFESLRKFFQENKVERAVYRRFEDLFDLRKRNYPQLSKRIHLPDHETVTHTF
FT                   LLDLESSTPSSDESLEEFRYDRNFMEKESEIETLRSKLFALEGTDATPDEQRPAEDKTQ
FT                   SRELEMKKKIYLTLKGSLSGDEAAHKILKYKFPDSEKKAVVDILVTACSQETTYSKFYG
FT                   IVAERLCSSHKSWKAAFGQSFHDNYSAVDEFQANQVRNMGKFWGHILASDYLGFEVFES
FT                   VHMNANETSSAGRVYLKFLFQELVLDLSIDTLQARLDEPYIQPFLVNLFPKDDAEKSRF
FT                   SINYFTAIGLGRLTEGMRQALADMEKKVVALQDTEAESGSSLFSRRGSSSSPKTKAYIQ
FT                   GERASSETDNSHSLERSYRRPQDEEFSQTRYSESLTRSRTSVRRRSRTPTRRRSRTPTR
FT                   RRSRTPARRRSRSPNTRFGP"
FT   gene            <825139..>825996
FT                   /locus_tag="KLTH0B09922g"
FT                   /old_locus_tag="KLTH-ORF14503"
FT   CDS_pept        825139..825996
FT                   /locus_tag="KLTH0B09922g"
FT                   /old_locus_tag="KLTH-ORF14503"
FT                   /product="KLTH0B09922p"
FT                   /note="similar to uniprot|P53332 Saccharomyces cerevisiae
FT                   YGR277C Homolog to human PPAT"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09922g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21780"
FT                   /db_xref="GOA:C5DDB9"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB9"
FT                   /protein_id="CAR21780.1"
FT                   /translation="MPAVAITLSSYKETDQNLLDGVLEDILPLLVKEGSSLDIIIVEKI
FT                   HSVDYLDYVLGKLYSGTRETLLAEDLYDTPINVLFNQDLSSYVDKKWDLLITDKNEVVQ
FT                   LPHKELRKVRLLKEVNEHERQDSSKDDPLYMVSALGGTFDHLHDGHKILLSAAAFLTVS
FT                   RLIIGVTDQELLQKKQFREQLEPYETRSGNVRSFLSRIKPSLKVEIVALRDVCGPTGAV
FT                   PEIESLIVSRETVSGGQIVNNARRSKGLKELKVHVVNVLGGKEEDGWKEKISSTELRRR
FT                   CSLK"
FT   gene            complement(<826050..>829619)
FT                   /locus_tag="KLTH0B09944g"
FT                   /old_locus_tag="KLTH-ORF14501"
FT   CDS_pept        complement(826050..829619)
FT                   /locus_tag="KLTH0B09944g"
FT                   /old_locus_tag="KLTH-ORF14501"
FT                   /product="KLTH0B09944p"
FT                   /note="similar to uniprot|P50101 Saccharomyces cerevisiae
FT                   YMR304W UBP15 Ubiquitin-specific protease that may play a
FT                   role in ubiquitin precursor processing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21781"
FT                   /db_xref="GOA:C5DDC0"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR024729"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR029346"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC0"
FT                   /protein_id="CAR21781.1"
FT                   /translation="MSEKPAFQENVGELIDLGKGISDVLPELESQETECEGAFTWHIGN
FT                   WSQLKQDKHVSPRFRIGEYEWDVLLFPQGNHNSGISMYLEPHPEEKFNEEKQCLEPTDP
FT                   DWHVCAQFAIGISKPGEDTKCQLFNVSHHRFSATDTDWGFANYIELESLKRRTSSKNSG
FT                   FLSNGRLNVSVFVRILKDPTGVLWHNFMNYDSKKLTGFIGLKNQGATCYLNSLLQSYFF
FT                   TKLFRKIVYKIPSENESPNDSVLLALQRSFYLLQKSNETLDTLELTRSFGWDTGDAFTQ
FT                   HDVQELNRILMDRLETRMKGTEVEGALNELFVGKMKSYIRCINVDYESSRVEDFWDIQL
FT                   NVKNLKGVQESFDNYVEVEIMDGENQYAAQDYGLQDAKKGVVFESFPSVLHLQLKRFEY
FT                   DFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCVYNLHGVLVHSGEISVGHYYA
FT                   MIKPDVGDQWFRFDDDKVWRVTKEQAFDENFGHEPLPDDKLRSLTREQYQNYLIARQTS
FT                   AYMLVYIREDMEKNVLEDVSDTDVPQHIVTSIEKELKEREQKRKELEEMHLYTKVNIHS
FT                   MSNFVNYQGFDLSPNERSKLYSSELHDESEYASSLKILKTTKLRDVKSEISSKLNLPRT
FT                   HRVNYWIMSYRKNYTLRLDSILAPELDSLSLEQVIHKMGISRATAIDFFVEEPYLELAF
FT                   LNELLKANIIPPSRLTSESVLKIRKAAYEENFPESSKYLSSPEEDSPKVLVFLKVFDTE
FT                   VRRLEGFAHTLVNRTDKVSKLVELAGHFCSVNTTEFFYEEFQPDTIEPIEREMQFVASE
FT                   LVDGDILSFSTTQSRQNLSSQPPSLLEYYDYLRYRIKISLTRTVNAEEEYVATDESNND
FT                   GPLELWISAKASYQELAQKISQRTGISAHFIRTFAIYGNGRFALKWDCKISDFLVKNYT
FT                   RDSIPPFEYEVLSIPLKEFEHLRSIKFYWLSDSYVHYQLYEFRIANSCTIGEFMDKLQQ
FT                   RLHFDDEQKSKILIWTNCDFKFQGILSEENVFEELSESFLFFGRILPEELALVKQLEAS
FT                   SPENIDSMDETEEEDLSIVTKSANPTEGKLVIVIQYFKDLDNRHGISFLFNLLPNENCL
FT                   QTWDRLHAKFGLGHKEFSKIKLGITVSSEAGLTFKSFQNFTDQELSEIILFDVLNNLDY
FT                   ICMDHPDRTRTQTYHDRPMVIKN"
FT   gene            <831234..>833657
FT                   /locus_tag="KLTH0B09966g"
FT                   /old_locus_tag="KLTH-ORF14499"
FT   CDS_pept        831234..833657
FT                   /locus_tag="KLTH0B09966g"
FT                   /old_locus_tag="KLTH-ORF14499"
FT                   /product="KLTH0B09966p"
FT                   /note="similar to uniprot|P32843 Saccharomyces cerevisiae
FT                   YMR302C PRP12 Integral inner mitochondrial membrane protein
FT                   with similarity to exonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21782"
FT                   /db_xref="GOA:C5DDC1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018850"
FT                   /db_xref="InterPro:IPR034260"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039627"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC1"
FT                   /protein_id="CAR21782.1"
FT                   /translation="MLALLSRSLRPVRYGRVKPNILLPLKRQVSTEIQEKDEQAGESTT
FT                   ATDTGVIHKTEEETLIYFDNVYPRATSLWSPTQWYNILLTNQSRDAVRSKIMEFASPPR
FT                   NPIHGLELRSTIPVKRDGGVFATFLVPRDYSKAQVNSIIQQNTAKESSKSILSFVTRAA
FT                   AFPVKGSPWIEDLRRLPSTVIKIKFEGQPLTEEEIYSLFRRYGTILDIYPSKKGDTVAT
FT                   LRYRSYRGAICAKNCVSGMEVHNSTIHVQYQRLADEHMIRDFFVNHQRIAIPLMIALLS
FT                   IVAVLVFDPIREFSVRQKITHRFAFSRENYLIKELFKLTSFTVSSFKSLIGSENVETNK
FT                   KQLWEERIEKVSDLKMWLEENNNTFVIVRGPRGSGKHDLVIQHTLHDRPNVLYLDCDKL
FT                   IKSRTDSKFLMNAAAEIGYFPIFPWINSFTNVVDLAVQGLTGQKTGLSESKETQFRNML
FT                   TTALMAIRQVALKGYHPIVGRGDDAITMKEEDYLQQHPEKKPVIVIDRFNDKAEMNGFA
FT                   YKELSDWAAMLVQMNIAHVIFLTETVSPNQLLADSLPNQVFKTLILSDASKESARSYVL
FT                   ASLDHTEPLDDDQEKSKPIILSDDIKRELDESLEPLGGRMLDLQAFVRRVKSGENPKEA
FT                   LDKMVEQALEQITQIFLAENVDQVKSAQAWELIEMLSKEPVVEFKNVVFRPLFKSAPEA
FT                   GLLELEKNGLITVSRDRGVLKDIRPAKPLYRAAFGYLLNDSELFTVLETGYLLRIINFE
FT                   TKRIQKWEEELKSLGKVSEHRMFKSRLLYLAAKIDASSDSINKCEDKIKALARS"
FT   gene            complement(<833923..>834025)
FT                   /locus_tag="KLTH0B09988r"
FT                   /old_locus_tag="Klth0B.tLeu.CAG.10"
FT   tRNA            complement(join(833923..833966,833989..834025))
FT                   /locus_tag="KLTH0B09988r"
FT                   /old_locus_tag="Klth0B.tLeu.CAG.10"
FT                   /note="tRNA-Leu (CAG) cove"
FT   repeat_region   complement(834084..834345)
FT                   /locus_tag="KLTH0B10010t"
FT                   /old_locus_tag="Klth0B.LTR.3"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <835039..>838875
FT                   /locus_tag="KLTH0B10032g"
FT                   /old_locus_tag="KLTH-ORF14497"
FT   CDS_pept        835039..838875
FT                   /locus_tag="KLTH0B10032g"
FT                   /old_locus_tag="KLTH-ORF14497"
FT                   /product="KLTH0B10032p"
FT                   /note="highly similar to uniprot|P28273 YKL215C
FT                   Saccharomyces cerevisiae Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10032g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21783"
FT                   /db_xref="GOA:C5DDC2"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC2"
FT                   /protein_id="CAR21783.1"
FT                   /translation="MSKIRIAIDRGGTFTDCIGNPGTGKPQDDVVIKLLSVDPKNYPDA
FT                   PLEGIRRLLEIFQKKKISRGVPLDLSDVESLRMGTTLATNCALERNGERCVFVTTKGFK
FT                   DCLLIGDQTRPRIFELAIKRPDPLYDVVIEVDERVTLEDFSEDPENVKSQPSANEGVIV
FT                   GKSGEIVRVLRKPDISTLRTALEAAFAQGIRSVGIALLHSYTFPEHEELVAALASEIGF
FT                   THVSLSSQVSPMIKYLPRANSAIADAYLTPVIQKYLSGMQAGLINTDNTNIQFMQSDGG
FT                   LVEGSKFSGLKSILSGPAGGVVGYSATCYDPVTKIPLVGFDMGGTSTDVSRYGDGKLDH
FT                   VFETTTAGIVIQSPQLDINTVAAGGSSRLFWENGLFRVGPESATADPGPAAYRKGGPLT
FT                   ITDANLLLGRLVPEFFPKIFGPNEDESLDMDITKKKFEELAETINRDLGTRFSTDQVAY
FT                   GFIKVANESMARPIRSLTEAKGHVISSHQMVTFGGAGGQHAVAVAESLGIDTVIAHRYS
FT                   SILSAYGMFLADVVEETQEPCSLVLENTSTCIKVEERFEAMTGKATDSLLKQGFSEKDL
FT                   SFEKYLNLRYEGTETSLMVLKDKSSWKFSQDFAKAHKREFGFIFSDRNIIVDDIRIRAV
FT                   AKSPVRSQTSIEEELARSLISEIDVEKEVAFYKDVFFDDRRMKTPVFQIDNMPVGSRIK
FT                   GPCILADGTQTNIIPCNATATILSSHIVIKITSRSQESDTKLENRVDPVLLSIFSHRFM
FT                   DIAEQMGNQLRKTSVSTNVKERLDFSCALFDPEGNLVANAPHVPVHLGSMSTCISAQAK
FT                   LWKNKLKPGDVLVTNHPEMGGTHLPDITVITPAFSETSGKIIFYVASRAHHADIGGILP
FT                   GSVPPNSKELYEEGAAIYSELLVKEGRFDEELVIKLLVDDPAQYPGCSGSRKISDNMSD
FT                   LKAQIAANNKGVQLIAKLMTDFGFDVIVKYMLAIQENASFTVKQVLKRMTEHFGATEFA
FT                   GEDYMDDGTVIKLRVTLDTKKEEYVFDFEGTSPQVYGNLNAPEAITNSAILYCLRCLVN
FT                   EEIPLNQGCLKPITVKIPKGSILSPTKGVAVVGGNVLTSQRVTDVVLKTFKVMADSQGD
FT                   CNNFTFGTGGKDSNGKVSSGFGYYETICGGHGAGGDSWRGPGWNGAHAVHTNMTNTRMT
FT                   DVEIFERRYPVILREFSIRAGSGGKGKFAGGNGVVRDILFRKAVQASILSERRVVPPHG
FT                   FDGGEDGERGLNLWIRGSSGAVINIGAKNTISAQPGDRVIIMTPGGGGWGLPE"
FT   gene            complement(<839166..>840677)
FT                   /locus_tag="KLTH0B10054g"
FT                   /old_locus_tag="KLTH-ORF14493"
FT   CDS_pept        complement(839166..840677)
FT                   /locus_tag="KLTH0B10054g"
FT                   /old_locus_tag="KLTH-ORF14493"
FT                   /product="KLTH0B10054p"
FT                   /note="weakly similar to uniprot|P53322 Saccharomyces
FT                   cerevisiae YGR260W TNA1 High affinity nicotinic acid plasma
FT                   membrane permease"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10054g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21784"
FT                   /db_xref="GOA:C5DDC3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC3"
FT                   /protein_id="CAR21784.1"
FT                   /translation="MAIGLVKTVQMETTHSVATKDPIKVSIHDDAELSEELAEHVIEEE
FT                   YYIDPQDESALTRKLDTRLLPMLAFMYFLSALDRSNIGNAYTSGMKEDLRLTSHQYSNA
FT                   VSVFYSTYLAAELPAVWLLKIAKPRYYMSILVFCWSVITLSSGFVKSYHSLLATRILLG
FT                   TFEGGFFPAMTLLITMMYKPKEQAKRIAFFFGSSALSGAFGGLIATGLASVNNAGGLEG
FT                   WRWLYIIEGLISVCASFWLFFGLPDNLDKMKFLNERELSLMQIREKQRIQYMGADPAFS
FT                   WGQVWLAFKDFKTYFAFVIQFCQDIILYGFSTFLTAILKLGLGYSSREAQYMSVPVYIL
FT                   AAIVFMVSAYVSDRLQVRGPVFFCYNILGATGYIILLAVDNNAVKYFACYLITFSLYTG
FT                   TGLNITWLTNNVAPHYKRATALGLNQTLGNLSGAIVGQVYTKSPYVFGNSFSLGCIVLS
FT                   NILTAVQIAWLVKLNKDKAAILAGTKKDTKKERIGDEALDFKYCL"
FT   gene            <841024..>843090
FT                   /locus_tag="KLTH0B10076g"
FT                   /old_locus_tag="KLTH-ORF14492"
FT   CDS_pept        841024..843090
FT                   /locus_tag="KLTH0B10076g"
FT                   /old_locus_tag="KLTH-ORF14492"
FT                   /product="KLTH0B10076p"
FT                   /note="some similarities with uniprot|P25502 Saccharomyces
FT                   cerevisiae YKL015W PUT3 Positive regulator of PUT (proline
FT                   utilization) genes zinc-finger transcription factor of the
FT                   Zn(2)-Cys(6) binuclear cluster domain type"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10076g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21785"
FT                   /db_xref="GOA:C5DDC4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC4"
FT                   /protein_id="CAR21785.1"
FT                   /translation="MPRKKMMKACIKCKQRKKKCSGQLPCDYCVKIEQPGGCEYRTRTK
FT                   SKVVKVTERYISSLKNKIRALEAELAKASEGPDSEGCLEDGATSAEVNPLIEPEFRLTP
FT                   DLDSPKQESLTIGSVEHCVQASQHSKQFLGMSSCVQYLAKLKQSLVNSCGSSTEHFVAT
FT                   DGGWPPNDLDINRSFVENVATKELPDLRKAKELIEIAHEIIGADYMFLETGYFEDTAQH
FT                   LICKNPPPLQSEAIIEYTTELLRLVAHLALGSLFDKENAESRSLGLKYHRTTLLLYSEL
FT                   VKTYDCAASTSLILSLLYMAYFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTKTIVENR
FT                   VFWLCFIYDRLLAVRFGFPLMIDERNINIPLLTEVDDNLTAVSLDIYHFVSQVRLAKIT
FT                   TQIITKIYTRNPYSFLHNCHAVLKQLKNWFESLPAELKFDYNDIKTATTRSTFNLHINY
FT                   NYSIIIATRPVLLYVFNSILTENRTKEKIYEARQLELISVLLESCVQAAEIQSRILAKL
FT                   YYDGKLANRSFLDCHYIFSATTVLILTGYCSMLSGESIAFSGDIEGLFDFIQHNLKILQ
FT                   GLSEYNLAAKNFNKQLTELIDMMSSDEVVKALATGRSQNDPTSVDFQQAVASPRPMSRI
FT                   LRKRGNNPPKDFEEIGYVDLSQLVNNMDAEFRSGSTTDLFLDEDFMNYASGSL"
FT   gene            complement(<843319..>844122)
FT                   /locus_tag="KLTH0B10098g"
FT                   /old_locus_tag="KLTH-ORF14491"
FT   CDS_pept        complement(843319..844122)
FT                   /locus_tag="KLTH0B10098g"
FT                   /old_locus_tag="KLTH-ORF14491"
FT                   /product="KLTH0B10098p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10098g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21786"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC5"
FT                   /protein_id="CAR21786.1"
FT                   /translation="MSNPESFRELCRKEIHTGPTSGVLPGYIQANLLILPKCVAESFED
FT                   LCTRNPVACPILSKTEGGPQFLRNHASLIKQGTFDIRTDFPRYNVYSRGKLVQQKNNCV
FT                   NEWSSDHVGFLIGCSFTFEHALEKAGLVPKNVLYNKNVSMFRTTKFLDSAGIFHQCPYV
FT                   VSMRPYKLTEVEIVREITRKFKKTHGEPLDWGYDGAKRLGIEDLQKPDYGDPIDIGEQE
FT                   IPMFWACGVTPQLAVTTVGDRIEGSVIGHTPGHMLILDATDVDWC"
FT   gene            <844878..>845986
FT                   /pseudo
FT                   /locus_tag="KLTH0B10120g"
FT                   /old_locus_tag="pseudo-Klth0B-844878-845986"
FT   gene            complement(<847376..>849082)
FT                   /locus_tag="KLTH0B10142g"
FT                   /old_locus_tag="KLTH-ORF14487"
FT   CDS_pept        complement(847376..849082)
FT                   /locus_tag="KLTH0B10142g"
FT                   /old_locus_tag="KLTH-ORF14487"
FT                   /product="KLTH0B10142p"
FT                   /note="similar to uniprot|P36172 Saccharomyces cerevisiae
FT                   YKR105C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10142g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21787"
FT                   /db_xref="GOA:C5DDC6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC6"
FT                   /protein_id="CAR21787.1"
FT                   /translation="MSDIETGIHSDRDRKISGESDDLSLKHKRCITLDRPKINKVKLFL
FT                   SLFSLGLSMFVTALDVLIVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARLSA
FT                   VLGPRISVVSCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQLVDE
FT                   KSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTWRWCFYINLPIGGLAIAIFVFFYNPE
FT                   GVNLLEKFGNTFKKVSSFHPVKKSPKKVLQQLLFGFDILSFISFTAGWLLFLLALTFGG
FT                   QTHAWNSGIVISFIIIGVLLIAISLVYDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSN
FT                   FTGFFSTVAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGILTKKTGH
FT                   IKPLLVFGSAMGVLGGGLMTLLDNKSTKHTQIGVLILPGVALGFVLPSALIACHVQLDK
FT                   GNPSYGADLLETTSVNALLKSLGTTLGSILSTMVFSTSMNNKMKHGGLSLEEYDRLDGI
FT                   ASYRMDHFDGPRSEMGYILSDSIKNAFWMALGSSAIAFLCSIFVSKRKIAM"
FT   gene            complement(<852039..>852989)
FT                   /locus_tag="KLTH0B10164g"
FT                   /old_locus_tag="KLTH-ORF14483"
FT   CDS_pept        complement(852039..852989)
FT                   /locus_tag="KLTH0B10164g"
FT                   /old_locus_tag="KLTH-ORF14483"
FT                   /product="KLTH0B10164p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21788"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC7"
FT                   /protein_id="CAR21788.1"
FT                   /translation="MMFAAFSPSKIAMYRFFVFGLSFLAIAASFPLYKRADLDVDILQF
FT                   ALTLERLENKFYKEALSMWSVDDFVDANFTEDFYTQLKYIAHDEEAHLLFLEQVIKAAG
FT                   AEPVQACTYNLPLDSPVSFVQSIAAFEGVGVSAYLGAASLISSKKYLTAAGSILSTEAI
FT                   HQAAARNAIGEIPMANPFATPLSANAIYSIASKFIKSCPANNTKLPFKAYPELLVTQGL
FT                   PTAMNSSITFASNGTLPNSTQIYVTFVSGLDVIPVVGSRNGSSIRATVPEDVSGQSYVF
FT                   LTTGNSSNLTDSNILYGPAIIEVTPSSPTFNVSIF"
FT   gene            <855907..>857637
FT                   /locus_tag="KLTH0B10186g"
FT                   /old_locus_tag="KLTH-ORF14479"
FT   CDS_pept        855907..857637
FT                   /locus_tag="KLTH0B10186g"
FT                   /old_locus_tag="KLTH-ORF14479"
FT                   /product="KLTH0B10186p"
FT                   /note="highly similar to uniprot|P38361 Saccharomyces
FT                   cerevisiae YBR296C PHO89 Na+/Pi cotransporter active in
FT                   early growth phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10186g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21789"
FT                   /db_xref="GOA:C5DDC8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC8"
FT                   /protein_id="CAR21789.1"
FT                   /translation="MTLHQFDYIFAIAMLFAFLDAFNIGANDVANSFASAISSKSLKYW
FT                   QAMILAGLCEFLGAVLAGSRVSKTIKNDIIDASTFNNDPAVLMLTMTCALVGSSCWLTI
FT                   ATSIGLPVSNTHSIVGGTIGAGIAASGAGGVVWGWDGVAQIIASWFIAPVLAGLIAAII
FT                   FTISRICVLEVKTLEKSIKNALLLVGLLVFATFSILTMLIVWKGSPNLHLDNLSETETA
FT                   LSIVLTGAIASVVYFIFFYPFYRRKLLHQDWTLKLADILRGPVFYFKPLDEIPPMPENH
FT                   QLTIDYYEGRRFPQETAVGVSDEENKMPNVSTKSINDNDDNLQRTGSVETKTEPENKMS
FT                   TRQYWWSLLKQGPKQWPKLLWLVVSHGWTQDVVSAQVNDKDMLSGNLVDMFKRSKYYDN
FT                   RVEYIYSVLQAITAATMSFAHGANDVANATGPLAVVYEIWKTNATAAKSDVPVWVLAYG
FT                   GAALVLGCWTYGYNIIKNLGNKIILQSPSRGFSIELAAAITTVMATQLAIPTSTTQIAV
FT                   GGIVAVGLCNKDVKSVNWKMVAWCYSGWFLTLPIAGLIAGILNGIILNAPHFGGVYEMT
FT                   "
FT   gene            <857838..>859700
FT                   /pseudo
FT                   /locus_tag="KLTH0B10208g"
FT                   /old_locus_tag="pseudo-Klth0B-857838-859700"
FT   gene            <861584..>862198
FT                   /locus_tag="KLTH0B10230g"
FT                   /old_locus_tag="KLTH-ORF14472"
FT   CDS_pept        861584..862198
FT                   /locus_tag="KLTH0B10230g"
FT                   /old_locus_tag="KLTH-ORF14472"
FT                   /product="KLTH0B10230p"
FT                   /note="some similarities with uniprot|P36034 Saccharomyces
FT                   cerevisiae YKL219W COS9 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21790"
FT                   /db_xref="GOA:C5DDC9"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC9"
FT                   /protein_id="CAR21790.1"
FT                   /translation="MKGERAEEHLIQTPHVDDQNLRLPRDTFPNRFLYEISRHRTFVIA
FT                   VSSELILYAFSIYRGLTSKDRDIGFLIALFMIVLGSTGIILTGIITICLLNDCGTDPSN
FT                   TLHFMKEIVAVGLQMEMREWDIIAARMNRVFYLNNSWATPYFFYDGEACHSFFKNYYLK
FT                   HYSRGEKTSGTNTYGLEEFQPFVDQAVEAYKKSETRMCSPF"
FT   gene            <863070..>863741
FT                   /locus_tag="KLTH0B10252g"
FT                   /old_locus_tag="KLTH-ORF14470"
FT   CDS_pept        863070..863741
FT                   /locus_tag="KLTH0B10252g"
FT                   /old_locus_tag="KLTH-ORF14470"
FT                   /product="KLTH0B10252p"
FT                   /note="some similarities with uniprot|P36034 Saccharomyces
FT                   cerevisiae YKL219W COS9 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21791"
FT                   /db_xref="GOA:C5DDD0"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD0"
FT                   /protein_id="CAR21791.1"
FT                   /translation="MMREERVEEYSLHASQEDDQSLTLPRDIYPNKFLYQISRHRAPLF
FT                   ATSLELVLCTLLIRYFMKKNDSSARFEAVSSVVSFGLPLGLSLFSGMVHLVHNCGKAPV
FT                   NRVRFMEEIIAVEPGTETRKWDSIAARLNAIFYSNNSLATPHFFYDGNACYFYFRLHYV
FT                   RPLFEKKESSYAFREFPDEFKALIHQAMEAYKKGLDKDWQRLLNTGSSLGIRASTSEKM
FT                   T"
FT   gene            <865279..>865761
FT                   /locus_tag="KLTH0B10274g"
FT                   /old_locus_tag="KLTH-ORF14468"
FT   CDS_pept        865279..865761
FT                   /locus_tag="KLTH0B10274g"
FT                   /old_locus_tag="KLTH-ORF14468"
FT                   /product="KLTH0B10274p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21792"
FT                   /db_xref="GOA:C5DDD1"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD1"
FT                   /protein_id="CAR21792.1"
FT                   /translation="MARKFISGDDLAAIRIFIVSLGMAGTAITGAIIEGRVESVILMPS
FT                   NKVQFMKEIAILGPGLEMKKGGVVAAKMNPVLHKSSLLATPYYFYDGESCYSCFRNEYL
FT                   HPYLRRKNTNDTQAYIVDEFKPFVDQVLKSYEESLNKDLQHMLEEEISVESQHIKL"
FT   gene            <867082..>867360
FT                   /locus_tag="KLTH0B10296g"
FT                   /old_locus_tag="KLTH-ORF14466"
FT   CDS_pept        867082..867360
FT                   /locus_tag="KLTH0B10296g"
FT                   /old_locus_tag="KLTH-ORF14466"
FT                   /product="KLTH0B10296p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21793"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD2"
FT                   /protein_id="CAR21793.1"
FT                   /translation="MVKPGIDMRKWDFIAAKMNANLYQNNSLISPYYYYNGEACYCFFK
FT                   AKYLLPHLERKGANSTGEMPLYDLEPFYGQILDAYEERTKKEWQHIL"
FT   gene            <869187..>873833
FT                   /locus_tag="KLTH0B10318g"
FT                   /old_locus_tag="KLTH-ORF14463"
FT   CDS_pept        869187..873833
FT                   /locus_tag="KLTH0B10318g"
FT                   /old_locus_tag="KLTH-ORF14463"
FT                   /product="KLTH0B10318p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10318g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21794"
FT                   /db_xref="GOA:C5DDD3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037240"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD3"
FT                   /protein_id="CAR21794.1"
FT                   /translation="MEKISDRFAAIDGFLVKKDKSGLRRIVNTISTTFKPNKQEARCIE
FT                   KLQLRNLALYFDCKDDLLPHDCPLLFKTVSSKRKLFYHTEDGIKVVKSGKTSSRDMRRA
FT                   IEHAVIEIPLSGSQKKYLVDCQDGIDQRLWREGRAMAPLQNSNNSHITRTLACDTLLFT
FT                   PQDYALLRSFALEKVLYEAESISIFEHCHRKALQNLEEKGQGDLLEEKITGKQFHLLLQ
FT                   KNTVRAYGRIMSSLYFILVNFHRLSLSTRVADPAINRALLLDSIGCSYNVESKASHLQE
FT                   IMCIMLKNTDHASLLQLLARMLPFNLEGYVDKNQTLGYYETEEICERLVAMRTWVKYVA
FT                   LSAKTGDEEVIFLENDPASTWGVLSSYYREIARESKKLDLATLRFISRDIVCVSGKTFG
FT                   RCYIRDFYSGLEQRFDALWMQLNKYYSVRSIQAVEELLFYDESMSLSEGKSCPYFSFEN
FT                   VFPMDVRRSLLPRGRKALTEAEQRVVLDTIEEMTRAVMWITWLAAGTPYAFAELQDLAY
FT                   AGERRNVYVDEDFRRIKLATCYNQNGDILYLVKWLDSHTSSYLAFLILVISKIQLELLN
FT                   EMRSIFDHPRHNEMRHSAANIRSSKYTTPMKKTCKALLSEFLFVDASQAKLVSEKRFQE
FT                   VCKEYPKRTAPLERLNFPQLRQGMTALVQRKLEGHRSQAGAAHPSTSAYLADHWPKMGT
FT                   GMYGLDSLLLESLQGPTAYMTQRELSEQWNLSMDLGVNTEDEPQSTGNTLKGGLQRAGL
FT                   VPDDLFLAGRMLYGEQFAFRNTDQTFACISAYMSDEKVIAVQAPTGFGKTLVFQLPLIC
FT                   YAMKKLQTVSFVFVPDAALVAATTHRLRSKSCLRVGSVEFLIHKGLVGDDPFQDVYVGT
FT                   FSDAIDHRLIELMKHWKEQFPETQLGLLVFDEFQNLPDVESYCKTPLHLPKDIDIEQFQ
FT                   RLILTTATGSQGSSEKALRELGLKGRLEIQPVWGDSEGDTCFVTAPIRFRNYIREPALA
FT                   HVYKHAILMEGDGTGQVMVLLRRLFEKDSKAKVAIVLGQEANTGSLFNRVAKEFTSVCV
FT                   GKELDKTEKAMKMQSFLLDKNVQVLMGPKLAVEGIDVAELRMVILLDYQPSVGEYIQCA
FT                   GRVRNSGVSIALWRKAPQRGNNDLSSIDYSRCFTSQICEFYELPQQVHAGCCKHFDSVS
FT                   EETRDIFEYVAIELEPADTQQKRKHTDGSPHSSKRLCSPHNPEVPGSRPTTNLELQATD
FT                   KSQQLTKAERLEISCRGCRDIFEYFEFSDDRRRDLLMEGLDERYFGNISIFNVNSELEC
FT                   RWCLEPKRGCCCWPESPACEDMSLKKLAMQALAFLGCFLTPKGYTEEVAFCENYGVATW
FT                   MMLLETRIKKEVFTRYYTAYKDYHDLVRRRMEYFYGYEGDRYIDDYNEMWRMLQKKELI
FT                   VYFSTRKIQECPMGGCCADCVKIAVEDDDPPWCRDYPISKGYLQAQMESTDEDAYLCSE
FT                   NMAMRLRGSPPVLGFHYKLMQFVLFHNKDFRDAIWERFPQLPQVGMFTHWLRLMKTEWI
FT                   FDGVPVPLYAVVGAIFYRQNPYYLHDAL"
FT   gene            <874656..>875879
FT                   /locus_tag="KLTH0B10340g"
FT                   /old_locus_tag="KLTH-ORF14454"
FT   CDS_pept        874656..875879
FT                   /locus_tag="KLTH0B10340g"
FT                   /old_locus_tag="KLTH-ORF14454"
FT                   /product="KLTH0B10340p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21795"
FT                   /db_xref="GOA:C5DDD4"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD4"
FT                   /protein_id="CAR21795.1"
FT                   /translation="MSIVWVGAIRKNAQQDIMLKKLCLGLLALATTTLCESISRDVTTT
FT                   TVIAAVSSSSSSLTVATPGTPVSPKVLLIANEFEFGYLDAYNFTTQYTGVLFDQTFACT
FT                   EDGAICKLECGQELVSASQITALMMIPGVDLKKTYVIITGTGGVNPKYGTAGGAAISTF
FT                   GIQWEWGSMFLGDDLPANFSGQYFASYAQLSPDKYPVTVGSEVYKLNEALVDRFYATGS
FT                   KVTYEDVSETSQGLRATYEYDAAKQDPFLARCDTVSAQVYWHGNVAGENVEYYSNVITN
FT                   GQARPCNTNEDDQGRLLALFLGAVHHMVDFGRVSMIKAFSNFDRPPPQLSAYQSRFYVG
FT                   EGATEPGLRNAWKSIIVIVDDVLENWDSVFDAGIKPNTYMGDIKGTLGGVCDFNSTASA
FT                   AKGSVQGS"
FT   gene            <876403..>876512
FT                   /locus_tag="KLTH0B10362r"
FT                   /old_locus_tag="Klth0B.tPro.TGG.9"
FT   tRNA            join(876403..876438,876477..876512)
FT                   /locus_tag="KLTH0B10362r"
FT                   /old_locus_tag="Klth0B.tPro.TGG.9"
FT                   /note="tRNA-Pro (TGG) cove"
FT   gene            complement(<877070..>878725)
FT                   /locus_tag="KLTH0B10384g"
FT                   /old_locus_tag="KLTH-ORF14452"
FT   CDS_pept        complement(877070..878725)
FT                   /locus_tag="KLTH0B10384g"
FT                   /old_locus_tag="KLTH-ORF14452"
FT                   /product="KLTH0B10384p"
FT                   /note="similar to uniprot|P15365 Saccharomyces cerevisiae
FT                   YJR152W DAL5 Allantoin permease ureidosuccinate permease
FT                   expression is constitutive but sensitive to nitrogen
FT                   catabolite repression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10384g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21796"
FT                   /db_xref="GOA:C5DDD5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD5"
FT                   /protein_id="CAR21796.1"
FT                   /translation="MHILIKLKIPTLAAISKNCINWTFVFHFYPQQSSPSSFPLTRFHT
FT                   TMSSTKQEGEVVTSVLSSEQAAELYDVKSRDLAMEKADEAAQLEVDPSSNRRLVWKIDL
FT                   ILLTVISLVSAFQYMDKSSSNYASVMGIKTDLKMVGNQYSWVGTSFYLGFLVFEAPCSW
FT                   TLQRLPLSKITSAYIIAWGLLLCLTSLVKSYPTFILTRTLLGVLESSITPAMVLFMSQW
FT                   YKKDEQFFRTSILIACNAVGGLVGASVSYRLYERQLAGTLSMDAWRILFIIVGLITIVT
FT                   GLMVLFIIPDTPSQAWWLNKTEKLLAIQRIRSNKQGFGNRHFKKEQVYEALVDPRLYLY
FT                   FFLQVAVAIPNGGFSNFSALMIAGLGYGKGKALLMGMPTSAVSIIGMILFGYLSTIRNR
FT                   RLDIAFAGLALNLISGCLMAFAKPLHAQLAGYYIFGISPIPYTCILSMVASNSAGHSKK
FT                   VFMGAISMIGYCTGNLIGPQTFRESQAPHYQGAKTAIVACYCIAFLILAAIYIVNVREN
FT                   KRRDALDERLPADMLNSEFADLTDFQNPEFRYAI"
FT   repeat_region   879953..880369
FT                   /locus_tag="KLTH0B10406t"
FT                   /old_locus_tag="Klth0B.LTR.4"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <881360..>885136
FT                   /locus_tag="KLTH0B10428g"
FT                   /old_locus_tag="KLTH-ORF14447"
FT   CDS_pept        881360..885136
FT                   /locus_tag="KLTH0B10428g"
FT                   /old_locus_tag="KLTH-ORF14447"
FT                   /product="KLTH0B10428p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21797"
FT                   /db_xref="GOA:C5DDD6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037240"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD6"
FT                   /protein_id="CAR21797.1"
FT                   /translation="MEKISDRFAAIHGFLIKTDRDGTKRITCPNISSLKPTKKEVQRIL
FT                   ELKLQNLAVYLGMKEDLIYVDCPLLFETVTSEQRYFYSTEDGMKAVRSGRTNSANTRRS
FT                   IEYRVLPITLPNKTRKYLCQTGKKLPEMPLEHEIATLHQESEAKTATVPQASEDLDVFH
FT                   TLHCDKLVFTNRDRRLFRSFAMDRTLYEVESVAILKHCHREAISKTTKTNSFGEPLVTK
FT                   YKLETLEIHGKHAGVLLFLIANLHQLSLGQQVERPTVDSELLLDRIGELHNTEAKAAHL
FT                   QQLLYIVLKEERYMDLANLFTRLLLFRLSAHFDIRKDLEVEEMETVRERMSATGVWIKC
FT                   VIISEKSEDQLNIFQEESHNIWSKFTTLYHKVAKESDQTMTMNINRVPPDCIRVYGKTF
FT                   GREYIKSFYSDMQYEFDQQWSKLDRVLTMTPVESTGKMLLENYRIPWAGHGYRANFSLK
FT                   DMFPQWIHDQVSPSMRQPLTQLDKREVLGAIDKMTVALMWMIWLAAGVPYTFSELQVLA
FT                   CGGDQQNIYVDSERRCVQIITRSFKKGNLKEDFKWLDKRTSYYLVYYVTVLRKTQISVL
FT                   GENYEAFEPPKEGEVDLEGIWEHIEGKCNMSKKEASALIMDQYLFLDAKLGQLMSRRRF
FT                   LKPSEEHPNYVASPERLSFKQLKFGRMGLLRQYLASSLNDSKPVKTARIDLAMCRFAAS
FT                   SARDYMDELGDSEDVDDPDAMGDLEVLEESMWQCEQSERFMTRTWHEEIAKQWIRWVGL
FT                   DEEEEIHHPLTYSVGEIVLQKEALCPDDLVHAGRELYGKSFTFRNSDQYLACVNAYLSN
FT                   KKIIAVQAPPGLGKTLVFQLPLMCYTMRKLSLVSFVFVPFVGLLAGTMCRLEASGNLRV
FT                   GSVEKLLNETRCKENSLLDVYVGTFNDAAAEDFIKMINFWSLLYPEKKLGLLAFDEFQN
FT                   LYDEKSHSEVSFPSLKRVQFGRFRRIILTSATCEQGSAQGALQELGFRGREGTNFTWER
FT                   SQAGRSVDVPIFLRNYVQEPAVMHVYKHALRMRGNGVGQVKQFLRSLFAYDPDAKAALV
FT                   VGENVATTELFTEVSQEFSAAYVHSDLTTEEKLKRVQSFIKDKSLQLLIGTKQVVEGLD
FT                   IEGLRMVILLDYYPRVAEYIQCVGRVRGSGTCIALWQDPPPQVENDQPRVDYDKCFTSQ
FT                   ICKYYELPQRVHAGCCGSFESVTEEAKSLFHRVVLEEEVNDVCSQKTTRDEDSEQGRER
FT                   KIARTDVIASADDSNEVSGVNKRPQDDTAITKA"
FT   gene            complement(<885429..>887291)
FT                   /locus_tag="KLTH0B10450g"
FT                   /old_locus_tag="KLTH-ORF14444"
FT   CDS_pept        complement(885429..887291)
FT                   /locus_tag="KLTH0B10450g"
FT                   /old_locus_tag="KLTH-ORF14444"
FT                   /product="KLTH0B10450p"
FT                   /note="similar to uniprot|P38724 Saccharomyces cerevisiae
FT                   YHL047C ARN2 Transporter member of the ARN family of
FT                   transporters that specifically recognize siderophore-iron
FT                   chelates responsible for uptake of iron bound to the
FT                   siderophore triacetylfusarinine C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10450g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21798"
FT                   /db_xref="GOA:C5DDD7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD7"
FT                   /protein_id="CAR21798.1"
FT                   /translation="MPEYQQGGPSLGSESTPNENYGKANVVQTEKEFSHDSKNEPELGD
FT                   KLQITKRIVIRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQ
FT                   THSLLSTVSVISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRY
FT                   AAGSIFYYIGLVGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPE
FT                   KNWSWGIAMWAFIFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQ
FT                   LFWKLDVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLLVPFFIYWESK
FT                   LALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSL
FT                   YSFVAAVFSPVVGIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVV
FT                   WGITSCFFNYPINISMQTVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRL
FT                   LKALGDPTLALEAYNMPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLL
FT                   TFFLRDPPLTEDYGQKLEDDEYVKHDDPITDWIAERFSSFKKHE"
FT   gene            <888176..>889927
FT                   /locus_tag="KLTH0B10472g"
FT                   /old_locus_tag="KLTH-ORF14441"
FT   CDS_pept        888176..889927
FT                   /locus_tag="KLTH0B10472g"
FT                   /old_locus_tag="KLTH-ORF14441"
FT                   /product="KLTH0B10472p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21799"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD8"
FT                   /protein_id="CAR21799.1"
FT                   /translation="MKIQSVCVLFLVLCLVEPSSLNQSRRKYASKSQTLFQTANTTTHL
FT                   SSQIESDGLLLINSRSNVSLGYATIDQLQDYLSNGSLSSQDLVRYYLQRFQQLNPHVKG
FT                   ILQLNPDALKIAKERDEERTQGLVRGPLHGIPFLVKDNYATKDKMETTCGSWSLLGSVV
FT                   PRDAFVVAKLRDAGAVLLGHTTLSEWADMRSSCYSEGYSARGGQARCPFDLSVSPGGSS
FT                   SGSAVAVAADMVTFSLGTETDGSIIDPAMKNGIVGFKPTVGLTSRAGVVPESEHQDSTG
FT                   PMARTVRDAVYAFQYMWGVDERDVYTLNQTGHVPQDGDYVKFLSDKESLKGARFGIPWQ
FT                   KLWTLAEENEISRLAEVIKMIESAGATIYNNTNFKNLDVVSSSGWDWNMGPANESEFTV
FT                   VKVDFFNNIESYLSELENSDMRSLKDIVEYNNRNYETEGGTENTHHAFQSGQDSFMESL
FT                   SWGGVQNETYWQAVEFVQKTSRGEGIDYALNYTDPETGENFNLDGLLVPSGLPITHQQA
FT                   AKAGYPMITLPVASKESNGRPFGLGIIQSAWEEPKLIKYGSAIEDLLNYQLKPWSNDNL
FT                   DKNISTT"
FT   gene            complement(<890670..>892271)
FT                   /locus_tag="KLTH0B10494g"
FT                   /old_locus_tag="KLTH-ORF14438"
FT   CDS_pept        complement(890670..892271)
FT                   /locus_tag="KLTH0B10494g"
FT                   /old_locus_tag="KLTH-ORF14438"
FT                   /product="KLTH0B10494p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21800"
FT                   /db_xref="InterPro:IPR039535"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD9"
FT                   /protein_id="CAR21800.1"
FT                   /translation="MKLKCFCTISLAASFVAADWQFKSRPDLSPPILNIAIPANQNTSP
FT                   GYLFAAPFSGYADNKNHGPRQAAPYIFTDKGELVWSGFSYFSIWATNFQKGRLNGEDIL
FT                   FSFEGSHNPDYGHGHGHVTILDSHYQTIKELRAGRHKIIDKHEFHIIDEKTGLVQIYQP
FT                   VPRDLTLYAKSEEQQWIVDAIFQEIDIESGEVLFEWRSLDWISPDESILPINEGQAGSG
FT                   FNSSDAWDYFHINSVDKNEEGDYLLSARDAAALYKINGTSGEVIWKLGGLPELSSDFKI
FT                   DFQFSFQHHARFISRNGSKEVISFYDNSAHGTENKDGKTVSYAETSSGKVIEVDNKEFT
FT                   AHLLREFLPPDGLLSKSQGSTQVLSDGHVIVNWGSKGAVTEYNSKDEAVFHAYFDSDLL
FT                   GENVENYRAFKFNWIGEPDEDISLYSEISADGEASIYVSWNGDTKTQKWRFFELDEEGE
FT                   KQIIGATTRKGFETAFKTNKIKLSNKVLVEALGERGEVLGVSDPTLSQKEIIPAGGKKV
FT                   STKNSFSNYFEWRMWQ"
XX
SQ   Sequence 893706 BP; 235205 A; 212749 C; 212390 G; 233362 T; 0 other;
     ccccctccac caaacgccgt tctctcactc ttctttctca aactatatct ttccagatct        60
     actcacctca tatatacaac tctcgactct ccatccgctc tccttcgtct acttgcctcc       120
     cccttttatc gtcttctctc tgacctcgtc gctttttctt ttctcaatcc aaaaactatt       180
     ctttcgtact tcagtactcc acgtactcca cgcactccac gtactccgcg tactccacgt       240
     actccaccta ctccacgtac tccacgtact ccacgtactc cacgtactcc acgtactcca       300
     cgtactcctc gtaactatat ttggggcact tccatctagg atatttgctc tatctcccct       360
     atctcggaca ctctttcact caaacactcc atctatctag aatatcccac cgtcccagac       420
     actcccaaga gatacctata atcaagactc ctgacggata ctcccaattg atactcccgg       480
     acacttggaa cagctcggga tacttggggc actccctctg gtacacccgc tatatattaa       540
     agcaactgtg gagaagaaca tgatggcaga ttattttgtg ggatacggcc cctcagagcc       600
     cgttactgcc tacctcatat ctgactacac cctcacgtat tcagtgatta ctggtgctgt       660
     agacggtata gacacagtta gagcacttcc acaatgaggg tgtcaggaca ctagtactac       720
     gctcactgca cgagctctac agctcctagt tgagggcttg ggaaatggtt cttttaatcc       780
     ttcaatgaag tcaatctacg agcccacttt tcatatttag gtgtcagaat atatttttca       840
     acgtccgttt gtctcgatat aggaacaact ataaatgcta gacaggaaat agatacaccg       900
     cagtactccc tcatcacccc tctcccatgt gaagtttttc tgcaaccgct cattcgtaaa       960
     cctacccata catctcacgc ccgtacaacc atctctgcct tttgctctat gaacttccgt      1020
     aatagatgat gtagtccctt gctctcaaac gcggagtgcc agagcaggag gggaaactat      1080
     ggatatccca aataggagtg tttctaattc gtggaggtga cgtttggggg gagagaagtg      1140
     ggaggtttat agtgagagga gaaggaggat caggaggaga ccttctttta atacagcagg      1200
     cagccctcca agataagcca attgtttatc gatagatatg atttgtgcag cccatatcgc      1260
     gatcaagaat gtgcagcact ttaacgaaat ccacgcgggg ggatggcaaa tggaaaatgg      1320
     caaattgcat gaaagcgtaa gaatatgagc cgggatggta cccagagtaa ccaacgcacg      1380
     tgacaggtga gaagcaggtg acaggagcat gtgacgagag agtagcacgt gactgaagaa      1440
     agacacacgt gacgcaggga caagtcacgc cacgttcaca ctctcgaagc tcttcatcaa      1500
     ggagcacaca gttttgggtt ttttcaaaaa cataagttac ggaatgatcc cccaagacat      1560
     aggtaaaact cagaaaaaac cacgaaactc cccactcatg cgctggcgcg cattcgttat      1620
     cttgcaagga aatagagatt ggaaccttgc atatctaaga ttgagacttc tgcttccaac      1680
     cagcttttat tttattgaac cttttgagaa tccatgtcag catgggatct tcgtctgatt      1740
     gagttgtttc tgcagtgaca ttgtcaccca gttttctatc ctttgtaaac agaatcaaca      1800
     gaaacaaagg accagtcaag acgaggctta caagcattgt tttcttttga acttcccggt      1860
     aagcatagat catttgggtc ctttcaggtg tcccccaagg atacagttct atgaattcgt      1920
     acggagaaga gaacgcggtc gccgcaaggc tgctgtcttc gagccgcttg taaagttgct      1980
     tgtacattgt ctgcgtccaa attgctccgg atatagaggc tccagaagca ctgccaattt      2040
     gagcaaacat gaaataaaga ccggtaatac tagccatgtt tttgtgagag gtcatagttt      2100
     gaagattcac aattaaagac tgggtaaaaa ttgcactgcc agtccccaaa acaacagaag      2160
     cgccaataat accactatgc gaactggctc cacccctgta atggtaaaaa agcccaatgg      2220
     aaagtatcca gaggcatacc ccaattatag agtagatctt tagtcgtttt gtgcggacta      2280
     ctagtaagcc aaagaaaata gaacctgtgc atgcaacaaa ggttggaagc cataaaatcc      2340
     ttgtggccga cttgctggat tcattaacag aaactaacaa cacagggtac aaataatcgg      2400
     aaattgtagc ataaatcagt ttctccaata gcgctgctgc caacgaagcc caaactcccc      2460
     ggtctttcaa taacttgaaa ggaagtactg cattcttggc aaactttata tcccaagcca      2520
     aaaaaaacat aaatgaaacg aaaccaacga caattgttgc aataattcca ggtttattcc      2580
     agtcatcgga aatcccgccc gccagcgtga gtggaactag tatacacccc agagagacag      2640
     tgacaaggga tgtcccaaca acatcgatat tagaataaat gctctttatc caatacacaa      2700
     tgcgtacgct tggttcttta ttatcgcctt gaatttcttt ccattctgct gttttcgatg      2760
     cttggcgggt gaaatagagc aggaaaataa taaaaggtaa ggctgatatg ggaaacaaaa      2820
     aagcccacat tcctatatca aatcgccagt tcttcgcggg attagcggac tgtacgatgt      2880
     ctccagatat ccagcatatt ataatgcagg gccaggatgt agcaaattga aagagtaacc      2940
     tccacttgga tggcgacaga tcagataata ctattattag tagaatggac accccaacat      3000
     agcctgagtt gtaaaatgcc gcacctactg cataagtcct tatatcacga gcttcgcact      3060
     gaataatagt accaacaatg tacagaactg tacccaccaa aaacaattga agtctaccga      3120
     aaatatcaga gagctgtgca aatataattt gagctgcgat gctgattacg ctattaataa      3180
     cctggatggt tgaaaggagt gcgtgctcat tgtatgagct agtagcatat cccgtataca      3240
     cagaccgtgt aatgtaatcc aggtagtacc caaacccaca aagaaaagca gatgcaagaa      3300
     gagcggctct tgccgatttt cctgagcacg ttgagctcat aatttccatt tctttgactt      3360
     tcaaaaagcc ggatcccaat ttagagcttt tattagaatc tgctaccgat tcaatatcat      3420
     gctctgttac atcaaacttt tcttctttga gctcataagc tttaatgcca ccagtgatca      3480
     ttttatgatt tgtattgatg ctacgtagta tttttattgt gctagccact cttatcatgt      3540
     cataacaata agtctcgaat tactccgaag taggctactt aaatgagtac ggtcgaacaa      3600
     atcccatcct acaaggtaaa tatcatgtta ttgaagctca gtacaattcc aatcaatatc      3660
     gatctcccaa gtaataaatc ccgccttacc aactacgttt ttttcatctt agctacagca      3720
     tgtgcatatt tttcttggag gtcattagtc cggacttcaa tttgcaccct aacaacttgc      3780
     agggttatgc aagaataaga aaatgattct ataaaaatga ttctaaaaaa attttgatca      3840
     actcgtgaag aaaaggaatt tactgctaat atattgaaga aaagcgtagt tgaaaggaaa      3900
     aattttgctc gctcactata aagctgcgag actgcatttt gggaatccag gccacattag      3960
     acccgagcaa ttacaagctt ttttcttaat taatcctgct gaagtagctt ttaaccgctc      4020
     attatgtaac ttgttagaag ttcccgccct tatttacaca aattatcact gttagatgtg      4080
     cagggctttc attaggtata ctcttcaaaa ctattttttt gatgagatac gaacgggtca      4140
     tttcgtaacc cttcgcgtag aaggaaaacc aagagtttcg aaaatggggt gcattagcat      4200
     tatcagcttt aacagcaagg aatgtgtctc tcgtaagccg tacaggccct tgattatcta      4260
     acctagagaa gcagatagcg aagaaaacaa cagctcagga aatttggaat ggcatgtgca      4320
     gtaccgccaa catgcttgcg ctctctgttt gtcaggtctc tgtccggcta cttgaggaag      4380
     caaacccaga ttgctataca catccttcct taagcttaga gagcagtaaa ggttccacct      4440
     ctttgacttt cttaatttct tctgaaaaca tttttttttt ttcgtcggag ttgtaggaag      4500
     tcacacaaga tttaattcaa cttggttttt ccgccaagct gcttagacac ccaggtatgc      4560
     actgatgagg agagtgagga ctgaagtact tttctaatat aatgtgggtg ctgaacccgt      4620
     acttaattct tattgattta ggccgcttta cacaaaacaa gtgatgactg aaattgagac      4680
     tggccaaaat tcagaataca acagaaagat atctgatgaa accaaagacc tgtctgtcaa      4740
     acaaagtgca tgtatcgctc ctgatgcatc aaaaagaaac agagttaagc tcttcctgag      4800
     tttgctttct ctggggcttt ccatgtttgt aacagcacta gacgttctta ttgttgggac      4860
     catcatcgat acagtttgta cttcctttgg agactacaca aaaagtggtt ggattgttac      4920
     aggttactct ctccctaatg ccctctttag cttgttgtgg ggtaggctgt cggccgtact      4980
     ggggcctaga ataagtgtga taagctgtat tatactattt gaaactggtt ctctgatatc      5040
     tgctcttgcg aagtcaatga atatgttgat ttcaggcagg gttattgcag gggttggtgg      5100
     tagtgggctc caaaccctga gtttagttat agggtgccag cttgttaacg aaaaatctcg      5160
     ccctttagtt ttgtcactac tgaattgcac cttcgctgtc gcctccattg tggggccatt      5220
     tctgggtggc gcttttacta cacatgttac ttggagatgg tgcttttata tcaacctgcc      5280
     tattggtgga ctagcgattg caatattcat ttttttttac aatccagagg gggccgattt      5340
     gctggagaaa ggcagtcaaa cgttcaagaa acttttgagt tatcgtcgcg ccaatctgtc      5400
     tcttaagcag cttttggatc agttactatt tgggtttgat attgtatctt tcgttctttt      5460
     cactgcaggc tggttgctat ttcttttggc tttaactttt ggcggccaaa cccatccttg      5520
     gaagtcaggg atagttattt cgttcattat tgtaggggtt ttgttaattg cactctcctt      5580
     aatctacgac ttcaggttgt tcgaccacat aaaaacaatg gacactttta gaccactttt      5640
     aagctggcac ttaatgtctc agcgagcaat tttaaacgca aactttaccg gattcttttc      5700
     aacaattgca tacaatgttc agatgattta cagcgtgcag tttttccagc ttgtttatgg      5760
     attttctgct tggaaagctg gtctgcatct cattccgatt ttagtatcta cagtcgtatt      5820
     ttctattgca agcggggtca tcatcaaaaa aactggtcat atcaagcccc ttctagtgtt      5880
     tggtagtgca atgggcgttt tgggaagcgg tctcatgata ctccttaaca acacatctac      5940
     taaacacacc caaattggtg tattgattct tcctggcgtt gcactagggt ttgtgctgcc      6000
     cgcggcacta attacatgtc atgttcaact agacagaacc agtccctcct atggagcaga      6060
     catgctcgaa actacttctg tgaatgcgct attgaaatct ctcggcacca ccgtaggtag      6120
     cattctttct acgatggtgt tctctacctc tttgcacaac aaaatgaaaa acagcaatat      6180
     tttgttcgag gtatctggcg agctggatag tatcgcatca tatcgattgg atcattttga      6240
     cggaccccgt tctgaaatgg gttgcatgtt gaacgattca ataagaaaca ctttttggat      6300
     ggctctgggg tcgtcagttg ttgccttcct ttgcagcctt ctcgtctcta gacggaaagt      6360
     gtctatgtag ctggtagatc gctctgtaaa agttttattg aggcgggtct gggtcgttgt      6420
     atgagagatt gccaaactcg ttggctaggc tctccataat cagatcagtg acctactctg      6480
     aggatgatag cacaaaataa ctttccctag acctctctag tccataatcg tgatcaggta      6540
     cgtgtgacta aaccgtcagg ccctttaaag gtttttaggc tgcagcaagg actcaactct      6600
     gaggtgaaaa ctacatcagt gacttaactg cacccatgga accaatcttc cgtcatttca      6660
     acatagccat ggtctactct gctcctctgg ccaaagttct gggaattcct ctgttgggtt      6720
     tgtactacag tctttacgta tcgagtttca aatcgctcta tactaattca acgtgtcatt      6780
     gtgcagctca gaactgtcgc acatccgtga tacgactata atgtggcaat aagaaatctt      6840
     gaaatgtgac ttaaacttga ctccaggata agtgctgcgc tcttggctca ggctctcatt      6900
     gaatttgaat cgcagagatt aaagtcaagt ctcaattaat aatgctgaga ctccctttag      6960
     acttctgcta cgtttcatct cggttgagtt ctcaccatgt tcatgaattg tggagtctca      7020
     aatcattata tactagtgtg tcattataca atttactact attacgcatc ggcaatccga      7080
     cggaatccaa cagatgcgtc ctcgataggc acagagtgta acttagaagc attttgccac      7140
     ctaattattt aattttacat caatctatat cagcaatcta gtcttaactt gataagaagt      7200
     cagtcgtgta cggacgcgtt ttcttctaaa gacctcctaa tgggaacgca acatgcttat      7260
     tagaatgcga gaacctctct caaatctgtc agagttcttg aatagaaata caaataaagc      7320
     atcttcttta aaggaccctt tcctccaaag gcttgtgaag tagattaagc tttctcaaag      7380
     aacactatag aataaaccca aaagccttgt ccagcaagtt cattttggga ggattttctt      7440
     cccagtacgc gtcctcttct gcgagttctg caattccaga gaacagatcc atttcaactg      7500
     gctttacaaa cctggttttc ttgtagagtt tgtgaccggc gaacaacaca atgaagaacg      7560
     ggatcatgaa atatgaaaaa ataaaacttt ggaggtccca agagtctttc agaaacactg      7620
     cataaccgtt catgaacaac ataaggacta gccagaaaag tgagtgccaa cccaaatagg      7680
     gcaggaagga actggaataa ggcagagttt tgagatcaat gttttgtgct ttacagcctt      7740
     ttgcaaactg caaatacgag atgcaaatga agatgtaaac aattgccatt gctgctgtct      7800
     caacattcag gaaccatgtt aaaacgttat ttgtactgtt ggaaactgag agatacgcta      7860
     atccacaaac cagtagaaca gcaacacagc aataaatagg tactcctctc ttcgttatct      7920
     tgaaaagctt tggggcttga ccctccagtg ccagtcgatg caaaaccctt gaagccgagt      7980
     acaaagatga atttccagct gagataatag aagtcaatat cagaacgttg acaatatgag      8040
     gcaacacgcc tattccaaga gtcttcattg cagaaacata tggagaggcc ccagccccca      8100
     ctgccccctc acttatcgct ttaatcatat tgtggtcgtt gaaagggaca agaatgccaa      8160
     cgcaaatcgc gccaccaatg taaaaaatga taagtcttcc gaaaactttc cgaaaagatg      8220
     aagggatcac tttccttggg ttcattgctt cgctagctgc gtttcctaag tagtcaactc      8280
     cccagaagac gtataaggcg aagatcagac aagacataaa accgtgaaat tttccggctg      8340
     agcctttgga aatatattcg gcaaatgcgc ctggattgga ccaattcttg aatcccagaa      8400
     ctttatgttg cgggttaccc cctgccataa cgacaatggt gaagaaaata agcccaatcg      8460
     ccaaaataac cttaccaatt gataagtaaa attcaccctc cccaaaaata aatacggaaa      8520
     acagattaag ggagccaaac agcgcgatta gaattgagat cagagctgct ttcggtattt      8580
     tatctgtcca gaattcgact actagacata cagctgttat ttcaaagcac acatttgctg      8640
     cttggcacac aaaataagtc catcccacag aaaatccaca cgaactgtca acgaatctct      8700
     ctgtgaagtg cacaaaagaa ccagtaactg gcaaatacgt caccatgacg cacatgcact      8760
     gcgaaaggcc aataaataca actgaccaca aacaaaatgc tatcaagagt gagcctggcc      8820
     cgccatgaat aatttgcgtt ccaattgaga caaaaagcgc cgttccaata gcaccaccaa      8880
     ttccaatcat tgaaacttgg cggggaaaaa gctttcttcg cgcaattctt tcttctaatg      8940
     acggcgcctg tccttcgagc gaccgaattg tttcagcccc aacgtcatgt atcgttgtcg      9000
     tttctccctc ttcgagagtg gtgacggcta gttcaaagtt ctccttcttt gacattcctc      9060
     gttattgctc ggcaataaaa aaaagttaaa attctccaca acttacaatg gctctagcga      9120
     tgattccagg gttcataaat tgaattttta aatgtttaga aaaatgatct tgaaactaca      9180
     ctttatatcg agagctgatc acccccaaaa tagaagtcct tagcgagcat cattttttca      9240
     catcctcaca cgaaaaaaaa acgatgatta agatctcggt tgaagttgcc gtgggttctg      9300
     agataacacc tcgcgtatga cttctctttg tgagcataaa tcaaggtctc tttcgtaaac      9360
     tttgatctag atatctttat cacagcctct acaaatatta tggcttcgaa ggatcaccag      9420
     atcacatggt cgaacacgta tttgatgtgg aacatcatag tgcattttaa agctctcaaa      9480
     agattgcaag acaacacaat gtaaagctta ttttttggac gagattttgg cttctattaa      9540
     cgtgcctaca aaaaaactct tgacatgagc actaaaatgc ccttctatat ttgagcacag      9600
     gctccttgca atattgaccc aaaacctgag ctctaatgga gctttaaacc acttcttgat      9660
     agcataagag ggcttggttt gagtgtggac caaacgttct atctgaaatt agccgactgc      9720
     ctacattcaa aactcatgtt aaaaaataca gatctcaaaa cgacagtagt tttctgttaa      9780
     accgtacgat agttaaaggt cataattatc agtcacgaat atactatttt tctctggagt      9840
     agactagttg tgaattaaag ccttgagctg cggataccca ggatgtgcat aaaaatattg      9900
     tttttttatc taatggctga ttcttgtaat gaatacttgt gtgtaacctc tttagcagtt      9960
     ttctatagtt taacaagctt tttgagtaat aaagtttagt gtccgtccgg cgcaactctt     10020
     ttccggcgca actcttttcc ggcgcaactc ttttccggcg caactctttg tattcaggta     10080
     ttgattcagt tcaaagtatc gtatttacat tgattcggaa tgggttatta aaaccagtca     10140
     taaaatcagg gaaaattgcc gcgtctttca tacctttttg ctacttactc tgaaaacatc     10200
     tctgctttga taatgaagaa aataaaaaaa ttaaggggta tttacatagt agtttcaagc     10260
     aacaagctct tgaaagctgt acataaactc ctcagtactt gaagcttttc ctcagtcttt     10320
     accttctgtc gaacccttaa ttgaccgtaa aaatctattg agatatctca tgaaatatcg     10380
     ccttttcata gttcctggtt atcattacta aaaaaaattg tcacatcaca ctgttccaag     10440
     atcaattgga aaattttgtt gtttactcga aagtctttat cagaataaat ggcggtactc     10500
     cgcttcactt ttggatggct gttaggcgtt tccaagcatc acattgagat agttcggttg     10560
     tcggtacgtt tgtgaggttg agaccgcgct ctcaaaatcg gaacccatgt tagttcgctg     10620
     tcccttgcca ataatggaaa gtgcaaataa ctaatcaatg gccaaggcta gtgctacttt     10680
     tcttcacgat ttcatatgag gccagcattt ttgaagggta gggaacggaa gctcatttgt     10740
     agaagtaagt ttccaagaga ttctatcaag caacgtgcca accttttgac atgaaatcta     10800
     tcataaatct attcaagggg tacgcctcac atgacttgct tccccgcaaa gatataattg     10860
     aagcgacatc agaggttctt caacctgagg tgcgtgagta tgactataat gatgaagaca     10920
     gacatccgct tgtttatgga tctgataacg gcagcgcatg ggttcgcgct tgcatagctg     10980
     aattttccaa caaagtcttc aaactgcctg tacacagtag tgctgcgacg cggcctgacc     11040
     acctaaacct gacttctggt gcaagttatg ggataatgaa tattttggtt caaacaactt     11100
     tgccacatac aggctatacg aaacaggcgt tcatagtaac gccaacctac ttccttgtta     11160
     acaaggcttt tcttgacgct ggattcacgg gaaagataac cgcagttgaa gagaagggcg     11220
     acggcctcga cttggcgttt ctggaggcca aattaaagtt attcgaaaat tcagctaatg     11280
     gagagagaga acagaaaacc gaagaatcac tcgacattat caatgcgcaa ggtggtcaaa     11340
     aaaaggtgta cagatatgtc atctaccttg tgccgacata ctccaaccca acgggtgcaa     11400
     tctattcgag aagctctcga ttaaaacttc ttgagcttgc gcgaaagtac gacattctaa     11460
     tcatttcaga tgatgtatat gatctattgc ggctggacga cgataatggt agcggcgcgc     11520
     tcatccctag tcccccggaa ctacggttcc ctcaccttga tagagaaagt atttctgcgg     11580
     caaacacgtt cggtaacact atttccaatt gcaccttctc caaaataata gctccgggtt     11640
     tgaggacagg atatcaagag acagcaaacg ctaatttagc tacacaactt gcatctggcg     11700
     gcgcaaatgt atctggaggt acgccgtgtc aactaaattc gatgattgtt gctactatga     11760
     taaaaaatgg agctgtcgag cggatagttc acaattttgt ttctgtgtta agagagaggg     11820
     caatggttct tgctgaatca ataaaactat accttcccaa agggacgcag tactcagaat     11880
     gtaaaggcgg gtatttttcg tggtgtacgc tccctgttgg ttatgattct tcaaagattg     11940
     tcgaggaagt aagccatgag ggtgtcttgt tagcagatgg ctcgcacttt gaagtttcag     12000
     gtgacaaaag aaattggggc gagcgaagtg tgaggctttc tataagctat gtgacagcag     12060
     ctgaaatcca agaagccgtc aaaacatggg gtcaattttg cgaaaaacac agatacttaa     12120
     gcagcaaggg aagctgagag agcagtaggg cacaaaaaat ctcttcacca ttgttttgca     12180
     ttaaaactgc aagaattcag ttgtttacaa acactgagtc ataattgaag ccctccattt     12240
     cccctagttt tcaagcaaat agcaaaatca aaaggagcga gcatcttctt atattttctt     12300
     agtgaaggtt ataaccgcct gttttcaagg caattcatgt accagcggta tatgtcaaaa     12360
     gggtttatca cttgagatcc gaaaaacgca tgacctacta tgtattgggg aatttgaaat     12420
     gttgaatcag gctaactact tgaacaccgg cttttaagtt gacttttctt attctttttc     12480
     gtttttttac cttattttca cggtggatta accacatagt gaagagaatt ctatgagcaa     12540
     aacctcattt tttgtcctta gaaaaacaaa tatctaaaaa cagattttgc acagcgtgac     12600
     cttaatatca agattgcgac ggtttaagcg ttttctcaag ttttttaaat ctcttgacga     12660
     ccacttgaca gctttgaggc ccatataata attaatttct agaatcaaga gctatatctt     12720
     gttacttgag atgatgtatc aaagtccata tttttgtatc ttcgatagaa ttgttaaaag     12780
     tcatgaatag cattttgctt taaccacttg acttctaaga tactcgctca tttatgtggc     12840
     ccttttcaac tctcgagaag tcacataatt atttgatttg aaactgcaat taaagaaaag     12900
     gtaaacccag ctgctttcta tctaaaagtt ggagaataag gaactttagg ttgggctttc     12960
     aactaattta tctctttcga ggctcctcga taacgctgaa agtaaaagag caaagttttc     13020
     gtgtttagaa ctcgatttaa agaaatcatg gtaaactaaa aaaggatatg atgttttcta     13080
     aagcaaaata tctctttatt tagcttgcag ttgaattgca tgatgcttag aatcacttca     13140
     aatgttgaaa tttttaggta ttcgatttga gccgtttctc ccttaaagaa gcctcccttt     13200
     cactttcgtt atttttaaac tgctttctaa cgcactttgt tcttagcttt tttcagagat     13260
     ctctaaattt tgatcagctg cctctgcaag gcttgagtat gcgtctttta ccggaccttt     13320
     tccctttctg aaatagaatt ttgttagctt cttccgtgtg tttaccaagt ttgctaacaa     13380
     gttcaacggc ggctgcacct tctatttaca ttttattatg agtatgtcaa ttacttctct     13440
     cctgtttcga accagaactg ttaagtttga cattgtgtgg gtccctttga gttttgaatt     13500
     taacacgaac tattttgata cactcccaat taattcaatc taaaaaattg atgcttcgaa     13560
     ctttccataa atacatagcc aaatcaatcc tttcaattaa atttataaga ggtcctatta     13620
     aattttcctt gagaaacagg aatcaagatt gaattggtgc atttagaact tactgaaaaa     13680
     cagttttgaa atttacaaaa cattcaatga tgaccgcaag gtgttcactg accccaaagt     13740
     gctctaaaac cttttttttg tactgctggc acacttgggg tatttggaaa cgaaaaaagg     13800
     tgaggtttag aatttttgct tcttaacata atcttcttct cgacagtcac actgtgagtc     13860
     aatggttttg cgaaatcaag aagcggaagt acgacataac caaagcttaa agggtaactg     13920
     ctctcgtagc aactaaaaat ctgggagatt atgaacaagt tttagtaaag caattttaat     13980
     tgatagatta gttataagac gtcctctggg gagctttttt cctccgacag ttactagttt     14040
     cgaaagagtt tgataaacaa cacatttttg aattgtgtga agcacaagta cttagtttat     14100
     ttaacttgaa attattgctt agaaattctg aacttttgca aaacaaaaac tacatatgta     14160
     caccatgata cttgttgtct gaccactttt tttctttata cttctttggt ttctaagaac     14220
     ttatgatctt acccattgaa tgaatttgcg gtaacaaaaa tattgacaac tgctatgttc     14280
     gacttgcact ctgaagtctt tgagcagagt ccttaatagc cttcgttatt ttgtttctca     14340
     gagttagctt aaagcaactt tgaatttaag gcaggaggat attatcttta tttagatttg     14400
     gtctctcctt gttaatgatt taaccagaaa cttcattatt ggtacacttt ttgtcaggat     14460
     attaccttac ttaaagagac atcgttactt ttgttatcac aacttaaaaa aaaatggggc     14520
     taacttgagt tttctacttc aagttaggct tttatttctg agctcaagaa gttccacctt     14580
     gcctttataa ggaaactttt ttctcccttc taattggcga gactagattt tatgaggcga     14640
     gtctgggtca ttggtcaaaa gggtcttaaa ttccttggct agtgtttcca ttatgatcta     14700
     attaaactaa ttcgtggatg atggtactaa atatctcccc cgtctttctt cagtccaaga     14760
     tttatgtctt gcgaaccaaa gaaattatcc ggatttatac aaaatttctg ggacgtggct     14820
     gagtcttaat cataaggtga taatcgtact ggtagtacca ctcattacct tctccaagcc     14880
     actgtggtct gatctggact atgaatggtc aatgtggacc ttctatgtgc cttagttagg     14940
     tatccgtcga atttatgata tgtccatgtg ccatatcatt tcataccaat gtgttattat     15000
     gcaacttggc actatcacac accaaagaac cgatcaaaat ctgaaataat aatagctgat     15060
     agcaaacagt tactgaatta ttaaatgcat tttgtatgga ggtggccatg caagggtact     15120
     ctgctgcttt ggaagtcaaa aaaaataaaa tggtgaagta gtaaaaatta ttatttgttg     15180
     gcagcaagtt acaggagcca aatttagtat ttaagagcta ttcgaagttc aaagagcaca     15240
     tacgtagatg agagggcagc gtgtgaatat ttttagccga aactcgatct ctgggggcca     15300
     cagcattgat agaaactttc gttgcatcaa taatttagaa tctttaaatg cttcgtattc     15360
     atatctgaat gtactaacta attaagacgc gcacgttatt ctaaacagga gatcttgcga     15420
     tttcaagttt ttaagtacaa catctgttaa agatagagta agcaaatgag atttggggtg     15480
     tgcatgaaca cataaacatt ctatctttta ggtcctttct ttaacatttg gcagagcatg     15540
     ctagcggcga tttaggtata aagctacagt acaagcccct catcgcaatt gaccagattt     15600
     ttatcacgag tgggcagcca gctaaattaa cataaagact tataaactgt acccaagcaa     15660
     actttttctt tgccattttg ttctcacttt tttggggggg tacttataac gcaacctttt     15720
     ttttaaagca aaaatatttt cgttgttttt gcctctcatg agcttggtac tggacgagta     15780
     atactagtag agttaaagtt ctaaggattc tttttccaag ttttttctct aaaaaatttt     15840
     tactgaatca ttaaaggtat cccataaatg gatctttacc ctttggcctt ttagtttttg     15900
     aaaaaaagct acttatacgc tacgttacta ctcgaagcgc tttcctaata aatctcataa     15960
     actatttatc gccagctaaa tgtgaaacag ttgaacacta tcacctcaga agcataaaaa     16020
     acctatctat gtgcagtatt agacttgggc gttcggtttc atgagtgtat agaatctatc     16080
     acaaaaccaa ttaaagaacc aaaaaatttg agcaatgttc tatgagtgtt caaacacaaa     16140
     gtcaaatctc tttttgttgt ttctaagact gaaccgcgag tgggactaat gacaaaacga     16200
     gaaacacttt attgtatgtt ttagatagta tgctttgttg cgtttattaa aagcccagaa     16260
     tgatcactgg gaaaggctat attaagactg agttaaaaca agatcctttt tggcacttta     16320
     attgtcttta ttgtttgaca tggatcctga ttggttttaa gcaaatatgc aaggaagctg     16380
     catcgctctg agactaattt catattctta atgatgaatt gagtgcacga aaagaggtct     16440
     ttaaagaatg atttagccgc ccagttaata tttgattatt tgcggaggtt ttttgctata     16500
     agcttcacct tactcttatt atctatatat tatatcaaac aatttaaaag atgcaataca     16560
     cttggtgatt gaaacgaaag gattcaagaa aggagaatca tttctcatct ttttaaggaa     16620
     cgttagtggc gtttgagacc gggtttcaat cgctgatgaa agaacagtga atagagaatc     16680
     gataggatag gcaggttttg aaatacacaa agttttgcgc tgttttatta agattgtgca     16740
     cattttttaa tatcaaattg cataccactt tgatgatttt ttttgatttt tagacttata     16800
     ctctcgagac gtttgtgata tggcttatta gaatgatagt tccttgtctg tgaaataata     16860
     cgagacaaaa gctccattta acacaaaaat tttctgagag acattatgtt tacgttaaca     16920
     aattttcgtc actagaaaat tcagaaaaga gttgcctcta ttttttataa gttctctttg     16980
     ctatgacagt ttagattttg ccctattatc accaaattcc attttattct aatgcagcta     17040
     gatttgaacc gatcattgaa ttcattttta tatctaaagg ttaaaaccag acttttttct     17100
     actaatggat aagctggtag aaatttgtgt tcgatagaaa ttcgactaat ataaaaagcg     17160
     aagaaaagcg tcttcgtgtt agcatgtagt gtatttaaac ttacatatct ccgatgattg     17220
     ctggtatgct cttggacaga gcatctagaa ttcaagcata actcgatcta tagcacttga     17280
     aagaccagtt tttttttttt ctcttatctc tctgaacttg tacaaagcgt ttgagaagta     17340
     ctttcctgtg ggccaaaaac aaaaaaactc gaatcaattt aacaattcat ggtatttatg     17400
     ttactaatta tatttaaaca ctttttatgg ccatgagctc tcttttgagg ataaaatcct     17460
     taatggttag actttgctgc atttggaagc agtttcaatg aggctctgat ggcttcaact     17520
     cctttcatta aatcttcttt ggatatgacc aaaggtggtg ctaaccgaat tatgtgatcg     17580
     tgggtaggtt tcgcgagaac accttggtct ttcatcaaca gacataggtc ccaagcagtt     17640
     cttccattag atttggatgg gtcaatgact atcgcagtga gcaagcctct acctctaacg     17700
     tcggaaataa ttccgccagc ttcttgttga agttttttca attcagattg gaagaattca     17760
     ccaagagttt tagctctctc gacaaggttc tcctttttta caacttccaa agcagcaatt     17820
     gcaactcgag aagagagcgg gttaccaccg taagtagagc catgtgaacc tggttcgaaa     17880
     cagcccatta tttctttaga tgaaagaacg catgaaacgg gcaaaatacc ccctgaaatg     17940
     gcctttccta atagaataac gtctggcttg acgttaggag agtgttcgta gcacaacatc     18000
     ttaccagttc tggcgatgcc ggtttgtatt tcgtcacaaa tcagcaacac attatatttc     18060
     cggcagagtt cctgaacctt ttgcaaatat tcaacaggag gaacaacaat accggcttcg     18120
     ccttgaatag gctcaagaag aatggcagca atacggtccc ctgcattctt gaaggccagt     18180
     tcgacatcct ctatgttacc gtagcgcaga tattgaccat cagttccagg aatcttggcc     18240
     gttatacttt ccaggaaagg tccaaagaac ttacgggctt cctcatctgt cgacagcgaa     18300
     agagcaccga gggtacggcc atgaaaattg tccttggcac caagaataat agcttcattt     18360
     tcaggaattc cttttttcat ataaccccat cttctggcaa gctttagccc agtttcgacg     18420
     gcctcggcac cggtgttcat tggaagcact gattcgtagc ggaaatattc cgtaatgaac     18480
     ttcgcgaatg cagagaaaac attattagaa aaggcacgag atgataaggt gagcttggac     18540
     gcttggtcaa ctagtgcggc aattatatcc gggtggcagt gcccttggtt aactgctgag     18600
     taggcagaca aaaagtcgag gtattgcttt ccttccgggt cccaaacctt tgctcccttt     18660
     gctttctgga aaacaacagg aagggggtgg tagttgtggg ccgagtacgc tttctcatac     18720
     tgaacagttg tttcagagga cagatcggtg ttcaatgttg acattttgaa tgcttgtgac     18780
     gatgcaagaa aagcacctcc atggtggaat acgcgacgga gaccagcaac cttccctctt     18840
     gcaaggatca ttatttcctt ctttgttggc tttttgggct ctaacaaatt cgggaataag     18900
     gcatcatctg tatttaaaaa tctctgggct gatatttata tctggtagaa gctcatctgt     18960
     ctcacttcat tgctaaccga agctcgctgt tagcagtgca tagggtatat atggtcggtg     19020
     aaattcacca aaaaaaataa gttatgcgcg ggtttccaat tcctctcaaa tgttttaagg     19080
     ctctagttac ttaagcgagc gcattttttt atcatgatca tgagatattt tattttagcg     19140
     taaatcgtga ttttaataaa gcggctagta ttaggtacga agctcaagga atttgccggc     19200
     actgactgga aagctactaa actttagtgt tagcaaacgt tgcttgggct gttcgacttc     19260
     tcttttgaaa caagattcag aaaaatgtgg gcataaacag gtgtcgaact caactttttc     19320
     tgaatggctg cttccttgac tcttaaatcc tctgaagcat agagaaacag cctgttcatt     19380
     tgtacgcggt caatttcaat agttctgaac tataatctca gaaaaaaagc caataatcaa     19440
     ggaaaactta agccttattg tggtgtttat gcaaataact gatttttaat ctttcgacct     19500
     tcaaagtatt tcggtgttca tctttgcagt ctcacagcac gcgatctgcc gccaactttc     19560
     agtaaatttt tttcactgtt tgtcctatac aaaactatga aatgtgatag atacaggcca     19620
     ataaatgctt caagggtttt ctgcttccct tgccacctct ctgatttctt ttttcgaatt     19680
     ggagagtaca tattgaaaat atgtaagaca tgcaggacac ggacctcgtt tccctgttct     19740
     acaaattaat cagccttccc tattttgctt tgtgccgtaa agataatata cgattatata     19800
     atcaattatt ttaagtagcc aaacttttat cctattgatc aaacactatc ggttttgttt     19860
     gtagcgtgaa atggaacaca ctttggttgg aattagccaa actccaaagt aaaactacga     19920
     ttaaagtgtg gcatttgtat agcatagctt ctgcatctgt atttcttttc acgtcttcga     19980
     cgtaggaccc ttaaacaacc tttttcgggg ccctggctcg ttttgcgacc catttactga     20040
     caacttcttt tcagcgtcac tttaaaattt ctttggccaa tcaaataatg tttcttatcg     20100
     aacttcaaat taagactcta gaactcaata gcttatatta ttttattctt ggccatcaga     20160
     cggttggaaa ttcttcattt cttgaacacc catagttttt ctgaaggggg cctattcact     20220
     tggctgagcc gtgatatcag gatttgatgc ctatttctga gagaatctta aacttcgcaa     20280
     aagcaaccaa tgcagccagc atctgggact aattggtatc ttcgataaaa ctgtcttttt     20340
     catctcttcc aagtcaagtt tattttgagt attttcaaag caacaactga tgtggaccgt     20400
     cagtatgatt tctgtcttgg aaatctggtt tttgacttat aatttatttt cagtgttggt     20460
     cataaaatat ttcccagatt cactttgttt gcaaagcttt gattcatgac attcactact     20520
     atttttcttg taaataatac atctttatta ctcatcaaca tgagcaagac attggaaatc     20580
     tttgcactat gtactagccg gtttcaaaag caatgagcag aaactttagg cttttgatgt     20640
     aaaaattggt ttataagtaa tgttgtgtag ctggttatta cgaattgatc ctacagaaaa     20700
     agaaaattga aagtttttaa ggtggttggg atatctaaac aacactttaa gccaactgac     20760
     tcaaaagcaa gacaccaaat tagcttgagt tactcttttg gataaagaaa ggataaactt     20820
     taataacatt tcagcaaatc tatatctatt gctaatgcat ttagccttga ttatacttca     20880
     attgattttg aaaatatatt gattttgaag taataaacaa ataatacgca ccatttgcca     20940
     gcgaattcga gtagcttgcc ttccaaagtg aaagagagcc ttgtatagtt tttacaaaaa     21000
     gggtctgaat actcgaaaaa tggtccttaa atgcagggct aaaaataaga atatttctga     21060
     tgggatctag tataagacaa agctgattgt ttggaaacta tctgttcaaa aaaaggtgaa     21120
     cacactatct gttttctact ttatgcccta tagcttcgtg atgtttctaa ctttaccaca     21180
     aactcttggt ttggtctttc taagaaagtc gaatttgaaa tttgcctgaa aatctcgagg     21240
     acaagtttca agtctagctt ttgcaattga tctgttcctt ttgcactttt ccattaattt     21300
     aaaattatta tataccaata cagtaaaaag ggctagttac taataaacgt acctgtgtct     21360
     caagtctttc ttgtcagata aatcttcctc aacactgtct tcaaaggtat ctcctttggc     21420
     ctcaagttcc atctttttgc tgttctcacg tcttgctttg aacctgtaga aaaggagcag     21480
     catatctaag agtacccata taattatatc agcaatcagt gcaccacggt acgatcctat     21540
     ccaccactgt gggaaaacta ttgctgcaac acaataaccc acaaaaaatc cattggaaca     21600
     taaagctttc ttggtgtttc ctctaacatt acttgatatg aaactcagca aaatagacat     21660
     tatgcatgta attactgagc ctagccatga ccctacaatt acccaccatc cagagcttct     21720
     ttttagacat agaagcataa tattacccgc caaagggacg atagccagcg caatcgaaac     21780
     taaggccctt tctttaggaa aaattttgac caaagccaca ccaagccaga taaataccag     21840
     ctggacagca ccggctggtg atccaaattt catgttctca aatttatcgt aaccaaaacc     21900
     agctaaaata agggactgga aaacaatagt acccccgaca acacaaatca aaaatccaaa     21960
     tatgattgta cacaaaaaga gccagtcaaa attgaggcac tctttcaatt gatctttatt     22020
     gaataccact ttttctgttc tatcactttc gtcatagagg cgtttgattg caatatcttt     22080
     ctctttcatt caagaaccat gcagttttag gtgatgctgg aacccaaaag tagaacagaa     22140
     tcccgccgaa gagcgaaata ataccacatg caataaacat taatctccag tccgcaatct     22200
     tactgctatt ggttttgcct atgccgtaca tgagaaaact tccaacaatc tgagcaatcg     22260
     cattcattga tatccagcag gccgctctaa ggggttgctc tcgtttcctg taccaatagg     22320
     atgtgatcaa tacgcatgca ggctgaacaa ctgcttcgaa aatcccaagg aaaagtctcc     22380
     ctacccagaa accttgtttt gtattaggcg cggcaagaca gaggcagcaa acggaccaaa     22440
     ttattacaca aatacctgtc attggtgctc ttgggatcac tgtcatcaga tacatgaaaa     22500
     caaaattagc accaagctgt cccaagtaaa atattgttgt acaccacgaa tagtcatgag     22560
     cagccattga aagatccttt tttaatccaa aaacagctgc ataactcagc gattgcttat     22620
     caaggtattg cgcaaagaaa atcaggcaca taaaaggcaa aatgtataga tcaattttgc     22680
     gcacgagttt tgcttcttct tctggagtga aggttaccga ttccaaacat ctttctcttc     22740
     cttcaactga cacctcagag ttggcttctg cttttaggtc aagctctttt atttgaccct     22800
     ctgagccttc gttttttaga ctcattgctg aatgtgatga tgggggcgta aaatgaaacc     22860
     gttattcaag cttgaggttt ctggccgaat gagcaagcct tataaagctg agaatcttat     22920
     cttgaaatct gagacaaatg aaatcatact tatctagtgc attgttcttc cattgtcaaa     22980
     tgcaatctaa ggtttaatca ctatcaattg cgtcttggac aagacaaatc gaacactatg     23040
     ctaagataga gcggtgccct tcacaacttg gcgaacagta ttaggtggaa gcaatgcgat     23100
     tagatatctt ctttaacttc aattagaatt agtttctgtt cgccgataat atattacgat     23160
     ctgcgtcata tcagtaaaca gataacgctt cttgtaatga gaaagaggtt cgaatgcagt     23220
     gagaacttcc tataagggaa ggtgaatgtc taaagttaaa gccagcacat ggaagcatca     23280
     gagatagcgg aatgtcagtt cctatcgtaa taactgaaag ccgggtttag aagaatcatt     23340
     tatcagaaaa aggttctttg ctccgattat tagtcacgct tatcaaaagc ttcaacgaga     23400
     tcaagctgtt cataaaaagc tggaatcaaa tcttcttaaa tcaggataaa acagaatagc     23460
     tttctctgtc tgttacccaa tttttttttg ttcgctcgtt atcctttttc actgtcttca     23520
     ttgtaatagt ataagttacg ttgatatgca actgactgcc attgatgtca acgaaagaaa     23580
     caacaagtcc cttgaagact tggttactcc ttggaaaatc ccgcctttaa aagattatta     23640
     catcaaaaac gcaaatctcg tggatgtcag ggaaggaata actaagcccg gtgcgcatat     23700
     ttttacgtca gggggcttca taaccaatat atgtttctca gaccatgaag ccgataaatg     23760
     tacttcagac aaatttgaga ttattgatgc aacgggaaag ttcgtgatgc ctggactgtt     23820
     tgataatcat gtccacgtaa catctgttcc tggtgagact gacttgtcta aaactctgaa     23880
     tatgccaaaa acccgcgctc ttatgagggt aagacataaa cttgaaggtg cattggctcg     23940
     cggattcacc actttgcgag gttgtggagg tgcagagtct tacatcaaag ccgctgttat     24000
     agaaggatct gtaattggcc cccggttgct gacatgtggc cacgcaatct cccaaacagg     24060
     aggacatgga gatatgagac ccgctgattt acctggtgaa gcttttgata gctgttcctg     24120
     tcacatgaac gaccttggag ttgtagcgga cggagcagca gagtgttaca aagttgctag     24180
     agaagaatta agaagaggcg cagacttcat caagattatg gctggtggtg gcgttgcatc     24240
     accaacagat aaaattacta atttgcagtt ctgcgatgat gaggttactg ctcttgtaaa     24300
     ggtagctaaa acctataaca cttatgtcac ggcccacgca tacactccag aggcaatcaa     24360
     agcttgcgtt agttacggag ttaaaggtat agaacacggg aatcttttgg acgaagaaac     24420
     agcccaacta atggccaaag caggatgtta cctaacccct actttagtaa cctacaagat     24480
     aatggcatct gatcaattct cgaccttttt aagtgggtca aatagggaaa aaaataccca     24540
     ggtcttgtat cgcgggattg aggccctcag aattgccaaa aaaaatggcg ttaaaatctg     24600
     ctatggatct gatctactcg gatctttggg cggttaccaa acacaggaat tctttataag     24660
     ggggagatat ctctcgacac atgaagttct actatccgca actataactc cagcagaaat     24720
     gaacggtctt caagaccaaa ttggtgaaat caaaccgggc ttcatagcag acatgttgtt     24780
     gatgaactcc aatcctttgg aaaacattac ggttctcgac gaacctgaaa gtaaccttgt     24840
     ttttgtgatg aaagaaggaa gggtttacta agttggtata ctttttcagc agtcttacag     24900
     gtttctcaac tttttttcga ctttcttacc cgtttgtatg tataatcatc taaacttggc     24960
     tatgattcat gatgacagag aggctcatga aacagaaaac actcacgcta ccagtcgcgt     25020
     tcaaccgcaa tttttttata tctatgcacc ttaataatta cgtgacttgt tcaggttgta     25080
     tgactcccct gcggtttctg aagggttagg ttattaaaaa agacctattg tcactaagat     25140
     accaatcata gggctttaga ggctttgttg aaaacatttc tctggataat attttcaaac     25200
     agttaattgg agtcaataat tccaaattgc ttgctgttct tcctaatatt ctgttcctta     25260
     gttaggttca taaccttagg gcatgctgtt acttgattat cgttggcaag atcaaatttg     25320
     gtcacgttaa tattccgata agataagtga taaaaaaacc tctcttataa gaaagagttt     25380
     gggcagattt catgaaagaa gaacgaatac tcaagatgta tcaattcgaa acttcttaat     25440
     gttaaagatt cgaacctcaa ttgtctatga gtaaaatagc aatcttaaat gccaacccac     25500
     cccaagaagc gctcaagcga tggggaagtt ttgcagacat ggcaatagag atgtttgaag     25560
     cgaccaaggc aagttttttg aactcaacag tagaatatga ggtgtacaat gtttacgaga     25620
     aagactttcc aacagtttta gagctttgta atggagacta tctggggctg cacattacag     25680
     ggtccactag tgatgcgtat gcgatagata tagagtgggt taacatattg cgtaagcttt     25740
     tgcaaaactt gcttaaaaat ggagctcacc cgccaataag tggcatctgt tttggtcatc     25800
     aaatacttgc ttctgcacta ggttctgaag tcaggcgtaa tccgaaaggc tatgaaggcg     25860
     gtataacacg cctagaaatc acaaaagagg ctttaaagct cgggctattc caaaactcaa     25920
     caagcccgtt accatcttgc gagttctacg cttctgagtc tcactcggat tttgttaaga     25980
     atgtccctca tggatacatc aatactttaa cttctaaaaa atgcgacgtt caaggcctct     26040
     ataagcggaa tgtggcactt acattccagt gccatcctga ctttatcagt gaggtttgca     26100
     tcaaatgtaa tgagggcacc tacagcaggg gcgaaataaa tgctgatgaa ttggcgcata     26160
     tgaaagaaag cggtaggcaa cgcaacaacg acggcaggtt ctttgcaaca tatatttgga     26220
     tgcttttcac aaatgttctg tgattcggaa tatgaacttc ctctcaaaac ataaatagag     26280
     atagattgga gccttgaaat aatactgcat cgtgcgcaca cttttcaaac aaaattctga     26340
     tgagctcacc tatatatctt tatcagtttt gaaggcccgc tctgtatatt aggctaccag     26400
     cggctcaatt agtatcagtg aattatttgt tgtacgtttt cgtaacctca atctctcacc     26460
     ggaccctcaa gccgcaggtt tcccgaaagc ttttgaaaag tcatcaattc aaattgtgtt     26520
     ccattcaata tcaagctaaa tgctttcaaa aatgggcata tttttggtca aaagcttgtt     26580
     taacttcaac atttgataaa gatgcaaaaa aacagaacaa gttttttagt atgagagtcc     26640
     atcaataagt ccaagtgtaa tcaagtgttt gtccttggcc gttttgaatt gaaagctgct     26700
     attaaactaa gccacaagtt tcaggagcat caaattttgg acatctcgac tcatcttcag     26760
     gaaatattta aattgagtct tctatttcac aattcgagac ggctggccat cattgccaaa     26820
     atgaagacat actacgcagc ttttcgcttg atctgtggaa cagattctca cgctatattc     26880
     aagtttttca tttacgtcat aaaatatatc atttaatgtt actgatcgat catgttggga     26940
     aacaatttaa gcagattcat tgatgtaaat tcttccttcc catggtttta gggttttgga     27000
     agatgcgtca acttggcctt cgtcataatt tccgaaagcc agggagtatg aaacatcatt     27060
     tggaaattca aagtcaactt cgtccgaact aaagttcaat gtcgtgaaca tcgtcttctt     27120
     tccatacttc ttcgtaaagc tgaacaattt tttattttcc aagtcgacga attcaaaatc     27180
     gtagccatag acagcaatgt ctttatgttc ctttctaaat tttaaagctt tcttccaaaa     27240
     gtttagaaca gagtcagggt ctttctcctc cgtttcgaca ttaatacctt ctctgaacga     27300
     ttcattcaag tagaaccacg gcttagcatc agggcccgaa aatccagcgt taggctcttc     27360
     gccgctccat tgcatcggtg ttctcgcatg gtctcttgaa attagagcga ctgcttctaa     27420
     aaatttcttc atctgcacag aattctcacc gtgttcctct ttgatcaccc tgaagttgtt     27480
     tctgatttca acatcttcat acttctcaac tggccagttt ttgaaattta tctggcctaa     27540
     ttcctggccc tggtagatat acaaggttcc tgtcaaagcc gtcaacaata cagaaagcat     27600
     cttgccagaa acaacgcggt atttgggaga gtcatcaccg aacctggtaa ttgagcgagg     27660
     ttgatcgtgg ttctccaagt acacagtaga ccaacagtcg gttccgttta tgtattcgaa     27720
     gagctccgca agtgatactt tgaaatcctt caaaacagct ggaactaagt tgtagcggaa     27780
     caatggtgaa gttccgacat ctgtgtgaga aaagttgaat agttccccca gttcatgtct     27840
     tgatgcgctg gtgtacatct ttttcacttc attgggagcg tgttgcatct cgccaacagt     27900
     cattatctcc ctcccgtctt tcactctgtc tctcatgaat ttgttcattt cttggtggaa     27960
     ctcgtggatg cgagggccgt tcaaagtcag agggtcgctg gattgccact ccgagtcctt     28020
     gtcaacaatt ggagcgtcgg ggagacctgg aactttcgag tacagacttc ccacgtcaat     28080
     ccggaatccg tcgacaccat ggtcaagcca gaatccaaca gagctttcat aaatcgcttt     28140
     tctgcactcc tcactctccc agttcaggtc aggttgtgtg gaggcgaaca agcgcaagta     28200
     aaactcctgt gttttctcgt caaaggtcca ggcagagccg ccaaagtaag atttccagtt     28260
     gttaggaggt attggcgctc cgttcttgtc gtagccctta ggaggcctcc aaaaaaacca     28320
     gtcgcgcttg gggttggtct tggaggatct gctttccttg aaccactcgt gctcgctgga     28380
     acagtgattg atcacgagat cagtgatgaa tttcatgccc aacttgtgtg tcttctcgat     28440
     caccttgaaa cagtcctcgt ttgtaccgta cgtgggccac accttttcgt agttggcaat     28500
     gtcgtagccc atgtcgtctt ggggcgagtc atagaacgga gagatccaga tagcgtctgc     28560
     tcccagctct ttgatgtaat ccaacttgga gtaaattccc ttcatgtcac cccagccatc     28620
     gttgtctgag tccttgaaac ttgctggata gatctggtaa acagtggctt ctttccacca     28680
     tttgggttca gtttctggat gatttggcat agaaaccatt tttaatctga aaaagatgat     28740
     atgttgagtt gcgcgaagtc aattgctgtt gagctactga tcgataatgc tttgaacttg     28800
     tgagagtctt gaatttgcca aaagtgcccc cttttatatc atttgtttaa tatctgttta     28860
     catcagttgt tccggtcatt gttggcaagt ttgttaaaaa tccggggcat accccgaggg     28920
     cataccccga ggacaccccg tgtggtctct gtggccacta gaaaagcctg ggcggcacga     28980
     ttatgaacaa gaggttttac gcacagggac gcggaaaaac taattgaggg gaaaaaagta     29040
     atactacccc gcctcgaaaa aaatggaacg tgatgagcag taagaggcgg ttctgagaat     29100
     tttagaggcg gaatacgtct ttcccgcgat tcttgggtaa tcttgtggag tgacgcctga     29160
     aatgcctgcg catattacag aagctttgcc ctgaatcatc tatccacatt tttccgcact     29220
     atcgaggggc attgtgtggc ggacggaagc gtaagatgga aggaaagagt ggaagtatac     29280
     gatgaaaaac agagtggaaa aataaagact gatgatttcg gagtattggg ttgattttgt     29340
     ggggctccag atccataagc tggagtgcgg aaatattgct agggtaacgt gtcgtaccct     29400
     gagccagacc gtttttccta ggaacagctt tgggggcgcc tgcagaattg cttgtaggaa     29460
     tggcgttcaa acagggctgc cgcgaacgct cgttccagtt tgccaggaac cagggcctgc     29520
     agatggcggt ccagatgcgc tgtcgcgggt gtttttgccg gcccttcagg agccaagatc     29580
     ggatacggca gttccgctac gctgccgtgg gtgttattcc agatccgtca ggaaccaggg     29640
     tttacagatg gcagttcagc tgcgccgcct cgagtgtttt cccgacccgt cgggagccag     29700
     gatcggagac ggcagttcag ccgcgccgcc gtgagtggtt ttcccgcccg tcagagagta     29760
     gggtctgtta acggttgttc ttcggcgcgc cagctgcgta taaatcgggt ggtgtttgca     29820
     gaagtgttac tttcagattg ggagatgcca ttgcttaact tatccgtcca ctaaatcaat     29880
     tattactgtc atgtcagagc ctggagttaa gctggatagg gtctcgagta atccagttga     29940
     gggtagcaca aaacccggtt caatttcgtc tcatgagaag ctagatattg aaagagaaaa     30000
     agatttacac aactttcctc ctcacgaaaa cgatattgaa cttcctaagc agccgctttc     30060
     tcattatttt tcgatctcaa ttctgtgttt gatgattgct tttggaggct ttatttttgg     30120
     ctgggatacg ggtaccatat caggctttgt taacctttcc gacttcgtac gtagatttgg     30180
     gtctcggaat tctaaaggcg tctactacct ctcgaaagtt aggatgggtc tgatcatatc     30240
     tatcttcaat atcggctgcg ctatcggggg catcgttctt tccaaaatcg gcgatgtcta     30300
     cggtcgtcgt atcggcttaa tttccgtgac gattgtctac gtgataggga taataattca     30360
     aatctcctca actgacaagt ggtatcaata cttcattgga aggattatct caggtctcgg     30420
     ggttggtgga attgccgtgc tttcccccat gttactttct gaggtttccc caaagcatat     30480
     cagaggcatg cttgttaatt tgtaccagct tctaggaact atgggaattt ttttaggcta     30540
     ctgtacgaac tacgggacca aaaaatatac tgattctact caatggagag ttggcctcgg     30600
     tttatgtttt gcttgggcaa tgttgatgat ttcgggcatg ctttttgtgc ccgagtctcc     30660
     caggtatcta gttgaagctg gtaagttaga agaagccaaa cgctcgcttt caaggtcaaa     30720
     taaggtttta attgacgacc cagcgattgc agcagagctc gatgctatca gtgcaggtgt     30780
     tgagtctgag cgcttagcag gcgatgctac ctggggagag ttgctctcaa caaaaacgaa     30840
     ggttattcag cgcgtaatca tgggtatcat gatccagtcc ttgcagcagc tcaccggtga     30900
     taactatttt ttttactatg gcaccaccat tttcaagtct attggcttgg aggattcttt     30960
     tgaaacatct atcatcatag gggctgttaa tttcttctct tcatttattg caatttacac     31020
     aattgaaagg tttggtcgcc gtacttgtct gttgtgggga gctgctagca tgttctgctg     31080
     cttcattgtc tttgcatcgg ttggcgttac aaagttgtgg ccggaaggtc cagatcaccc     31140
     tggaatatct tctaaaggcg ctggaaattg catgattgtg ttcacgatgt ttttcatctt     31200
     cagctttgct accacttggg ctggatgctg ttatgttatt gtgtcggaga ccttccccct     31260
     gagagttaaa tctaagggaa tggcgctttc tacagcagct aattggatgt ggggatttct     31320
     tatcagcttc ttcactccgt tcatcactgg tgccataaac ttctattatg gttacgtctt     31380
     tatgggttgc ctgatatttg catattttta tgtgtttttc ttcgttcccg aaaccaaagg     31440
     attaactctg gaggaggtcg atattatgtg gctggagtct gttcctgcat ggaattcttc     31500
     gtcttgggta ccaccaacta ggagaagtgc ggactatgta gttgacacgt ctagtaaaaa     31560
     tttcttctcg aaattcttct ccaagaatta gcgaatcaca atttcaggct gtagaaggaa     31620
     ggctttgttg cctcgattca ctagccttcc cgaaacattt gactgaatgt ttttattcct     31680
     cagaacagac ccaaacgctt gagaaattca tgtatatggg ttgataagtc gttgagataa     31740
     acttgtttcg tgcttagaaa gcaagttagg atcatcttaa cggatgaccg tgaacaaaat     31800
     cccatgctaa tgtcccttgt tattacgctg cttttgtcac acgctttgat caaaatcaat     31860
     cctcaataag attacccaag aatagaaaaa aattaacaac acacaacttc cacatatcgt     31920
     aactgccttt gacactcaaa cttcggcgag atcaaaaaat actagggaaa gattctccag     31980
     agtattcatc ctcaaaaact ttgaagtagt caagaatgtc aaggctaaat ccttgagcat     32040
     cttcggccac ctcctcggat aattgttcgt tgcggtcgct taaggatgat acatcattga     32100
     cttcaggtgt gttttcagtg agtttccaaa gctcaagact ttcaagaatg gttttgaagc     32160
     tttctaacag atctgaatcc atagctccaa gaacgttggg attgaacaag tcgtctttta     32220
     tagctttaga ctctttgaat ttaagacccc actttaaaaa gattcgattt gcgatagact     32280
     cgggcacttg cttataattc ttttcgtatt cccaaaatct gtttgtaact tcaggcaaca     32340
     tatctatgtc aacaaggtga agcacatatt tagccatgca gaccaaacga tagcatgaga     32400
     ggaatcctag gccccaattc gtagattgga gagaaatcag agatctgaga gcctgcgcca     32460
     agctttcttt gacattaaca atcatttgta gactgtgaga gctatcggag tggtcgtctt     32520
     tttcatataa aactctttcg gacttaacag acatcttaag ctggcgttcc gcaaacgaaa     32580
     gcttgaacag tatactgcac ataggtatta aagtccgcag cactgagtct agcgttattc     32640
     gagtaagtgc atatttgtat cgagaaaata gggaattttt ctccatattg tccggaagct     32700
     ttttcagtag tttaactatt tcaagagagc gacgaaatgt gagtttcaaa tatttccgat     32760
     agtattcaag gtacctatcg ggttcgttac ggcacaaatt ctcaaaatgg actgtaagtg     32820
     ccatacttat attcaaaatg ataatccgtc cgcgaaggtt atttgcataa gttttgcaag     32880
     cacgaatggc attatagtca atttctgcct tcgactcagc gcatttaaca gtaccttttt     32940
     ctgggcatga aaaacttgaa atttctgtga tatcagtgag cgggaaaagt tgagaaaggg     33000
     tgatttcagc tctagaaata ataatttcga tctctgacaa caaaataggc ttgtctaggg     33060
     agttacacgc tgagtttagt tttgtccata tccttcgaag ctcatattcc ttatgggcaa     33120
     actcgtgaag gcgcgtatca aaactgtttt cttgcccttc gtcttgaatc acagaagaca     33180
     tgtaactttc tttgtcctct ctgcctcgct tcaagaagct ggacatgagt gcatgagtag     33240
     actctagact attaccattc agaagcagtt catttgttct cacagatact acacccatcc     33300
     ataatttgcg tcggtaattc aaaaaggatg aatgaaactg tgaagactca acaagcctag     33360
     ggtacataga gggatcatta tgaagaccca agataacaga aagatgagat aaagtgccca     33420
     gcaccaaggc tacgtgcggt ggtaaactga aattgacatc atccagatca taagattggt     33480
     agatccacaa aaatagaagg cagcagaatg tgttttcatt aggaagtctc aggaagttca     33540
     aggcattgag acatttttga gccagaatta taacatcatc tttaatatta ttgtgcccaa     33600
     atatgtcgag ttttttggcg gttgccgatt ttagtggatc ttgttgcatg ttaagtgctg     33660
     cttgcgatat tttgaggacg acgagaagaa tagccagatt ttcgagcttg ttgtggagag     33720
     cactggtgcc caacataatg ttgtatcttt gggaaccgtc actacgtgcc tttagtacct     33780
     cactcaagac cttttcaaaa gagggaacat caagaaatgg atgtagaggg taaacggcct     33840
     catagaagca atcaagcaaa aatctaagcg cggcaacatc tggtaatata tcttgaatat     33900
     tggttacaag tgaaacaagc tcggctggat acgcagacgt ggacccgaca ttgtcatcga     33960
     agctccatgg attttgaaaa aacacaagct ttataagatc attgccggcg cgtcgcctgt     34020
     tcattagcat gttcgtcttt tttatctcct ccataaatac attaaccggt atctcttgcg     34080
     tacctctgcc ttcgttattc gaatcttgac gtgaattcag tttgccatcg taagtgaatg     34140
     actctggatt gccgtttgct ggggccgagt gcatgccagt gaggattaca ccggttacag     34200
     aaccagcgaa cgcacgaagg aagtggtcgc gctgcatcat ggcaagggcc gagaatggct     34260
     tgtgtaaata tctcatttgt tcatgtgcca ccatggtatc ttctggattt ccaaaattga     34320
     cgtaaatctc atgggctgag gcgctagtag gagcacgtct tccactgccg tcggcataag     34380
     caaaagtggt gccgtagcca caacagcttc cacagctgca tcggcatctg gtggaagctt     34440
     ggggaagtgc taattgctca tctccaagtg cttctgaatg cgcttcggat gtcgccgctc     34500
     cgctttcacc aggagttctg ctttctgtag ttgttacact ttcgcctgtc catatgctag     34560
     tctcgtcgcc tgatatatgc cagtctgctg ctgaacgcga gcccgacgcg aggtaagtgc     34620
     acggaaggcc agtgtcgaca caacggctac agcgtggccg cttcttgtca catttaatct     34680
     ttctacggcg gcactcctgg cacacgaacg agggccgatt acgcttttgg atcttgatag     34740
     ggtgttgatg ttccatagcc ctttcgtgcg gtttgcgagt ttctcgtgcg attcggcgtt     34800
     atctcgtgcg taagtgatac cgacatcttc aaataaattt tcctaaagtc aacaaatatg     34860
     tgcttggcag aagcttcttt atatagagag cgaacgtaac ttgattcacc cagcgctaaa     34920
     ctttgtgcta aaagtgttgg ctttaaaaga gattaaggtt ctaaattgct gtgtttacta     34980
     atgcaaagtt aaacgtagac tgtaattgct ggactttggc atcggattaa aatgctctcc     35040
     ccatacccat taaacaccgt cagcaataca aaagataccg tccaattgat aggttgcatc     35100
     agtttttttg aaaagaaata gggtttgtga ctctttgcgt tgaacttgga gatgtaacgg     35160
     atccatgttt tagctgcata ttgggcatca ggggctaact taaaagcaca gcatccatct     35220
     aaatcctact atttaagctg gttttaactt attgttgtca acaagcttgt gtggaattaa     35280
     taattacacc aagttaacaa tttcgatacg gtactttcct gtttgcctga catattaaca     35340
     aaaatataat ctgttgacat ggcgttagtc gtgagggtta gtgccagaaa atgagatccc     35400
     agacattcca aatgctcttt gtggtgcgcg gcaatcgttg ggatggtttc gactatgagc     35460
     aggctttcag gagtgaaagg cagattattg gatgcatcaa ttgatatcca ctttctcttt     35520
     atctaatgtg cggcgcatga catggatcct gtaaacttga cgaaaggttt gaagtttgct     35580
     ttgaactttc tcgcttgctt agctgcattc tgcttttagt catgggcaac ttataagtgg     35640
     caaaataaag ccatatttat ggccaataac tcttcttttt tggattgttc attaacagtc     35700
     tgaaaaaaca tgatcactgt ataaagaagg accaaagctg tcacttttta accagttggt     35760
     ccgtaatcag tttttgaaac aaattaatta gcacacacag ctatctatat atatatatat     35820
     atatatatgt atgttggttc cctggtctcc cccaaaaaca atgtgggccg ctcttcaata     35880
     aaattttggt gtattattac tggtgtattt gccgtaatca gcgctgcaac ttttaaatta     35940
     ttccagtttt gaagcttcac ttcagcacct ctgcgcaatt agattgatta cattgagggt     36000
     tcctttaatt actttcgagt gtcgtgttta taattcttcg aaatgaacat tggtgagcgc     36060
     tagcaacacc aaattcaaaa gtggccgcga tttcctagca attcattcaa actcaggcat     36120
     ctcaaagcgc tgtcaattac cagtctttgg cgatcagcat catagtgggt tccggttccc     36180
     gcattcggag atccgggaac tgtcataccc ataggtgatg gtccccatga gggagtataa     36240
     catatttcat cccatttaca aactttttcg catcggtaat gtagctcaat ccatcctaag     36300
     tcttcgatca agtcatcgat ctcttgctga gctctcgtga cagcttgagc tgcttcaatt     36360
     gaagccccac tctcctttcc catatgagaa cgcacaatgg gtaataagag ctcattcacg     36420
     tcgtaaattg cgtcgacaac ctttctaacc acattaacac tggcggacca aaccaaaaaa     36480
     tctgagttgg tccgtaggtc tttcaaaggt ctgacgtatt ggtaaacagc aaattctctg     36540
     tcatttccat attggttttt gacgtcatcc ttggccttga atcttaaaga gaagttcagt     36600
     gtaatcgcag ttgcgttgat agctatattt tctgaagagg aatcatctcg ttgtaatatt     36660
     ccgctcaaca ttctcaaaat tggagcaaac ttatcgacaa cctcatcgaa aacgatttgc     36720
     caatcagtgc tttgggacgc atcgaaccct atactcagta cttgctccag gtcttcaacg     36780
     attttcagct gattttccca tgacgttccg tcattgagta atcttctgtt gttggggtct     36840
     ggattgataa cagtcctgtt aataccagta actaaatgcc tgtagtctaa ctggattctc     36900
     cgttcccctt tgtcatgaac agcacctgcg cgcaaccaat taaagctttt aactccgtaa     36960
     aagttttcca aaacctgctg ccacgagtct tctttgtcaa gaagagcttt ttgctcatct     37020
     gtcaggtcct cttcaatcag gtttccgtca tcgtccaacg gccagccgtt ctccttcgaa     37080
     ataacgctag gtggtggtag gcccagatgt tcgctaggat tgaccagttc taaggccgat     37140
     actaattcaa cggcagacga ggaaaagtta cataggacca cttcaaatcc aacttcaact     37200
     cttataatgc cgtcaagacc aaaaggcttc ccccattcgc agatcctcgc ggcaaaaata     37260
     cgttcctgca tacctccatt ttcgccgtcg cctgaaaggt tgagtttctt ttcagccacg     37320
     ttagaaagta actcttgggt atccatctca cccgtttctg tttttgcagc tgacgcaccg     37380
     tcaagataga gaaatttgtt caagtctctt gtagcccgat aggtaagcat cttttgcgag     37440
     cttgtcaaac ctggacctct tgacggctta tcaggggtat ttactgaagt attactcccg     37500
     ccgggtttct tgtcaccccc aggcccgcgc ccaggaccac cacgacgctt ttgtaaggac     37560
     tttctgccgt aagatggcga ccttaagcca aaactgtaac taaattcatg gtccatcgct     37620
     aaccattcaa atgtcgttgg aacctttgat ccggcatggt acatcagagt cccttgaggt     37680
     atgactgcag gaaaataaga aactccgacg ggatgaatgt ctgaggaaga ctgcctcaac     37740
     gctgcgcgaa ctgagttaaa gagagcagtg ctattttcaa aatcaagctt tcttgtgtaa     37800
     tccaagtagt tatcccagcg gataagggaa actgcagtac tcgtttcctc gctagttttt     37860
     gctggagacg tcaggcttga caatatatca ttggtttgga agagtcttga ggacgagaaa     37920
     actaacagaa cgagtattcc gccagctgca actaaaaagc tcagtcgcct cgtctgcatt     37980
     atgaacttgt tctactaagc atttttcgga agatttattc caagtattgg caatcggacc     38040
     cgatatttta atatacggcg tactaggagg agctccagcc tcctttttca tggcgttatg     38100
     tgggtgccat aatttttttc catataggta ccgagcttca tgtttatctt tttttttttt     38160
     cactgaggtt actaagatct tggcattctg ccattcattt atttaaacta acacgaaata     38220
     cgagtgtagc agattagcat ttggattctg agttgcgcgg cgcagagcgt gcttggctga     38280
     ggcccttttg ataagccttt tttgccgcgt cctctaagcg ttcatactct ccgctttcct     38340
     tgcacatttg atgaaatgcg ccgttctgtt tcagcaagag gtagggatga ttgttttcct     38400
     ttacaatacc ggagtccaga actatcactt ggtcgtaatc tataatggta ctcattcgat     38460
     gcgctacagt tattacgatt ccaccacttg aaaaatcacg caccacttgt tgtatagttg     38520
     catccgtctc atggtcgatg gaagcagtag cttcatccag tatcaaaatc ttagattttt     38580
     gcaacagagc ccgagccaaa caaagaagtt gacgttggcc ttgagacatg ttttctccac     38640
     cttcgctcac caaagagccc agtgaattga aagtccttac gtcatccgtg cctgagaaga     38700
     gcccaatacg tctcgcaaaa tgcgttagtt cttgatctga gtaccggcca aaagggtcaa     38760
     tgttggattt gattgttccc gagaataatg acggatcttg tgggatgact gtgagctctc     38820
     ttcggagagt ttgaaggttc agcgaggcaa tgtctatccc gccaattcgg atagtaccat     38880
     ttgtaagctc gataagccga aaaagtgaca tcataactgt cgattttcct gatcctgttc     38940
     tcccaacgat agccactttt gagttgggga gaagtgtaaa tgaaacattt ttcagaacat     39000
     ccggaaggtg cggtgcatac ctgacgtaaa catgatcaaa acttatttca gcaccacctg     39060
     accattgagt attgataaga gccccagctt tagtgtcctc gcagtcaatc tccgtgtatt     39120
     ctttgatcct ttccactgat gtcatcttga tttcaacatt tgaggagact gttgcagtcc     39180
     aaagggcact ttgagaaaat ggcattgcgt acgtcagagc caaccctgcg aggcctgcgc     39240
     cgagctcctt agcattcagg agcgagagag tggcagttgc gcctaaaact aatgacccca     39300
     gtacttcaac tcggaggcac aaccatagct gaacaacaga cacatagtaa gcaggcctat     39360
     tgttcagatc aagctttctg aaaagctgtc ccatacagct tttttccttc ccaaaccccc     39420
     taatcgtaac aaatcctgac aaaagctcag agaactgctc aaatatgggg gaccttgtga     39480
     ttccttcata ccgttttaag tctctgaacg cagggatata ggacgtaatc atcaccgcat     39540
     aaatgatacc caagagaaat gcaaagatca agaacttcgt tgcaattact gagattagca     39600
     gcaaaatcgc tccgaggcta gtgatggcaa acaagagttg caataaaaga accatcagct     39660
     cctgctctaa gatttcaaag tccctagtta ttcgattcaa aattctgcca gccggtgtga     39720
     agtcaaaaaa ggtcatttta gcgtgtagga cgcgattaag tatttccgca aaaaccttcg     39780
     aagatgcttc caaacctatg cataggaact ttagcataat gagagtggtc acagaagcat     39840
     ggaagagccc tattgctgcg taagtgctta gataatagat ggaagacttg tagtgttcat     39900
     ttgcaccatc ccccgaagag caccaaattt ttatccagag attctgagtc atttctattc     39960
     catgagttaa acagagcagc attgtgaatg ctgttatcgt cctccaccct ccgaggtgct     40020
     tcaccagcca gttataaact tcgatcttta ttgatccatc ttctttgtgt tcttctctac     40080
     taaatccagt gtctggttgc aaaatcattt ctttctttgg ttttttgttt ggtttcattt     40140
     cagctttttc gagttttgag ggctttgaat aatcaaattc agaatcaaaa ttaaagtctc     40200
     tggctttccc tatcttgcta actcttccat tatccaacaa tataatcata tctgcatgct     40260
     tttgaactaa tgcaatgtta tgagtcgcca aaatgcacgt ttttcctttc attagtggac     40320
     ccattatgca cttttgaaaa atccatacag ccattcccgg atcaacagcg ctcaagcaat     40380
     cgtcaagcaa taaatgttca gcaccagaat aaactgccct tgctaatgcc aaccgttgcc     40440
     tctgtccgcc agaaagagtc atgcctttgt cccctacaac agtttcgtca ccttcttgca     40500
     tttcaagtat atcctcttcc aaaccgcaag catgaagaac ctcctggtat ctttttgtgt     40560
     tgaattgact cgagaaaacg atgttttcct tcactgtggc gtttgtgatc caaggagtct     40620
     gtgagcagaa tgcaaaagag cagcgatcgt catgcatata tccccttgga actcttattg     40680
     atccttcaat caaatcaagt tctccaagaa gagctagaag aacgctgctt ttacctgatc     40740
     ctgaagggcc tataatgaca ttcagcttgt gcaactcaaa atcaatggtc aagtttttca     40800
     acataaagcc tgtatcgaac cggttccaag tcaaagacgc atttcgaaat cccatttcag     40860
     taaaagagtc tttcaaaatt tcatgtttct tcgtgtttga tctattgaga aatttctcta     40920
     tcctctgtat agagaccgtt gtttgaataa ttgtgccaag catcgtggcg agctgggtaa     40980
     ggggatttct caaaagcgca aatagcgtta aggcagtata cgcagaagca acggtaattt     41040
     tttgcttctg taagtatatc gaggcaccaa atgtcgcggc agtaactagg gttggtgtca     41100
     aaaaccaaac cagatgcaaa gtagcccaac aaaacagttt ttttgtgagg aaggaacact     41160
     cggagcttct gaaacccatt ataagctcct ggaaatggtt ttcccagcaa aggaacttaa     41220
     cgtttttgat ggagcccagc atcgcgctaa tggcatttgt tttcttatca gtcatggcca     41280
     atgcttctga ttgataagtt tgcatcaggg ttgcaatctt cacgttgaag ggaagaagga     41340
     tgattattac cgaaactcca acaaaagccg accaaccaag catctgatat agtaatgaga     41400
     tagcaactgt tgtcatgatg cctgcctgaa ccaaatagtg caacgaccca cagagttctg     41460
     atactgctgt agagtcaata gcaacaaggt ttattacctc cccgttcgtg gctccgcacc     41520
     ttgtcttgga ctctgaagaa aacaagctct gcttgagagc tttcctggaa atctcagcgg     41580
     taattattga tttcagctga aaacatactc gagcgcccag ataaacggcc tgtgattcac     41640
     aaagggctgc tatgattttg gaaacaatca ttacaaagac gcaaacccag gccactcgga     41700
     tattggagcc actgggattc tctatgtact caagaatctt tttcatttga agggtgggca     41760
     taaatgaggc aatagcacca gctaaactcc aagtacattg catgattatg ctcttccagc     41820
     agaacgctgt caaacgtttt atcaaagatg tacagccatg gcttctatca gaatatctct     41880
     tgatcacagg cagggtgcga tatttgggtt gcaaatcaaa aatgtcctga aatctcagct     41940
     gcttctggct acgcctaaat atcaagccat ctagccatga aaatgtcaag gagtggaata     42000
     ttgaagaaga tccttcagga gctggtggcg catcgttctg gttaagtggc gggtctgtaa     42060
     ggccgaaaga ctgctgcgat gaaagtgcca atatgctaag caccccagcc aagaatgttc     42120
     cgccagtgac gtatttccct tccaagcttt tcacttgaga tcttaagaaa accagtgtga     42180
     aatgtaacac ctttacgcaa aagataaagc caaacaatag aaagttcagc gctctcaatt     42240
     tttggaaagt tatgaatgat ttcccaccac gatgaagaga tacaatgcga caaagagagg     42300
     aaaccagtaa tgaaaaccaa aatatttgac ttgaaagaat ccatggtgct tcttcctggg     42360
     ttctgttgac cgctctttga aggcttaact ctaacacaat gcaaagaatt atggtaagaa     42420
     gttctgcata gcttttcaac aattcttttc caaacacctt tttgacaact tgttcacagt     42480
     cttgctggct tgactcgcag agtacgcgcc attccagttg agggtagctt gaagcatgct     42540
     cagttatttg atgttccggt tttctgctga taagcgatgt tgaagcatct gcttctggag     42600
     cttcataccc acacgcgttt ctttgcgatg cccaatataa cctcagtaag tcccatccca     42660
     gaagtacaaa gcttccacca gacaatggaa caagaaaact gtagagaaat gccacggttg     42720
     aacgcagctt ctctgtttct gttgcgaatt gcatcatcag ttgttcactt cttgcaacgg     42780
     ttgagcagcg ctcgcatagg agggtatata tagtcgtcaa aacagcaccc tgttagagaa     42840
     gagaaagcag catgtccaag ttgagtgacg acacgctggt acttcgagac tcaatgcact     42900
     taatcccgcg tacctgaggc caacacgcga gatcgaagca agcctcattc tttagaggac     42960
     cctgaaagtt gggtgcagtt cattttcaca gcatatgaaa gcgatgtcat ccccttcgta     43020
     agaaatgtgc aactaggaca ctgaacattt tccgccaaca tgaggcaagc gaatcagata     43080
     cgagcggctc cccgtatgtt tatgtaatta tacgctcgct cggagttcta aaagctgttt     43140
     tgattctttt cgcttcaatt tggcttgttc tttttttgaa aagatacggg tcattggaaa     43200
     atcatatcct tgtggtacat ttaggggtaa ctggggcatt aaaagacgag atacgtcatc     43260
     taacttgggg tgcgttatcc ctccgattct ttgtgatctc atgacatgtt aacacgaggt     43320
     gccgagacac aactcacacg ggccttccgt tgaagccagc ttcacgaaaa actacaacct     43380
     catttggatc agttgagtat tctggtgaat agaatggtgg ctaatacgac ctcatagcct     43440
     atcggcagac ttggttgacc gtaaatgccg taatggcgtt tgcgttccca tttctttttc     43500
     ctcggagttc aggttcattt tcatgtaggg atttctagtc agcaacatac gcctctgtca     43560
     cttaagcaga aggaattcct cattctcgta gagacctggt gatggctctt ttcgttaaac     43620
     gattccaagg gcaaaagtct ccagtgcagt gtcttttgtc aagctcgaac tgttcggaaa     43680
     gttaacgaag gcaagcagcc agctcgaagc ttcgctcgat catccgcttt aatcgctttt     43740
     tgcggtagcg acgcactgtc ccggatcgtg agtggtcgtg cgctgtcttg tacacttgat     43800
     gctaaataaa tggattcgca gttttcataa tataaccagc ttggggtaaa aaaaggtcca     43860
     cgtaattgcg cggtagccgc cattattcat gtgaaatggt tatcaaacaa cggcttttat     43920
     gaataagttt ttacagctgt tcgccaaaag tctttaaaag gacatcagag cccttggcga     43980
     ggacagagga ttggcagaca aacgagagcc cgttccatgt cctgctttta aagctaagcg     44040
     ccaccacatg tctctttcta tcacgcatca aggactcgca cttccctctc cattgaaagc     44100
     gcaaattatt cgtttccaac tcggcttcta aaatattcta tgccagcact actaattttg     44160
     ccagggtata ttgagtctaa taaagttttt gtgatcatgt aaccacagaa ggtctcatgg     44220
     caattggaaa ctaaattcaa aggatcaaca gccaggcgag ttcatccagc gcttctaaca     44280
     actataccaa atttacgtct gggtattata atacacgtgc ttttgtcaat aattcagaac     44340
     ttcgcgtctt ttcacgatac tgtggggtga agtttcgcat gtttgcttaa gttaagcttt     44400
     gcattaatga ttgcaagtta atgcctctgt ttttggagaa taacgttggg aaagttgttt     44460
     cccgtttggc ttttgtgacc gttctgcagt caatatctat tttatgttcg tcaggtattt     44520
     attaatatcc agcggcacta acaagaccat ctaacaaagc agccagcccg acggcgcccg     44580
     gatctggtaa tcctccttca tcatcgagct tgcttaattc ctcttttgca acgtacgacg     44640
     cacggcctac tagagcatcc atctttctcg ttttttcggc acccttgaaa gcggcatcaa     44700
     cagcagtcct aggatcttgg cccgaattca acgcctcaac aaaaggctga agggcatcaa     44760
     ttagtgttct gtacccaggg cgagcacgag tatacttata aagcgcatcc aaagcagttt     44820
     ttgatgcttc tctaaaagta tctactgtaa gggtcttgtc tccggagtcg ctgatacctt     44880
     tcgcaagtgc tgacaagtat atagagtaca gtcctcccga tgtaccaccc atggagtctt     44940
     ccacgatgta agcgatgtct tcaattccgt gtgcggcatc cgtgagacgc aaagtgtgtt     45000
     tctgaatagc ttcctctaag gccctgccgc cagaaacgag cgttgtgccg caatcgccat     45060
     cacctgcaat agtgtcatac caagtaactt tgggttcgac ttccttcacc tttgcaatcc     45120
     ctgactgcag tattttggag aaggtttcat aatttgccgt cacgcctgaa ggtttttcgt     45180
     tcttaactgt ctctagaggg ggcgctgttg gaactttgcc cccggcaagc actttccact     45240
     cttgtgccga atgataattt tgattccatc cgcttgcatt tgtggggtaa tcaaagtacc     45300
     tcatgatgtc agggccggct ttagatgcgt tcagaagcgt gatgccgaac cctggaccgt     45360
     tcaaggccgt aatgaatgtg ccgctcattg ttcttttggg aacaatacta aatttcttaa     45420
     tcagttgttc agacacaact tcggtagcgt agcccaattc aaggttggac atgccgccca     45480
     tattgttgat cataagaacc acatcttctt cggggctaaa ctcgacaaaa gtgttatcct     45540
     ccttctctcc tagaactaga ggtagaagtt cagttacaag ctgcggaatt gatggcagtg     45600
     gggaccgtct ctcggtgccg gattcattgt gaattcccat gcctatttca tattcatcag     45660
     gccccaagtt attttcaggc ttgtggcccg ggaccgtaca gtggtcaaga gatcccgcaa     45720
     ttgtagcact attttcaaca accgccctgg caatcttagc aacttctgat aactccagcc     45780
     cgtgagaagc agcggcgcca gcaattttat gaacaagaac ggttgcgcct agcccacggc     45840
     gaccaacgag agatcctttt ttctttccaa ccgaaacatc gtctccgacc gccacgagct     45900
     ccacattcat gcctgctgcc tttgctcttt cggcagcaag gccaaaatga attatatcgc     45960
     cagtgtagtt tttaacaatc agcagggtgc cctttggcga ctctacagct ttgagcgccg     46020
     aaaaaatctg cttagtggag ggagaggcaa agatagcgcc agcagcaatt gcatcgagcg     46080
     caccatcgcc tacaaaccca gcgtgcgtag gctcgtgacc actgccgcct cccgacacta     46140
     acgtcacttt gggtttgttt ttagcgcttg gggctgaagc agccctgaat acgactctgt     46200
     catgttcgat cacggtgaga ccgggattgc tgcgagcaag tcctagtagg taaggcgcaa     46260
     cgatatttcc gtctgatttg aattgttttt gagacattac aatgcttatt tcatcagcag     46320
     ttgatgagct ttaaataaaa ggttacaaac accagacatc atgcaaccaa gctacgacag     46380
     ctgcttgcgt tcgacttata actggtggga tatcagatct cgaccaaaga ttgagctatt     46440
     tttactgtca caaaggaaag tcatatgacc ttaggctgct ttattattgc ggagccccgc     46500
     gggaatttgc aacctaaact cgtggtatca acatttgaga ccattataga gtgctggcct     46560
     ttgttgtttg agaggcctgc cgcatagttc tgaggaatct ccgttatttc gctagataat     46620
     tagataaccc atggcgccat tttgaaggca cgagtggcaa agctacgagc cggcaaattt     46680
     tatccggtgg tgtccccttg tcagattacg tactcttgca gcatttactg tggtgctgca     46740
     cctaggcaac ctgtgaagtt catttaattt atcgcggggt tgtgaccgca acaaaccgga     46800
     gttcagctac ggcaaaattg tccccttcaa atggtataat ctccacacat tttatcgcgc     46860
     agaagcctca ctctttataa gcagctcttc tctttaattt ttctgccggc acccaaatgg     46920
     gattacagga gtcttaatat gattaattaa tggtgggaga atcaataatg ccttcttcgt     46980
     cgtcatcgtc gtcgatatct tcttcttctt ctgatgtacc acgcgctact agagaacaga     47040
     ggggaaggga aggagaaaca gagcaggtca agtggtcggg aaaccttaag gattccagtc     47100
     aaaaaacaaa aaggggagac agaacttcag tggatgtcgg tgttgctcgt ggagttagtt     47160
     ctggacggaa agccacacat acagaaggca cgaaaaatgt actgtctcga ttaacgcctc     47220
     tgaataaacc tgcggcagaa gatgcgcagc ctcgccatca aaagaggcac cctgtgggga     47280
     cagctttttc ttcaccgaat ctaaagtcct taaatactcc cctcagtcgt gagcaggcgc     47340
     ggcttatgga gtattacctc tccactgcag tacctaggag caataataac tatgttgacc     47400
     cactttatcg ccacctcaac ccatctgttg gtagcacgaa aagcaggcct gtctggagtt     47460
     tgaaccagcc gttgccgcat gttctggatc attcgctagc tgaaaaaatg ctaaagaaga     47520
     acacagatgt caaatctcgt gcttcttcga ggcccgagtc ccgtgaaatg tcccgtgcag     47580
     gctctttggc atctatgaac gattggaaga aattaattgg ccgctcaggt tcttggagaa     47640
     agctcaacga tgttgaggcc caaattccag gcgctactaa aaactcaggg ctaacgagga     47700
     accggaaaca ttctcaaagt caaatagaat tcgcgaataa tcagagacga gctcatcatg     47760
     ccgcttcttt tcaactggga gatgaaagtt gtacaccatc gctgagaggc gaggatgtcc     47820
     ctgcccaaat tcaaaaccaa aaacaggctg gtaccgcacc cacagccgag gagttgcttg     47880
     aaaagcgctt tagatcgagc ctcgatggag caactcccct cgatggaggt cgccttggga     47940
     caggtgactc cgaatcagaa cagcttgcat tcacaaacta ctgggcgaag attaggtacc     48000
     gcttgcggga gccttttgca gagtttctag gaacccttat acttgttata ttcggtgtag     48060
     gtggtaacct tcaagctacc gtaactaacg ggagcggcgg ctcgtatgag tctctgtcat     48120
     ttgcatgggg gtttggttgt atgctaggcg tttatgtcgc tggtggtgtc agtggtggtc     48180
     atattaaccc ggctgtaact atatcgatgg ctatatttcg aaagtttcct tggaaaaagg     48240
     ttcccgtata catatttgct cagattgtag gtgctttttt tggtggagca atggcatatg     48300
     gttacttttg gagctcaata actgaattcg aaggtggcac tcatatacga acagctgctt     48360
     ctggtgcatg tttattcact aaccccaagt cttacgttac ctggcgtaac gctttctttg     48420
     acgagtttat tggcgcgtct atgcttgtag ggtgtttgat ggctttattg gacgatagca     48480
     attcgccacc gacaaatggt atgactgctt tgattgtcgg ttttttggtg gctgctatcg     48540
     gtatggctct tggatatcaa acaagtttca caattaaccc cgcgagggat ctaggtccaa     48600
     gaatattcgc ctctatgatt ggttatgggc cacatgcatt tcatctcaca cattggtggt     48660
     ggacatgggg tgcttggggt ggtcctattg ctggtgggat cgctggagct ttggtgtacg     48720
     acatttttat ctttaccggt tgcgaatctc cagttaacta tcccgacaac ggatatattg     48780
     agcatagagt tagcaaaatt ctacatgctg aattccatcc tcatgatagc ccgaaatcct     48840
     ctgaagttgt tgtggaagag gggagcaaca gtaaggatgg gagtaccaaa tcaaactcag     48900
     cccattgatt ttgcttggca tgtgctgcca ccacgttttt gttttttgtt caatagtttt     48960
     gcgctgcaag gtttcatcac tttaaaagca gccatcaggg attaagtcgt gattttacgc     49020
     tcttatttaa tgtgacattt caactatata gcaggttgat agagaagctt ctcttgaaat     49080
     ctcatgattg gaaggaaaat tcaagaaggc aaaagcgata ggtgttctta ttaggaggta     49140
     tttcaaatgt tgagcgtggt gggagagcgt tgtttcgaat agtctttcct aaaaaaaaag     49200
     tctggcggaa gccgactttt cggagaattt ttagtctttt aacggtcctc gatgacactt     49260
     cgtcataagc tgactcaatt tgcataaatc taaagacttg tttttcttcc caccctctcc     49320
     cttttactct ccttacgcgc agagtggctc tttaagatat ttagtattga gccacaatct     49380
     taacggttgg atgacattta ggttgatcgc tatcataatg tttcgctcag ctcgatttct     49440
     tcatttttga gcagataaaa gagtcgctca gcaacttcag ccgccttctc gaaatctgat     49500
     agatgcttca aatctattat atccgcagct tttcttcctt tgggtaagaa atgttcgagc     49560
     ctggccatga gctctttaat gtgcatggga gggaagtaat ggaaaagaag gttctctccc     49620
     atttcctttt tcctttggct gatggcactc agctggctgt cttttgaggg aagagaagaa     49680
     gcattggccc aaacacctgc tatggctgag gcagtaagtt caaaactagg ccatttcaaa     49740
     ggcgtaactg tgacacccac aaatgcgaga cttgggtcat caatactaaa agtatcaagg     49800
     aataagccgt ctaccatgga ggcagagtcc tttagaactt tctggcccga ttttataaca     49860
     cttaagcccg atactccctc attcaaaaat ggataatgcc agtgatatcc agtcgagaat     49920
     atgatatggt caacaccttc tacaatagag ccatcttgaa aaattacctt gcggttttct     49980
     gatggccgga gctctttaat cctgggcttc tttataaggc cttctgaagt tgcagctttt     50040
     gtcaaccaag gatatatttc ctccttatca ggagttctgg acactatgac ctctttggcg     50100
     actgggaaaa catattgtag tatgtcaatt ccgcttaagc ctgtcccaac aaaaagacac     50160
     ctcttgtttt taaatttatc aaactctcta aagctctttg aatgcaacac cgaatccctg     50220
     tatcgagcca cccactttga caacccctca attcttggaa tataaggaat tgaatagtgg     50280
     ccattgctca ccaagactgc atcgaagtct tcttcatacc aacgggttaa gctactgttt     50340
     ttcggattct ctttcactgt tagtctccac gatccattgc tgaccttttt tattttcact     50400
     acttcggagt tgactcttat atgtttttca agccgatgtg ttttggcgaa gtctaagagg     50460
     ctctcagtga tagagtaatt ggtaattaat ggtgcaatgt ttgaattttg tttttcctga     50520
     ttctcactat atggaataaa ggaattgcgg aggtatcttt gcggaacgtt agaataaagg     50580
     tgctgataga tgccactcgc tgcccaggtt ttcggacttg gggtatcagg tctctcagta     50640
     atcaatggct cagaaaaagt gtaccctctg ttgtagagct cagagggggc ttcagtcgga     50700
     ggtctcaaaa acagagggtc atcgtaacgt tcagaatcca agtctttttg ctcgatgaaa     50760
     tcaggggtat cgaaattggg ggaccaaatt ccgccaattg agctttttaa ttcgaaacct     50820
     acgatttttt ggaatgcagg atttttgttt tcattcgtgt tggcttcgtc aaatttcccg     50880
     tcagagctgt aagctaaatt ggtagttcca tccttgcgag tattgaggag ttcaaatagc     50940
     gaggtcagac ccgcgactcc agcgccgatt atggcaacag attttatttc ctttcttgcg     51000
     tctttggtca ttgcgggaag ttctttcgat cactttttat tcaacctcac cgaaattacc     51060
     ctcgaacagc gattttggtc tcgaaatata tcgatatctg gtttttccct taggcttaat     51120
     agccaatagg ggtcgagggt cttcataagg actccgcata ccacggtact cacatatgac     51180
     ttttcaccta aacatgtact ctaactcttt tgacctctga tcacagctca gatgtggtgt     51240
     cccctggcgc cacattgact tcaaaaaaaa atgattatgt aattgcacca gactatggct     51300
     tttgagcccc cttttgttcc ttcttgggta gaaaaggatt cgactcaggt caacgcgata     51360
     gaccccgtca gtttaaccta attgttacaa gttttcctaa ttgtatcaat ttcattgtga     51420
     ttttttgagc agaacagggc ttcccgcgtg gaatattcgt taattttaaa aaatcttaat     51480
     ttaatggaaa atttagacgc cttgccgctt tcaagctcac taaaatcatg aataatacaa     51540
     agaagaatgt taacatctat agtgaatcta tacatatata tatctgattc ggtagttcat     51600
     aatgggagag atacacagta tcaagatgtg caccagactc ggcgtccaat aatagttagc     51660
     tacaactagg ttgttaggaa ggaaaaaagc ttcttggttt atcagaagca attagttgcg     51720
     gactatcctg tgcaaagatt tcttaatgtg agccgaaacg cccactttga atatttcatc     51780
     aagctgctcc agcgtaaagc gcattgtttc tgggatacat aggaacgtca aaatccaaac     51840
     aacaatatta aaagcgccgt agaaataaag acctcctgaa gctgtcattg aagattccat     51900
     ttttggccat gtcatgctca aacagaagtc tagaatccaa ttcacaaaca tacaggtggc     51960
     actgtgtgcc attctcacgg ttatggacga ggtctcagct accaaagtga agcttacagg     52020
     tccaatccca gcaccgtaaa acaaaacgta cacatacatt gaagccaggc ctgcacccag     52080
     tctgctttgt gcatcgttaa cgttgagaac acctcccaac caaaataaac acaaggcctc     52140
     catgggtaga gtaaatagaa gcattttcct tctcccaaaa cggtcaatca gctgcgtcga     52200
     caaaaatgtt gctaagaaac aaccacctcc aataccaatt gagcctgcaa ttgctgtaac     52260
     ggagtcaaca ccggcattcg ttaaaattgt tgttgtataa gatactaaga tgttgacacc     52320
     tccatactgc tgacccagaa ttccaatcag tgaaacgatt aaggcgaacc tgtttctcct     52380
     gttagtgaaa agagacaaaa actgctgcca agaagataac tgattttcta attcagactc     52440
     gaacttaagg gattgatgaa gaatgtaaaa gtcccgcgca cccgagagtt cgtgaggtct     52500
     aagtttcatt aatgagtaca aagactctct tgttttgccg tgggcgataa gccatcttgg     52560
     ggattcaggt ggaaaaaaga ttaaaattcc tgtgacgaat ggagcaaccg ccgaagaccc     52620
     tatcataagg cgccatgaaa gtgatccgct tatattgacg aaagcccgat tgaaaaccga     52680
     gcccaagcat acaccgagcg ctatgaatgt ttgccatagc attaaaatgg cgccgcgaga     52740
     tatcgctgga gaacactcgg ctgtgtaaat tggtacagtg gaagagttca agcccattcc     52800
     aatcccaaga aacaacctcg cgaataaaag gcagccaagt ccattcgaga acccttggat     52860
     gagcgaccca gcaaatccaa tgaagcaact caaaaaaaca atccattttc ttcccacata     52920
     attgtcgagg tagatagtaa gaggggagcc caaacaagcg gcagcaaggt atggagcagc     52980
     aacggtaaga ccttgtatat taggatcagt gatattgaac tgcttttggt attgtaaaac     53040
     agcacctcca atcgcacttt catccatccc gaagttaata gctgcgcatg aggtacatag     53100
     agcggctaac agcatatgct tagatagcga tgaaagtggc ctttcttgcg cttgtttagc     53160
     aactcgacgg tcttcatcgc tgtagctttc ggtctcaagg atacctgggt tattagccca     53220
     caatgcgccc cgagtcaaca gctctcgatg atcttccaat tcatattccc ttataatttg     53280
     atcaacctca gaaagaactt ctttttctgg ctcatactct ttaaagacag ctgcaacttt     53340
     gattgattga tcagaagatg caacgtcgcc aacctctgta acttccccat ttaacttttc     53400
     ttccactgtc attgtgatat agcctccgat tcaaatggga aggaccgata tgagcagaaa     53460
     gttaaacgca gctgacggtt tttgtattgt cagttttgac tttgcgttag acttggtgtt     53520
     tgttcccaga tgccctttga ctgtgacttc gcagccaata atttatgctt tccactggcg     53580
     ccataacaag agtctctggc gaaagtttcc tgcagtccgt gactttcgaa taacatgaag     53640
     tcatagggtt ttaataccta gttacaaacg tactacaaat ttctccgcgc tagagccacg     53700
     ctcctcaagt tccttcaacc catttcttaa accaacacca aacttttcaa aacccttaaa     53760
     cactttaacg ctgcgaacag ggtttaattg gcctttctcg aataggtcag atgtgaactt     53820
     cacgaaagtc tccccgaata ccagatcctc atgaaacctc ttaatcccca cggcttcgac     53880
     cttaatgtca gggtatttag ccctcacgtc ctcgccagga gcgccgctga ggcatactag     53940
     agactttttc gtcccttttc catctttcaa gatttcaaga acaagctctg ctgtcttctt     54000
     agaaatcacg tcgacaccat aatcgacacc cgttgggcat aactcttgga atttctgcac     54060
     cagttcttca gaaggaagcg ttctgtcgat aacggccgta gcccccaact cctttaggta     54120
     atcctcatat ctcaagcttg acacagcaat gatattcttg aaaattccta ggtttctggc     54180
     gagctggatt gtgaatatgc cgacagaact tgagcctccc caaacaacca aggacctgcc     54240
     ctggtctgcc ttcccaatct cattgaagtc gacgaaagat gagagcgcgg agcccgcagt     54300
     gaccagcggc acaccaactc cggctgcgaa gtcgagtccg aaccttttgc gagtagtacc     54360
     gtcagggaga atctcgcgtg gcagcctcca cacaagtctc gagtcgaata ctgtaaattc     54420
     ctggaatgtg gatgttttga gctcgcggta gcatgtgctc gctagaaaca cctcggcccc     54480
     gattggaaat ctatccctat cgaccttagc acccctgcgg acaacaatac cgctggattc     54540
     tctcccgttg atccatggga atgaatgaat attaaagcgg tactttttgg atttccagtc     54600
     cacatggttc aatcctgtat atttgttgcg gattaaaatc tcgtggtcct ccagtctttg     54660
     aggaacaggt atctgatccg atactattat ttcctcttca aatgacttga caacggcagc     54720
     ctgttggaat aacggcaagg gtgcttcaac accaattaaa ggaccgcttc tgatactgat     54780
     cctcttgagg tgtctttctt gcatttgaga gactaggatg ctcccgacat caacgctttc     54840
     tagttttctc ttgtacattt ttacgctggt agcttggaca attctgctga ggggacaaag     54900
     gctagaagaa agcttcttaa tctaaacact taaacattgg atttgtgctg caatatcagc     54960
     gttatcaccg attcttccac gcccgttttt attctgactt cattggttgg cacccattta     55020
     cactgtcatt ggcctttttt ttgcgtcaat atttcgaaga cattgtgtct tgccatgtcg     55080
     ccggcaaaat attgaagaca aaggaggcgg aatatagaaa aatctacaag ccacggcaga     55140
     tagttgggga tgatgccatt gaatgcggtt cgatagtacg tctgggccta gcatcagtat     55200
     ggtattttga taggggaaaa tgctttcgtg tcaagataaa tagaaacgaa gaggctttca     55260
     tatcggatac aaaagagaag gttgaggcta tagatcgcta gcatcgttgt ccttttgaaa     55320
     agcctatcca cagcgaacgc tataatgaca attgaccaca cagcgaaacg cagctcggag     55380
     ctcgaggtcg gaaacgccaa gagagcgcaa ttgacgtctc caaagcgcaa aaatttgatc     55440
     gtcaacgcct tcatcatggg atctgcaggt aaccaatctg ttggaatctg gaaacatccc     55500
     caagacaagt ccgcggagct ctatcaatca ccagaatatt ggataaatct cgccaaactt     55560
     ctcgagaggg gaaagttcaa tgcggtcttc ctggcagacg tactgggacc gtatgacgta     55620
     tataagggtc ccgcgaacgt tggcccggtt gccaaggctg gatcacaatg gcccatctcg     55680
     gaccctagct attttatccc actgatggca gcagtgacta caaaactcgc ctttggaatg     55740
     accatttcaa ccatcagcga gcagccgtac cacttggcca ggcgcttggg aacgctcgac     55800
     ctgcttacca acggaagagt tggctggaat atagtgacgt cttacttgga cagcgcttcc     55860
     agaaatttgc ttgacggcaa gaatctgcct cctaacgagg agcgctacgc ccgagctggt     55920
     gaatacgttg atgttatcta caaattgttt ctaagttcat ggagagacga aagcttcaag     55980
     gctgataaaa aaacaggagt gttcaccgac cctgaaggcc ttagacacat caatcatgtg     56040
     ggcaaatact tcaatgtacc tgggccagct atcactcatc ctagccagca aaaactacca     56100
     gttataattc aggctggcac ttcggccaaa ggaaaagatc tttctgcaaa aaacgctgag     56160
     gtagtttttc ttgctagctt gactccagaa gctctcggcg cttctataaa agagataaag     56220
     cagattgcga ctacaaaata ccataggaat ccatcgaaaa tcaagttcat tggactggtt     56280
     actgttatat tgggagatac tcatgaagag gcagaaaata aatacaacga atacaaagca     56340
     aactattccg atgaggaggg agccaaggcc atgttttcgg gttggacagg cgtagatatt     56400
     gacaagttcg aggacgacga ggtactttct aacgttgatc atattgccat tgcatcggcg     56460
     gtcaagaaat ggcaaacagc ctatcccaga gtggagaagt ggacaaagag ggctatcata     56520
     gatgaaatca aggttggtgg gagcggccct gtattgatcg gaacccccca agaagttgca     56580
     agtgaaattc agaactgggt ggatatctct gacatagatg gttttaactt tgcgtacaca     56640
     gttcttcctc agtctttcga agagattatc gacaaactgc tgcctgagct tgaaaagctg     56700
     ggattgttct ggcatgatta cccaaatgct tccgactctt ccaagtactt aactttcaga     56760
     gagcaattgt ttggggagcc atcgcttgat aagacacacc cggcctcgga cttgagatgg     56820
     aaagcagatg aaacgagaga ggcttacgaa gcaagaattg gggaagcctt gaaaaaatta     56880
     gtgttgtaga caatgttcta attgttatta atttcttgaa agatctggaa agacgactta     56940
     ctgcgatttc taaaggaaac ggcacttcaa gagcgcaaat gccggagtca aaattaataa     57000
     aagttagact gcattcatac ttgaatggtg tataacatga ctaactcaag caattggacg     57060
     gtttagatac ttattctcat atcagcattt aataaggaaa tgaatataag taaatttata     57120
     taagaagctt acaaaacctc accaattcag cctattttat tatatagcgg ccacattgat     57180
     ggaagtctta tcaagttttt ctctttcaat ggagctagtg tctgtttgag atagatctgc     57240
     actgctatct gtcgaagctt ttcctattag tttcttgaaa acgaatatca aattagactt     57300
     tgattcatat aggggataga aaatgatcca cattgcagcc aggaaggccc atatgataat     57360
     tatgcagacg taaccgcgaa acaattttct tgaaaagata tatttggttc catacattga     57420
     taatgggata atgatcagga aaatgataaa ctgacagaaa accaatattt tggtgataaa     57480
     aatgtgcttc ctaagatcct tgactgactc tttagatact tgggaaaact cgatctcgtc     57540
     agagtctgca tcatccgcta tttgtgtttc aaagtaagtt tcgttcattt cattaaaatt     57600
     ccagctctgg gacttgactt gcgaaaggat ccatacgaag atgccacttg aaaaaaccga     57660
     aataaagttg ccgaaagcca aaggttcact gagagaaaga gaagctttat cgactcttcc     57720
     gtcgcttgag tagcgcgtgg cggaggctac ccagcccaca ataccacaaa gtgttgctga     57780
     gggaacacca acgaccagag ccattgtatt catcttcttg taaaatagca tacccaataa     57840
     cccaaaaaat gctggcccaa gagcaattcc cacaaagctg aacaaccacc caagggttac     57900
     gccgatgtag ttaaatacaa ctgccaatgc tcccatgcat agcgaaaagc cgatgacgtt     57960
     caggtgcgag acatagacaa gttgtttacc agaagccttg ggattaacgt aagtcttata     58020
     gaagtcatat gtcaagattg aagagcaaga tatgagctct gctgacatcg ctgacgtcgc     58080
     tgacataaaa accataacaa cagcacaagc tgcgcctgac tttccaaaaa ttgcggtcat     58140
     agcataaacc aatgacaagc cccttcctgc ctctaggtca gttaatttgt ttggatatgt     58200
     gaagaaagca ggattcttgg ttaaagcaag ggacgctaat cccatcgagg ttccaagtcc     58260
     cagtggtatg atttgccagc aaatcccacc tagcatatag cctctcataa cctccttact     58320
     acccgcggca atagcctttt gtgaatatga tgggtccata aaaactgttg cagcccctcc     58380
     taataaagcg ttccaagcag tcagaattat atctttgttg gcaaatgtca agtaagagcc     58440
     gttggctgag gactcaagtg gaaacgactc ccccatgtct ttcagcaggt catacatttt     58500
     gtctggagat ccgataaggt ctgaagtgca atagactgtc acaatcgaaa caatcaccat     58560
     tatatagatg acgattgtgt gtgaccaatc agataaaaac gtagcttgca atcccccaaa     58620
     gagcgtgtaa atgcatacac tgactggcag cagaaaacat gctgctatta tattcatacc     58680
     agttgtgtaa gcgatcccct gcgatccacc caggagaatc atgcctgaca caatcacgtt     58740
     tgtgccgagg gagtaaaaca agtagcaaaa gtggccccac ttaccaaatc tcactttagc     58800
     gacctcagca atagtgtgaa ttccaggaca tttgagctta atttcgattg ctactagggt     58860
     aaacacgagt atttgaaagc aacccgtaac actgtaccaa tacgcgccca caatcccgta     58920
     ggagtacgtc cacaagttgg aggtcagtag tgttgctggc catgtccagg aagatacaac     58980
     agccgaggat ataagaccct gcttcacatt acgagaagca gtcgtgaaac gctccgagtc     59040
     ctgtttttgg ttcaagaact tcgcaattgc ccatgataat gctatcatga ggacgctaaa     59100
     cagggcacct aagccaagca cgataccata accataacct tggttcaaca caaattcgct     59160
     catgttactg cttagttggg tcgactctcg agctaaagtt taaaagttta atgcagtaca     59220
     tgcatgatgc cataaaagcc aactttttat attaaccatt agggactata tgccaaacct     59280
     gataataact tttaccaaga ctctagccca actatgatgt ctttttccac actggtcacg     59340
     ttaagtccaa cttcttgact tttaatgtgg ggtctgggcc ttcaatagaa ttgttaatta     59400
     ctgtggtgtc aacggcgctg ccagagacaa aggcaaaaat gatatcaaat acacctaaaa     59460
     agacacaacg cgaaatcaca gcaaatgtag tgactgctat tatagcgata gaggccacat     59520
     aaattacggt tgagaccaca gtctgatgaa ttaatggtgg gcaaaacgag aattccgcac     59580
     acacgaaatt agagttagct gcttcgcctc gaatattaag cagtctcgca ttggttcttc     59640
     ttctggttcg ggaagcttcg cgcgcaggga acgcagcttc ggttaatcat caatatgctc     59700
     atcactcatt gatgttccat gtcatagtca cctaagaagt atatatgaag cccagataaa     59760
     gacaacttca ctctactaaa cacgttgcgg taagattacg tgtgcgcgat agatactgca     59820
     gagttgagta gcattgcacg ctgcgtcaag gcttgtgaat ttttcttcga ggatatgcag     59880
     ttttcatttt tacagatttc atttgaaaga attatatcat tatttcacca taagacactt     59940
     gcagagggga taactatatg atacactaat gccaaagtca taaaacacgc ttggttcgct     60000
     caagcttccg gtcaaggaag tattagtatg ttactttgat aaacgtttga gcgttgtaca     60060
     cttccctctc ttctcttagc gctcgacttt agttcgtagc aacgccgtgt attcgtttct     60120
     gtagttacca aaacagtaac caaaagcctc agcaaacagg ggttttgagt caaattcgta     60180
     tcttatccaa agcctcccag gctttcaaag tttctgagat tgaacttgct tcgcaatatc     60240
     ttttacaatg gatatataaa gtggtcattt tcaagatcag tgagatcgag aagcgcaata     60300
     ttacctttga tggtggaagc agactctata tccgtgcttt tgattaaacc tagcggtgtt     60360
     ccgccgtcta aggacgattt cctttcttca tttcttctgg ccagaatgta ccgaatagcc     60420
     aatgcagata ttggtgccaa aaaaaatgcg aaaacaatct ggacaatcca agcgggataa     60480
     tatctgggcc catcatttgc cctccagagt tgtggcgcaa taatattagc aactccatac     60540
     caaaacatga tcagtgcgtt tcttgtaatt ttcttagtgt gaccggaagt tgaggtggaa     60600
     gtccagctaa acatcaatat ccaggcaatc cccttaggcg cacaaataca aatcatggct     60660
     aaaagtgcat acgttctatc ccaaggtaag gtgaccattg cgatactgcc aacaagtgga     60720
     aagagagtcc aaaataccac cgagtaagcg gttgagttct ttttctttcg aatgatgctt     60780
     gacgctataa cagcgcaagt cacagaaaaa ctgccgtatg cgacagaaac tagagtagac     60840
     cctaacgttg aaattccgat ttccttaaac agcaacttct cttgataaac aaggttgttc     60900
     gaaagctggt tgcagaaaaa aaaggcgcag aatagccaag aaacggggtc tttcaaagct     60960
     tcgatgattt gctgtttttt aatgaccttc tgctcgattg aggatcctgt tgtcctttgg     61020
     actcttctaa ttacccagat tttctctttc aaattcaaga aacgtgcgtc tgtcggattg     61080
     ttgggataca agaacaggac caaaattgtt acgagaagac ttatagtagc aattacaatc     61140
     ataaaaagct tccaaatagc aaacgccggt tttgcatgta aaattccgaa agcgataaag     61200
     ccaacaacta tctcgtttcc caagcaagta gtgtagaata aaggagcagt ccagcttttt     61260
     tcttccgcag tcaaaaattg gcccattgta acattgagag ctggtactgc tatcgcttcg     61320
     acaaatccta agaaaaatcg gagagcatag atgccctggt aactggttgt tacggtatgc     61380
     aaatatatta taagggacca aaaaaagctc aaagcggcta ccacgcgccc cacagggaac     61440
     ttttggagaa aaagtaaatt tacttggcct atgataaaac caacataaaa caaggtcgtg     61500
     gagttgctgt acttgttttg atccaagttt gtgtctttcc acatgccgaa aatggaggtg     61560
     tacgacgcag tggccttgtc agcgtaaagc acaaaatcta tgagagcaca cagaggcacg     61620
     atagtccaca aaaccttcct cgctaagcgc ctctcttctt cataactgac ggctggtacc     61680
     aaaacattat tgtcaagcag aaatcctaac gtaacatctg catcacgtga tgtggtgact     61740
     ttgtcttcga tctgatcctc gctttgacct atttcgtttt ccacaatatt aactaatatc     61800
     ttgtcagcgt tttcaagaga taggcttcca gagctgcgat cggattcagt ggccaacatt     61860
     ttctttttca gtttgtaatg ttaagactgt agttcctaca gagcaccaac agttgctgcg     61920
     taaagcattt catatcaatt tcgagcctta tttgtagtaa aattgacaat cattgatggc     61980
     tgctaagttc cgcctgaaac gccactggtg ggagaagagt tgatcttgga tgctcacagt     62040
     gtcttgggat ttcataaaaa agagtcctgc ggcatgaagt caatgttgat attggtggta     62100
     ggcaaagtcg caacacgagg ctacgagaat tttgctaggc aaagaacgat gtagtacccg     62160
     gtactctgag ctggggttca gccgcactga ttgtcggcct tatagtctaa tcttgatact     62220
     gactcagcat tgcagtcaat agcagccacg ctactagcag ccttttctaa gaggaaaata     62280
     ttctggggcg cgtccgaata gagatttgtc gggcttataa ttgtgcttcc atagcaagtg     62340
     gcgacttcgc gtacaaccga gaccctttca gcgacttttc tacatccgaa aataacctaa     62400
     agtgttcggt agtaggactg cgtgagagga acttgaaata caacgattga caatggtttt     62460
     tcctttgtgt gagttttcga cagaatactg gccagtctca gaccatcttt ctgtctgtaa     62520
     ctcaagaatt acaagtgcga cctctttctc cgttatgtgt ggcacaattt tattcgttca     62580
     gtagctcggg cataaaatag ggtctccaaa aatgcgaatt ctcttacaga aaaacactat     62640
     ctgtatccat cctgaggtcg agcaaagtga catccagtta aaaatggaga tccccctccc     62700
     tttaaagaaa ggctgtgcct cttcaatctg aagacgctct tttcggtagc gtgagatgtt     62760
     cctgtcagca agaagccgat cacctttcac ttttctttcc ttagaacttt cttgctcagc     62820
     tttgaagtta aactatttgg tacaatcacc agcgtacttc ctgattatta aaacatctag     62880
     ccaacttcta ggattcttcg gggttatttg atattggttt tttgcaagct aacattttca     62940
     tgatgtgagt tggatgtctt ctctttgcag ctgaacgagc gacagagcga gcacaaaaat     63000
     cactatgcta cactgtgcaa tgcccaatca cgcagaaagc aagtttttct gtattccctt     63060
     cttctggatc cgcttttgat actttaggcc tccaaaagtc ttactgagct tcgcgctaca     63120
     tgctgtaggt tatcctaagg actctgcctg ttgcaatgag tgactttttt atccttgtta     63180
     gcgctaagcc tgatcctttg acaccgtgta ttgtttggtt caacagctac gcgctctgtt     63240
     tgcctgtact ttttgttgta cgtgaaattt tgttttgagc actttcctta cgttcgtcca     63300
     aattcacagt ttctaaggcc ctgcattgat gatttcagcc tccataaaca gcataaaaaa     63360
     cgtttctggg tccctttttg agtatttttg gcagcctctt cggttaagtc actccattgg     63420
     tggaaacaca gagctgcgag ctcggtcaac acgtcctgcg tatgactcag gcttcaaagc     63480
     gtttggccac agccatttcg ccctagatct gaccgctttt tcaaaactcc ggacaattac     63540
     ctccttgatg aattttaagt gctcacctct tgctccgcga agaaaaccgg ttcacctgcg     63600
     cagccatcta atagctcgcc tttccttttc tgcgtagctt ttggatgtgg tggttcttga     63660
     ttggcgcgct ccgttcgcaa gcagcaggat ctgtacgtcg ttcctcacca agaaatgact     63720
     gttcaagtta aagctctcgg taatcttcta atgtttacct ctccagatta tgcacaattt     63780
     ttttctacga aggtccttgc agggacttta gcgtcctggg aagcgtttta ttttcagaag     63840
     ctcgaggaaa aaagcccggc ggctcaattc tacgcggagc attcctcttc ccggtttcga     63900
     tttccaaact atactcgcag agtataacgg cctagcttga agaactgaac cgcacccttt     63960
     ccaataattc ggtctgggtc ccagtcaatt tttgagctcc tcaaggaccc tccttcgcca     64020
     agaaaatctt tgccttcgca tttcggaatg taacaaacgt tgcttgatat gtcatcttca     64080
     aggtagttaa tcacatgctc agttcggaat tttgttgttg gatcatcgaa ggaaattgtc     64140
     ggaaataaaa aaaaggacga aaagtctata tccgcgtagc ctgcgctact gaacggcgct     64200
     tacggcgcta ctgcggaaat agacaaagaa ggcgacttgt ggatcttggt ataaaaggcg     64260
     gtaataggct tggtcttttt ctttatccgc cgctcaagcc cggccctatt gagcattttt     64320
     gccaagaaga gatgagtgtg tgcttagata atcaaacgac ggcatcgctt tcagatcgcg     64380
     aggtcgttga gggcaccaaa gaggacattc atgaaaaagt gacgggggga attttggaaa     64440
     aggcagattc tgcgaactct ggcgctaatt ctgtagccaa ggatagtgag aacggccagg     64500
     cggctccatc ggaaccggaa actgcaattt cgcctctgac gggacttagg ttttatgtct     64560
     gttttgcgtc gctagcgcta tcgctttttc tggccgcact ggacattttg attgtgggaa     64620
     ccatcatgga gactgttgct gccaagttca acggctacag catgaccggg tggctggtga     64680
     ctggctacaa tctacctaac gcgttgctga gtcttctgtg gggccggttt ggcactgtgg     64740
     caggcttcaa gacatctatg cttctctcaa tagtcatctt cgaagtgggc tccttgatag     64800
     cggcggctgc gacgtcgatg accatgctta tcggaggaag agtcatctct ggtatcggcg     64860
     gaagtggtat tcagactttg tgttttgtta ttacttcaac actagtgaca gaccgcacac     64920
     ggggtactgc aatttcgatc ttgagctgcg cctttgcggt ggcatcggtt gcgggaccct     64980
     tcctaggtgg agcctttgca acacatgtga cgtggagatg gtgcttctat attaatttgc     65040
     caatcggagg actggccttt ttcttcttcc tgttctctta caaccctaac ggcgaaaaca     65100
     ctttcgagaa cttcaagatt ttacttggca ggattaaaag gatttcgtac tcccagttgc     65160
     tgaccgttag tttctatcgc aggcttttcc gcacgttggt cttcaaattc gacttttttg     65220
     aattcgcgct atcttctgcg ggtttcacgc tcgtgctatt ggccctgaca tttggaggta     65280
     acagatatga ttggaactca ggcactatca ttgcctattt tgttgttggc attttgttga     65340
     taatcgctag ttttgtctac gactttgtgg tttttgacag agttaaaccg caaactgatc     65400
     gtatccccta tttgccgctt ctttcttgga acgttatttc caagccaggt gtattgatcc     65460
     ccaatattgc taatttttgc acatgtttct gctataacat gcaagttgtg tacattgtcc     65520
     agtacttcca gctggtgtgg ggagactctg cctggaaagc atctattcac ttgattgcac     65580
     cagttatttc gactgtcatt actgtgctat tttgtggaat cataactcgg aaaacaggac     65640
     atgttaagat tcttctggtt gtcggaggaa tcgttatacc agtagcatct ggaatcttga     65700
     cactcctggg tcctaagtca agtagctctg ctaaaattgg tctgctcatc ttgcccggta     65760
     tatctttcgg ctcggttatg aacggctcct tgttgagctc tcaacttcaa atccaaaaaa     65820
     accatccact cttccgtttt gatttcattg ctgtgacaac gttcaacgct tttgttaaaa     65880
     tgctggggat ggcgtttggt ggtatcatgt ctaatatgat tttcacgaca tcagttcgta     65940
     acgaactttc caagattaag ccaccgttgc cacatagcca gtctgttgat ggccttatca     66000
     gctggtggta caagaactat gcgggcagag actcggctga ggttcacgtg ttcatgaatg     66060
     gaataaagga cgtgttttgg gctgctcttg gactagctgc cattgctgca gttgcgtgct     66120
     tttgttcgtc aaacaagaaa gttgatattg aaaaacctga aggagatgag gagaagaatg     66180
     gaaaatagct aatccaaaat agcagaaaag aagttgaggt ggttggaaat acgtaatgat     66240
     tgtatatatt taaataattc aaagaataag gtgcaaataa tttttcgaga gtaaccagag     66300
     caactctaca cgctcctcac ttgtattttt gttaaattga gagttgttca gattttggtg     66360
     catcgacgct agtaatgatc agctgtcgtt ggttccaccg gtttgttttt tacttgtggt     66420
     aagaactaat gtttcaaatg acagcgaact gtacaaaaac tttaatacag acacgagttt     66480
     tcaaataacg attacataag cgaactaatg aagaaaagtg aagcaatctt gtagtttgta     66540
     aacgcttcgt atagatttgg ttagccagga gataaaaaat tgcctggctc tataaccaag     66600
     cccgagtata gcgcgaacta taatctggct actcaagaca cctatttttt ttagtgttaa     66660
     cgtaagtcac gcccagagat ttcttcagtt cactatcttt atcattaaat tgtgtctggg     66720
     agatgatctc gccatggaaa ctagcaaagt cttcctacgt cgcatcaatt gtgactagga     66780
     agggaggact ttgcacacca caatgaagtt gagctttgaa cattagtttt gatcgttata     66840
     catctgtcat tgacttttca tatatctatt caagttaatt gctcggactt ctaagtttcg     66900
     aagaggaagg aaggttatca cgcgaaggtg aacagggcgt gtagatcgac cctcaagttc     66960
     gcgcttatgc gaagaggtgt attagtagac tgatcagaag gaaggcttgt gcccaacgag     67020
     gccccagcct actagcagcg tttttcgtct cagtgagagg aaattgatac gcgcccggaa     67080
     gacccagccc acagaggtac ccatcttcgt atgttgtacc gttgaatacc tgtaagtagg     67140
     tgtttccatt attgcaagta attgcagaag ttccgttcag caacctgtcg tctcttggat     67200
     ccgaaccagt gcgagccgca gtaccacagc accacccctc catagccgat gtgttgctag     67260
     ttacggtaag gttgtagacg tatccacaag gcacaatagt ttgagactgc tcagctgtag     67320
     agtccattcg gtgtgtaata taaaaagtaa ttggctttca ataattccct gaaccagctt     67380
     tggggcacac gaaacttcct gctccattat gtaccgcttt gaaaagggtt tttccgacat     67440
     ctctaatgac aaaatcagcc gctcggctga gtttcttggg gcttcaagcc tcgcatagtc     67500
     cgcgccacat gagatatgcg aatacgtcat ctttatactc tcgaggcagc ggacttataa     67560
     aacatctatg ctcgcaaaaa aattccgaag cggggaatcg aaccccgatc tccacggtga     67620
     gagcgtgatg tgatagccat tacactacat cggatgctgt tgggttaatg ttagaaggaa     67680
     cgtataataa ccagctaact ggaaaatgtg ccgtaagtta ttgaactcga cgctgggacg     67740
     tcaatgtgga taatacggcc gaggtaaaga agcgcattaa gattcttcca ctatcgatag     67800
     ggctgttaca gtttgttggt gaactcgaga aacttttcaa gatcatcttt gagccgaccg     67860
     ttattctcat gtatactcta taaacttttt tgcagggtac attaaaccga gggtttccga     67920
     aatttagtta gaaggcgcag ttgagcatct tgagtggagc tacgcgctca tgcaaagaga     67980
     tgcacgaaga aactgatcag aagaaaaatc tgcgtccagc ggggggcaag gctggtggca     68040
     gcgttcttct tagtatttga ggattcctga taatctgaaa tattcatcaa accaagtctg     68100
     caaaggtatc catcaatcac cgttgtattt tcggttattt gtaaatttgt attagtactg     68160
     caggtgattg tggtaaagcc atgcgatagg gtttcatttc tatcgtccca tcaactgcga     68220
     gccgtgaaac cacaacacca cccctccatc actgatgtgt tgcgagttac ggtaagatta     68280
     taggtatatc cgcatgggat tgtgaattgg gactgcgcag ctgtcgagtt catgacgcgt     68340
     tcaatgtgtt gtatttcacc ttcaatactt cgatttctag acttcgggag ttgcgaccca     68400
     cccgctccgt tacataccac tctcaaaaat ctttccagga gatatcagtc gacactatca     68460
     gccgtattgc tgacttcagc agggcttgca aagtccgctt ctcacggaga cgttgaattc     68520
     gtaatcagtt agtcccaaaa aggacaaatt ataataaaca ctggaataag aaatcggcaa     68580
     aaaagtattc cgaagcgggg aatcgaaccc cgatctccac ggtgagagcg tgatgtgata     68640
     gccattacac tacatcggat ggtattggct tactgagaga gggacgtaga ataaacatct     68700
     aacttgataa attgaccttt gtcataaaac aataatggaa caaggatatt ctgagacaac     68760
     gaaggaacaa catcagagat aatgaggaac actagagata atgagacttg ctctaggtct     68820
     ccggatctat aactataagt actactgcat ccaaggctca gtatgagatt aagtagaaga     68880
     aaggaagaag gcatcctcgg atagaagaat agtcgcgact gtatagaagc tactaaccgc     68940
     caacttcatc ataatccaga agctcataat aacatacgac aaccttcatg tcgtatctaa     69000
     tttttggagc tccggactat attttaagtt ggcggttcgt tggctcgata attatggtta     69060
     tccatcccaa gaatccttgt ttctctttct tctatttaat ctcatgttag gcctggagcc     69120
     tagtagtgcc tatatttata gatctggatg cttatagcga gcctcattat ctctggcgaa     69180
     attccttcga tgtctcagaa cttccttgta acattattgt ttcgtgacac tacaagtatt     69240
     ggactacacg catgaaagct attgtcgtcg atatcagggc cgaagtagag aagcacatca     69300
     taattcttcc atttttggtt ggtctaacac catttgatga cgaacttggg caaagtttaa     69360
     agattatctg taagtgaatt ttcattttca tgcatatgct ataaactttt ttgcagagga     69420
     tattagatct ggagtttccg aaacttagtc ggagggtgca gcttagcacc ttaggcgcgg     69480
     ccacgaactc atgcaaaata ctgcatgaaa aagctgagca aaataaaaaa ttgcgtccag     69540
     cggggcgcca agtcgctagc agcatttgtt tgcgttaacg aggattgccc agcatttgaa     69600
     ggattcgcca taccagatcc gcaaaagtac ccatccatta ctgttgtatt cgcggttatt     69660
     tgcagcattg tgttatcgcc gcaactgatc gatgaaaact cgtgcgacag ggtctgctct     69720
     ctgtcgtccg caccgctgct tgccgcaata ccacagcacc atccctccag aaccgaagta     69780
     ttactggtta cggtgagatt gtagattcgt ccacatggga ttataatttg ggattgctca     69840
     gccgtcgagt tcatgacgcg ttcaatgtgt tgtatttcac cttcaatact tcgatttcaa     69900
     gatttcggga gttgcgaccc acccgctccg ttatatacca ctctcaaaaa tctttccagg     69960
     agatatcagt cgacactatc agccgtattg ctgacttcag cagggcttgc aaagtccgct     70020
     tctcacggag acgttgaatt cgtaatcagt tagtcccaaa aaggacaaat tataaacact     70080
     gaaatgagaa atcggcaaaa aagtattccg aagcggggaa tcgaaccccg atctccacgg     70140
     tgagagcgtg atgtgatagc cattacacta catcggattt tgttattagt agctctatgt     70200
     tcatatgtca tataagctaa caatttaaga gcatgccctc catatcatta tctagcggtc     70260
     gctcacggga acgccctttc agaccttcca gagctcaaaa aaatatgaag catctggaag     70320
     ggaagcccgt ctacagtcga gcccggtaca gcaatcgcag tgaagaggtg aattcgattc     70380
     aaaaaaaaat tagttgtata ttagtcctta acacccacga tttttgatta aactaaatgc     70440
     agagtatatt ggcgtgccag ccttcgaagc gcgagttgag gtcaaagaac aagggttccg     70500
     caatgcctcg ctcacgcgaa aatgtacacg aacagactga tgaaaatgaa aagttggctc     70560
     caacggggcc ccaggtagtt ggctccgttt aacttggtat tagaacagta cgagaatcct     70620
     ttcactgttc tattgccagc tccgcacatg tatgcttcag acaccgacat atttccagca     70680
     atctcgaggt cgggagcgcc cgtacaattg atagttgcaa cattgcttgg tagagtttca     70740
     cctctgttgt caacattagt gcgagccgcg ataccacaga accacgcttc tataactgat     70800
     gtgttactag tataagttaa attgtaggca tttccacatg aaagcttctc atcacagtac     70860
     cacgaggacg aattcatttt gtttgctgag aaggtttagg aactccttcg aaactatcct     70920
     atgaccacac ttggattcat gggcccgtcc gccattaatc tcatttttaa aaatttcgga     70980
     aagtctttcc gttcatatca gctgttcggc tgagtccctt ggggcttcag ggctcacata     71040
     gctcgccgca ctgcttaagg taattagaca cgtcatattt attatctcga gactccggac     71100
     aactttgtca acatcggaga aattcgcaaa aaaatattcc gaagcgggga atcgaacccc     71160
     gatctccacg gtgagagcgt gatgtgatag ccattacact acatcggatc ttgttgaagt     71220
     atggagcaag atccactata atattagaag agggaaagca catgatacct aattaattct     71280
     aaaattgtga tatgccggag tgtcgcctct aatccaagcg cccagatgtg gaacatatga     71340
     aggtcgattc ccctttcgaa aacgctggtg caacaaacta ataattccta gtggcttttg     71400
     agaaaaaggc gagcatatct tatgaacgtc gtaaatactg cactaacata ttctagaata     71460
     cattgagatg ctaacttccg aagcgttaga tatcaagtaa aaccggtccg cgccacactc     71520
     acccaaaaag atacgcgaaa agactgacaa aaacaaagat atgagtccaa cgtggcgaca     71580
     ggttgctggc tccgttttcc ttggtatttg aacattgaga atattctgta tagttcgtgc     71640
     tatccagtcc gcaacggtat ccgtcgatca ctgttgtgtt ttcagagata tacagatcga     71700
     aagcagggtt agcgttacaa ttaatgcccc caatttcgat cgataggagc tcatccctgt     71760
     cgtccacgcc gctcctttct gtagagccac atcgatatcc ctccattacc gatgtgttgc     71820
     ttgtaatagt aagattgtag aggccaccgc atgggagcac cgtttggcat tgctttgctg     71880
     aagggcccat tttatgcgtg gtcgcgagtt tcgtaacgcc tttctcgggt tatcgtgtac     71940
     caacctgagg gcccaccgac tcacgcattg ttatatttct tcaaaaatct tcggcaaatg     72000
     ttccagcaca catcggccgc atcgccgacc taataagggt tcgagtggtt agcgccgcat     72060
     ggagtagaga gtcgtcattt taatgctaat attggtatat ggtgaaaacc aaaaaagttc     72120
     cgaagcgggg aatcgaaccc cgatctccac ggtgagagcg tgatgtgata gccattacac     72180
     tacatcggat ttagttgatt ttgaagcagg tagaggatta tctgtacgtc aacaataagc     72240
     atgccagtca gaggttagcc aatgtgttaa cggtaacccc ttaaggatac ggtaggattg     72300
     gagtgtttac gcgctcagaa gcacattcat ttctcttttt cttgtttggc aaagctgccg     72360
     ccgcctactt tcaaacggat ctccagcatt gacattgaag tggcttcctt taatgcaaat     72420
     cacagagtca cgcaggcact gtatcgcaca tgtgcacaaa taaaaaggat ctacctgcaa     72480
     tagcaaatgg tcagagcaaa aaatcaaaaa ttctccgcga cggggaatcg aaccccggtc     72540
     ccgagcgcga caagctcgaa ttctagccac taaactatcg cggatgttgt tggatgatga     72600
     tgaggtgtgg agcttcacac cgagactggt aaagcatgtg agccaagctc ttcttatcga     72660
     taatcatcta cgagattatg gtgcaggaga tgacgatttg ttcataggta cgcggagaag     72720
     gacgcagcac agtaagggac ggaagcagtg cctcccataa caacagcgaa aacccggggc     72780
     tcgcggccat gccgtctaag gtgtcaatca ctttcccgtc tcccctgaca ttcatccatt     72840
     tttctcgacg gtgcttcaga gtagatccat tctggtgatc tcggaacgga tttaggcgcg     72900
     cgcggactcc gcgtctacag atcttctcct gttgctactc ttggcttttg cccacgttga     72960
     aatttcaaag cgtggctccc tctgtctcaa aggaaaaaaa acctagcctc attaggcgtc     73020
     atgaagctcc agccaaatag cagaaacaaa cagacagcca gtagtgacgc aggctgtggc     73080
     cgtacggcgc agaaaatttt aggcaaaaag cacacagttt cgagggtctt tttccttttc     73140
     gccacattag tgtttttggt cgctgattta gtagcaacag gaaagtcttt ttccacagct     73200
     catcatgaac taaggttttt ggccgcctat aaaagccaag atgcaaaagc atgaggattc     73260
     ccgggacatt gtatggatga gttgatggta aaatttgcct gagtttagcc tgattgatcc     73320
     ctaataacag cttgagtgct cgcgaacagt ttcatcatga gcagcaacct gagtacagct     73380
     cctgaagagg gaaaaaaggt gtatgcgacg aggtcgaggg actcaggcac gtcggaaagc     73440
     atcgccgcgc tgccggaagc catgcagcaa actacgaaat actccagcga gactccgctg     73500
     ttgattctgg agaacgagag cgagcacgac atccagtaca agacgtgctc gtgggtgcac     73560
     acgtcggggc tgatgctctc cgagtatatc gtcctggcaa tcatgtcgtt tccctggtcg     73620
     tactcggtcc tgggaatcgt gcccgggatt atccttacgc tcttcgtcgc gtcgacggtg     73680
     ctctacactg gcctcacaat catcgactat tgcgagaggt ttccacactt gaaaaacgtg     73740
     tgcgacatcg gacagcacct gttctggggc cagaagtggg cgtggtacgc aacactagtg     73800
     tgtttcttag ccaataacac tttaattcag ggcctgcacg tgctggtcgg ggctaagtat     73860
     ctcaacacgg tcaccgacca ctcgctgtgt actgtcaagt tcggcgtcat tgtggcgtgc     73920
     atctcgttcg tggtttccgt accgcggact ttctcttcgc tttcaaaggt cgcctacttc     73980
     tctgccgcca ctatgttcat cgcggttgtc ctagccatga tcttcgcagg cgttcaagac     74040
     catccctacg gctacgacgg gaccccggtg acttttcgtg ccttccccga aaagggcacc     74100
     acctttgtgc agggcatggg cgcttttcta aatatagtgt acacttttgt gggccagatc     74160
     acatacccac agttcatctc cgagatgcag aggcccgccg agttcagaaa agtcctgtac     74220
     atcgtgacca cgtgcgagat cgtgattttc accctggcag gtgttatcat ctatgtctac     74280
     gtcggcaacg agtacatgag tgccccggcg tttggatcgt tgacgaggac tttcaaaatt     74340
     atcgccttct ctttcgccgt ccccacaatt attttcgcgg gttcgttata ctcaaatgtc     74400
     tccggccgtc tcttattctt caccttcttc aagcgctcta agcacttgta ctcgcatact     74460
     acggtgggct ggctcacctg gattgggatt ctggctctaa catgggttgg tgcctttatc     74520
     atcgctgagg tcgttccctt cttctcggat ctgctctccc tcatgtcttc tctcttcgac     74580
     tgttggtttg gcttcgtgtt ctggggtatg gcatacttca agctcaagga agcgaagtac     74640
     cagaatccac gttattattc acagttgacc gcttcagaga agtttcattt cttcattgcc     74700
     atatttctga ttgcggttgg gctcttcatc ctgggcccag gtctctacgc ggccatcgac     74760
     agcattatcc tgaactatca ggacgatgcc tacggaactg tgttcagttg tgcatcaaac     74820
     ggcagctaat agcgctgcgt aactcccagt gggaagcaag ctattcccgt ttggattata     74880
     ttattgcaaa tgataattta atttgacgaa agcaggaccc gctgccatcc tcctcacaac     74940
     actcttgtat attaaggcct cggaggctca cacgctgctc agttttcgcc ccaaagaacc     75000
     ctcggagccg ctcagcttac tggccattct caaatgtatg tagtgtgcgt ttttaatgat     75060
     ctattaaccg agattttgta tattatattg cccaacacga caaccaatgc gaagggttcg     75120
     agcccgggtc tgctcaacat gtacttgcca gtttccaagc aatagttaat tgcgctgggc     75180
     ggctcggtca tctttataac ggttaatcct catcttaggt ttcggccaat cacagctggc     75240
     aaatcctccg tcgacgaaac ccgaaaaaat tttgtaaagc tttttctttt aagattttga     75300
     acggctatat aaggcagata ttttgggctg cccggaacgc gccccacacc aagagctcac     75360
     gccgcacagc accgaaatgt ccgctcctat ccctcaatat tccatgtctg attacgccaa     75420
     attcgcactg gctggtgcga ttggctgtgg tgtgacccac tccgctatgg ttccaattga     75480
     tgtcgtcaag actagaatcc agttggaacc aactgtttac aacaagggta tggtctcgtc     75540
     tttcaagcag atcgtctctg ctgagggtgc gggcgctttg ttaactggtt tcggtcctac     75600
     tctgctcggt tactccatgc agggtgcttt caagttcggt ggttacgagg tgttcaagaa     75660
     gctgttcatt gacaccttgg gctacgacca agctgtaaac tacaagaact cgatctacat     75720
     cggttccgct gctatcgctg agttcttcgc tgacattgcg ttgtgtcctt tggaagccac     75780
     aagaatcaga ttggtgtccc agccatcttt cgctgacggt cttttcggcg gtttctctag     75840
     aatcctgaga gaggagggtg ccgcttcttt ctacaacggt ttcaccccta tcttgttcaa     75900
     gcaaatcccc tacaacatcg ccaagttctt ggtttacgag cgtgctgccg aggtctactt     75960
     cggcatggtc ggtccaaagg acaccttgtc taacaccacc gctactggtt tgaacttgct     76020
     gtctggtttg accgctggtt tggctgccgc tgttgtttct cagccagccg acaccttgct     76080
     gtctaaggtc aacaaggcca agaaggcccc aggccagtcc accatcggtt tgttaggcca     76140
     gctggccaag gagttgggtt tcgtcggctc tttcgctggt ctacctactc gtttggtcat     76200
     ggttggtacc ttgacctctc tgcagttcgg tatctacggt actttgaaga agtccttggg     76260
     ctgcgcccca gctatcgaga tcgcaagcaa ataagcgcct ctaaaacggg cttaatacgc     76320
     ttgcccctca cgcttgtgtg atgaacctgt acagtctagt cgcatagtat aaagatgaat     76380
     atattcggtt aatgtcatga atttttaaat attacatttg ccggtgggcc acggaccacc     76440
     tcaaacacgg tacaaacgct aactattcat gtaattctcc agctcctggt ctagctggtc     76500
     tgctgtgggt tgggctggct tctccctctt gggggcgcgt ggcccacgcc tgccgccacg     76560
     atggcctttt ttctgagagc gacgactctg gcggcttctc gattcgaaaa cctcaacggt     76620
     aaccttcgcg ccgctgatct ctttctcgtt gagcgcacgg tgcacctctt ccgttttttc     76680
     gggcgcctcg aactcaaaca cagccgtgcg gccgctctcg tggtcgtaga tgttagagta     76740
     cacgggttcc gcgatttcct tcaccatatc ctcgatggta aaatcggaca cgtccaaggg     76800
     aatgttaaga atccgtaagc gctgcttagg ggcctcttga ggctgttcat tgcggtcatc     76860
     gtcataccag cttttcgagc tggggtccag gtcgcgcctg ggcgtgtctc tgatcccaat     76920
     tctagcggca agcccatttc tcaggtcacg gcgacggtat ttctaacgga tctgttaata     76980
     aaagcacctc tggcccatta acttgcctaa catacggtta ctccacgact aggcttcttg     77040
     aaaggatgtt agcatttgtg ttcaacgtag actcaatgaa tccaaacgat tagaattcta     77100
     aaacccaatt ttatcgtact tgttcgccaa ttatgctgtc tagttcatcg tcaactgaca     77160
     tctttggtta gtttgctgag gcggtgtctc gaccaacgct agcccatgtt ggcccttcta     77220
     gcctatttta taaaacggca tgaaattgag tccttcgtat tgagctacaa aggcacgtca     77280
     cgtgacacgc gttcaggggg agctacttcg accgtgttaa agcataaaaa tgtactcgcg     77340
     aactggtact cagcagaagt ccgatgaaca tcgcttatgc ggagctcatg tagacattca     77400
     gtgctaaaga tatatccaag actctgccca gaggaccttc cagctatcaa tctcgatcgc     77460
     ccaacaggga gatgaactgg atttttgttt aaacaagcta tctacttgag ctaccgccga     77520
     gctagagaca gagagcgttg ctttcttaag catataaagc ttgcctttat gaaaaagatt     77580
     cttggcaaat cgcgcagaaa gcatcgttct aaaacagcac ctaatggaaa gcaaagagaa     77640
     gctggatgcg gagcctcgta agactaggat tggagcacaa cttcgcgcgg agggtgaagt     77700
     ggtactgcaa ctgctattct tttcgattct cggaaactat tcgcgtctcg gtttagttcg     77760
     actaaccgac tatagagggt cctacgtgca gggtcctacc gttctatggg cgaacttagc     77820
     agcatgcttc ctcatgggcg cagcgcaggc actaaagccc cgggacgtgt tcacaccgtt     77880
     gttcttcaca gcggtcacga cgggctactg cgggtcggtg tcgtcgttct cgtcgttcct     77940
     ggtggaggtc tttgagcacg cgacgaatac cgctgcggat tcaggttcgc attcgtttcc     78000
     aaaccgtgcg tacgggataa tggagtttct ctcggtcctt ttcgtccagc tgatggtttc     78060
     aatgtgcagc catctctttg ggttgtgtct agcccgggag ttttctgggt ctctagaaac     78120
     ttcaggaagc tgggaagcgt caaaaaatgc acgcagggtt aggaaagtgc tcaagctggc     78180
     ggaaaacatc gcacgaattt tggccgtccc cgtgcttatc gtccaaattg ttcttgccgc     78240
     agtttatacc aatggttcga gatattggac tttcgcagcc gtgttttctt ttccaggaac     78300
     gctgctgcgc tatgttttgg caaaatattt aaacccgcga gtcaaacact tccctctagg     78360
     cacttttgct gccaatgtgt ttggcactgt gctattggca atctttactc tgctttcaag     78420
     gggcaagttg ccagacggaa gtagaatcat caaattcacc acgactaacg acgtagtggt     78480
     gggattaggc aatggatttt gtggctgcct gacgaccata agcacgttca ttaatgaggg     78540
     gcacgtactg ccgctgaaaa agaccttgat ctactacttt acgtcaattg cggtctcatt     78600
     ctgcctaatt gttgtaacat tgggatccta cgcatggacc agaggtattt gaaaactaaa     78660
     attcaataat ggcagacctc cctatcacaa atgatacact aatatctcat aatagcataa     78720
     ttgccggata aataatattt agtttgttcc ttcctttgcc ctaggtttga actgtctcag     78780
     ccaagttata gattaatcgt tggaggcctt ctgcagtttc ctccacgcct ttcgagcgtt     78840
     tggctcttac gaatatggtc ttgagaagga aaaaacggta tgtcttgcgt atcagtgagt     78900
     tcgccttccc tgttttttgc tcgagggacc tggggaacag atttctgttt tcggcatcca     78960
     gttagttgcc aactgtgctt caagttccag ctcgtttcag cccatgtgtt aattactcct     79020
     ttaaagactc acttaacctc agtgacggaa gaaactccct ctctattggc aagcactctt     79080
     gaggatctca gattaatgcc ttagatgaag gatgccagtg ccgtgacgcc acgccttgat     79140
     ttgctccaac atcgatcttg gaaaagaacc ctcacacatg aagagttcac gtaacatgtt     79200
     tattaaacta agcttatcag attatcgagc gctcctcaga cgagaaatcc accagtcctt     79260
     tacctttagc tcctatatac aatcatgttc atttaccagt tctataagag gtctgcgaaa     79320
     acatgactaa acctagaaag gtggccgtac ttctctttaa caggcttaat ccacgcgatc     79380
     gacttcgcaa attgtagcag cgttggctcg accgtagcta ggttcccgta agcgacaagc     79440
     attctgtaag ctgcttcttc agagtcttgg atcatctgcg aaggcccaaa tttgttattc     79500
     agcgcatccg caacagtggg tagcaaatca agatttccac ttttgatgat cataacacta     79560
     tagttaaata tcagagtggc aatggaaacg gcgaggttaa ctgttttaga agcttgcgga     79620
     cgattgggtt ctatggtctg gaacacagaa tcatagacag cgtttttaga catcaactcg     79680
     gtaccccact tcttgttttt gaaacagtta gccagagtcc gcaccgttaa catttccagt     79740
     tgtggcattg cggaccccaa accttcctct atgaactcgc tcattgcatc tgcatgaggc     79800
     aagtactcca caataagtct catgatgtca tatgcaggaa ttttgttgga ccacgaagaa     79860
     cggattatgg aggcctgggc aaacagaagt tcatagttgt cttcgacatc atgcaacgct     79920
     gctccaatag cggccaagtc ttcatcgtca aatgatcttt cttgagcatt caactttaca     79980
     acgccgttga aaattgcgtc aggagaaaaa gaccgaatat ccaaatattc tcttacaggc     80040
     aaaactgaca tgggcttgct ttgtggtatt gaattagact gaccgtttga tgtagaactc     80100
     tgatcttgtt caaggctcac tcctgtagta ttggtaatca aaaaacgcac aacttcttca     80160
     cggtaactgg cgggaagctc atatcttgca agaaagtcat cagcagcttg gtatgcattg     80220
     ccgtttgcat taaaggggag tttaaggggt ggcgctccct ctgtgacatc cacatcgaaa     80280
     acgtagtcat acattttgcc ttcgaactct ttcttcttgt cgttaccagc tgaactgaca     80340
     acatcgccaa cttttgtcca tgcgccctga gtgtactggt gcgcctcatt taccccgtta     80400
     ggactcttaa ccactatcac ctgaccctct ttgccagggt tcaagagagc ttcgcttgga     80460
     gaaagttttg attcgtcaaa gcccattgtc tgagagctga ttgcagtacg ctcgacttct     80520
     ttcgcgaatg tgtctagttc ttgctgcggc gcaaccctac cctcatgaca ggtaaagatt     80580
     ctagccaacg aatcactgca cccaactaat atgtccccat tcggcaggac atcaagatcc     80640
     caaacagaaa ccgcggggac tcttatcact tgtttgacag cgccgtcagg cccccaaacc     80700
     cttacagatc tgtcctcgcc acagctaaca agaccaccac agggagtgta cttcacacaa     80760
     tatacaaaac tttcatggcc tttgagcgtt ctcagggtgt ttccgtccat gtcgtttatt     80820
     ttgatagtac catcatttga acaactggca aactgatccc catctgggct gatatccaaa     80880
     tgcctgacca catctgtgtg aaggttcgag aatgttttga gcactttctc gccctcccaa     80940
     agcttaacgg tcccgtccgc tgaagctgtt agatagaacc ctacctcggg aagcatctta     81000
     acatcccaaa cggatgcctt atgtccaacc agttcatgct tcagggcacc ctggaaccaa     81060
     accttagcgg tggcatccca gctgccactc aagatatacc cttgagagct gttcaatgca     81120
     cacacattac tcttgtgccc aactagtaca aattctggct cctgccctag ttctccaagc     81180
     aaaggagata tgctgttgat aagagtatcc ttgccaccac aatacaatag ccttgaaagt     81240
     ttgtcgtaac atagactgtt aatgaattcg tcaaccttgt aaagaattgt gtcttgccac     81300
     atgtcgttgc tccccttctt ccaaagtctc acagacccgt ctctcgagca ggtagcgacc     81360
     tcatcgttac tcattactgc aactgacttg acatcttgct catggccaaa gagagtagca     81420
     ctaagtttga ataccttctt gaccatctgt aatgtttaaa gcggcaactt ctcgtgtaca     81480
     tagcagagaa aagggtcaaa aatctttcga cttcaatttt acgagatata agcctttata     81540
     caaaacaaca aaaacaggtc atttggatag gttatttgga taacatggct ggccctttac     81600
     tttactccca cttgggtgaa aagattgttt tcaaactagc gacgccctct agcgagaaag     81660
     atgtggtcct ttctttgggt ccttcaggtc aggatatttc tttggaaagc cctgaaatct     81720
     tccctacgag aggcaaaata gtgaaaagcg cagcgctgat aggctgcatt aagcttaagc     81780
     ttaactccta cgcgattttt gctcaccggg tggaggagtt tggagtgctt gctgggcaca     81840
     gaatcttcaa ggtcgtagag cacaccattt tacctctaaa caagggtggc caaagagaca     81900
     aagatgaaca gcagtacttg gatctgttgg aaatgcagct ttcgagtgct accttatttt     81960
     attcttacac atacgacctg accaactccg cgcagagaaa cgaaaagctc gacggaagct     82020
     cgtggaagac tgctgacacc cgtttcttct ggaaccacta tgtgacgcat tccttgcgga     82080
     ccttagctga aaaatgccct gcagccggtg actttattca gcccatgata tttggctacg     82140
     cgcattttat tgagacagcg ctcaacaatg tgccgattac catcggcttg gtcacgagaa     82200
     gaagcaggtt tagagcggga acaagatact ttcgccgcgg tattgattcc gatggtaatg     82260
     tggccaactt caacgaaact gagcaatttc tcttggtcaa aaagcctgaa ggagggaact     82320
     ccgaattctt ttcatttttg cagacaagag gttccgtgcc agtctactgg ggggagatta     82380
     acaatttgaa gtacaagccc aaccttgttc ttggggaaaa ttcttcactg gacgccaccg     82440
     ccaagcactt tgaccagcaa aaaagcctat atggggaaaa ctacttggtg aaccttgtta     82500
     accaaaaggg acacgagttg ccagtaaaaa atgcgtacga gtccgctgtc aacgctttga     82560
     acgatccaat gatccattac gtttatttcg acttccacca tgagtgtcgc aagatgaagt     82620
     ggtacagggt caaactgtta attgatcatt tgcagaaaat gggcctagac cccgaggata     82680
     ctttccataa aattgtgtct cctgacggca aaacagtgga tgttgttagg gaacaaaagt     82740
     cggttgtgag aaccaactgt atggactgtt tagataggac taacgttgtg caatctgtgt     82800
     tagcaagttg ggttttgcaa catgaatttc agattgcaaa cgttgttcct gaaggtactt     82860
     tgtgggagct ggatttgaag cttctggcaa agttccaaaa cttctgggcc gacaacgccg     82920
     atgctgttag tttctcatac tcaggaacag gcgccctgaa aaccgatttc acgagaaccg     82980
     gcaagcgtac ccgtaagggc gcattcgctg actttatgaa ttcagtatcg cgttactacc     83040
     agaacaactt aagcgatgga cctcgtcagg atagctttga tttatttcac ggaaactttt     83100
     taccatttga gaacagtttc caatctccct tccccgacag aagacctctt tcgatccaaa     83160
     ttgtgcctac agtaatctgt gctgcgatca cggttattgc agccactgta tttttcccca     83220
     agggccactt ctttagcacc aagaaccttt catttttctt tgtctcgagc gctatcgtga     83280
     ttttgtctct gagatttatc tttagaaatg gcgaacaata cgtcaactgg cccaagttca     83340
     acaatctagg attcttgacg gcggtgcaaa ctcacaacaa ggagcgcacc tttaaaggta     83400
     taagatacgt gcaaagccct aaattctcca aacctggcga gctgaagaga gactagtgat     83460
     acatacacgg cagtcctttt gagaggttaa atttatatag aagaaaatgc aataggacca     83520
     attaggcact taggtctttt attaaggagt caacgttagc agctctcatc aaggcttcac     83580
     caaccaaaag acccttcacg ccctccttct tgtacttctc agcatcagct ccacttgtaa     83640
     taccagacag cgcgagcagg atagttccct ctggaacaga ggaagctagc gagctcgttg     83700
     tgttgagatc aacattgaag gaatgcaagt ctctgttatt cacgccaaca accttggcat     83760
     tcagttctag ggctctgccc atttcttctt tggaactcac ttccaccaaa ggctcgatgc     83820
     cgacctcaaa cttcgagtag ttgtagagct cgagcagaag gtcctgcgaa agcatcttga     83880
     ctattagcaa gacgctgtct gcaccagcta agcgagcctc caaaatctgg tatttgctga     83940
     aaatgaactc ctttctcagt acacagggac ggtcctgggg cgcgttctta aattcgatat     84000
     ccagggctct tcttacgttc acgaggtctt gtatgctgcc tttgaaccaa tgaggttctg     84060
     ttaaaacaga aatagccgaa gcaccagctt tagcgtattt caggccttgc tctgcagcga     84120
     tagcgttcat atcaatgtct cctttcgatg gagaagccct ttttatttca gcaataacag     84180
     cggatttggg gcccgaggaa agctttgtgt aaaagtcttg aacctctggg gcaagacctt     84240
     ggttaaagtt gctttgcaaa tccctcagcg tgaaacctgg cgtggcagaa agctcgtcaa     84300
     catccttctg tctctgtgcg taaatcttgt cgagaataga tgaccctttc acgcgctttt     84360
     ccttgctcag cttctcgtgc tcctcccagg taccaccctg gatgtttaga atgttcctga     84420
     ccataacatg gccggcttcc gtaaggatcg actccgggtg gaactgaaca ccttcaacgg     84480
     taaggttttt atgtctgact cccataatga tgccattttc tgttctagcc gtgacctcca     84540
     agacttcagg aagtgaaaga ggctcgcctg ccaatgagtg atatctgcta actgccacgc     84600
     cttgggggat gtccttgaag atgcctttgt tgtcatgagt cacctgcgat gtctttccgt     84660
     gcacgatctc gccagcgtag gatactgttc caccaaagac gtcaaacata cactgcaaac     84720
     ccatgcagac accgacaaca ggaatctttc ctgcgaagtg acgaacgcag tctctggata     84780
     taccagagtc agttctgggg tggcctgggc ctggcgagat gaagacacag tcgggcttta     84840
     gatcatcaat ctcctctagc gtgatttggt cgttacggta gactagcacc tctgctcctt     84900
     cctggcatag gtactcataa aggttccagg tgaacgagtc atagttgtca attaggacta     84960
     ctcttctttt tgctgaaaac accatgttaa agatcggact ctaacctgtt aagttttgat     85020
     acgttaactt ttgcacaagt tcaacaattg gcggctccag gtccaagtac cagctcaatc     85080
     gcttgttgat ttacatatac ttaaggccag atgatgagtc aaggaagcac ggcccaaatt     85140
     tttcagaaca gccaatatca cgtgatccat cttggtttat gtcaggtagt ggtattcact     85200
     tccagaatct atccatgatc ttagttcagt aacgtgagga gtggttttaa cgattgtttg     85260
     gccacgaaat ttagcagaaa cggttaggag tttttttaca agactggcag tttcttgggc     85320
     tcaaaactct atgatgtatc agaagcgaga ttccaaccag gattctctag ctggcgctct     85380
     aagttgagaa gagttgaagg cagctgtgaa aaggatccac agcttagaaa gcgaaggaca     85440
     tcgctgagaa tatggagcac gctggtcatt cccagaagca gattggaaaa gaatcttaaa     85500
     ttagtggccg aaggctaagg ctaaatgcca gtaagtgcga gtgcgagaaa gttgctccag     85560
     ctttcagaat ttggactgca cactgtagaa ataaatttgc gccgtatctt gaacttaagc     85620
     tcgtaaaggc taatttcgca gcaggttggc aagccggtag tatcagagcc tcttgcagac     85680
     gcttccagct agagcctaaa aggccgggca tccctttaac ggattgctgc tgggctctca     85740
     cagcaatccc acccgacacc cgggcggtat gcgaaggttc gttggctacg gccacccaga     85800
     accaaataat aggagggccc ttcacacggc acctgaggcc caaccagcac acccggtcaa     85860
     ctaagcggga catgctctag cgtcacagag tgccggacca aaagcatgtg tctcgaagag     85920
     aatttcttca atcgcatccg aattgcatga tgggctttcg atgagggggg ccttaatcgg     85980
     aggagggtcg aaaacacatt ttggacagcg tattcccagc ctacatagca gcgcacgcgc     86040
     tctattatgg cacatcatgt tgcagaagcc accattttag gttgtggggt gctacaaatg     86100
     agaaattctt ggtgtggggt cgcaagtaga tgcctcacga taaccatagc atcaaacttg     86160
     tgtgaataag gtcatggagt tctttcgatg gggggggggg cagttgaagg cgtgagccac     86220
     ttgcagaaca aaggctggaa ccgaggaact tcaatccttt taacctacag tttgtgtgag     86280
     cgtgtctcag ttaaagaaaa ttttgaatgt ttttcttaat gagccttcaa acatgtagca     86340
     taacttaaac ttcatcaaga accaagggaa cagcaaacgg caatggcaag tatcatagag     86400
     gcctctgcag ccttgagaaa gcggaagaac ctgaaaagag gcatcaactt cacgttgatg     86460
     gttgtaggtg agtccggttc ggggagatca acttttgtca acacactatg cgggcagcaa     86520
     gtggtggacg tatcaacctc tattatgctt ccaacggaca gatcaacgca gattgatcta     86580
     caattgcgtg aagaaacagt ggaactggag gatgacgagg gtgtaaagat ccaattgaac     86640
     atcatagaca cacccgggtt cggagactca ctcgacaatt ctcaaagctt taatgtggtc     86700
     tctgattaca ttcgccatca gtatgatgaa atcctgctgg aggaaagccg tgtgagaagg     86760
     aacccacgtt tcaaggacgg cagagttcac tgttgtctgt atcttatcaa ccccaccggt     86820
     cacggcctta aagaaaccga cgtcgaattt atgaagactc tcgggccttt ggtcaacgtc     86880
     attccggtca tcagcaaagc ggactctttg acccccgctg agctcaagct caacaaaaaa     86940
     ctcataatgg aggatatcga ctactaccac ctccccatat acaatttccc ctttgaagaa     87000
     aacgacatct ccgacgagga ctacgagacg aacatgtatc tacgttcttt agtgcccttc     87060
     tcggtgatcg gatccaacga agtgtacgat cttggggatg gagctatgat ccgtggccgt     87120
     caatacccct ggggcaccct tgacgtcgag gactcatctc tttcagactt cgttgttcta     87180
     agaaacacgc ttctaatttc gcatttacat gacctcaagg attacacgca tgagattctc     87240
     tacgagaggt acagaacgga ggcactgtca ggcgagacat cgtcccagcg ggccaacggg     87300
     aatagcagca cggcctacgc cgactcaccg gtggcctctg gcaaatcatt ccaacatgcc     87360
     gaaactgact cgctcaactc ctccaagcag gccagtgcta accaagatac atacttggct     87420
     cgcgaagaac aaatcagact tgaagaggaa aggctcaggg catttgaaga gcgcgttcag     87480
     caagagttgc tcatgaagag acaagagcta ctgcagagag aacaagagct cagggaaatt     87540
     gaagagagaa ttgagagaga ggctagaatc aaggaagaat ctggggacct tgagtaatcc     87600
     accaaacagt tcacgttggg gcatattgac tgaagtgtac aataaagttg gacgctgact     87660
     tttgcaagac agaagcccta tctcaaggtc aataaaacgt gacgagtcta ctttttcgca     87720
     gcgaaaaaaa ttcgaggtat ataaagacaa cattggaaaa gttattctag caccatcata     87780
     agtatcgaat cctcactgct taagggcaat caatcgaaca tcaaatctag tcggatttgg     87840
     cggaatttaa ccaaatttcg tatagtagcg tactcaccaa aacgtttttt aaatgatgag     87900
     gaaccagata gggacaacag acttcgttag aatgacgagg aaagtctttt aaagcccagt     87960
     ttttagtaga gcttgggcgc caaacctgat taaaaaacgt tgaggctgaa attttataat     88020
     tattcttgta tttatacact cttgcaaagg taagcaaagc ctcgcgctag ttatctccag     88080
     ccacctttgg ggctgctttc cagctcttga gaccggtgtg cctgcagaat tgcagcgcct     88140
     tatttccatc ttcctccttc tcgggagcat cgaaggagaa ctgtggaaac accagcacgt     88200
     cgcccacaag ctttggaaca cccagattgt gaaactcctt ccaggtgatc ttgctgagga     88260
     tgccactttg gacgtagtca ttgaagtagg tgaaaaccac gtctgtccat atccctgagc     88320
     cggtccagct cataatgttg aggtcgtttc tgaggttcat acgcagctcg ccgtctgcgc     88380
     gacgtttcaa ggtctcctct gtgactttag cgacgatttc gcgcatgact ggatggccgg     88440
     gcttggcctg catgatccag ttaccgaatt gcagcctcct aacgtagttg ctcctccagt     88500
     cgggactgtt ggcgtcattt tctatgccta taatgaggcc aatttcgcga ggagacacat     88560
     tttcagggat ccagttagga actggctgca gagggtcggt gtctatgtct gcgtaaacgc     88620
     cgccgcgtgc aaacaaaatc aagtacttga agaagtctgc ttttaggtat actgatggga     88680
     gcgcgtcgta agcttctatg acctctggga tagatgcata catgtagtga atgagagctg     88740
     acgcagtgtc atcgttgatt atttcatgca cgaaccctgg gttcttgtca ccccaccttc     88800
     tttcgaatga ctgaagagtg gggtccatgc ggtcgtccag gtcagagtaa ggccaagtct     88860
     gccagataaa agcgggaaat ttcttcgacg ttccatactc gaacatgtgg gcaagctttt     88920
     cacgcagcgt ggcatgcgtg gcaggctgct taaggtcttg tatcttcttt tccagtattt     88980
     tacgctcttt ctcaaatttt ttaatttggt cttcttgttt cgcaagcaag tcctgcgaca     89040
     gcttctcgaa cagctcaacc atgttaacgt cctgcttctg tgcggatgca gcatcagctc     89100
     ctggagcaat gtctttgggc aaaccttgca ggatagcctg cacgtcggtt gccgtccggt     89160
     tgctcacaaa ccgtcctacg agcgcgagcg cgattgtgag caggacagcc cataccacgt     89220
     agcgcttcca ggtgggcctg cgtgacttcg gcatgttagc agagcgttgc gtgggaaata     89280
     tttttatggt tgagttgaag ctttgatctg catcgagatg attactagaa ttgtttcgca     89340
     gtgtgaagcg aaaaatatgg tatagtctca tacgaataga cctttatcta gaatacggaa     89400
     ttcagaagcc atctgcttga cgagatggta cgcggccgca attctgagcg gaatggttga     89460
     gctcgtctta ctgagccagg cgttcaaaag ctgaagctct ggctcggatg tgacagggat     89520
     gttgacgcta agcactacat ccgtttgtac gtcgtcgaag cgcagcagcg cgacacacag     89580
     cacaagcgtc tcacgcatgt cgcttttgcc ccatttgtag gcagcctcga ctgcaatgca     89640
     ggtgaggtga ggaacttggc cgacttcggg agcgctctgc tcgcattcga ctaagttcca     89700
     ctcgtgactt ccgtttagcc ctgcaatttc ttgcaaatga acgtcaagcg cgcggcagct     89760
     gtcgtcctcc tcgacgcgct gtagaaggtc cactatgacg ctttcgtcga gccctaggcc     89820
     gtccttgaat accgcaattt ccttttcttc cctgctattc acgaacacct cttgcgtgtc     89880
     ggggacctca cgcagaatag aggcgtccaa aaatcctttg ggaatgacgg tggagattgc     89940
     accaccgtag agcgcttgct tctgaaacat ggtagcggtg tggggagtgt gcgtgatatg     90000
     cttgaacagc aggcgtcttg cttcgtagta agatgtctgg cttcaatgcg cttatccgta     90060
     catcgctaca taatataaga gaagcggtaa gagcagcgaa ttgagccctg gaacgccaga     90120
     tacgcagctt agcagtgaaa aacggtaaat tatgcggctc gaacactgaa agtgcgcatg     90180
     ctaccgcatt gcgccggaga gatgcttact tctttggaat tattatatac gcaaattgat     90240
     tctacgtcgg cacgctcagc tacgcgtctg gttgactatg cttgtgcgat gcgcaaatgg     90300
     ccgcgagcga tgctaccgtg aaatcactat gttctcacgc tgcccgggcg ttgccggacg     90360
     ttagctacgt agacgtttgg aacccaacgt cactcccgtg taaagttact ggtgggcaca     90420
     cagacgcgag ctatttggcc agctagcgcg ctgactatgt tcaccttcta ccagctacca     90480
     tcgcggcgag attccacgtt cgcgatggct ctctctcatt aattacactc caaacgacag     90540
     ccgcctccag cgtttggatt ctggctacat catctgctgc acaaacacca gcaccctgct     90600
     gatgcatgcc cgtaatgtcc agtgtgatga tgtgaagtta cctgaggggc tattttgaac     90660
     agcattgcaa tgtgcctctt ggccatctgc aagtattatc atcattcacg acactaatat     90720
     tccttacctc acggcatgtc cccatttaat gcccagtgtc caactctggt tctgggcata     90780
     gtctcccctc tattctcaag cttttctagc cctttaacaa gcttattcac atgcctgaac     90840
     gcttgcatac tcctaactcg ctccaagggg cggatgttcg tgtctaaaac aaagaacaag     90900
     ctactgcaaa tagtaattga tagctttgag tttgatagga ggtaatctgg aatcaactaa     90960
     cgggttctgg acttcccgct gtgtgcggag acgaagtcag gacggcttcg agatatatgt     91020
     agtggtgtac gaacaagcgt catttggtgg caaaaaagcg tactttgact aaccttattt     91080
     cgagctcaaa ctcaccagcc aagcaacaca acaggataca aagccattga aagcactcga     91140
     taggatggtg aagcccggtg aaattgacga gagtctgtac tcgcgtcagc tttacgtttt     91200
     gggcaaagaa gcaatgctca aaatgcagca ctcaactgta ctgattattg gattaaaagg     91260
     gttgggtgtc gaaatagcta agaacatcgc actagccggt gttaagtcgc tgacactgtt     91320
     cgaccctgcg cctgtggtgc ttgaggacct gtccacacaa ttctttttgt ccgaaaagga     91380
     cgttgggaag ccaagggccg ccgtttcgca agcgaaactg gcagaactca actcttacgt     91440
     cccaatcgac gtcttggact cgctgcaaga ccaggagcag ctgaagaaat atcaggtgat     91500
     tgtagccaca gagaccttgc cgctcgagcg caagattgag ctgaacaact tctgccatgc     91560
     cgctggcatc aagttcattg ccaccgaaac cagagggttg ttcgggtctg tgttcaacga     91620
     cttcggcgag gaattcacag ttgttgaccc aacgggtgag gagcctcagt ccggtatcgt     91680
     ttctgacatc gagcctgacg gaacagtaac catgctcgat gacaacagac acaatctgga     91740
     agacggtaat tacgtgaagt tctccgaagt cgaggggctc gagaagctga atgatggtac     91800
     tccatacaaa gtcgaggtgc tgggaccttt tgcctttaga atagggtctg ttaaggaact     91860
     gggtacttat aagaagggcg gtgtgttcac tcaggtcaaa atgcctttga agctctcttt     91920
     caagacttta cagcagtctc tgcccaaccc tgagcatctt tattcagact ttgcgaagtt     91980
     tgaaaggcct ggtcagctgc acttgggttt tcaagctttg gatcaatttc aagccacaca     92040
     ccaagggcaa ttgccaagac ctttcaacga ggaggatgca aatgagttga tcgaactaac     92100
     ctcgaagctg gctgtccagc agccgaaggt tctgggagaa gggaactctg tgaacaaaga     92160
     tataatcagg gagctctctt tccaggcgag aggtgatatc ccaggtatgg tcgccttttt     92220
     cggtggttta gttgctcagg aagctctcaa agcctgctct ggtaaattca ctcctctaaa     92280
     gcagtacatg tacttcgatt ccctggagtc actgccagac gccaaagaat accccagaaa     92340
     cgaggaaact acgcggtcaa ttaactcacg ctacgatccc caaattgcag tgtttggcct     92400
     agagttccaa agaaagctgg cgaattcgaa ggtctttttg gtaggttccg gcgcaattgg     92460
     atgtgaaatg cttaagaatt gggctctttt gggtctgggc tctggcccag atggtaagat     92520
     cttcattacc gacaatgatt ctattgagaa gtccaacttg aaccgtcagt tcttgttccg     92580
     cccaaaggat gttggtagaa ataaatcaga agtggcttca gaagcagtca gcaatatgaa     92640
     tcctgacctc cagggcaaga tcaagtggat gacggaaaag gttggcgccg aatctgagga     92700
     tctcttcaac gatgatttct ggaacgggct tgactttgtt acaaatgcat tggacaacgt     92760
     tgatgcccgt acttatgtcg atcgcaagtg tgtcttttac aaaaagcctc tattggaatc     92820
     tggcacactg ggtactaagg gtaatactca agtggttatt ccaaacgtga cagaatctta     92880
     ttcatcctcc agggacccac ccgagaaatc tattccgctc tgtacactgc gttccttccc     92940
     taacaagatc gatcacacaa ttgcatgggc taagtcttta ttccaaggat atttcaccga     93000
     agcgcctgaa aacgttaact tatatctcac ccaacctgat tttgttcaac agactttgaa     93060
     gcaagccggc gacgtgaagg gaattctgga gtctatcgct gactctttaa acaacagacc     93120
     ttacgacttc gacgactgca tcaaatgggc gcgcctagaa tttgaaaaga agtttaatca     93180
     tgaaatccag caacttctat acaacttccc caaggactcc aaaacgtcca caggagctcc     93240
     gttttggtct gggcctaagc gtgcgcccga gcctctggtt ttcgacatta aaaatccaga     93300
     tcacttctat tttgtggttg gtgctgcaaa cttgcgcgcc tttaactacg ggctgacggg     93360
     agacgaaggt gagccggata ttagccatta tgagtctgtc cttgctaaca ctaacgtccc     93420
     tgctttctca ccaaggtctg acgtgaaaat ccaggcgaac gatgatgagc ctgatccaaa     93480
     ctcaaacagc gatgttggcg gcgacgctct ggaagctttg actgcaagcc tccctgatcc     93540
     ttccacgctg gcaggcttca aactcttgcc tgcagagttc gaaaaggatg atgactcgaa     93600
     ccaccacata gagtttatca catcggcgtc caatgacaga gcgctgaact actccatcga     93660
     aacagctgat cgccagaaga ccaaattcat tgctggccgt attatcccag cgatcgctac     93720
     tactacaggt cttgtcactg gactagtcaa tttggagcta tacaaggtcg ttgacggtaa     93780
     aacagatatt gaggcgtacc agaatggatt cattaatctg gcgttgcctt tcttcgggtt     93840
     ttccgaccct atcgcctcac ctcagggaaa gtacaacgat aaaagttatg ataaaatatg     93900
     ggacagattt gatatccgcg gtaacattac tttgaaggag ttgattgatc acttcgacga     93960
     aaaggaagga cttgaaatta ccatgttatc ttatggcgtt tctctcttgt atgcatcatt     94020
     cttccctccc aagaagttga aggacagatt gaacttgccc attactgagg ttgtgaaact     94080
     agttacaaag aacgaggtag cgccacacgt gaaaactatg atactagaga tatgtgcaga     94140
     tgacaagaat ggcgaagatg tggaggtccc ttacataacg attcatctgt gagtatcagt     94200
     gtgacctttt ctaatattat taaatagtta atatcctatg ctcaaggttt tagtgaacac     94260
     tattcagaac aactagagag gattttgaat aattctcctt tttgactgta aagcctttcg     94320
     aatgacccat cttctattat gttgccattg gcgaaagtta agatacgatt gcatgcacgc     94380
     atcatttgtt cactgtgtgt aaggacaaga gttgtggtcg attgtgatcc ttgtcttaca     94440
     aactccgaca taatgaaacc gtgctgtgcg tcgagggcgg aagtgcattc atccaagacc     94500
     aagagttgag gctttcgcaa cagtgctctc actatagcta atctctgtaa ctgacctccg     94560
     gataaaacat ctgtatcaat aaatgattgt agacctaatg ggttcgaatt aacgaaatcc     94620
     atcatgccca ctagttccaa aagctctcga atttcccttt catcgacact tgtggacagc     94680
     ccataggtta aattgtcaaa aattgaccct ctgaaaagac ttggcctttg ctcaactact     94740
     gcaatccgtt tcctgagtgc ccattcttcc cattcattga catctaagcc atcaaaccag     94800
     atgcttccgc ttggaacacg atacaaacgc gttattaggt gccaaagagt ggatttccct     94860
     gaaccagata aaccgaccaa agccacggtt tcgcctgctt ttacactaag gttcaaacct     94920
     cggtatacca taggattgtt gaggaaagaa taggaaaatc tgaggtcttt gatgaaaatt     94980
     aaagcttcat ttgaacaccc ccggctagtc agggcgctct ccccttctaa attagcgtct     95040
     gcgaattgcg tttcgctgtc tagtatcctg aacaaatatg tggctgctct ctggcccctg     95100
     cttatttctg ggatttgagc tattagagac atgcaagtca ttattgtgaa aagaagcaac     95160
     gtaagggttt gaaacatcct ttcactgcta tactcccctg taattaccag cttcattcca     95220
     taatacagga gtattgactg tgtgataaga gtgagagcgt tcgacagggc aactccgaat     95280
     ccagtgccca aggctctttt tctcccagcg agttttgcct tcccttcaag aacctcgtat     95340
     tctttaatta ccctttcctc gacttgtagg caccttattg ttttaattct tcttaccgca     95400
     ctgtaaagct ggtcttccat gctagcgaca gcgctcttat aattagcctc acacttctgt     95460
     aacagcccac cgtaggctcc agtaaacaat atgaaggcag gtattaagga aatacacacc     95520
     aagcttaact tccaacccga tgctaatgcc caaattaacc cgcaaaacga gaccacaacc     95580
     aaagttgtaa cggcagccag aaactcggaa gccagggctc gcaaatctct taggtcattg     95640
     atgactaaag acgacacgtt tgacgtacta ttctgttcac tgttgaacca agcgagttct     95700
     cggtttgata tatttttgaa agctctgaga cgcagggccc taatccagtt ctcgccgcac     95760
     ttcgataaag taaaacattt caggaaagtg aaggttgaat ctaaaagtgc tacagaaagc     95820
     acaattagtg accatttagt tgatcgcctc ccagttgcag ggtaggcatt ggaagaggct     95880
     atcccactca atagtttaga aaacgtgtag gagaataagg ggttagcgac acctgcaagc     95940
     aaagcggagg ttccacccac agcaagcagc cttttctgtc gtgaattgat aaagaactgc     96000
     ttaatgatat ctctcagggg caaaagactt ggttccgttt ggcccttttc gatatccgga     96060
     acagttggta acgggccgag ttcggttgca tctactcttt ccttggtctt tgcaaccctt     96120
     cgtgttcggt gtggcatcat aatactagat tgaagtaggt ccaccgaact tctcaatgca     96180
     tgggaagtaa ctggatggta gtcagactca ggaacgcaac atgtccgcaa cgtcgacggc     96240
     gaccctaatt ccgagtacag ctcttctacg tcagtgcgaa cgccctcgag cttttggtcc     96300
     actatttgtg atgtaccatc accaagcgta gctacatccc cgaagtcgtc atcacaggct     96360
     tgaaacctgt gaagattaga aaattcagat tttggattcg aaagcaaccc gcttttgtaa     96420
     ccgtgctccc ttatttggcc gtcgctcata acataaacat aatccgtatc caatatgtca     96480
     ctaagctcat gggtcaaaat tattgtagtc ttatctgctc tccattttct aatagcttcc     96540
     attaacagac tcttgtgtat ccggtcttga gcgctgagag cctcatcgag tatcaagatt     96600
     ggagcgtttc tgaagtaagc tctggcaagt gcaacccttt gctgctctcc gccgctgaga     96660
     tctaagcctg agcaaccgat cgttgtttct aaaccttttg caaggtctct aattatgttt     96720
     cctaacattg ccatttggca tgcttgttta aggcggattt cgtcgtcatc aacaccagct     96780
     tccccaatgg tgacattgtt tgctagagtt tcagtgaaca acgaggtggt ttgttcaaca     96840
     agcattatgt tgcgcgcaag ttcactttga ttaatttcct taacatcttg gccgttaaca     96900
     ttaatagtcc cagatcctat tccataaaac ccgagtaaga ggttgcctat tgttgatttt     96960
     cccgaacccg acttcccaat gacgaaagtg gtttctccag aaggaaaatc caggctaact     97020
     cctttcaaca caaagtcatc aggtcttgtt gggtacgcaa aatggacgtt ttggaacgtt     97080
     attgaagcac gctcccaaca aagaggcagg cgcctaaaag aaatctcaac cttgtttttc     97140
     tgactttcgc tggcatcgcg ggagttcaca aaagccataa ttttttgaag tcctaccgct     97200
     cccttctgta atattatgat ctgatgcaaa gtgctattca aggtgctcgc gagaaggaca     97260
     cacgaggaaa agcaagttac aacgtcacct ggcttgagtt tcccgatgtt tatacgagag     97320
     ttaccgtacc aaaacccctg cacaaacatg caaagcgtaa ggaagcgtaa gacggagtag     97380
     ttcaaggagg agaacaaaga catcttgtta aaatgttggc gacacttttg aacgcaagcc     97440
     tcaaacctcg ccaattcgcg gtcttgcgta cccagtagcc gtaccatctt ggcggcatcc     97500
     agagaccacg ccatggcgtc cgctgcgctt gaagtttcac tattctcgcg ctttgcatac     97560
     ttttcgactt tccgtgaaaa gaagacagca aacccaatta ctagcggtga gtttgccatg     97620
     ataattaacg tgagtgacca agagtagtac agagcacttc cgaggagtgc agcaactgtg     97680
     accacgtttt gaaagacgat tgcggaagat tcggcggaac tcgagcgaag ttcctcaacg     97740
     caccggttca gctgcgtgaa gtcaccagag atctgttcat ttgcatcgta ccaagccata     97800
     ctcttatcga ggtatgattg tagcattttt ctgcgcagcc ggaacgcttg tctttcacca     97860
     aggctcatcc atgccgagac cgagagccag caaagcggaa tggacgcaat acccgtggct     97920
     agtatagcca tgcttctcaa cgccagctcg tgcatgagtg cattaacaga cccaaactca     97980
     cgggcagcgg gctgttgtaa aaggttaaaa accgtgcccg tgaggattga tgtcacagca     98040
     ggcactaacc cgtaggccac tgagcatacc gtaatcacca ccagcaggct ccagtcctgc     98100
     tttagatgca cattagcgta gacatttgac aattgtaggt tccgcagctg tcgcatccta     98160
     ctatacgtaa cttggaaacc ttgggccaag acgggtgcat ctcgcttccc agtgtatata     98220
     taccgatctg gcttaattga cgcaagcctc aactagcttt ggtccctttt gtctctacca     98280
     atttcggggt tctaagtttc ccacatgaat tacccaatcg gttaacatca atcacaactt     98340
     cgcttgaacc agctgaacgt ttagcgaaaa gcggttaaaa tagccccaaa actgtttcgg     98400
     gctcgtatca aaccttaatc aattagtatg ctactattga gacccttcaa tacactgcaa     98460
     gcggcccacc ccccctaact catctgatat ccaattcttg ttgatgttat tttatatgct     98520
     agaagtgccg tttttcgtag catgtgaaaa ggatacccaa ctcacatgta tttaaagaag     98580
     ggaatccgga agttgcgggg atcaggacac ctgttcggtg gcaagtctaa ggcagactag     98640
     cgaatttaag catcttagaa agaagcaaaa aagcgaactt gacgagccat ggatttgttc     98700
     aacgatctca caggaaaact gggaaaggtc caggatgttt acatcgaaat gttgtcggag     98760
     gtggtaacag acgagaagaa tctgaagcta gcgctgttct tcattgtttt caacccactt     98820
     ttctggaaca ccgcagctcg gttggagtac aagacacact tcctcaccaa gatcaccggg     98880
     tccgcaaagc gtggctgcta tgtgctggca gtaacgatct tttcgctggg cattgtgcgt     98940
     gactacttct tccaccaggc attgatgcag cagcccactt cgcgggtact agacactgat     99000
     gcggtgcgca aggccggaat ggtgctgtct gcgttcggac aggtgctggt ggcaacttct     99060
     atgtaccaac tgggcgtaac cggtacgtac ttgggagact acttcggcat tttgatggac     99120
     aacatcgtga ctgctttccc atttaacgtg agcaacaacc caatgtacca cggatcgacc     99180
     ctgacattcc tgggtacgtc gctatactac ggtaaggccg cgggcgtgtt tgcaacggtg     99240
     ttggtgaacc tagtgtacaa cattgcgcag cagtttgagg agcccttcac ggcgcagata     99300
     tatgcgaagc gcgacgccga gcgcaccaag aagtcgtcct aggctcgcac gtgcactctg     99360
     cgcccagtgg gcatttgttc gcctgtggcc aatatctata gctttatagt ttctgtagtt     99420
     gtaaccgatt tcattcgcaa cccccaagct acgctgaaga cgatggcgta ttcattgaag     99480
     ttttccctac cccgttgtat cttcgtgcca tcgccatcac agctcacgtt tgggtcaaat     99540
     tttttgaaaa gtggcacgca tctcacagct gctcacgaag ttcaatctgc aagagtaacg     99600
     cagccgttgt aaaatgccca gagacccttt gattggtatc gttggtaagc cttcttctgg     99660
     taagtccacg acgctaaact cgctgaccga tgctgctgcg caggttggct cgtttccctt     99720
     cacgacaatt gagcctaaca aggccaccgg ctacctgcag gtcgactgcg tgtgcggacg     99780
     gtttggcaag caggcgctgt gcaaacccaa ctatggttgg tgctcgaacg gcaagcgcca     99840
     cgttcctatc atgcttctgg acgtggcggg gctagtgccc ggagcacact caggcagagg     99900
     ccttggtaac aagtttttag acgacttgag acacgcagac gcgctgatac acgttgtaga     99960
     cgtgagtgga accacagacg cggagggaaa gaacaccaga ggctacgacc cactgtacga    100020
     tatcgaatgg ctgcaagacg agatccggct gtggatcgag ggtaacttgg aaaaacggtg    100080
     gggctcaatt gtgcggcggc acacggcaac taaatccagc gccgtggaca cgcttcaagc    100140
     gcagtttggt gggtacgggt cgcacgcacc aatggtgcag cgcgcactgc acaggatccg    100200
     gggtctgccg ccattggagc agtgggataa ggaatggatc accaaggtgg ttcgttcgtt    100260
     catgatcgag aagttcccca cggtgctcgc gctcaacaag atcgaccacc cggacgcaga    100320
     caagaacgtg tcaaagatca tgctcaagta tccggaaaca aaggcggtgc tggcgagcgc    100380
     agtcacagag gtgttcctac ggaaactgaa aaaacagggc ttcgtgcact acgaagaggg    100440
     cacggagttc gtggacactt ttgaggacga cccggacgga ctcaaaccgc tggacgacaa    100500
     gctgctgcag cggattgaaa acatccgcga cctggtgctg taccgttttg ggtccacggg    100560
     cgtagtacag gtgctgcagg ccgctgcggg cgtgctggac cttgtgcccg tttacacagt    100620
     gcggaacata cacactttca cgggcggtca cggggaaaac gtgttccggg actgtttcct    100680
     gattaagcgc ggcacccccg ttggaaaggt tgcgcgctac gtgatgggcg aggtgacgat    100740
     cgcggcggta gagaccgtgg gcggtgtgcg tgtgagcgag gacgacgtgg tggacgcggg    100800
     gaagaacgac gtgctgagct tcaagcttgc gccaaagagc gtgaactgag cggcggcacg    100860
     ggcgctcgag ctgatagaga agatagtttt gttagtagga taaatgcgaa ataagcgccg    100920
     gcacgggggt ggcgccgtct ccagtgagcg ctggtggatt ctgtgtccac gtgggctgga    100980
     agtcacgtgg cgagcaaagc agtttctggc ccatttgacc tatatcacat gacctctgct    101040
     gcccgggaca atgacacaca cgtgcacttc ctattcacgt gctgtttcta tcacgtgcac    101100
     agctcttgtg ccgcctcgcg gctcgtagca agcacggcgc aagaggctgc tcccccaaca    101160
     gaggtcacag tttacgttgc ggtgacccgc gcgttacctg agtaatcgag ctttcaccca    101220
     agtaaatgtt ggcccgtctg ggtgggtaac caagtatctc cacacgagcc cctttctacc    101280
     tccgggtaac ggaccctcgc gccgtggcgg acttaatagt gccgttgcag atcttgctac    101340
     gcggcttgcg cgacgccctc tgttatgtgc ttaatttctt tttcaactcg cccgataagt    101400
     ctttctcagc cgcgccgccc agccaagcgc caacagcagc tgtaagaccg tcataaagaa    101460
     aggcttctca cagcttcgcc ccgcctttag cacgtgacca gcctattagc tcttccggca    101520
     tcccctccaa ggtcttctgg gcgcagcgta agcaagaccc aggctgttca tacccttatt    101580
     cacgtgcctg tgggtggtat gtgccttccc aggcacacgg gcatgtaatc atctgtacat    101640
     aatcaagtgc aaggctcgtt tatctcgtac gacctgttag gaccctatct aatctggaaa    101700
     aagcacggct catcgtcgaa cgctttagac tcgaagaaaa gagccgcacg gcactgcagt    101760
     ggccatctcg cggcacattt gtgcactagc gccgtggctt gggctgcccc tcctcgaaac    101820
     tttatcgctt tagagccgca ggtagtgcct tgaggcgtaa gttcttcgca tgtgcgccgc    101880
     agctcttcgg tcccttctca cgcccgtctc gcacctccat caccaggcgc ccggggacgg    101940
     gtcttctgct gctgctggct cgcagtcgcc tatcgcagat gcagggtcgt aaactggcca    102000
     gggtcgtccg agttgtgacc tctctatcac gcagccccgc tctatcgcgc gccatcggtc    102060
     ggatctcaac gcaaacaaat ctccaacggg cgttgaagac cgccaaacgc tgcgaaagag    102120
     cagcatataa aggcgacgcg cccgcgtagt ttcagtcgtt ggagtcagca caagttagaa    102180
     ggactcacat caatctcttc ttgtcgtaca tacagcagat agctcaatgt ccgagtctct    102240
     agagaagaaa aatgctggga tattatacag caacgagacc cttgaggagg atgtcgcctt    102300
     tgacaaactc gagcgcggcg ccagcggcgc cagcgccgcg ggcgcgtctg tggacggcaa    102360
     acacgaaggc atccggctga agaaagcgct tgaggcgcgg cacgtgtcga tgatcgccat    102420
     cggcgggtcg cttggtaccg ggctgttgat cggcacaggt agctctctgg ccagcgcggg    102480
     ccctgcgtca attttgattt cgtacagttt cgtgggcctg ttggtgtaca cggtgatggc    102540
     gtgtctcgga gagatggccg cgtttattcc gctggacggc ttcacatcgt acgcgtcgcg    102600
     ttacgtcgac cccgcgttgg gcttcgcagt cgggtactgc tacctgttca agtatttcat    102660
     tgtgacgccc aatcagctga ccgcaggcgc catggtgatg cagtactggg tctcgcgtga    102720
     aaaggtcaac ccgggcgtgt ggatcacgat tttccttgtt ctcattgtgc tcatcaacac    102780
     ggtcggtgtg cgcttcttcg gcgaattcga gttctggctg tccagtgtca aggtcctggt    102840
     catgctgggg ctcatcctgc tgctgtttat catcatgctc ggtggcgggc ccaaccacga    102900
     ccgcaccggc ttccgctact ggcgcgaccc tggtgcgttc aagccctact ccgaagccat    102960
     ctcgggctcc aagggcaagt tcgtgtcttt tgcttccgtg ttcgcgctcg ccttgttcgc    103020
     ttacaccggt accgagctgt gtggtatcgt cgccgccgag gctaagaacc cacgtcgcag    103080
     tgtgccccgc gccatcaagc tgaccctcta ccgtatcgtg ctcttctacg tcatctccat    103140
     tctgttgcta ggaatgaccg tcgcctacaa cgacccacta ctgatcaagg ccaagaagat    103200
     gtccacctcc gcggctgcct cgccttttgt tgtggctatc aagaacgctg gcattcctgt    103260
     cctgcctcac atcttcaacg cttgtgtgct gctctttgtt ttcagtgcct gtaactcaga    103320
     cctttacgtc gcctccagaa ccctttacgg tctggccatc gaccgcaagg ctccaaaaat    103380
     ctttgccaag actaacggct ggggtgtgcc atactactcg ctcgcggtct ctgtcctgtt    103440
     ctgtctcctt gcgtacatga atgtctcctc aggttccgct cagatcttca actacttcgt    103500
     caatgtcgtc agtatctttg gtctgttgag ttggatctcc atccttatca cctacctgcg    103560
     tttccacaag gctgtcatcg cccaattcgg cgacaagtct ggtttctctt acacggcacc    103620
     attccaacct tggtctacct gggtgtcctt gttcttctgc tgcctcatcg gtctcatcaa    103680
     gaactacacg gtgtttctgg gccacacgtt tgactacaaa accttcatct ccggttacat    103740
     cggcatccct gtctacgcta tctgctacgt gggctacaaa ttggtgcacc gctcgaagct    103800
     aattaaacca gaggacgtcg acctctacac attcaaagct gcgatcgacg cggaggaaga    103860
     agaaggtaag ctgctcgagc tcgagcgcaa agaacagctc aaaagctctc caaagaacct    103920
     cacatggttt tacgacacct ttttgggctg gattttctaa aatttcgggg tataagatac    103980
     atatgagttg cataatataa taaattctat acaagtactt gaaagagaca aagtgccaga    104040
     ggggtgaact acaatggcaa gttgcttagc attcaacctg ctagccgtcc gtttggctgg    104100
     ggattctgac ggcagatgct gaatgtccga ggaactcaag atgactagct atgcgctgat    104160
     tttaaaatga gaaaaccctt tcgttattcg tatctataaa gaacctatag aatgagactt    104220
     cgcttaagcg gacttggcgt tggtggcagc agtcaattga gcctgcttga ccaaagactc    104280
     tggagcgtcc ataactggca acatcaactc gatcaatctg atcttagagt tcttgttgaa    104340
     gtccttgtcc tcagccaact tgttccactc accagtggtg gaaactctga tggcctcgta    104400
     gtccttagca ccgaaagttg gcaacaggtc caagtggttc cagttctgga tctcgttgta    104460
     ctcagcggtt ggaccgtgaa tcaacttctc gatggtgtaa cccttgttgt tcaagacgaa    104520
     caagtatggc ttcaagttcc atctgaccat ggtggagatc tcctgggcgg tcaattgcaa    104580
     agaaccctca ccggtgaaca agataactct cttagacttg tccaactcct cggcggccat    104640
     gacggcaccc aaacaagcac cggtggcata accaatggaa ccccacaaga cctgggagat    104700
     accgtaggtg ttgttaggga agtgggtctg gttgataccg aaagcggagg taccggtctc    104760
     agtcaagacg atgtcaccct cctgcaagaa ctgaccgacc tggttccaca accattgctg    104820
     cttcaatgga gtagatgggt cgacagcggc gtttggagct ggcaactctg ggactgggac    104880
     tggcttgtag tccttgacga cggcgccgac cttgttcaac aagctctgca agacgaactt    104940
     catctggaca cctgggaagg tggcgtttct aatcttgatg tggtcggagt ggaactcaac    105000
     aacgttcttg gtcttgtaag agtaagagaa agaaccggtg ttgaagtcag acaacaaagc    105060
     accgacggac aaaaccaagt cagcggactc aacggcctcc ttgacagctg gggaagacaa    105120
     ggtaccgacg taaacaccac cgaatcttgg gtgcttctcg tcaatggaac ccttacccat    105180
     tggggtgacg aaagatggga actgagtgat gtcaatcaac ttcttggtct cagccttgac    105240
     atcgtgtctg gaagcgcaag cgtcagccaa gatgactggg ttcttagcgt ccttgatcat    105300
     ctccaacaaa gtagagatga cctcctcctc agcctgctgg tcgtttggct tcaaggccaa    105360
     gtcaattggg gtgtccaata gagaggctgg gaccatctgg tcaacgaagt tagatggcaa    105420
     acccaagtaa acaggtctct gtctaatgta ggtggttctg atacatctgt cgatctcaga    105480
     tggggcggta gctagatcag tgatcatagc agtggtctca gagatgttgg cggacattct    105540
     gtggaagaca gtgaagtcac cgttacccaa ggtgtggtgc aacaatagct gcttggcctg    105600
     ggcggagacg gatgggacac cgacaatgtg caagacaccg acgtgctcag cgtaagaacc    105660
     ggcgataccg ttcaaagcgg acaactcacc gacaccgaag gtggtgatca aacaggacat    105720
     acccttgatt ctggcgtaag cgtcggcagc gtaagaagcg ttcaactcgt tacagttacc    105780
     ggcccatctc ataccctcga cctcgtagat ctcgtccaac agacgcaggt tgaagtcacc    105840
     tggcagaccg aagacagtgg taacatcgac ctgctttaat ctttcaaaga cgtagcgacc    105900
     tagagtaatt tcagacattg ttatttctgg tttgttttgg gatactcgat tggagtttaa    105960
     gttcctggtt ttataaaaat cacaataaag gatcaaatca gacattacaa aatcgggctt    106020
     tcccagctcc ttatttatac tctgccggcc tgcgctttcc tcgcgatgcc ttcaccctgt    106080
     atgcattttc caacacctgt ccaattccaa cttcatgcga tgtctagcgg acgcccgcgg    106140
     taacgaaccg gatgctagca ccaatattca ggccagacag cccatacagt gcgtaatttt    106200
     ctttttattc agcttccact cgtgtgatag cggcgaaaaa gtggcgaata tgcatttcct    106260
     ctaaacgcat attatccgag ggactatgca tacggcacgt atgcgtttag tggaaaatcg    106320
     cgttcgacgc gataagccgc actcgcatgc tgcatacacg tgatccgtgg ttcgtgctcc    106380
     ctcattccga tagttgcgtg ctcacgtgcg cgcatcttgt tctggggatt ggcaaaggac    106440
     caagggggct accccagaga ccagcttggg gagcggaaaa cttggttcct ccggctccgt    106500
     cacggtagtg ggctatcgtt cggagactaa tgaaccatac tcgtagtact cgatagcttc    106560
     aaagctgctg tagctgtctt gcagcattct ttccctgttt catcggcggt tgttgtgtgt    106620
     tgtaggagtg aaaccccgcg ttgaagctgg cggttagcac gagaggctat ataactataa    106680
     acgggtcatt gtcctctcgc acatgatgct cattctcgat atcatactga acggaaggaa    106740
     acatatagtg cacgtgatag gtagctttga acgagataca agtccgagcc ttttgtcacg    106800
     tgatggggtg ttccagctct gcgttttgcg ggccgtgcgc agtgctctca tccatagtaa    106860
     gtgcgtcgcg acgaggaagt cgtcgtttaa ggcctggctc agtggctgaa tcccagtgcc    106920
     tttgtttgtc cagccgcgcc ccccaaggac atcgtggcct gcagcataaa cgtcgctaga    106980
     atctagggga ttcaatgccg ctcctgtgtg ccatgcgata ccaattcccc tggactagac    107040
     cagaatagta agaccgggct aatcctcagg cttggaaggt tttggttcgt ctcgcgtgat    107100
     atatttcttt tgctcacgtg cagtctcaca gagcctcgtc tttcatcatt tcgtgcccat    107160
     tttcttcaaa gtagtcaacc tgcccgctcg agcaaccctt ttatggcgct tgatctgacc    107220
     cccgaccaat gggagcggct cacggcttgg atacgagatc gcagcggtct gcccgactcg    107280
     gaagccctta cgctgttcca ggattttgtt cttgaactgc ttcgtaactt acacagttgt    107340
     aacgagcgga aatggctaga agagcagctt tcagggctag tggacaatcc tactgagttt    107400
     ttacgtgatc tagaaatttt cttgaagggc ttgggcgcgt ccgcgcctcc atcacttaat    107460
     tctggcaccc cgttcgtact ggtggcacat gtcccttaca aaaacctcaa cgcgcaagac    107520
     gtgcaagctg ctttcgcgcc ctttggtgcc attgtgtctt gccgtgcaga cgtggattct    107580
     cggagcctac ttgtccaatt tcggaaagtt gcgtgcgcaa ttcggtgcac caaagcggcc    107640
     acgctcttct ttagcaacag gttcgttact gtcgagttat accagggcga ccctgaaagt    107700
     tttggtagcg tgcggctaat tggtagtgcc cctcaaccgg tggctgcaga ttcggatccg    107760
     gttccgcctt cggctgcgaa gccctcacct gttcccttca atgaccgcgt tcaacaagtc    107820
     cagaccgccc agcaaaccat attcgagcaa aatcagcgtt ctgctgaagc ctacaagcac    107880
     aatttcgctc agttgtttga gtcgaaggaa aagctacttc gggcgcacca agccgctctg    107940
     caggaactta agcaaaaggt tctcgccaca gaggatccgg ctagtatctc tcgaacaatc    108000
     atagagtttc aagaactaca gaagaatatg gagagccttg gtataacgcc gattgccatg    108060
     gttcagctga aacttcagaa gtttaacctc gacgacccgt cggaattccc tgtcgagagt    108120
     ccgcgcgcgc tcgcggtcaa gcaaaagcga actaagaagg ctgcatcatt tcggagaaaa    108180
     atcaaacgca gaagatgaaa tgatctcgtg cttttatgga aactacacaa tatgattaca    108240
     acagaggtta tttcctctta agtttcacga attacccata ccccgtgtct tagccctcat    108300
     gcgctctatc ctagccttta gttgcgatgt tacctcagcc gctcttttcc agctttcgtc    108360
     attcaaaaag ctattgccgg tcgtggcagc acgctccgcg gaacgcagct gcaaggagtt    108420
     tactctatga ggcaagtcgt cgctacattc actcggggac ctcagtctac taccgacgct    108480
     cggtagacgg ctgtctgcaa tcctatctga atttgcgtcg aacgatggcg aagcgcggcc    108540
     gttagatgag gaggagaaaa ctcttttggt tggcggggtc ccaggtggtg ctaaagatag    108600
     cggcgccgac ggaggttcga atgaggaagc cgaccgaacg ccgtaattgg aagagggcag    108660
     ggttgacttg gcttctaact cctgctctag gttggatatc cgatcttgaa gacgagtaat    108720
     ctgcatttcc tttgatcgca gctcgatgtt gctttcgtgt aagctggatt gaacggtgtc    108780
     caactgctgt cgtaaagaag aattttctga gctcaaatgc gaagccttgt tttggaagtc    108840
     tgtgatggtg gccaaaaatt cttggcgctc tttaagccac ttttgcttct gtctttgaag    108900
     ttcttcgaat cctgcatgag gcgctgcctg cggtttcgag gcaggtgcgg agtcagtagt    108960
     caaggaacgc gccgtcagtc tggatttcat ggacgacgct ccatcttggt aagtttccac    109020
     tcgagtgcct gtctttagag gcgatgaagg gcctctcttg gaaggtattg tcgacagcgg    109080
     tttccgaagc ggcaaggtgc ttccgctggt tgcctgcgca ctcaagtcag gtgtaggagt    109140
     cgtgcgcggc gcttggcgac ggctcgcgtt gggagtgtaa ggcatcgagg gcttctccct    109200
     tcgtgcagga gccgatgtga cggcaccctt tgtggcacca cccgcgacct cgactttctc    109260
     ataatgttcg tagacttttt tcttctttaa attgtcaagc ttgtccagca cgtcagaaac    109320
     ttctctctct ccaacgagct tcattaaggt agccaagcac tcgaacccgg cgtcacgtac    109380
     tgttggctga gtatctccaa cgattttaag tagcatttgt gaaatatcag gtactaattt    109440
     gatgagcagc tcatcgccaa agtggcgacc ttcaggcgtc cattttttca gaaggcgcgt    109500
     cagaaaccta gtactttctg ttcgaacctg gggagttttg tggttaataa agctcaaatt    109560
     gtcttcgagg caagcatcta caccacagca gtcggcaata ttgttgagtg cttcgcaaat    109620
     cgcttcattc accgaagcct tcttctcttt ggaccgctcg agcagtgatc tcagcacaat    109680
     ggagccgtaa ctcctggtga agtttgcttt cagcttctgg cataattgct ggacgcattg    109740
     tgctgccagt gtaaccgctt gaacatttgc atctttctct attacatgag cgacagccct    109800
     caaaaaatca ctgtagtcct ggcccttggc ctcaaatttc ttggttggaa tcagaacttg    109860
     gttgagtatt tcttccagaa cttcaacacg atccttccac ttggatgatg ttattctttc    109920
     catgaaatcg agcggaaatt tttcgagaac cggcgaaact ggcaggagct cgaaagggtc    109980
     aagctgagga agtccaggat ttgcgtgagc tttgacatca ggaaaagact ctcccatcaa    110040
     ggtgtcacca tccttgtctt tgctaccttc taaattttga acttcgagcc ccttctgcca    110100
     ctgaaatgga cgcggttggg aggttggagg gatctcgccg tcgtatttgc caaacgtctt    110160
     gtcgaggtca cgctgctgga taggcttcaa cttttctaac agcagttcct ggagtaggtc    110220
     ccgacctagc cacttgtaaa gctgcaggat gagattcatg gtttgagacc taacgtttcg    110280
     gtcggcatga ctagaaagtt tcggcagggg ttcaagcaga acaggtagaa acccggacat    110340
     gttgctaact tgtgccaggc caaaactctc cacaatatta gatatgcatt cgacacagtt    110400
     agcgacaagc ctggggagct tattggtgag tgaaggctcc aaaagctcga tagagtgttc    110460
     cacggaccga tcgagcgata ctaagataag gacgcattcc tgggctttgg cctttgtcga    110520
     gttacgcgat gaactgaggc ctttctcggc cagtaacggc agccagcgcc cacgcatttc    110580
     gtctgagcgc ggcgtatccc ggaactcgca tagatactca agcatatttt gcagtgctgt    110640
     tatcgcttgc tcctgtgcta caacattaga gtccacaata tagccggcga acaagtcagg    110700
     gttggcccaa tactgcgcga gttcccgcgg gacagatgtc acagaagctt tttggaacag    110760
     cgcctgcagc tcctggtacc cgtgcaggcg cgccttccat agcttgtgat ccaatctttc    110820
     ggagagcggc agagaggtaa aatcgccgtc ttcggagtct gccatgctgc gcgaatctgt    110880
     gctgatgcgt gtttacgcag acatcgaacg ctcagatcac aaacgcacgg taaatagagg    110940
     tctgccatgc gcttcatttc gcagtggccg ggtaactgct catcgcgtgc cagaaaggac    111000
     cctaatcggc ggccattggc ctcggattgc tagcaagtga attgtcgact acaaggttca    111060
     tagtagttac agtgagctac agactctggc tttcgagatt ctccaaggcc tcttccttcg    111120
     ttaggctctc tttccaacta atgtttttga tggctaactc gacattccac ttagaaaaca    111180
     catgaacgta attaaagcgc ataaacacaa aaaaaacggt gaagaacaat gaaaaaggtc    111240
     gcctgggcat tgtaatgatg atgtgaatgt caataccgcg atatgaggct atcccattat    111300
     gtgtgcgact cgaacgggcg ccttgccgcc aagcacgtga taatacaaca acaacaggct    111360
     aagacgggtg ctgagaccaa gccgcagctc cagggaacgc aaaggccatg attcaaatgc    111420
     gaagcacgcg taagatacac gcgacattgc aactgcaagc ttcgcgttag caagaacatc    111480
     cgctgttaat cgttctgaac gtcagagacg cacgaataaa acaagtggat atatgcttaa    111540
     cttctctgcc cttctttcga aataaggcaa tttggccgag tggttaaggc gtaagattag    111600
     aaatcttttg ggctctgccc gcgcaggttc gaatcctgca gttgtcgtta tttctttttt    111660
     gccgctctaa acggcccttt tttccctttt agatatatgg attaaggtgc tcgagaatag    111720
     actaggcaaa agaggaccaa ttgagctaat caaagcctat agagacatac gttatcaatt    111780
     agttgggctt gtgggcttgt ccgcctgtat tacacatcta cgattttctt tctcttctac    111840
     tcacggctgc aagacagggc tgataaatct cacgagtcgt aggattactc atttccgcac    111900
     actggaacaa gtacttaaaa atgctagaag cttgaccgtc cactgttggg cgtctattag    111960
     caagcagact cgctagactc ttgttattaa ttgctgcggt tacccatgct aaaagcttac    112020
     taaccccgtg ctctagaact ttttcgccag agtatataag agccacagga ctccaaggaa    112080
     ggtgcggcat tacctttgag tttcgctacc agagaactcg acaagactcg ctgctcacat    112140
     acacgtacat cacacttcat taacaatggt tgctcaaatt ggttccgctt ctgaattcga    112200
     acaggccgtc aaggtcgaca agctggttgt tgtcgacttt ttcgccacct ggtgcggtcc    112260
     ttgcaagatg attgctccta tgatcgaaaa gttcgccgag cagtacccaa gtgccgcctt    112320
     ctacaagcta gacgtcgacc aggtccctga ggtcgcccag cagaacgaag tctccgccat    112380
     gccaaccatc ctgctgttca agaacggcca ggtcatcgac aaggttgttg gcgccaaccc    112440
     agctgccatc aagcagaaaa tcgctgccca cgcctaagcg tcgcttggaa gcatctcgtc    112500
     ctgtaattct atatacgcgt ctatcgaaat aatataagtt tcattttagg agctcctgga    112560
     tctcaccgtc agtgtatcca aagatgtaga acgcgtcttg catagagcgc gtgttgagct    112620
     tggaaggtgc ggcagcctgg accttgggct tcgcgttcca ggcaattccg aacccagcaa    112680
     cgcccatcgc aggcaagtcg tttccgccgt ctccaaccat caccgtggct tcgattggca    112740
     ctccgtgctc gcgcgcaagc tcgatcaacg tcgcagcctt gcactcgcca tccacaacgt    112800
     ccccgagggt gtagccgctc agcacctcct cgcccgtgct cgcgtccgtc tctgtggcca    112860
     gtacgttggc ccgtgcgaaa tccagtccca gcacctcctt catgtgattg gcaaatggcg    112920
     taaacccgcc acttaaaaca gcgagcttac atccggtctt ttgcaagcct cgcgtaagct    112980
     ctggaacacc ctctgtcacc cgcagcttcg ccttgatctc gtcgtacagt gtagctgttt    113040
     tgataccctt cagcagagcc acgcgctcct gcaaggactg cttgaagtcc agctcattat    113100
     tcatggcacg ctctgtgatt tcagccacac ggtcctcgac ttgcgcatac gcagcaatca    113160
     attcaatgac ttcctgatag atcaaggtcg agtccatgtc gaacactacg agaccttttt    113220
     tcttgcgcca ctccgagttc ttctgcacaa taacatccaa aatgccattg ccaaggctac    113280
     ccatggtttc tttaatgaca gcgacatctt tttgggtcct taaaaagaag tcataagctc    113340
     tcacagacag cgctttttcc tgctctagtt cgacgtcaga gagatcattc aggaacgcgc    113400
     gaaacccgct cttggtttgc tcagagagct cagaaccatg tgctatcaga gtgactacta    113460
     tctcagcgga agacatttcc aatcttgcgg gcgtgcttat ttctgttccc aaatgagctt    113520
     cgcttcattt aagattcatt ttcgatattg tcaagaagtc aatgaaaaaa atgatcaatt    113580
     taagatcgct attagcttga aggcctcatc agcgatatcc gagctaccga gctataagaa    113640
     gcccggcacc aggtaacata tcactttccc aatgagcaag tcacttcgta ttctggttcc    113700
     cgtcaagcgg gttattgact atgctattaa acccagaatc aacaaggctg gaacaggagt    113760
     tgagaaaacg ggtgttaagt tcagtatgaa cccgttcgat gacattgccg tcgaagaggc    113820
     agtgcgcatt agagaaaagc acaagaagct cgtggaaaac atccacgcgg tttccattgg    113880
     ccctttgaag gctcaagaca ttctgagaac tgcattggcc aagggtgccg acacttgtag    113940
     tcacgtcgac gtcaaagaag ccgagctaga gcctctggca gttgcaaaaa tcctaaaaga    114000
     gatggtagca aagcagaatg cgaacttggt cattctaggc aagcaaagta ttgacgacga    114060
     ttgcaataac acaggtcaga tgttggcagg actactgaac tggccacagg ccacattcgc    114120
     cgccaaagtt gaaatagacg aggctaatat gaccgccaga gtgacccgtg agattgacgg    114180
     tggtgaggag accgtaagtg ctccactgcc gctagtagtc accactgacc tacgtctaaa    114240
     ccaaccacgt tatgctacac ttcctaacct gatgaaggcc aagaagaagc ctttggaaaa    114300
     gctatctcta tctgatttta gcaaggtgga cgctgagcct agactcaagg tcatgaaggt    114360
     tgaagagcct cccacgcgtt ctgcgggcat caaggtcggc tcggtggacg aactgatcga    114420
     aaaattgaaa gaagtgaagg ctatctaaat acatacgcac ggacatagca tccttccagg    114480
     atacaaatac gttgggtggt tctcatacgg agttttcttt cacctgcctt ctagacggcg    114540
     agagtaccgc gcaatctgtg atacca