(data stored in SCRATCH zone)

EMBL: CU928168

ID   CU928168; SV 1; linear; genomic DNA; STD; FUN; 1513537 BP.
XX
AC   CU928168;
XX
PR   Project:PRJNA12499;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Lachancea thermotolerans CBS 6340 chromosome D complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans CBS 6340
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-1513537
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1513537
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   MD5; b634f3240a5bb7f436e0eb0bf4fcfa72.
DR   BioSample; SAMEA3138300.
DR   CABRI; CBS 6340.
DR   EnsemblGenomes-Gn; ENSRNA049514814.
DR   EnsemblGenomes-Gn; ENSRNA049514849.
DR   EnsemblGenomes-Gn; ENSRNA049514886.
DR   EnsemblGenomes-Gn; ENSRNA049514926.
DR   EnsemblGenomes-Gn; ENSRNA049514952.
DR   EnsemblGenomes-Gn; ENSRNA049514979.
DR   EnsemblGenomes-Gn; ENSRNA049515030.
DR   EnsemblGenomes-Gn; ENSRNA049515057.
DR   EnsemblGenomes-Gn; ENSRNA049515093.
DR   EnsemblGenomes-Gn; ENSRNA049515113.
DR   EnsemblGenomes-Gn; ENSRNA049515154.
DR   EnsemblGenomes-Gn; ENSRNA049515188.
DR   EnsemblGenomes-Gn; ENSRNA049515221.
DR   EnsemblGenomes-Gn; ENSRNA049515289.
DR   EnsemblGenomes-Gn; ENSRNA049515320.
DR   EnsemblGenomes-Gn; ENSRNA049515354.
DR   EnsemblGenomes-Gn; ENSRNA049515393.
DR   EnsemblGenomes-Gn; ENSRNA049569555.
DR   EnsemblGenomes-Gn; ENSRNA049569620.
DR   EnsemblGenomes-Gn; ENSRNA049569686.
DR   EnsemblGenomes-Gn; ENSRNA049569742.
DR   EnsemblGenomes-Gn; ENSRNA049569803.
DR   EnsemblGenomes-Gn; ENSRNA049569863.
DR   EnsemblGenomes-Gn; ENSRNA049569917.
DR   EnsemblGenomes-Gn; ENSRNA049570045.
DR   EnsemblGenomes-Gn; ENSRNA049570107.
DR   EnsemblGenomes-Gn; ENSRNA049570160.
DR   EnsemblGenomes-Gn; ENSRNA049570289.
DR   EnsemblGenomes-Gn; ENSRNA049570333.
DR   EnsemblGenomes-Gn; ENSRNA049570367.
DR   EnsemblGenomes-Gn; ENSRNA049570403.
DR   EnsemblGenomes-Gn; ENSRNA049570528.
DR   EnsemblGenomes-Gn; ENSRNA049570580.
DR   EnsemblGenomes-Gn; ENSRNA049570645.
DR   EnsemblGenomes-Gn; ENSRNA049570759.
DR   EnsemblGenomes-Gn; ENSRNA049570840.
DR   EnsemblGenomes-Gn; ENSRNA049570907.
DR   EnsemblGenomes-Gn; ENSRNA049570986.
DR   EnsemblGenomes-Gn; ENSRNA049571065.
DR   EnsemblGenomes-Gn; ENSRNA049571140.
DR   EnsemblGenomes-Gn; ENSRNA049571214.
DR   EnsemblGenomes-Gn; ENSRNA049571287.
DR   EnsemblGenomes-Gn; ENSRNA049571354.
DR   EnsemblGenomes-Gn; KLTH0D03300r.
DR   EnsemblGenomes-Gn; KLTH0D03674r.
DR   EnsemblGenomes-Gn; KLTH0D03696r.
DR   EnsemblGenomes-Gn; KLTH0D03850r.
DR   EnsemblGenomes-Gn; KLTH0D04202r.
DR   EnsemblGenomes-Gn; KLTH0D04488r.
DR   EnsemblGenomes-Gn; KLTH0D04752r.
DR   EnsemblGenomes-Gn; KLTH0D05016r.
DR   EnsemblGenomes-Gn; KLTH0D05874r.
DR   EnsemblGenomes-Gn; KLTH0D05896r.
DR   EnsemblGenomes-Gn; KLTH0D07282r.
DR   EnsemblGenomes-Gn; KLTH0D07348r.
DR   EnsemblGenomes-Gn; KLTH0D07612r.
DR   EnsemblGenomes-Gn; KLTH0D07656r.
DR   EnsemblGenomes-Gn; KLTH0D07678r.
DR   EnsemblGenomes-Gn; KLTH0D07700r.
DR   EnsemblGenomes-Gn; KLTH0D07722r.
DR   EnsemblGenomes-Gn; KLTH0D07744r.
DR   EnsemblGenomes-Gn; KLTH0D07766r.
DR   EnsemblGenomes-Gn; KLTH0D07788r.
DR   EnsemblGenomes-Gn; KLTH0D08096r.
DR   EnsemblGenomes-Gn; KLTH0D08206r.
DR   EnsemblGenomes-Gn; KLTH0D08888r.
DR   EnsemblGenomes-Gn; KLTH0D09394r.
DR   EnsemblGenomes-Gn; KLTH0D09768r.
DR   EnsemblGenomes-Gn; KLTH0D10758r.
DR   EnsemblGenomes-Gn; KLTH0D12980r.
DR   EnsemblGenomes-Gn; KLTH0D13024r.
DR   EnsemblGenomes-Gn; KLTH0D13266r.
DR   EnsemblGenomes-Gn; KLTH0D13882r.
DR   EnsemblGenomes-Gn; KLTH0D14828r.
DR   EnsemblGenomes-Gn; KLTH0D15312r.
DR   EnsemblGenomes-Gn; KLTH0D15730r.
DR   EnsemblGenomes-Gn; KLTH0D15928r.
DR   EnsemblGenomes-Gn; KLTH0D16478r.
DR   EnsemblGenomes-Gn; KLTH0D16742r.
DR   EnsemblGenomes-Gn; KLTH0D17292r.
DR   EnsemblGenomes-Gn; KLTH0D17666r.
DR   EnsemblGenomes-Gn; KLTH0D17820r.
DR   EnsemblGenomes-Tr; EFT00001979162.
DR   EnsemblGenomes-Tr; EFT00001979164.
DR   EnsemblGenomes-Tr; EFT00001979166.
DR   EnsemblGenomes-Tr; EFT00001979168.
DR   EnsemblGenomes-Tr; EFT00001979171.
DR   EnsemblGenomes-Tr; EFT00001979173.
DR   EnsemblGenomes-Tr; EFT00001979175.
DR   EnsemblGenomes-Tr; EFT00001979176.
DR   EnsemblGenomes-Tr; EFT00001979177.
DR   EnsemblGenomes-Tr; EFT00001979180.
DR   EnsemblGenomes-Tr; EFT00001979182.
DR   EnsemblGenomes-Tr; EFT00001979184.
DR   EnsemblGenomes-Tr; EFT00001979186.
DR   EnsemblGenomes-Tr; EFT00001979189.
DR   EnsemblGenomes-Tr; EFT00001979191.
DR   EnsemblGenomes-Tr; EFT00001979193.
DR   EnsemblGenomes-Tr; EFT00001979195.
DR   EnsemblGenomes-Tr; EFT00001979197.
DR   EnsemblGenomes-Tr; EFT00001979199.
DR   EnsemblGenomes-Tr; EFT00001979200.
DR   EnsemblGenomes-Tr; EFT00001979201.
DR   EnsemblGenomes-Tr; EFT00001979202.
DR   EnsemblGenomes-Tr; EFT00001979203.
DR   EnsemblGenomes-Tr; EFT00001979205.
DR   EnsemblGenomes-Tr; EFT00001979206.
DR   EnsemblGenomes-Tr; EFT00001979208.
DR   EnsemblGenomes-Tr; EFT00001979210.
DR   EnsemblGenomes-Tr; EFT00001979212.
DR   EnsemblGenomes-Tr; EFT00001979214.
DR   EnsemblGenomes-Tr; EFT00001979215.
DR   EnsemblGenomes-Tr; EFT00001979216.
DR   EnsemblGenomes-Tr; EFT00001979217.
DR   EnsemblGenomes-Tr; EFT00001979218.
DR   EnsemblGenomes-Tr; EFT00001979220.
DR   EnsemblGenomes-Tr; EFT00001979221.
DR   EnsemblGenomes-Tr; EFT00001979222.
DR   EnsemblGenomes-Tr; EFT00001979223.
DR   EnsemblGenomes-Tr; EFT00001979224.
DR   EnsemblGenomes-Tr; EFT00001979226.
DR   EnsemblGenomes-Tr; KLTH0D03300r-1.
DR   EnsemblGenomes-Tr; KLTH0D03674r-1.
DR   EnsemblGenomes-Tr; KLTH0D03696r-1.
DR   EnsemblGenomes-Tr; KLTH0D03850r-1.
DR   EnsemblGenomes-Tr; KLTH0D04202r-1.
DR   EnsemblGenomes-Tr; KLTH0D04488r-1.
DR   EnsemblGenomes-Tr; KLTH0D04752r-1.
DR   EnsemblGenomes-Tr; KLTH0D05016r-1.
DR   EnsemblGenomes-Tr; KLTH0D05874r-1.
DR   EnsemblGenomes-Tr; KLTH0D05896r-1.
DR   EnsemblGenomes-Tr; KLTH0D07282r-1.
DR   EnsemblGenomes-Tr; KLTH0D07348r-1.
DR   EnsemblGenomes-Tr; KLTH0D07612r-1.
DR   EnsemblGenomes-Tr; KLTH0D07656r-1.
DR   EnsemblGenomes-Tr; KLTH0D07678r-1.
DR   EnsemblGenomes-Tr; KLTH0D07700r-1.
DR   EnsemblGenomes-Tr; KLTH0D07722r-1.
DR   EnsemblGenomes-Tr; KLTH0D07744r-1.
DR   EnsemblGenomes-Tr; KLTH0D07766r-1.
DR   EnsemblGenomes-Tr; KLTH0D07788r-1.
DR   EnsemblGenomes-Tr; KLTH0D08096r-1.
DR   EnsemblGenomes-Tr; KLTH0D08206r-1.
DR   EnsemblGenomes-Tr; KLTH0D08888r-1.
DR   EnsemblGenomes-Tr; KLTH0D09394r-1.
DR   EnsemblGenomes-Tr; KLTH0D09768r-1.
DR   EnsemblGenomes-Tr; KLTH0D10758r-1.
DR   EnsemblGenomes-Tr; KLTH0D12980r-1.
DR   EnsemblGenomes-Tr; KLTH0D13024r-1.
DR   EnsemblGenomes-Tr; KLTH0D13266r-1.
DR   EnsemblGenomes-Tr; KLTH0D13882r-1.
DR   EnsemblGenomes-Tr; KLTH0D14828r-1.
DR   EnsemblGenomes-Tr; KLTH0D15312r-1.
DR   EnsemblGenomes-Tr; KLTH0D15730r-1.
DR   EnsemblGenomes-Tr; KLTH0D15928r-1.
DR   EnsemblGenomes-Tr; KLTH0D16478r-1.
DR   EnsemblGenomes-Tr; KLTH0D16742r-1.
DR   EnsemblGenomes-Tr; KLTH0D17292r-1.
DR   EnsemblGenomes-Tr; KLTH0D17666r-1.
DR   EnsemblGenomes-Tr; KLTH0D17820r-1.
DR   EuropePMC; PMC2765284; 19525356.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00069; SNORD24.
DR   RFAM; RF00086; SNORD27.
DR   RFAM; RF00471; snosnR48.
DR   RFAM; RF00473; snosnR54.
DR   RFAM; RF00475; snosnR69.
DR   RFAM; RF01176; snR78.
DR   RFAM; RF01181; snR77.
DR   RFAM; RF01185; snR75.
DR   RFAM; RF01207; snR73.
DR   RFAM; RF01209; snR76.
DR   RFAM; RF01248; snR8.
DR   RFAM; RF01251; snR3.
DR   RFAM; RF01254; snR34.
DR   RFAM; RF01255; snR35.
DR   RFAM; RF01257; snR31.
DR   RFAM; RF01259; snR63.
DR   RFAM; RF01262; snR44.
DR   RFAM; RF01267; snR37.
DR   RFAM; RF01846; Fungi_U3.
DR   StrainInfo; 318472; 0.
XX
CC   The Lachancea thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1513537
FT                   /organism="Lachancea thermotolerans CBS 6340"
FT                   /chromosome="D"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0D"
FT                   /db_xref="taxon:559295"
FT   gene            <796..>2658
FT                   /locus_tag="KLTH0D00110g"
FT                   /old_locus_tag="KLTH-ORF12822"
FT   CDS_pept        796..2658
FT                   /locus_tag="KLTH0D00110g"
FT                   /old_locus_tag="KLTH-ORF12822"
FT                   /product="KLTH0D00110p"
FT                   /note="similar to uniprot|P38724 Saccharomyces cerevisiae
FT                   YHL047C ARN2 Transporter member of the ARN family of
FT                   transporters that specifically recognize siderophore-iron
FT                   chelates responsible for uptake of iron bound to the
FT                   siderophore triacetylfusarinine C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22295"
FT                   /db_xref="GOA:C5DDD7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD7"
FT                   /protein_id="CAR22295.1"
FT                   /translation="MPEYQQGGPSLGSESTPNENYGKANVVQTEKEFSHDSKNEPELGD
FT                   KLQITKRIVIRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQ
FT                   THSLLSTVSVISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRY
FT                   AAGSIFYYIGLVGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPE
FT                   KNWSWGIAMWAFIFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQ
FT                   LFWKLDVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLLVPFFIYWESK
FT                   LALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSL
FT                   YSFVAAVFSPVVGIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVV
FT                   WGITSCFFNYPINISMQTVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRL
FT                   LKALGDPTLALEAYNMPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLL
FT                   TFFLRDPPLTEDYGQKLEDDEYVKHDDPITDWIAERFSSFKKHE"
FT   gene            complement(<2951..>6727)
FT                   /locus_tag="KLTH0D00132g"
FT                   /old_locus_tag="KLTH-ORF12818"
FT   CDS_pept        complement(2951..6727)
FT                   /locus_tag="KLTH0D00132g"
FT                   /old_locus_tag="KLTH-ORF12818"
FT                   /product="KLTH0D00132p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22296"
FT                   /db_xref="GOA:C5DFV4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037240"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV4"
FT                   /protein_id="CAR22296.1"
FT                   /translation="MEKISDRFAAIHGFLIKTNRDGTKRITCPNISSLKPTKKEVQRIL
FT                   ELKLQNLAVYLGMKEDLIYVDCPLLFETVTSEQRYFYSTEDGMKAVRSGRTNSANTRRS
FT                   IEYRVLPITLPNKTRKYLCQTGKKLPEMPLEHEIATPRQESEAETATVPQASEDLDVFH
FT                   TLHCDKLVFTNRDRRLFRSFAMDRTLYEVESVAILKHCHREAISKTTKTNSFGEPLVTK
FT                   YKLETLEIHGKHAGVLLFLIANLHQLSLGQQVERPTVDSELLLDRIGELHNTEAKAAHL
FT                   QQLLYIVLKEERYMDLANLFTRLLLFRLSAHFDIRKDLEVEEMETVRERMSATGVWIKC
FT                   VIISEKSEDQLNIFQEESHNIWSKFTTLYHKVAKESDQTMTMNINRVPPDCIRVYGKTF
FT                   GREYIKSFYSDMQYEFDQQWSKLDRVLTMTPVESTGKMLLENYRIPWAGHGYRANFSLK
FT                   DMFPQWIHDQVSPSMRQPLTQLDKREVLGAIDKMTVALMWMIWLAAGVPYTFSELQVLA
FT                   CGGDQQNIYVDSERRCVQIITRSFKKGNLKEDFKWLDKRTSYYLVYYVTVLRKTQISVL
FT                   GENYEAFEPPKEGEVDLEGIWEHIEGKCNMSKKEASALIMDQYLFLDAKLGQLMSRRRF
FT                   LKPSEEHPNYVASPERLSFKQLKFGRMGLLRQYLASSLNDSKPVKTARIDLAMCRFAAS
FT                   SARDYMDELGDSEDVDDPDAMGDLEVLEESMWQCEQSERFMTRTWHEEIAKQWIRWVGL
FT                   DEEEEIHHPLTYSVGEIVLQKEALCPDDLVHAGRELYGKSFTFRNSDQYLACVNAYLSN
FT                   KKIIAVQAPPGLGKTLVFQLPLMCYTMRKLSLVSFVFVPFVGLLAGTMCRLEASGNLRV
FT                   GSVEKLLNETRCKENSLLDVYVGTFNDAAAEDFIKMINFWSLLYPEKKLGLLAFDEFQN
FT                   LYDEKSHSEVSFPSLKRVQFGRFRRIILTSATCEQGSAQGALQELGFRGREGTNFTWER
FT                   SQAGRSVDVPIFLRNYVQEPAVMHVYKHALRMRGNGVGQVKQFLRSLFAYDPDAKAALV
FT                   VGENVATTELFTEVSQEFSAAYVHSDLTTEEKLKRVQSFIKDKSLQLLIGTKQVVEGLD
FT                   IEGLRMVILLDYYPRVAEYIQCVGRVRGSGTCIALWQDPPPQVENDQPRVDYDKCFTSQ
FT                   ICKYYELPQRVHAGCCGSFESVTEEAKSLFHRVVLEEEVNDVCSQKTTRDEDSEQGRER
FT                   KIARTDVIASADDSNEVSGVNKRPQDDTAITKA"
FT   repeat_region   complement(7718..8133)
FT                   /locus_tag="KLTH0D00154t"
FT                   /old_locus_tag="Klth0D.LTR.1"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <9418..>11267
FT                   /pseudo
FT                   /locus_tag="KLTH0D00176g"
FT                   /old_locus_tag="pseudo-Klth0D-9418-11267"
FT   gene            complement(<12199..>13608)
FT                   /locus_tag="KLTH0D00198g"
FT                   /old_locus_tag="KLTH-ORF12810"
FT   CDS_pept        complement(12199..13608)
FT                   /locus_tag="KLTH0D00198g"
FT                   /old_locus_tag="KLTH-ORF12810"
FT                   /product="KLTH0D00198p"
FT                   /note="similar to uniprot|P24031 Saccharomyces cerevisiae
FT                   YBR092C PHO3 Constitutively expressed acid phosphatase
FT                   similar to Pho5p; brought to the cell surface by transport
FT                   vesicles; hydrolyzes thiamin phosphates in the periplasmic
FT                   space, increasing cellular thiamin uptake; expression is
FT                   repressed by thiamin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22297"
FT                   /db_xref="GOA:C5DFV5"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR016274"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR033379"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV5"
FT                   /protein_id="CAR22297.1"
FT                   /translation="MWLENNMLMALAGLYTAHALSIPKKYKADVKNIGTQEHIFPYLAG
FT                   SGPYFSYPNDYGISADTPSGCEISQIQLLARHGERYPSKSKGKKLLKTWNTLQHFPYQF
FT                   NGSLSFIDDDYEFFIQDLDNLEMETTTENSVNAINPYTGEMDAKKHAQEFLAQYADFLE
FT                   DNREFAVFAASSQRVHDTAQFFIDSLGDKFNISLQVVSEEPSAGANTLSPGYSCPAWNP
FT                   DEYEDIIGSYSTTYLKAIAERLNRENSGLNLTVTDAYNLFDWCAFELNARGYSEICDVF
FT                   SPEELIHYSYYDDLTAYYEDGPGYPLIQAVGALYFNASIKLLQQSEQLDQKVWLSFTHD
FT                   TDILNYLTTVGLFDDEKKLDPSYIPFRNHVFHKSWFIPQGARVYTQKYRCSNESYIRYV
FT                   VNDAVIPLENCSDGPGFSCEANKFYKYAENRTANQDFYQSCNVSSVSNITELTFFWDWN
FT                   TTHYNATLLKE"
FT   gene            complement(<17298..>17885)
FT                   /locus_tag="KLTH0D00220g"
FT                   /old_locus_tag="KLTH-ORF12803"
FT   CDS_pept        complement(17298..17885)
FT                   /locus_tag="KLTH0D00220g"
FT                   /old_locus_tag="KLTH-ORF12803"
FT                   /product="KLTH0D00220p"
FT                   /note="highly similar to uniprot|P40893 Saccharomyces
FT                   cerevisiae YJL217W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22298"
FT                   /db_xref="InterPro:IPR009784"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015987"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV6"
FT                   /protein_id="CAR22298.1"
FT                   /translation="MTDSPWSKGSWLNAPSQVTIDNDRLKITTDEKTDFWRQTFYGFTR
FT                   DSGHFFGIKTGSSFTAELRVQGSYESLYDQAGIMVRIDSKNWIKAGIEVSDGQKMLSSV
FT                   LTTGVSDWTTAVYNGNAYDFWLRVTVENGVLRLQVSSDKKRWPLVRLAPFPSSEEYFVG
FT                   PMACTPKRGGLNVTFSDWKLTPPLKRELHDLS"
FT   gene            complement(<20418..>21098)
FT                   /locus_tag="KLTH0D00242g"
FT                   /old_locus_tag="KLTH-ORF12799"
FT   CDS_pept        complement(20418..21098)
FT                   /locus_tag="KLTH0D00242g"
FT                   /old_locus_tag="KLTH-ORF12799"
FT                   /product="KLTH0D00242p"
FT                   /note="some similarities with uniprot|P36034 Saccharomyces
FT                   cerevisiae YKL219W COS9 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22299"
FT                   /db_xref="GOA:C5DFV7"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV7"
FT                   /protein_id="CAR22299.1"
FT                   /translation="MDERNIEEYLVGSHNESIGHSRLPRDVFHNWFQYEVVRHKFYFAV
FT                   AVIQVILFIISTHNFFQAQKNANKILTVTGAVYLSSVVIYFTGLIFFQVERGFVTTAAN
FT                   KVQFLKELITIRPGIDMIEWDILATKANTIFYNESVLTSPYYFYDGASCYSFFRFVFLL
FT                   PYLRRKEACFADENSPDEIRRFISQAIKVYQEKADRKWQLILNKILSGRTNTSRWHSNF
FT                   CFKN"
FT   gene            complement(<21321..>22868)
FT                   /locus_tag="KLTH0D00264g"
FT                   /old_locus_tag="KLTH-ORF12798"
FT   CDS_pept        complement(21321..22868)
FT                   /locus_tag="KLTH0D00264g"
FT                   /old_locus_tag="KLTH-ORF12798"
FT                   /product="KLTH0D00264p"
FT                   /note="similar to uniprot|P17064 Saccharomyces cerevisiae
FT                   YER056C FCY2 Purine-cytosine permease and similar to
FT                   uniprot|P40039 Saccharomyces cerevisiae YER060W FCY21
FT                   Putative purine-cytosine permease"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22300"
FT                   /db_xref="GOA:C5DFV8"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV8"
FT                   /protein_id="CAR22300.1"
FT                   /translation="MPLKSDVEVQTSDRLTETTSVLPQDDHVNKGAASCNRYFAFLDAI
FT                   NAALGTETKGIEPTTEDERNDASLLNASTMWFSANMVIAAFSVGVLGPIVFELNFWGCV
FT                   VAVVVFAFLGVLPVAFYSVFGAELGLRQMVLSRYLLGNLTARIFAMINIIACIGWGAVN
FT                   TIASAQLLHMVNPHGARCPPWAGCLIIVLSTIIVSFFGYRVIHIYEKWAWVPNLAVFLI
FT                   VIARVRINGSFTIGHWEEGANTAAGILSLGGIVFGFATGWTTYASDYTVYMPSTINKYK
FT                   VFFAVTAGLMLPLCFTILLGAAAGRAAMNNELYRYYYDKESTGGLLYAILVPKSLGGFG
FT                   QFCCVVLAMSTVANCIPNMYSIALGTQSLWQPLAKVPRVFWTVTGNFVTLAIAIPAYYK
FT                   FASFMTTFMDAIGYYLSIYIGISISEHFVYRRGRFQNYIVADWSSWDRLPVGYAGCAAL
FT                   FVGGVGVALGMCQSYWSGEIGRLIGDYGGDIGFELGLGFSVITYNVLRPLELKFVGR"
FT   gene            <25172..>26821
FT                   /pseudo
FT                   /locus_tag="KLTH0D00286g"
FT                   /old_locus_tag="pseudo-Klth0D-25172-26821"
FT   gene            complement(<28125..>28883)
FT                   /locus_tag="KLTH0D00308g"
FT                   /old_locus_tag="KLTH-ORF12793"
FT   CDS_pept        complement(28125..28883)
FT                   /locus_tag="KLTH0D00308g"
FT                   /old_locus_tag="KLTH-ORF12793"
FT                   /product="KLTH0D00308p"
FT                   /note="similar to uniprot|Q12512 Saccharomyces cerevisiae
FT                   YOL154W ZPS1 Putative GPI-anchored protein transcription is
FT                   induced under low-zinc conditions as mediated by the Zap1p
FT                   transcription factor and at alkaline pH"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22301"
FT                   /db_xref="GOA:C5DFV9"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029482"
FT                   /db_xref="InterPro:IPR039124"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV9"
FT                   /protein_id="CAR22301.1"
FT                   /translation="MFENFKVMKITNLLSCTSLLAAISLSAPVEYSSNATISSYVEYNS
FT                   DIPGWARPTFPELYQTCNSTKRRILQSFIEDSLEVSAYAKDRLLNYGAEDVFFQRWFGN
FT                   GSIITVLGTLDHLVEASKAGFVFRCDDIDGLCLKNPTTYPGYHRQTADKETVICDLFFQ
FT                   SKKPLVNICYEGAIKDVGPKHYAGVDILHRYLHISSMNMNGFIGEFVEEFDDLAEFASG
FT                   NSTFAVRNVDSYLYYMADVYSSSVVPGGCL"
FT   gene            <29951..>31029
FT                   /pseudo
FT                   /locus_tag="KLTH0D00330g"
FT                   /old_locus_tag="pseudo-Klth0D-29951-31029"
FT   repeat_region   31772..32188
FT                   /locus_tag="KLTH0D00352t"
FT                   /old_locus_tag="Klth0D.LTR.2"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            complement(<33818..>34939)
FT                   /locus_tag="KLTH0D00374g"
FT                   /old_locus_tag="KLTH-ORF12786"
FT   CDS_pept        complement(33818..34939)
FT                   /locus_tag="KLTH0D00374g"
FT                   /old_locus_tag="KLTH-ORF12786"
FT                   /product="KLTH0D00374p"
FT                   /note="weakly similar to uniprot|P53344 Saccharomyces
FT                   cerevisiae YGR295C COS6 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22302"
FT                   /db_xref="GOA:C5DFW0"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW0"
FT                   /protein_id="CAR22302.1"
FT                   /translation="MNKACVPDKEAQNDFLPKFFYKSSLRWALDQLMRMPLFYLLLSSI
FT                   VIDIVWFSIGNKLHSFWIHVPVFSSLLLQIKVTKAISNSIQRLCEIVIEEGPGMQEEQW
FT                   DIAAARMNSHFYEQGLWPNSCCLYSGRQCHAAFRHLVMTPYNKKEEQIQASYSLDQQLP
FT                   LEEQAAKVYIESVSRWWNTYTANLESSAQFHIENTLPQQEYRSKASWCFFKFIEVVMGQ
FT                   SSFGGMCFYSILLSLFFTSFTSFKNYDSLLGVWIGNAAGFSICGPLLFFVLRGADLDAP
FT                   HLMAFWASVVAIEPHGDINKWGLVASHTNHYWNALNEESPRNFFFDSMDCRKAFKNRFS
FT                   TSLLRNKGNSHIYSDLRKYIEEALEASKEINEK"
FT   gene            <35809..>37278
FT                   /locus_tag="KLTH0D00396g"
FT                   /old_locus_tag="KLTH-ORF12784"
FT   CDS_pept        35809..37278
FT                   /locus_tag="KLTH0D00396g"
FT                   /old_locus_tag="KLTH-ORF12784"
FT                   /product="KLTH0D00396p"
FT                   /note="similar to uniprot|Q08268 Saccharomyces cerevisiae
FT                   YOL119C MCH4 Protein with similarity to mammalian
FT                   monocarboxylate permeases which are involved in transport
FT                   of monocarboxylic acids across the plasma membrane mutant
FT                   is not deficient in monocarboxylate transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22303"
FT                   /db_xref="GOA:C5DFW1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW1"
FT                   /protein_id="CAR22303.1"
FT                   /translation="MLMPSMLQKPTRAFLHGLKDLRKDHFEDSRFEAPTTSGYEGSAEE
FT                   RRLFGAELQAKRGNVQETPLSNELVEEIEIFEQEGGFQAWLVVFGSFMGLIPVFGTVNS
FT                   LGAIESYISKHQLASESSTVVSWIFSIYLSLTFSSCIIAGGYFDRNGGRDPLCVGTILF
FT                   TGAIIATADCKTVWQFILAFSVLGGISSGILMTPLVSCVATWFLKKRGLATSIATIGGS
FT                   VGGVIFPVMLRSLYSKVGFSWALRILALICFSCLACSIIFARERQKPESKPFHTKTEAF
FT                   KWYLNSSLNWRYFLDWKFLFASLGMGFAENSLTASSTYLASYSLARGNSEEVSYALIAT
FT                   TNAVGIFGRYIPGYLADRWTGRFNMVIITVSLAAFFNLVMWLPFGGNVKVLWAYSILYG
FT                   FTTGTILSLPPVCIGQISRTTDFGKRYSSAYFLEALMTIPVIPVGGAIIGSGKISNYND
FT                   FIVYSSMMMIAASICFIISRSICTGFRMCKF"
FT   gene            complement(<37778..>39463)
FT                   /locus_tag="KLTH0D00418g"
FT                   /old_locus_tag="KLTH-ORF12780"
FT   CDS_pept        complement(37778..39463)
FT                   /locus_tag="KLTH0D00418g"
FT                   /old_locus_tag="KLTH-ORF12780"
FT                   /product="KLTH0D00418p"
FT                   /note="similar to uniprot|P16467 Saccharomyces cerevisiae
FT                   YLR134W PDC5 Minor isoform of pyruvate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22304"
FT                   /db_xref="GOA:C5DFW2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW2"
FT                   /protein_id="CAR22304.1"
FT                   /translation="MTTVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVN
FT                   CCNELNCSFAAEGYARTKGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTND
FT                   SSDHRLLHHTIGTHNYDYQYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYI
FT                   EVPTNMASAICAPPGPISSLVNSVPTPKDVLSQAVNASVDFINSHLKPTLLAGPKLKCA
FT                   DAQKAFLRLAEALKCAVAVQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTIC
FT                   AGCIFTDYSTTGWTALQPSSHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKS
FT                   LIEYNRLRQSPPLIKAADPKAAITRKEMARQIQQLITPKTTLFAETGDSWFNGVQMDLP
FT                   KGALFEVEMQWGHIGWSVPASLGYAVGAPDRRIITMVGDGSFQMTAQEVSLMVRLRKPI
FT                   IIFLINNYGYTIEVEIHDGPYNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAIE
FT                   KAQANVSGPTLIEIQINRDDCTNELITWGHFVALANARPPKKTT"
FT   gene            complement(<40316..>41296)
FT                   /locus_tag="KLTH0D00440g"
FT                   /old_locus_tag="KLTH-ORF12778"
FT   CDS_pept        complement(40316..41296)
FT                   /locus_tag="KLTH0D00440g"
FT                   /old_locus_tag="KLTH-ORF12778"
FT                   /product="KLTH0D00440p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22305"
FT                   /db_xref="GOA:C5DFW3"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW3"
FT                   /protein_id="CAR22305.1"
FT                   /translation="MAQNKESSTMKAGLNPVKVVVVGTGSVGSTTAYTLLLSGMVAEIV
FT                   LIDINKDKADGEGMDLNHAAPMTTDCRVYVGDYPDCANAAIVIITGGANQKPGQTRMDL
FT                   AAKNAKIMQEIIPNIVKNAPDTILLLATNPVDVLTSISYKLSGFPASRVIGSGTLLDSA
FT                   RLRYNLSKYYNISSESIGAFIIGEHGDSELPVWSLASIAGMRLRDYCEKSNQKFDQDAL
FT                   EKIFEKTRSAAYDIIKRKGYTAYGIAAGLVRIVETILKNEGSLLTVSTVGDYFGVKQVA
FT                   LSVPTKVDRTGAHHIVGLSLDDNEIEEVKKSGQNIKSVCSRLGFD"
FT   repeat_region   43700..44116
FT                   /locus_tag="KLTH0D00462t"
FT                   /old_locus_tag="Klth0D.LTR.3"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            complement(<44278..>45819)
FT                   /locus_tag="KLTH0D00484g"
FT                   /old_locus_tag="KLTH-ORF12773"
FT   CDS_pept        complement(44278..45819)
FT                   /locus_tag="KLTH0D00484g"
FT                   /old_locus_tag="KLTH-ORF12773"
FT                   /product="KLTH0D00484p"
FT                   /note="similar to uniprot|Q12300 Saccharomyces cerevisiae
FT                   YDL138W RGT2 Plasma membrane glucose receptor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22306"
FT                   /db_xref="GOA:C5DFW4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037792"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW4"
FT                   /protein_id="CAR22306.1"
FT                   /translation="MGILQTLFHAEEDIQGSKFRAIFIGLFVAFGGILFGYDTGTISGV
FT                   LAMDYVKEHFTSRGHFTANETSLITAILSAGTFCGAMLAPLASDTIGRRLGLIISTLIF
FT                   AVGVVLQIAATGQNLLIVGRVIAGAGVGVLSAIVPLYQSEASPKWIRGAVVSCYQWAIT
FT                   IGLLLAACVNQGTHARNDSGSYRIPIALQLLWAIIMFIGMVILPESPRFYIMKEKVPEA
FT                   RKALSKLRGLPEEHEVIQNELEEISANYNYERSFGSTSIWDCFKPANHQLKRIFIGIAI
FT                   QALQQLTGINFIFYYGTQFFQNSGIKDPFIIQLIMNVVNVVMTVPGIALVEIAGRRNLL
FT                   LWGAIGMCVSELIVAAVGTALPDSFSANKTLIAFSCTFIASFAATWGPLAWVVVGEIFP
FT                   LRVRAKSVAVCAASNWLFNFAIAYATPYLVDSEHANLQSKVFFIWGGCTFLCFLFVYFF
FT                   IYETKGLTLEQIDELFEVCPSARYSKNFVPSSGPAVDVSNISDSDKAVVEVLEKV"
FT   gene            <47320..>49170
FT                   /locus_tag="KLTH0D00506g"
FT                   /old_locus_tag="KLTH-ORF12767"
FT   CDS_pept        47320..49170
FT                   /locus_tag="KLTH0D00506g"
FT                   /old_locus_tag="KLTH-ORF12767"
FT                   /product="KLTH0D00506p"
FT                   /note="similar to uniprot|P38731 Saccharomyces cerevisiae
FT                   YHL040C ARN1 Transporter member of the ARN family of
FT                   transporters that specifically recognize siderophore-iron
FT                   chelates responsible for uptake of iron bound to ferrirubin
FT                   ferrirhodin and related siderophores"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22307"
FT                   /db_xref="GOA:C5DFW5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW5"
FT                   /protein_id="CAR22307.1"
FT                   /translation="MSIEKETATGVQSSAYPIEADDKDSHRELNEYGLPDKLRVTRHIV
FT                   IKKTEILAAQYDSWYYRVILLFAAFICGYGYGLDGNIRYIYTGYATNAYSEHSLLSTIG
FT                   VVNNVIGAASQLVYARLADTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNI
FT                   GYVGVILVLLLMLSDFSSLRWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGM
FT                   WAFIFPLSCVPLIACMIHMRIKARKTPEWIALKQEKSYFQTNGLWDTLVELFWKLDVVG
FT                   VLLLIATLGCILVPLTLAGGYNSKWNNPHIIGPFVLGFVLVPILMFWEMRWARDPLVPY
FT                   GLIKDRGVWSALAISFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSSFVSVVWS
FT                   PIFSLFITRQKKLKPYIVLGCAMWMVGIGLLYHYRGGSYAHSGIIGALCVWGAGSTMWT
FT                   YPVNISVQSATSHENLATVTALNYTLYRIGGAVGTAVSGAIWTQTLYKQLLKRLGDADL
FT                   AAAAYASPYTFIVSYAWGTPQREAVVGAYRHVQRYETIVALVFCAPLVIFAMCLRDPDL
FT                   TDEVAHSGLEKGEYIVKDQTDPISDWFSSKWSRLRERKEN"
FT   gene            <50179..>50808
FT                   /locus_tag="KLTH0D00528g"
FT                   /old_locus_tag="KLTH-ORF12760"
FT   CDS_pept        50179..50808
FT                   /locus_tag="KLTH0D00528g"
FT                   /old_locus_tag="KLTH-ORF12760"
FT                   /product="KLTH0D00528p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22308"
FT                   /db_xref="InterPro:IPR037738"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW6"
FT                   /protein_id="CAR22308.1"
FT                   /translation="MSLFDTQYKGIQSVTQRYTLASRARSKMMRCASQGKGQDLDLRVL
FT                   VGHANLLDRVMESLHTEEEEEVSTSDEEEPVELGITSEVGSGHVTFALPQPLETVYECD
FT                   SDSDSDNDDEATSSDYDSDSDGEFSSDSDNESEDESDEEGFSNFGKSRNYTLTGSDAAT
FT                   TPVLRKHGGGNLYLFSLTGDGADTAERGRDLAARNGEAAGPRVLCV"
FT   gene            <51882..>53270
FT                   /locus_tag="KLTH0D00550g"
FT                   /old_locus_tag="KLTH-ORF12754"
FT   CDS_pept        51882..53270
FT                   /locus_tag="KLTH0D00550g"
FT                   /old_locus_tag="KLTH-ORF12754"
FT                   /product="KLTH0D00550p"
FT                   /note="highly similar to uniprot|P07262 Saccharomyces
FT                   cerevisiae and to YAL062W uniprot|P39708 Saccharomyces
FT                   cerevisiae, GDH3 NADP(+)-dependent glutamate dehydrogenase,
FT                   synthesize glutamate from ammonia and alpha- ketoglutarate;
FT                   rate of alpha-ketoglutarate utilization differs from Gdh1p;
FT                   expression regulated by nitrogen and carbon sources"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22309"
FT                   /db_xref="GOA:C5DFW7"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW7"
FT                   /protein_id="CAR22309.1"
FT                   /translation="MSPIAHEPEFQQAYEEVVNSLKDSTLFDKQPKYQKVLPIVSVPER
FT                   IIQFRVTWENDKGAQEVATGYRVQYNSAKGPYKGGLRFHPTVNLSILKFLGFEQIFKNA
FT                   LTGQALGGGKGGLCVDLKGRSDNEIRRICYSFMRELSRHIGQDTDVPAGDIGVGGREVG
FT                   FLFGAYKSYKNSWEGVLTGKGLNWGGSLIRPEATGYGLVYYTQAMIDFATKGKESFAGK
FT                   RVAISGSGNVAQYAALKVIELGGTVVSLSDSKGSIIAQNGITAEQVEAITEAKVQFKTL
FT                   EQIIGEYSAFSNNKIKYLAGARPWVHVGEVDVALPCATQNEVSGDEAKALVAAGVKFVA
FT                   EGSNMGCTAEAAHIFEGERLSAKSASEPAVWYAPGKASNMGGVAVSGLEMAQNSQRMSW
FT                   SREQVDQELKKIMVNCFNDCLSTAREYTNEDNAEALPSLIKGANLVGFIRVADAMFDQG
FT                   DVWA"
FT   gene            complement(<53475..>55136)
FT                   /locus_tag="KLTH0D00572g"
FT                   /old_locus_tag="KLTH-ORF12749"
FT   CDS_pept        complement(53475..55136)
FT                   /locus_tag="KLTH0D00572g"
FT                   /old_locus_tag="KLTH-ORF12749"
FT                   /product="KLTH0D00572p"
FT                   /note="weakly similar to uniprot|P54862 Saccharomyces
FT                   cerevisiae YOL156W HXT11 Putative hexose transporter that
FT                   is nearly identical to Hxt9p, has similarity to major
FT                   facilitator superfamily (MFS) transporters and is involved
FT                   in pleiotropic drug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22310"
FT                   /db_xref="GOA:C5DFW8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW8"
FT                   /protein_id="CAR22310.1"
FT                   /translation="MKAFKLKNIFAKAEDRPTPPQIYNWRIYGTALVASTASVLIGYDT
FT                   GFVGGCFANKYFLANFGLVEGEARTDDTISNLISCFHAAAFFGALFSYPLSHYWGRKRA
FT                   LIIAAAVATVGAAVMLGSVTGHLAPMYIGRVFTGLTVGASTNLTVVYLSEVSPAPIRGQ
FT                   IIAAFEIGWRVGDLVGFWINYGINQHIAPGNKQWIIPVGVQVIPAALFFIGSLIMCESP
FT                   RWLFQMHRDQEAIKNLCFLRNLPDDDGYMIWEINSIRESIATQNEEIGPGLLDPAREVF
FT                   IRNRKYAKRLVISSILLVIPNFMGIQSINYYSPKIFSSIGVKGTNATLFSSGMFGVVKF
FT                   ICTFIYILFIVDNLGRRKAFLASASMCSLCFWYLGAYLKVNDPTKPGATPKPGGKAAIG
FT                   FMFIWTASFILAFSGGPFVWSSEVFEQNIRTFVQAINAAMSWVPIFIMTRLTTTMIDHM
FT                   KYGIFFFFAAIAALAIPFVFFFVPETKGIALEDMDQLFARGLPAYKAHKVVTSKSEDTV
FT                   LEIQNSASQFFSDQGSKKGTQKLVEDADVGESASKV"
FT   gene            <57414..>59309
FT                   /locus_tag="KLTH0D00594g"
FT                   /old_locus_tag="KLTH-ORF12740"
FT   CDS_pept        57414..59309
FT                   /locus_tag="KLTH0D00594g"
FT                   /old_locus_tag="KLTH-ORF12740"
FT                   /product="KLTH0D00594p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22311"
FT                   /db_xref="GOA:C5DFW9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW9"
FT                   /protein_id="CAR22311.1"
FT                   /translation="MDFQPKRKRSVHGCLTCRTRRKKCDENKPVCGGCERNFVQCTWPQ
FT                   HTGGRVRRKRGEAAELTSDRSSTSADPAAGQGFEFHIICGPRTPVFNRSGTLAFEAYSK
FT                   SSSNQLTKFDEDAGRFVATPQFAAETPEELTRWISCCGERQTTKQADAANNTQGTLDDG
FT                   SVETTLDMHMGGIAANVIGVPTGAIIVHASASADRLGWALQRDNWAYGQLLERYRKAEE
FT                   VTDEDLAGIDLREFLFYTCVKGFVPKLDTQYTHPSLTTGATFLPQADRNSIVRSVFACC
FT                   GATYLAWYDLERFQQLSDELYIDCKTQILEYVQSVDNYADEDWLFASLLLLCIRDKNSF
FT                   TGTVDGCVWHLANSFLIISEKYYHRAPAQSLDDPLSDNLLRESIVLQPQERMFLESFIY
FT                   HYSISLLFARDISALPNPCALFRSLSLVLKCPVYDIKGNNDWVSNPLLGLTLDAFEILA
FT                   KLSYIARMPMPLGPTWLGKVVHLKSLCTCYAPPAPTSPDMTEAEWLNYRVTSATGVLVT
FT                   KACDLLAKKIIDYDSFDIDSSDVQMRTREIIQLFKDLPSDHKIWGILPWTLLITGAFCR
FT                   RIEDQIFITRKIEIMAHRAHSYCGLKMSSFLHAIWNSEVGINYLFDRDRLAQVDL"
FT   gene            <59883..>61031
FT                   /locus_tag="KLTH0D00616g"
FT                   /old_locus_tag="KLTH-ORF12737"
FT   CDS_pept        59883..61031
FT                   /locus_tag="KLTH0D00616g"
FT                   /old_locus_tag="KLTH-ORF12737"
FT                   /product="KLTH0D00616p"
FT                   /note="similar to uniprot|P39713 Saccharomyces cerevisiae
FT                   YAL061W putative polyol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22312"
FT                   /db_xref="GOA:C5DFX0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX0"
FT                   /protein_id="CAR22312.1"
FT                   /translation="MRALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHE
FT                   YLDGPIFFPANGKTHAMSGQGLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCE
FT                   DRARWPDVKHEREGLCIACKTGNPNCCTDLGFCGLGCQSGGFAEKIVLSERNVVKIPNS
FT                   LPLDVAALVEPISVSWHAVRISKLQPGQTALVLGAGPIGLAAVLALQSHGAGTIIVSEP
FT                   ADTRRQKAEALGAQTFNPTEHGDNVIEALRKLAPGGEGFNFSYDCCGTSETFSAGLHTL
FT                   TPKGVAVNIAVWGPKPIDFYPMDVTTSERFVTGSICYTTQDFEEVVDAMDKGKIDINKV
FT                   KTMITGRERIENGFENGIMDLINNKEKNIKILLTPNNFKELA"
FT   gene            <61224..>61775
FT                   /locus_tag="KLTH0D00638g"
FT                   /old_locus_tag="KLTH-ORF12734"
FT   CDS_pept        61224..61775
FT                   /locus_tag="KLTH0D00638g"
FT                   /old_locus_tag="KLTH-ORF12734"
FT                   /product="KLTH0D00638p"
FT                   /note="similar to uniprot|P39715 Saccharomyces cerevisiae
FT                   YAL059W ECM1 Protein of unknown function localized in the
FT                   nucleoplasm and the nucleolus genetically interacts with
FT                   MTR2 in 60S ribosomal protein subunit export"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22313"
FT                   /db_xref="InterPro:IPR022784"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX1"
FT                   /protein_id="CAR22313.1"
FT                   /translation="MAKKISKHSRAARRLEVEDVEAQTLAKLPRAQNLDLTNKLIRTAS
FT                   KNEQLLEAKMRKKEGSGKRVGKKSIAKGLPENLDKERLEKALNVTSRLDGKVQKAKSRA
FT                   KYVQNARKAGWDRTNESIKRDLALLTASKSDISSKDDKTAEDSMEQDEAYIDEDEGNSS
FT                   TPPQAEATNAFDLLTDDVEA"
FT   gene            <62142..>62582
FT                   /locus_tag="KLTH0D00660g"
FT                   /old_locus_tag="KLTH-ORF12733"
FT   CDS_pept        62142..62582
FT                   /locus_tag="KLTH0D00660g"
FT                   /old_locus_tag="KLTH-ORF12733"
FT                   /product="KLTH0D00660p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22314"
FT                   /db_xref="GOA:C5DFX2"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX2"
FT                   /protein_id="CAR22314.1"
FT                   /translation="MRTLEDITIGGSTYTMADKDALRLGETAQSIVNKIFSRFMLLDAL
FT                   FRGMVFGVGVLVVVFLTAVLLIKIMLASQENGKAKAKSGNRNTSPSSVDNAKSGDQKSR
FT                   NAKSSALNDEDHAHLLSRKVIPINSTDDFTEELEISVMEEDD"
FT   gene            complement(<63033..>64601)
FT                   /locus_tag="KLTH0D00682g"
FT                   /old_locus_tag="KLTH-ORF12730"
FT   CDS_pept        complement(63033..64601)
FT                   /locus_tag="KLTH0D00682g"
FT                   /old_locus_tag="KLTH-ORF12730"
FT                   /product="KLTH0D00682p"
FT                   /note="highly similar to uniprot|P46367 Saccharomyces
FT                   cerevisiae YOR374W ALD4 Mitochondrial aldehyde
FT                   dehydrogenase that utilizes NADP or NAD equally as
FT                   coenzymes expression is glucose repressed"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22315"
FT                   /db_xref="GOA:C5DFX3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX3"
FT                   /protein_id="CAR22315.1"
FT                   /translation="MLSRTGTALRGMPVAATRLGMRFYAQLPLRVPVKMPNGIEYEQPT
FT                   GLFINNKFVRAKQGKTFEVVSPATEEEITHVYEAREDDVEDAIAAADQAFKSGVWSDAD
FT                   PLVRAKALNKLAELIEEDLETIASIETLDNGKAISSARGDVQLVANYLRSCAGWCDKID
FT                   GRLINTGSTHFSYTIRQPLGVCGQIIPWNFPLLMWAWKVGPALATGNTVVLKTAESTPL
FT                   SALYVSQFVPKAGIPAGVVNIISGFGKIIGEALTTHPKIKKIAFTGSTATGRHIYQNAG
FT                   ANLKKVTLELGGKSPNIVFADADLKATVQNIILGIYYNSGEVCCAGSRVYVEESVYDQF
FT                   LEELKAATENVKVGDPFDDATFQGAQTSQMQLSKILKYVEIGRDEGATLVTGGERLGNK
FT                   GFFVKPTIFGDVTEDMRIVKEEIFGPVVTITKFKTVEEVIEKANDSEYGLAAGVHTKDI
FT                   NKAIEVSNRVNSGTVWINTFNDFHHAVPFGGFNASGIGREMGIEALENYTQVKAVRAKL
FT                   TLSGK"
FT   gene            complement(<65886..>68045)
FT                   /locus_tag="KLTH0D00704g"
FT                   /old_locus_tag="KLTH-ORF12725"
FT   CDS_pept        complement(65886..68045)
FT                   /locus_tag="KLTH0D00704g"
FT                   /old_locus_tag="KLTH-ORF12725"
FT                   /product="KLTH0D00704p"
FT                   /note="weakly similar to uniprot|P32336 Saccharomyces
FT                   cerevisiae YOR373W NUD1 Component of the spindle pole body
FT                   outer plaque required for exit from mitosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22316"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX4"
FT                   /protein_id="CAR22316.1"
FT                   /translation="MSSKSSPSKQLSESLGRFHISSPSKLKPYMENDKFQDKAFDSQGR
FT                   YPRNGRSYVDKLDSWSVNYGTVQQHGIDSENAELPQWKQYMQGQVVAEKGSQELHAPAD
FT                   LVVTSSLSDISLIPTNTFKKRGTRLPVDETHQLDPENNTTQEKDTELDIDPAREALGVF
FT                   NNVLRHQRSNFFNDDEHKLNSPVRSVSDGYETGSNSSFDSFDPSLSPSIRQSNKKQPHQ
FT                   PRNEARKESPRRPLKLITPEDAGMVFNYKEGVWDQPSATVDVSTSGAQDESSQSKIVSF
FT                   KLPRTRPETSMVDDTPLSTPKVDLKFLSRNRSGENTQVPAGVDKAVRRASRVTSLPADT
FT                   THNLVDNVTSVSDLDTSFRISRGAVVSALVDAIPRKENWVKVRDLSLERRDLESLVGLD
FT                   EMAPSVLELNVSHNKLNSLQGVPKHTISLCCSHNRIGTYCRLDALEHLEDVDMSHNALS
FT                   TNLSLFAACLHLRNINISQNGVTSLQGLSESRLRIDTLNIARNRLIGPLDFADLLSSDQ
FT                   EPNFLTHLRELDLSGNKITTVKNLHLLTGLRVLKLDGNPLETLVGNTNKSLRSLTALGC
FT                   AALRELGDFPQLRILKLSGESLQIQRLPESLEHLELTGITGASSSVMVPWNILPHMLRK
FT                   LRLSRLGFEELPPEFATHCPALDALIITDNELQSAANLFERLPVNLRTLDVRRNPLTQF
FT                   KAESERKMLAEAAAMAAPNLKKIFL"
FT   gene            <68287..>69699
FT                   /locus_tag="KLTH0D00726g"
FT                   /old_locus_tag="KLTH-ORF12722"
FT   CDS_pept        68287..69699
FT                   /locus_tag="KLTH0D00726g"
FT                   /old_locus_tag="KLTH-ORF12722"
FT                   /product="KLTH0D00726p"
FT                   /note="weakly similar to uniprot|Q08887 Saccharomyces
FT                   cerevisiae YOR372C NDD1 Transcriptional activator essential
FT                   for nuclear division"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22317"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX5"
FT                   /protein_id="CAR22317.1"
FT                   /translation="MEPSNDEEAFFRVISENMKYAFTSPIATTTQFPTPYSQAHNNTSS
FT                   HTQETERARTHSESQSIVENSMLAESNGASSLSDVNVQPSSVLQLGNEFMLTSPEQFRE
FT                   FLFESPAGINLLHRTPAKTPLRFFNSSAIVSSAQSQSHQSQQNQGHLPQQATNGPLQNQ
FT                   ITPLRNIDVNLMFNSRNKQTNNTSSPSKRYLSLTPYGKRVLSDIGTPYAKLLASSNSAL
FT                   VDFQRARKDVQKSVGPQGSDLRSRGNSNTNKGLSGDLDVGSGHHKASLVSGSDDEIESG
FT                   ADDCGSSPTTIQLNSSVTKSTRDKLGSIGSIPENNITNSDLGPSSEDEHETNIDERLFE
FT                   MEKLPLSPTPKPSKRNDLDVTRIKIPELPKMGSFKSERSSSVPNTAKKTTRKQPKFQII
FT                   VTDANSFNSTRGTVMGGDAVGKKRKPALKRSQSEIVSTTSASSSRGKTKRQKLSQVHNF
FT                   SLDLNSRYPDSQ"
FT   gene            <70793..>73255
FT                   /locus_tag="KLTH0D00748g"
FT                   /old_locus_tag="KLTH-ORF12719"
FT   CDS_pept        70793..73255
FT                   /locus_tag="KLTH0D00748g"
FT                   /old_locus_tag="KLTH-ORF12719"
FT                   /product="KLTH0D00748p"
FT                   /note="weakly similar to uniprot|Q08886 Saccharomyces
FT                   cerevisiae YOR371C GPB1 Proposed beta subunit of the
FT                   heterotrimeric G protein that interacts with the receptor
FT                   Grp1p has signaling role in response to nutrients involved
FT                   in regulation of pseudohyphal growth through cAMP levels
FT                   homolog of Gpb2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22318"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX6"
FT                   /protein_id="CAR22318.1"
FT                   /translation="MQSGVSSFSGSSDNSQLSLNLQNNAPVAGNYGVPVWTKDHYKSQY
FT                   KAPPYLSNYVPGLRDASAQVSAERRKLDNEKALIAYYSSKIHVSRHDSIISGCSNPSVG
FT                   SDNSRRSARMKHALKSTHKTFGDHGSPLRCAHDESKYSPEVFSKGYLNYCSKLPLPVLE
FT                   STKLLKRHNMWIPMTRWDIRDKNSESEGPSLSHHDGNKEEDSRLFTDVKIHPADYPSNQ
FT                   NTFVGSMTIPPLFGEMKLPPFAYQCTVDLDDNIYTLGGLTSSYLYSDEAPDLSSFHVDG
FT                   VPNLPPPLLDNVVNNPCMVNNHDLYVISSSSSRVQKPTTTGQVPPPLLCMTGSVLTKRH
FT                   IFYYGGFEIKTETTVDEQTGKFFLKKRAYLHNTAYILDVVTFKFTKVELVAQPTKFNAY
FT                   PATVPRFGHAQVSVQLSPTTTLKCAACSASSSSESKTDESKPENIGASSPISQPLDLRS
FT                   QSETSLTAEKVINTKLSNSLNSGVFTVIVMGGYRQINEDEYETLNDLWKLEVTVTARGK
FT                   RNYFKFADTALATPFARVLNEHEGGTWPGARAFQACEVYDTELLKTYSSKPKLLENLRA
FT                   NFCIEPETLSPGVMSPGEKAPSLTRRSELYENHHIHAYGDSTCSGAWNHKSNANTQFTG
FT                   KTLLVHGGSDKEHVYGDMWWFDLDNEEWTLVPTYVKRTDSKCHSNEVQLPLVGHTLVRI
FT                   ASNAVLTGGLSQEDVDKLWSRNKTQSDPNPALPPSLTGALHLLDLSSLVLKPFLLGTDP
FT                   NEIQRARNIGWPEVLRFICAPGMHKNGFVYLVGGMMFNISKVEELYLRGTMTVFILPII
FT                   TTPKVVTI"
FT   gene            <74519..>76360
FT                   /locus_tag="KLTH0D00770g"
FT                   /old_locus_tag="KLTH-ORF12716"
FT   CDS_pept        74519..76360
FT                   /locus_tag="KLTH0D00770g"
FT                   /old_locus_tag="KLTH-ORF12716"
FT                   /product="KLTH0D00770p"
FT                   /note="similar to uniprot|P32864 Saccharomyces cerevisiae
FT                   YOR370C MRS6 Rab escort protein forms a complex with the
FT                   Ras-like small GTPase Ypt1p that is required for the
FT                   prenylation of Ypt1p by protein geranylgeranyltransferase
FT                   type II (Bet2p-Bet4p)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22319"
FT                   /db_xref="GOA:C5DFX7"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX7"
FT                   /protein_id="CAR22319.1"
FT                   /translation="MMGAERRTSMAERRPSTLNQSSFSMERRASSVVVPHLAGIEDPLP
FT                   DTTPDKVDVVVVGTGLVESILAAALAWQGSNVLHIDSNSYYGDTSATLTIDQLKQWVQD
FT                   VNQGSLKCYENAKLHISSVVGRGSYKSRDFGIDLSPKILFAKSDLLSILLKSRVHQYLE
FT                   FQSLSSFHTYENDSFERLTNTKQEIFTNPSLPLMTKRSLMKFIKFVLDWENQQEVWASY
FT                   RDKPITSFLVNKFKLERAQVYELIFSIGLCYNIDVKTPEALQRIRRYLTSFDVYGPFPV
FT                   LYSKYGGPGELSQGFCRSAAVAGATYKLNETLVSYDPESKTAIFGDGSRVTVTEKVVAA
FT                   PTQCPKNSRNVPEQMFEVQRLTCVVDKPCLEWFGEGEYAAVVVFPPGSLKSGNRQAVQA
FT                   LIMGAGSDVCPAGSSVWYLTSTESGPRGEMDLDAAFGALEESIIRESSADIENDSGILE
FT                   VDTSGHFTLNSVKLGQSFKEHISGESIQVLVKLYYKQLTSTPPFEVVDPSIFDVNDPAD
FT                   GVHKKLIPGASDNGVLYTALPSAEISYDEAVTAARVLFQRIVGSDDDFFDLDFEDEDDT
FT                   DQMNESAVVDDEDDRMDIGLNAEMSVEPVEFAGEMEI"
FT   gene            <76844..>77281
FT                   /locus_tag="KLTH0D00792g"
FT                   /old_locus_tag="KLTH-ORF12713"
FT   CDS_pept        76844..77281
FT                   /locus_tag="KLTH0D00792g"
FT                   /old_locus_tag="KLTH-ORF12713"
FT                   /product="KLTH0D00792p"
FT                   /note="highly similar to uniprot|P48589 Saccharomyces
FT                   cerevisiae YOR369C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22320"
FT                   /db_xref="GOA:C5DFX8"
FT                   /db_xref="InterPro:IPR000530"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX8"
FT                   /protein_id="CAR22320.1"
FT                   /translation="MSDVEEVQEVQEIQEVAVEQPTESITIEDALKVVLRTSLVHDGLA
FT                   RGLRESAKALTRGEAQLVVLVDSVTEDNIIKLVEGLANDPENKVPLIKVADAKQLGEWA
FT                   GLGKIDREGNARKVVGASVVVVKNWGADTEERQMILEHFSQ"
FT   gene            complement(<77439..>78620)
FT                   /locus_tag="KLTH0D00814g"
FT                   /old_locus_tag="KLTH-ORF12711"
FT   CDS_pept        complement(77439..78620)
FT                   /locus_tag="KLTH0D00814g"
FT                   /old_locus_tag="KLTH-ORF12711"
FT                   /product="KLTH0D00814p"
FT                   /note="similar to uniprot|P48581 Saccharomyces cerevisiae
FT                   YOR368W RAD17 Checkpoint protein involved in the activation
FT                   of the DNA damage and meiotic pachytene checkpoints with
FT                   Mec3p and Ddc1p forms a clamp that is loaded onto partial
FT                   duplex DNA homolog of human and S. pombe Rad1 and U. maydis
FT                   Rec1 proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22321"
FT                   /db_xref="GOA:C5DFX9"
FT                   /db_xref="InterPro:IPR003021"
FT                   /db_xref="InterPro:IPR016587"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX9"
FT                   /protein_id="CAR22321.1"
FT                   /translation="MLDQNVLFSASTVHLEHITTALNCLTPFGLRDDVLIIIDSDGLSF
FT                   ARENNRVISIQLFLSKELFISYQYNAPESDSDAHTKISVKINHILDSISVASRDKDDVV
FT                   ECTLSYVGEGSPFVLIFEDSAITEKVEYSTYLTKEWDMTGLELDRSLVDLECMMKGDIF
FT                   YSALQDLKEIGCKECYIYARAGSSGKNIFAIISKSHLGFSKILLPSERSILEKLETFDS
FT                   DTHEKVHEKPVIGFFDFGSFDKMRASAKIASKVLIRKDAHGLMSVNILSETDDILRGDS
FT                   KTKSSASPANPHSSAYLSREYPGIVIDISILEKARVDYDDMEEVKLLMQNNDELKAPPA
FT                   YQPVSTGASRDPNPAAQESTSLLFNERKRHAEELDNGEDGEFIPATNDIPLFF"
FT   gene            complement(<79191..>79817)
FT                   /locus_tag="KLTH0D00836g"
FT                   /old_locus_tag="KLTH-ORF12709"
FT   CDS_pept        complement(79191..79817)
FT                   /locus_tag="KLTH0D00836g"
FT                   /old_locus_tag="KLTH-ORF12709"
FT                   /product="KLTH0D00836p"
FT                   /note="similar to uniprot|Q08873 Saccharomyces cerevisiae
FT                   YOR367W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22322"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR003096"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY0"
FT                   /protein_id="CAR22322.1"
FT                   /translation="MNSKHTGPSSYTAKADVTSLDQDLQELRRSKFSRESIDEISQWIF
FT                   GAVLKEPIPSDLLPALKDSTALCRLANALHEADAPNSGPLIKFKESRMPFVQMEQISQF
FT                   LSFARQYGVPEDELFQTVDLYEEKDPATVYQALKSLSRYANKKHPHQFPVIGPQIATKR
FT                   PRPPKAAKPKHLQSSGWSTLEYGYIKGANQSSEGVVFGQKRDITH"
FT   gene            <80807..>83134
FT                   /locus_tag="KLTH0D00858g"
FT                   /old_locus_tag="KLTH-ORF12707"
FT   CDS_pept        80807..83134
FT                   /locus_tag="KLTH0D00858g"
FT                   /old_locus_tag="KLTH-ORF12707"
FT                   /product="KLTH0D00858p"
FT                   /note="similar to uniprot|P39719 Saccharomyces cerevisiae
FT                   YAL053W Protein of unknown function green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm in
FT                   a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22323"
FT                   /db_xref="GOA:C5DFY1"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="InterPro:IPR032800"
FT                   /db_xref="InterPro:IPR040241"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY1"
FT                   /protein_id="CAR22323.1"
FT                   /translation="MRPALTGPMRVLFLVFVFLQFWVSPASASNTSRHLETTSLLTCMQ
FT                   NSQLTASFFEVKFYPSLNKVYFNIDATTTISTNITAEVQVIVYGLNLMERSINFCNLDQ
FT                   PALCPLQAGRIDVNSSFTVDSDITSNIPNVAYTVPDLDAQVRVVVYSTSDTDHGTPLAC
FT                   VVAPLGNGKTVQTKYAAWPIAAISGLGVLTSGFVSVIGHSTTAAHIASNSISLFIYFQN
FT                   LAITSMMGVSRVPPIAAAWSQNFQWSMGIINVKFMQDIFNWYIKATGGEPTVVVANKDV
FT                   LSIAVQKKRVKRALVEGAKHLYKRLTISTTDSMDLDSFLSEQGLYTGNERNSTNYASKT
FT                   LVLHGIQRVAYKAGIELSNLFLTGVVFTFFFVFIVVIALMFFKALVELLTRTRVMAESS
FT                   KFFEYRKSWGNIIKGTLFRLSIIAFPQLSILCIWEFTQRDSAATMVDAIVILITIGAVL
FT                   LYGVIKVVLRGRESARLYKTPAYMLYGDSNFLNRYGFLYVQFKADLYWWLMPLLGYSFL
FT                   RSLFVAVLQNNGKAQAMVTFIIEMVYFVAICWKRPYLDKRTNAFNIVIHLVNFFNALFF
FT                   LFFSGLFRQPQIVSSVMAVVLFVMNAVFALFLLIFTIVTCSLALIYRNPDARYQPMKDD
FT                   RVSFIPKIQTNGNASKSETELFELGKAVMTTNEASNISSDKSYRNQSSKKLLFDDEVDD
FT                   SSIFDDHSGAREKRANSGEAVQPSSAVLGPSTFGTYQKIPTAPSSRGAQNLRAPENTFG
FT                   NTSYQGYTGASSNPYSKNNPYL"
FT   gene            complement(<84021..>86015)
FT                   /locus_tag="KLTH0D00880g"
FT                   /old_locus_tag="KLTH-ORF12706"
FT   CDS_pept        complement(84021..86015)
FT                   /locus_tag="KLTH0D00880g"
FT                   /old_locus_tag="KLTH-ORF12706"
FT                   /product="KLTH0D00880p"
FT                   /note="highly similar to uniprot|P39722 Saccharomyces
FT                   cerevisiae YAL048C GEM1 Evolutionarily-conserved tail-
FT                   anchored outer mitochondrial membrane GTPase which
FT                   regulates mitochondrial morphology cells lacking Gem1p
FT                   contain collapsed globular or grape-like mitochondria not
FT                   required for pheromone-induced cell death"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22324"
FT                   /db_xref="GOA:C5DFY2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013566"
FT                   /db_xref="InterPro:IPR013567"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR020860"
FT                   /db_xref="InterPro:IPR021181"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY2"
FT                   /protein_id="CAR22324.1"
FT                   /translation="MGKEQIKIVVCGDDGVGKTSLVACLVKDQFIQNLQNCLPPVTIPR
FT                   DFSSSPFCPKSSILVDTTSYDLPALHRELKSADVIWLVYSDHETYDRVALYWMMMFRSL
FT                   GVNLPVVLCKNKCDDFSVESEPKSSVLSPSDDSLSDSTKVEDEEFIPILREFKEIETCI
FT                   KTSAKDKFNVNQAFYLCQRAITHPIAPLFDSRVGELKPLTVLALKRIFLLSDKDQDGFL
FT                   NDHELIVLQKRAFGKAIDKSELEFIKETLLNLSMPPQEYGSYTLYIPDKGITKDGFLVL
FT                   NKLYSEKGRHETTWGILRAFHYTDSLSISDKVLYPKMDITDTASVELSPLGYRFLVELF
FT                   LTFDKDNDGGLNEQEIDFLFKTTPGIPRLWAETNFPFSTVVNSQGFVTLQGWLAQWSMT
FT                   TFLDHKTTTEYLVYLGIEKDARLALQITKSRKKRRRNGKFYRALVTDRKVFNCFVIGKP
FT                   FSGKSSLLESFVGRSFLESYSPTIRPRIAVNSLELKGSKQYYLILQEFGEQEPAILENV
FT                   EKMKECDVLCLTYDSSDPESFSFLFELINQHKHLQELPMVFVALKADLDKQQQRCYIQP
FT                   DDFTDQLYIDHPLHVSSVWSSSLNELFIKLTEASLEPSINTPGIAPDIVKEDINYWRYA
FT                   LVATSAVGFTSLFTFTFFKLFRSLRNEHS"
FT   gene            <86268..>87172
FT                   /locus_tag="KLTH0D00902g"
FT                   /old_locus_tag="Klth0D.mRNA.gf.353.p"
FT   CDS_pept        join(86268..86270,86342..87172)
FT                   /locus_tag="KLTH0D00902g"
FT                   /old_locus_tag="Klth0D.mRNA.gf.353.p"
FT                   /product="KLTH0D00902p"
FT                   /note="highly similar to uniprot|P21242 Saccharomyces
FT                   cerevisiae YOR362C PRE10 20S proteasome alpha-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22325"
FT                   /db_xref="GOA:C5DFY3"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR037555"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY3"
FT                   /protein_id="CAR22325.1"
FT                   /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDG
FT                   IVLAVEKLVTSKLLVPGKNKKIQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYA
FT                   TPIPLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDDDGAHLYMLEPSGTYWGYKGA
FT                   ATGKGRQSAKAELEKVISNKPELDAREAVKEAARIIYLAHEDNKEKDFELEMSWCSISE
FT                   TNGLHKAVPKDLLDEAIAFAKAENGDDSDSDDSSDESENEKDNEKKDAEGDVQLE"
FT   gene            complement(<87310..>89439)
FT                   /locus_tag="KLTH0D00924g"
FT                   /old_locus_tag="KLTH-ORF12702"
FT   CDS_pept        complement(87310..89439)
FT                   /locus_tag="KLTH0D00924g"
FT                   /old_locus_tag="KLTH-ORF12702"
FT                   /product="KLTH0D00924p"
FT                   /note="weakly similar to uniprot|P39723 Saccharomyces
FT                   cerevisiae YAL047C SPC72 Component of the cytoplasmic Tub4p
FT                   (gamma-tubulin) complex binds spindle pole bodies and links
FT                   them to microtubules has roles in astral microtubule
FT                   formation and stabilization"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22326"
FT                   /db_xref="InterPro:IPR024545"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY4"
FT                   /protein_id="CAR22326.1"
FT                   /translation="MVPLRGNSVQDSSGCLSANNTRSSDEGSTGTMSEADELDIPQFNN
FT                   SMTPWRKRDVAKESIYHQGSSSVSPTVGASAENGDGFSEGPLNLASPVNSRPHTRSSLF
FT                   SDGYTSSVPTMSASSSNEVEQLQRQLTACKLRLRALAEVIKELNYDRESHHFDEFPNLP
FT                   CSAKLVDTLPSCDKCAKLSKDLAELRQNLEAKDKELLSAKNDYSTVLDDVNSYLEHSDV
FT                   IASNIDDILQVLSEKLDISDEEKEVLCKARGISNNFIDVKINALGSTVRKFLDTLSTAQ
FT                   IPEQFDKSLITVADNSQGNISQMDTRLESAIESMHEEYHNFLRSLQDRMDQSGETEKLL
FT                   GDKLMKQQLLLEKLTELFHGRSISGVTAGVLSMDIHASDRAKSPDTQGSSSQTFPAPNV
FT                   EIEEYKNRLEIQKNRVKELEEEIVAIEQRREKLDRGSAETGGVTEVEGRYKEKELEWMN
FT                   KIEDLMSQVSKSRTESQRLENVIAELQNELSAAQEESEKTIMDLEKTLKRAVRNSGLYM
FT                   GENREMQQHIKEIESELNSTIRHNSQLEESINEVTKDRSELENELLKLRSHLILHLNKI
FT                   FDVFDKILQRHSIDQAKKKLKNLDVLSSKNHHKAVHAKLESLYVFIESAINSIVEEHAK
FT                   LLLKEKKRSSHINVKDTEEGYGSQLHIELLERRWVAERERRKLDADAAEYRISQLEDEN
FT                   RALRLKIRERFGHSQ"
FT   gene            <89863..>92082
FT                   /locus_tag="KLTH0D00946g"
FT                   /old_locus_tag="KLTH-ORF12697"
FT   CDS_pept        89863..92082
FT                   /locus_tag="KLTH0D00946g"
FT                   /old_locus_tag="KLTH-ORF12697"
FT                   /product="KLTH0D00946p"
FT                   /note="similar to uniprot|P06103 Saccharomyces cerevisiae
FT                   YOR361C PRT1 Subunit of the core complex of translation
FT                   initiation factor 3(eIF3) essential for translation part of
FT                   a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates binding of
FT                   mRNA and tRNA(i)Met to ribosomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22327"
FT                   /db_xref="GOA:C5DFY5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR034363"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY5"
FT                   /protein_id="CAR22327.1"
FT                   /translation="MATSALEDIRIEDIPVDDVDFSDLEKKYEVESPVNFDNFVVVDGA
FT                   PVAPESKVPVLTKVLTKLFSQAGSVVDINLPLDEEKKTTKGYLFVEFDSPASARKAIKL
FT                   LNGKKLDVKHRLFVNSLTDVEKFGTEDFDTEFHEPKLPEFQKTDYLQSWLQDEQGRDQF
FT                   VLQKGELTGVFWNRNTQQPENAVEPRTNWSNTTVKFSPKGTYLFSFHNQGVASWGGRNF
FT                   ERLRRFFHPQAKALAISPTEKYLVTLSPEPIVVPEDAPEDFPFGPESNGHQLCVWDIAT
FT                   GLSVKTFALPPNQRLHWPMIKWSFDDKYCARLGPNALAVYDAENNFELLGGRIMKIEGI
FT                   QDFSFAPAGAKLAVNRNGELSSVLAFWTPESNNQSCKATVMEIPTRRVLRTVNLVQVSD
FT                   VTLHWQNQAEYLCVKVDRHTKSKKTFFSNLEICKLTEKDVPVEKVEMKDLAVRFAWEPK
FT                   GHRFVTISTTETADDNPSIPKNVVTFFAPEQKEKTNVAVKAEPKKWKAFASVPGKFSNT
FT                   ISWSPAGRFVVVATLVTPDTRKADFDFYDFDFTGDKNDNDSDDVAANLKAVAHPEFYSA
FT                   TDMQWDPSGRFVAVWSSAVKHKLENGYKVFNVAGECVREEMIEAFKNFVWRPRPESLLT
FT                   NGEKKKVRKNLREWSAQFEELDAMQADSAMRELILSRRSMLEGWTQYRQDRAALMEEEY
FT                   NYKVFDQVEHSTADEDYEVVEEIKEEILEEKEEEVTSFEEPTSSE"
FT   gene            complement(<92187..>92450)
FT                   /locus_tag="KLTH0D00968g"
FT                   /old_locus_tag="KLTH-ORF12693"
FT   CDS_pept        complement(92187..92450)
FT                   /locus_tag="KLTH0D00968g"
FT                   /old_locus_tag="KLTH-ORF12693"
FT                   /product="KLTH0D00968p"
FT                   /note="highly similar to uniprot|P39724 Saccharomyces
FT                   cerevisiae YAL046C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22328"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY6"
FT                   /protein_id="CAR22328.1"
FT                   /translation="MLARVARRLLSFTPEEKLVYEKLTKQLKPQQIEVRDISGGCGSMF
FT                   AIDITSEKFKGLSMVKQHKLVNKVLQDDIKRWHGLQLRTRSE"
FT   gene            <92563..>92928
FT                   /locus_tag="KLTH0D00990g"
FT                   /old_locus_tag="KLTH-ORF12692"
FT   CDS_pept        92563..92928
FT                   /locus_tag="KLTH0D00990g"
FT                   /old_locus_tag="KLTH-ORF12692"
FT                   /product="KLTH0D00990p"
FT                   /note="similar to uniprot|Q3E793 Saccharomyces cerevisiae
FT                   YAL044W-A Similar to pombe uvi31 putative DNA repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22329"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY7"
FT                   /protein_id="CAR22329.1"
FT                   /translation="MLLLKTLARSMSTAANRSTSGPIAQSITNKVRQQFPDLQHFALFN
FT                   DSYKHAGHHGMAEAENRIESHFRIEVVSGAFEGLTLPKRHRLMYTLLDEELQKGVHALQ
FT                   LQTRTPAEQERKNQRAE"
FT   gene            complement(<93016..>93540)
FT                   /locus_tag="KLTH0D01012g"
FT                   /old_locus_tag="KLTH-ORF12691"
FT   CDS_pept        complement(93016..93540)
FT                   /locus_tag="KLTH0D01012g"
FT                   /old_locus_tag="KLTH-ORF12691"
FT                   /product="KLTH0D01012p"
FT                   /note="similar to uniprot|P39726 Saccharomyces cerevisiae
FT                   YAL044C GCV3 H subunit of the mitochondrial glycine
FT                   decarboxylase complex required for the catabolism of
FT                   glycine to 5 10-methylene-THF expression is regulated by
FT                   levels of levels of 5 10-methylene-THF in the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22330"
FT                   /db_xref="GOA:C5DFY8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY8"
FT                   /protein_id="CAR22330.1"
FT                   /translation="MIRTCAQSTLRASSRLSAISPRLFLRAQSSNALTKTQPPFTFSKS
FT                   GPSSVKYTSQHEWIAAHQDGTAFVGITKYAADALGDATYIELPEADSELEAGDSLGSVE
FT                   SVKSASEVYQPLAGTVLEGNESLNDTPQLINEDPMGEGWIAKVRLNDLADMNGEELMSL
FT                   EQYEESLKEDH"
FT   gene            <94778..>96259
FT                   /locus_tag="KLTH0D01034g"
FT                   /old_locus_tag="KLTH-ORF12688"
FT   CDS_pept        94778..96259
FT                   /locus_tag="KLTH0D01034g"
FT                   /old_locus_tag="KLTH-ORF12688"
FT                   /product="KLTH0D01034p"
FT                   /note="similar to uniprot|P06776 Saccharomyces cerevisiae
FT                   YOR360C PDE2 High-affinity cyclic AMP phosphodiesterase
FT                   component of the cAMP-dependent protein kinase signaling
FT                   system protects the cell from extracellular cAMP contains
FT                   readthrough motif surrounding termination codon"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22331"
FT                   /db_xref="GOA:C5DFY9"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR036971"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY9"
FT                   /protein_id="CAR22331.1"
FT                   /translation="MSSMATLFTVNSPELAPQLASRFKGHVVALTAVADLLARLYSDRL
FT                   SGADNYERDLYLVVYCEPKRSAQDASPPASSTLDTLSAAELAHLLEKQFPCFNLSVVTP
FT                   ERAVPAIAELDNYRAKYTQRLTRVTTWMYAKRHDPCSVNMYSMISHLTQVRHSNTEKPR
FT                   RSYARLISSSLDLRKLIQLPQGKSDDHYWKLLTTWDFCALSLSTCELIWCSYLILKKLA
FT                   IDADYVISDNDLFLLLLTLETSYHQGNKFHNFRHAVDVMQATWQLCCKLQLHFPKDASV
FT                   LLVCVAAIGHDLGHPGTNNALMCEENSPVAQLYQKASVLENFHTELFLDLLQDHWPQLL
FT                   EDRRNVISDTILATDMALHSQYIDQMDEAPSQQPTFLSLIIKAADISNVTRPLEISAKW
FT                   AVLITCEFNECAALVRELKEGSAEYDAYNTEYDQPLPESVDSILEKFPSIPKGQLIFIN
FT                   AFAEGLFAGLGDYFEELKFLHHNVQANKKFWEGKL"
FT   gene            complement(<97316..>98434)
FT                   /locus_tag="KLTH0D01056g"
FT                   /old_locus_tag="KLTH-ORF12687"
FT   CDS_pept        complement(97316..98434)
FT                   /locus_tag="KLTH0D01056g"
FT                   /old_locus_tag="KLTH-ORF12687"
FT                   /product="KLTH0D01056p"
FT                   /note="some similarities with uniprot|Q08831 Saccharomyces
FT                   cerevisiae YOR359W VTS1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22332"
FT                   /db_xref="GOA:C5DFZ0"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR037635"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ0"
FT                   /protein_id="CAR22332.1"
FT                   /translation="MFKEESMSFPPRVHSPVGMPRRAHPGAVLLSPQASAMNNSHSTGP
FT                   GNSGVSQLPLSPQLSSQHLSLNDLLDQQQNMLVDSQRAAAGPAVVSPMLQPSSSMFLDT
FT                   FTRPASSGAQVPAPQHNSMVNFAHDLNQLCSWMAMLSTSQQNSVMDNLLSSLNEEVLQH
FT                   TKLKLDSLISSGYISPSVRSPQVIAPMPDRGPTPQPLTLDSLLNNNMDHHMSRQWSPIP
FT                   QNPSNSQPIYDYINDLTHRPRSADPQLRRKMGSSGKPVQKKSPTQPKPNPHNGLSSPTG
FT                   SNGSSASSSMNPKTLTDPKLLNNIPAWLKSLRLHKYSDALSGKPWAELVYLEDDALESM
FT                   GVSALGARRKLLKAFAVVRDYKERGLIDANAY"
FT   gene            complement(<99148..>101307)
FT                   /locus_tag="KLTH0D01078g"
FT                   /old_locus_tag="KLTH-ORF12685"
FT   CDS_pept        complement(99148..101307)
FT                   /locus_tag="KLTH0D01078g"
FT                   /old_locus_tag="KLTH-ORF12685"
FT                   /product="KLTH0D01078p"
FT                   /note="similar to uniprot|Q01329 Saccharomyces cerevisiae
FT                   YAL043C PTA1 Subunit of holo-CPF a multiprotein complex and
FT                   functional homolog of mammalian CPSF required for the
FT                   cleavage and polyadenylation of mRNA and snoRNA 3' ends
FT                   involved in pre-tRNA processing binds to the phosphorylated
FT                   CTD of RNAPII"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22333"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR021850"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ1"
FT                   /protein_id="CAR22333.1"
FT                   /translation="MSSEVLQLAQARELAMDNKPGEMLPKVLDTAMALHRSSRSPSVEL
FT                   GRLCAKLFLDVASHEAVVSSEKPFLASQHLGELWKLCSSSTDHSTLRDGILGLSRCYDW
FT                   LFDLVAKTSNKELWETLCQFRSFVLSKWKTVYPLTPSEDSLQDHSRSLGVKLATVKFIS
FT                   TLVIVHTPGNSGISIASVPENHPVITGKSQLESGAKKLLGFLLSYLSEEPMMVASLFIG
FT                   VLNCLAFVMKRRPQATYHILGGLLRFNVDMKYQQNAESVLQYRLAKRFVERCYKVFVQF
FT                   GLKSQLIKNSGNMAQYHAKLSKISQTLHIIGEETKAKGIMNFDPKQVERKMPSRERAKY
FT                   VTALKASNQNSSSRNNSTQPRMSPDMQLLTELQKYTMSKNSSAGFFNTSPIAFDSTYAS
FT                   VYSLMNSKHSEIDVSKLSPAVMAKLCTECLYQTDTNKMISGLSIVASRYTDLMNKASQA
FT                   TDNKKRPLEADTVQQPSKKREVVKQPEDEELSEDEDKQEFTLGAPAPMSEEEKKQHFIR
FT                   IVGHIMAVKDSEEEPGASNEVPVNMLHKVRLLDWNNKTSWLTLLTRLASRGVSHNEEMS
FT                   NTARQAIYDYFIEDFGNRVAVVIEWLSEEWYYESLNNEKGETPVYDQWSLKILDALIPF
FT                   LEVSHRRLFIRLVSELPRLSQEHVDKIRSLCLDPLRGSLGFQSLKFMVMFRPPVKPHIA
FT                   KLLTSMKEQDESVREQCEAVLAKFY"
FT   gene            complement(<102765..>103181)
FT                   /locus_tag="KLTH0D01100g"
FT                   /old_locus_tag="KLTH-ORF12682"
FT   CDS_pept        complement(102765..103181)
FT                   /locus_tag="KLTH0D01100g"
FT                   /old_locus_tag="KLTH-ORF12682"
FT                   /product="KLTH0D01100p"
FT                   /note="similar to uniprot|Q02516 Saccharomyces cerevisiae
FT                   YOR358W HAP5 Subunit of the heme-activated glucose-
FT                   repressed Hap2/3/4/5 CCAAT-binding complex a
FT                   transcriptional activator and global regulator of
FT                   respiratory gene expression required for assembly and DNA
FT                   binding activity of the complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22334"
FT                   /db_xref="GOA:C5DFZ2"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR027170"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ2"
FT                   /protein_id="CAR22334.1"
FT                   /translation="MDPHPEEEEIDVFRNVGQGLVGPYREITIQYWQELINEIEMTNEP
FT                   GSPHQDDFKSHSLPLARIKKVMKTDEDVRMISAEAPILFAKACEIFITELTMRAWCIAE
FT                   EHKRRTLQKSDIAQALLKSDMFDFLIDIVPRNIE"
FT   gene            <103352..>103834
FT                   /locus_tag="KLTH0D01122g"
FT                   /old_locus_tag="KLTH-ORF12681"
FT   CDS_pept        103352..103834
FT                   /locus_tag="KLTH0D01122g"
FT                   /old_locus_tag="KLTH-ORF12681"
FT                   /product="KLTH0D01122p"
FT                   /note="similar to uniprot|Q08826 Saccharomyces cerevisiae
FT                   YOR357C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22335"
FT                   /db_xref="GOA:C5DFZ3"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ3"
FT                   /protein_id="CAR22335.1"
FT                   /translation="MRQFQSFSSSIESSLPQPHKQQSSSEIYAEPENFLEIEVTNPKTH
FT                   FPHPDHRGMFTDYELICRTNVPAFTKRMSRVRRRYSDFELFRKCLLKELSLSSHPKIAV
FT                   PHLPGKILLGNRFNDEVIQERMQSLNKWMIAVAGHPLLQSGSKVLVRFVEDEKFTG"
FT   gene            <104099..>105307
FT                   /locus_tag="KLTH0D01144g"
FT   CDS_pept        104099..105307
FT                   /locus_tag="KLTH0D01144g"
FT                   /product="KLTH0D01144p"
FT                   /note="similar to uniprot|P39727 Saccharomyces cerevisiae
FT                   YAL042W ERV46 Protein localized to COPII-coated vesicles
FT                   forms a complex with Erv41p involved in the membrane fusion
FT                   stage of transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22336"
FT                   /db_xref="GOA:C5DFZ4"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="InterPro:IPR039542"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ4"
FT                   /protein_id="CAR22336.1"
FT                   /translation="MKKSKLLSIDAFAKTEEDVRIRTRTGGLITLSCVVVTFLLLLSEW
FT                   FHLKEVVTRPQLVVDRDRHLKLDLNMDITFPHIPCYLLNMDIMDSAGEMQLEVLNKGWS
FT                   KTRLDPSGQVLDTKQFKPGKDVVDYAPEDENYCGPCYGARDQSKNDEVNVDERVCCQTC
FT                   DDVREAYAEKQWAFFDGKNIEQCEREGYVEQVNEHIEEGCRIKGMAKLNRIGGNLHFAP
FT                   GKGFHNIRGHFHDASLYQNSPSLNFNHIIHHLSFGKEVEDITGQGASTAPLDGTNVSPE
FT                   FDTHKHQFSYFAKIVPTRYEYLSGETVETTQFTTTYHSRPLKGGRDSDHPTTLHSQGGF
FT                   PSVYFYFEMSPLKVINKQQYAQSWSGFWLNCITSIGGVLAVGTVLDKITYKAQRSMWGK
FT                   KST"
FT   gene            <105674..>107905
FT                   /locus_tag="KLTH0D01166g"
FT                   /old_locus_tag="KLTH-ORF12678"
FT   CDS_pept        105674..107905
FT                   /locus_tag="KLTH0D01166g"
FT                   /old_locus_tag="KLTH-ORF12678"
FT                   /product="KLTH0D01166p"
FT                   /note="some similarities with uniprot|P11433 Saccharomyces
FT                   cerevisiae YAL041W CDC24 Guanine nucleotide exchange factor
FT                   (GEF or GDP-release factor) for Cdc42p required for
FT                   polarity establishment and maintenance and mutants have
FT                   morphological defects in bud formation and shmooing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22337"
FT                   /db_xref="GOA:C5DFZ5"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR010481"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR033511"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ5"
FT                   /protein_id="CAR22337.1"
FT                   /translation="MAIQSQSTVSLPTSVTQSTQSLLNRKVSTEDSLYHICLTIQKRLE
FT                   LLPQIRPYLNLAHASSELLSERQALLLSQKQQLSQQHHRSVGSAMSGNSGAAGVKNGLD
FT                   RRISSLSASSFNEDPEASSISVEETVVTFSMGILPISMDCDPVTQLSQLFQQGSPLCII
FT                   FNAVKPQYKLPVVSSDDLKICKKSIYDFILACKKYFTFSDEELFTISDVFSNDTEHFIK
FT                   VLDVVKTLMDSAPQVLPQIPVEHIKWSNTDRGKVVREFIETERKYVYDLEILNQYRNQL
FT                   LQRGIINSEELYMLFPNLSDIIDFQRRFLISMEINGQVDPSKQRIGALFMHSKHFFKLY
FT                   EPWSIGQNAAIDFISSSFDKMAGSDFVIGNKLELQSFLLKPVQRLCKYPLLLKELLQQA
FT                   KDSANYKELELAWEISKSIARSINENQRRTENHEVVKKLYDRVVNWKGYRIAKFGELLY
FT                   FDKVAISTGNGNESEHEFEVYLFEKIIILFSELVQKKGNSISLKKKASSASTITLQHMS
FT                   GSGNNLNSHGSSGDSKLDLRGRIMIVNLNQVSPIDNRSLSIIWESPKEQGNFVLKFKNE
FT                   ETRDNWCSSLQSLLRQIRSESLKSSNSDRSSFSSNTYYPHYSMNSINSSQNRRISDVLP
FT                   KQHTHQSFENEYRSISENYRTSIPESTLLVRISYQNDFYTVLVEVDSGIDNMLQIVKRK
FT                   LTHVGNISKIKYQDEDGDYVMLESEDDWNVVKDMLRESSERILNVWAHA"
FT   gene            complement(<108037..>109977)
FT                   /locus_tag="KLTH0D01188g"
FT   CDS_pept        complement(108037..109977)
FT                   /locus_tag="KLTH0D01188g"
FT                   /product="KLTH0D01188p"
FT                   /note="similar to uniprot|Q08822 Saccharomyces cerevisiae
FT                   YOR356W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22338"
FT                   /db_xref="GOA:C5DFZ6"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ6"
FT                   /protein_id="CAR22338.1"
FT                   /translation="MLKSRLLRLGQRFPTNRRAIASALPCFKTCCNVKPQVSYRRSFST
FT                   TTVKRQSVEVPFGKLTDEEQAALSEERAVDKVDVCIVGGGPAGLATAIRFKQLDNLQGT
FT                   GELRVVVLEKSPDMGSHMVSGVIMEPRALRELFPESEFYDESGNGIPLPPSLVTPVASG
FT                   QLKYLIGDFDLPVPEPPQMKNEGNYIGSLSQVVRYLAEKAEEVGVEIYPGISVSEVVYN
FT                   DEGTAVVGVATKDMGISKEGKPKPSFERGMEFHARQTVFAEGCHGSLTKQIIKKFDLRK
FT                   GRANQTYGLGIKEVWEIRPENFQKGFASHTMGYPLSNEVYGGGFIYHFGEGLAAVGLVV
FT                   GLDYRNPYISPYQEFQKMKHHPYYKKFLEGGKCIEYGARALNEGGLQSVPKLNFPGGVL
FT                   VGASAGFMNVPKIKGTHTAMKSGMLAAEAMFDSISKIPSIAELEERGIEKVVESPINLN
FT                   SYEKAFKNSWVYDELYEVRNIRPSFNHALFGRLGGMAYSGIDSLLLRGQVAWTFNHHES
FT                   DAFLTDPAEKYEPIDYPKPDNKISFDILTSVSRTGTFHNEDEQCHLRLPDQDLQKHAEK
FT                   AYPKWKGIESRFCPAGVYEYVPDETSPLGVKFQINGQNCIHCKTCDIKVPTQDINWVVP
FT                   EGGDGPKYTLT"
FT   gene            complement(<110551..>111846)
FT                   /locus_tag="KLTH0D01210g"
FT                   /old_locus_tag="KLTH-ORF12674"
FT   CDS_pept        complement(110551..111846)
FT                   /locus_tag="KLTH0D01210g"
FT                   /old_locus_tag="KLTH-ORF12674"
FT                   /product="KLTH0D01210p"
FT                   /note="similar to uniprot|P41913 Saccharomyces cerevisiae
FT                   YOR355W GDS1 Protein of unknown function required for
FT                   growth on glycerol as a carbon source"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22339"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ7"
FT                   /protein_id="CAR22339.1"
FT                   /translation="MALTNSRPLQMPALENEALHNSASPVFQPSSLRSSARSSCSESTS
FT                   EMDHALSTSDTSEGASDTRLTRKDVLALKRSATASPLTPTGAVSELSKLVPVTGQRPKP
FT                   TKKDLFMDDDILLAIFVILYEKDPNQEGVTVKQLCDYLVDKHPDMAGASTKLSNLISAK
FT                   LNAYVKKVEKGEKTLKYALSRQWSEGSPRRMVYVYRGILAPDYKSHTQSMSSQRQDAKQ
FT                   TGKSTTSSSKKAHGLSNNATDANMDYSLTESKVSNQAKGTFSINNNSFTINSFGSDFNI
FT                   PYAASPVTMRMMPNLAPNAFQDDQLSKAARDRRPKTSLSGPPSKKPNLQASPVVPPYIT
FT                   AAAAAPRLSKGVPKRNAASGELLNAAASSIQKLTAFPKQGEASCITDIALVPLAPTTTC
FT                   PSWLQTIQSGFLLEDIESPEAVSLEDLDGLLG"
FT   gene            complement(<112790..>114400)
FT                   /locus_tag="KLTH0D01232g"
FT                   /old_locus_tag="KLTH-ORF12670"
FT   CDS_pept        complement(112790..114400)
FT                   /locus_tag="KLTH0D01232g"
FT                   /old_locus_tag="KLTH-ORF12670"
FT                   /product="KLTH0D01232p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22340"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ8"
FT                   /protein_id="CAR22340.1"
FT                   /translation="MSKRPLNTNVIDGSKRPSSLNSEICNSYPGYCPGFGSVTVDEINV
FT                   PSSKEEIDLFYQNYVLRRRPCKFKGVSSKEVLSEPLSPLNLVKTLPEQTILQVERKVQG
FT                   GFGSGEKRLKMTLGELVERLRSGDEQLYLTTQYAEDDPDRDDASDVGENTEEYAEDDDD
FT                   NEDDTKETDGGFGSAGDISDAGSFDFSNAHDDFEDLNGAESMDGESHDSKDVIAQLSTG
FT                   PLTQFEADARVKELYQPPMDNLIEQLPETPSFLNSLIPQQINLWVGSSGNIGSSDKFLE
FT                   GFDPSAPKLGLGRAIPGGGSSSGLHHDHADNIYVPISGRKRFTLFSPRDAAKMYTVGTI
FT                   RKVYDSGVIDYARCETAPFWRTLRDDGAIEAEVAKNELEFNSSLTADQRQNLERVIEAD
FT                   SVCSSSIDSKLDPPSFSSIIPTVVHLDKVKDEGLRAEIKKVALEKWPMFFEANRLTVDL
FT                   RPGEMLYLPTGWFHEVTSFGNEQTASADDRIHVAVNYWFIPPNGSSQDQLYAHEDQYWQ
FT                   KDYERTKAALEHARFCSKD"
FT   gene            complement(<115317..>116630)
FT                   /locus_tag="KLTH0D01254g"
FT                   /old_locus_tag="KLTH-ORF12667"
FT   CDS_pept        complement(115317..116630)
FT                   /locus_tag="KLTH0D01254g"
FT                   /old_locus_tag="KLTH-ORF12667"
FT                   /product="KLTH0D01254p"
FT                   /note="weakly similar to uniprot|P13365 Saccharomyces
FT                   cerevisiae YAL040C CLN3 role in cell cycle START involved
FT                   in G(sub)1 size control G(sub)1 cyclin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22341"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ9"
FT                   /protein_id="CAR22341.1"
FT                   /translation="MPESTLAEMAAVRLSVWNSRAAHPRVVQMELLAHQLACQDYSVDI
FT                   LRHLIDIEQASRPCLASFQAQPEINVHMRTLIFDFAMCCHTRLGLSTSTLYLCFSVIDR
FT                   YCSRIVVKSSTYQLVALCGLWLASKYIDRKPRVPSLRALQNLCCNQYSRSQFQDMELHI
FT                   LKALNWSPCNAPPHDVFVDILLKNKISSLSYKGLHLNDLKYGSCMLCELACFEHVLAFD
FT                   YNASAVALAAVTITTHALRLSVDGQFVHYSSMLKDANLQRVCDLILRKLRSRNFPSSFK
FT                   LKYLGQNKLESNPILRSLLEYELMIAPPIPVQAVKKPAYASFSPSKPGSCANVSPAPSL
FT                   GFQDSFAGTSFRSPRVVAPPTPCSPSNLSSNSVPKVKTPHLNLSPGTIGSGKQYEVSQA
FT                   RATAVRPTMFRRNESKRNSDIMEPDFFDMAANSNKRAR"
FT   mobile_element  complement(118691..120631)
FT                   /mobile_element_type="transposon"
FT                   /locus_tag="KLTH0D01276s"
FT                   /old_locus_tag="dnatranposon.8"
FT                   /note="DNA transposon of KLTH part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:degenerate
FT                   copy"
FT   gene            <122364..>124418
FT                   /locus_tag="KLTH0D01298g"
FT                   /old_locus_tag="KLTH-ORF12648"
FT   CDS_pept        122364..124418
FT                   /locus_tag="KLTH0D01298g"
FT                   /old_locus_tag="KLTH-ORF12648"
FT                   /product="KLTH0D01298p"
FT                   /note="weakly similar to uniprot|Q08818 Saccharomyces
FT                   cerevisiae YOR354C MSC6 Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to
FT                   mitochondria msc6 mutants are defective in directing
FT                   meiotic recombination events to homologous chromatids"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22342"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG00"
FT                   /protein_id="CAR22342.1"
FT                   /translation="MIPRSIKSNSALSIRARLRARWNSSAAAPAPAVHPVSQLSREVSK
FT                   ELTDRRSSLAAFDLFKTKVNDLSQTLSNSQYTLQRSFGLNSALTQLLQASKAELAGRAG
FT                   SGGPAADSGRQLPPDPFEILTVMCEYGLARDAHFQVVLEHLVAANRPQEVLGLWVKYLE
FT                   TLAENPKAVTYGSHHANNVALASVGYLQLPGNSPKLAELAQILNLAEKEDQIPILRIRY
FT                   LVDTLKLGSAVRSSVIENFGALLLEFSHACQAEFRRQLLSMEQVADLQKLFTALTSAAE
FT                   KSSQGLDASNVALFMDAFIGCKKPQQAIKCFNVAKEKNCVGEPVKNSLLIAVANLPVYG
FT                   KDMRDQKAKRIEAVWNSYISEAPEKISVSSYTALLAALGESRNFNKLQQLWSSEIPKEL
FT                   KSDQDLLETHLLFQCYKRDFSFEKMRDQIPEKLRSIKLANEILFKMAQEKVPENVITEF
FT                   YRQQFVDASAPLKPDSKSLALKMYINFLYTKDPEFQFMKSISKSKNDVNTTNLIFKRFV
FT                   EFCPDIEITKKLFDEIKYPLDSRKYGYMITAESRAGDITACEEIFKKFVQETKNPSTIT
FT                   RAILDPIVDAACEQCVAEKSAASLEKAHIYATFAKKAQKMLSFQSASKIIHTLALLVRS
FT                   LDGKLSPQQDEAVKKLLEDVHSVKNFSPSTRDLETLTRHKVSLPDGMQQ"
FT   gene            complement(<124574..>125463)
FT                   /locus_tag="KLTH0D01320g"
FT                   /old_locus_tag="Klth0D.mRNA.2976.m"
FT   CDS_pept        complement(join(124574..125362,125428..125463))
FT                   /locus_tag="KLTH0D01320g"
FT                   /old_locus_tag="Klth0D.mRNA.2976.m"
FT                   /product="KLTH0D01320p"
FT                   /note="similar to uniprot|P06182 Saccharomyces cerevisiae
FT                   YAL039C CYC3 Cytochrome c heme lyase (holocytochrome c
FT                   synthase) attaches heme to apo-Cyc1p in the mitochondrial
FT                   intermembrane space human ortholog may have a role in
FT                   microphthalmia with linear skin defects (MLS)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22343"
FT                   /db_xref="GOA:C5DG01"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG01"
FT                   /protein_id="CAR22343.1"
FT                   /translation="MGWFWADSGKNSTSGNKITDKPSECPLGHSTSKVTSGADGCPVLH
FT                   GSNAQNEINPFNNMPKNLSHEKHIGQKLELPKDRTTSSIPKGNPGEEEFWEYPSPQQMY
FT                   NAMIRKGKIDPNTGEEIPEDAVESMVFVHNFLNEGCWQEILDWEKKYSEQTEMEPKLLQ
FT                   FMGKPSQLSPRARCFSILGTLFPSKFSAELPFDRHDWVVLRPDPTSSDTKNPGFRQVRY
FT                   VIDFYGGPDDEDGLPTFNLDVRPALDNFTNAKDRFTRWTEPIIQEYFGSDKK"
FT   gene            <126137..>128377
FT                   /locus_tag="KLTH0D01342g"
FT                   /old_locus_tag="KLTH-ORF12638"
FT   CDS_pept        126137..128377
FT                   /locus_tag="KLTH0D01342g"
FT                   /old_locus_tag="KLTH-ORF12638"
FT                   /product="KLTH0D01342p"
FT                   /note="similar to uniprot|Q08817 Saccharomyces cerevisiae
FT                   YOR353C SOG2 Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22344"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR019487"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG02"
FT                   /protein_id="CAR22344.1"
FT                   /translation="MNCHEHTWSPYSSHQRNQAKGYVRTALSFGLMDGRGDILSNLRQN
FT                   VDRRNNLAFLASKQVSQRDPTIKLIDLGITSLTQETIDLLLSVERLSLQKNLLTSLPEG
FT                   FNKLAELRYLDLHDNKLQEIPATLMQCQRLEILDLSSNYITHLPHEYSRVWCENIKVLS
FT                   LKNNSVSSIRELYPAIMSLRSLKILEIEGNQFPAEELEQIKSEVPPSSLPDSVSPDEYW
FT                   CVALRKHFSDNKISKAAKRRGFINVSEEQHRQEELYSNNKYNDYFKRLSVLPEETTSQR
FT                   VTQDELVVACRKLLFSFTECQQSIRKITSLCEDKAVAVNSVSLLYSVRSHIDNLVELLE
FT                   QSESPTSAKNDVMVKLCLTIISIFKQIFALLRKNFKSFFQGNDICFARIFYMNILCSYT
FT                   EMYNAWSQITPQDSIAPVKKRIARTHSLSVSQGFKHITPRSRSNTLQRSATGNSAHPTT
FT                   SPIPQSSNLRSAPGSVMTTPPPSQSNLAGEVRAANDGSPSFKPDLTQQSPHAGRRAADV
FT                   PPQAGTPAVPVVDNKMGPEDQGSADIDAQLYHTLNTVISMVTVVYSQLTSAITKSAIAS
FT                   TKTTEMSSITSSIAAKIKDLTDTCFQSMELSKLLKGRLSDVSLGKSEVFSTTAEKAKTW
FT                   ESINAFLKSIISILANTKIIMKDLPILNEVRPNLASLAKITKDVTVILDLSSYRSISQA
FT                   AQQQSQETATVKQQSHPQASGMLEESHNPILVTPLSTPSLVTVHASNPFDQF"
FT   gene            complement(<128407..>129288)
FT                   /locus_tag="KLTH0D01364g"
FT                   /old_locus_tag="KLTH-ORF12635"
FT   CDS_pept        complement(128407..129288)
FT                   /locus_tag="KLTH0D01364g"
FT                   /old_locus_tag="KLTH-ORF12635"
FT                   /product="KLTH0D01364p"
FT                   /note="similar to uniprot|Q08816 Saccharomyces cerevisiae
FT                   YOR352W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22345"
FT                   /db_xref="InterPro:IPR031349"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG03"
FT                   /protein_id="CAR22345.1"
FT                   /translation="MIKTPDTPEHTGANEELNVDEIHEIDENDVEDLDLGYGNEDEQQN
FT                   DRSSLKREASTDDDIVFDQKDEFVPQVNISSPFSSTANITRLRDSHSSAQGRLSMSQQS
FT                   KFVSYCDDRLMEIQRKFVQSRGLAEENGYRELSPLLQDLKSLLDFIWYSIEGIPNTELL
FT                   LKQNLDDMLARQFANTRSTNFGQTYYLIRVADDFLDYLTKFDLTHLKVEEQQKTVAKVF
FT                   KFLMILDKVFAKCLEGLIPGNLKMNGTEMVRISGIAERTRMVLPQYLEQQKIHGYHYEV
FT                   SKVYEETLERCA"
FT   gene            <129448..>130974
FT                   /locus_tag="KLTH0D01386g"
FT                   /old_locus_tag="Klth0D.mRNA.58.p"
FT   CDS_pept        join(129448..130053,130132..130974)
FT                   /locus_tag="KLTH0D01386g"
FT                   /old_locus_tag="Klth0D.mRNA.58.p"
FT                   /product="KLTH0D01386p"
FT                   /note="similar to uniprot|P24719 Saccharomyces cerevisiae
FT                   YOR351C MEK1 Meiosis-specific serine/threonine protein
FT                   kinase functions in meiotic checkpoint phosphorylates Red1p
FT                   interacts with Hop1p required for meiotic recombination and
FT                   normal spore viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22346"
FT                   /db_xref="GOA:C5DG04"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG04"
FT                   /protein_id="CAR22346.1"
FT                   /translation="MAVNTFESLRGQVLGVLEPLPVYRNQDVNENFAAVPIFKNKLVKI
FT                   GRNSRECDIIFPHPSISSIHCMFWAIRFDDDSVPMHYVKDCSLNGISINGLLLKRGQTC
FT                   LLEDEDVIAIPNACEYRFQAKIKMLTSDLIEQLGFQVNVENWRLTSKVVGSGTFGHVLV
FT                   ANEKAEPTRHQPRSYAVKIIKMKPNRLDKEAKILLRLDHPNVIKVHMTFSDDRNHLYIF
FT                   QDLITGGDLFSYLAKTDCLSPIPETEALVIIFQILHALKYLHSQGVVHRDLKLDNILLC
FT                   TPEPCTRIVLADFGIAKDLSTKHSRMHTVVGTPEYCAPEVGFKADRAAYKEFSRAATME
FT                   QHGYDAKCDLWSLGVIAHIMLTGISPFYGDGSEASIICNAKIGNLDMSTKQWTKVSEHA
FT                   KSFVRSLLETNVTKRLDSSRSFQHPWIAKHKGHLEKIYQKKIIPDSEPRQSFEETNWKR
FT                   KLPKSVKLSPTSVMNKKARKLELS"
FT   gene            <131435..>133357
FT                   /locus_tag="KLTH0D01408g"
FT                   /old_locus_tag="KLTH-ORF12631"
FT   CDS_pept        131435..133357
FT                   /locus_tag="KLTH0D01408g"
FT                   /old_locus_tag="KLTH-ORF12631"
FT                   /product="KLTH0D01408p"
FT                   /note="weakly similar to uniprot|P24720 Saccharomyces
FT                   cerevisiae YOR350C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22347"
FT                   /db_xref="GOA:C5DG05"
FT                   /db_xref="InterPro:IPR025694"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG05"
FT                   /protein_id="CAR22347.1"
FT                   /translation="MLKKKGAPLSLQNFAAKILGGDKLVKQLENGSLKTASTKALSRSD
FT                   VWLREALVNTATTRRSYTLPHSGAIYPSRSIDVSLNVILSTLRRLRFANDAGGYFILLN
FT                   RIKSSRVRWVSSSGKPIAGNVPVELYREVSHMLRAKSSGFQREELVCLAKFTLKLLRDY
FT                   NEIVAFRRPLKPDKIFLRNCADIVTRLGSMTFLNAFNNLIEHEDIKVYAMISFYLQTKQ
FT                   IAHLVQFLESSNLGRDSLGLELASSLLLHCIREFVTLGLEDIACSTLELLLKKCALDLE
FT                   KPLNDVKLIAEKFGAFKVQLAINKANDPELRSAFVPWKTFQKDLSFKDYINLFDESEID
FT                   FYNETASMEFLSSKLPHHRMALEGWYHLFEETRPHPTASASLKAFHFNTILSTVASTGS
FT                   LGLVTLFWRHSIVKLGLTEDFLNSHNLISSRNCGGFHVILRSVGKSSSAKLAGYQLFNF
FT                   LKHDFKKLTSNHGVATFNLTNKDYFYLMQSATRGPNVSSVYFYLFHHLLDAGDTCFSFG
FT                   KDGSPSWQPGEPILSLIKSKFSKDWHLTGVGKIVERVGTWYKNEKDRGVYSSHIQKDVL
FT                   VDIFGPHFIQELSPKTLLQLESDSNNAMDAKSSSVYSLIADCENTERIKETLGHLTQSI
FT                   KGKLD"
FT   gene            complement(<133354..>136428)
FT                   /locus_tag="KLTH0D01430g"
FT                   /old_locus_tag="KLTH-ORF12630"
FT   CDS_pept        complement(133354..136428)
FT                   /locus_tag="KLTH0D01430g"
FT                   /old_locus_tag="KLTH-ORF12630"
FT                   /product="KLTH0D01430p"
FT                   /note="weakly similar to uniprot|P40987 Saccharomyces
FT                   cerevisiae YOR349W CIN1 Tubulin folding factor D involved
FT                   in beta-tubulin (Tub2p) folding isolated as mutant with
FT                   increased chromosome loss and sensitivity to benomyl"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22348"
FT                   /db_xref="GOA:C5DG06"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033162"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG06"
FT                   /protein_id="CAR22348.1"
FT                   /translation="MEPQNAESILESIEEGVCGLGPLPELLKAIDQFQQDPSILEDRLS
FT                   EFITKLVDGFFTCRSEDQHRCSQVFYTFSKVCGIKKVMNHLSTDIFLLPKILEKLKDSG
FT                   DWQDSYLLLAWLKMVLMSPFKLENDSQIYKMTGKFKSLQALHPLVSAVHAELFAKNIGL
FT                   FRSSFSNETSDLYTVNFTLKAVLRQGQVHERQAVLDSAALNNLTSFCIDNADSANEIKL
FT                   KLTFKTLPKLCKLHAAHRNWEAIEEIASWLLDSFNVPFTELRFQLAHNFAKIMELLMAL
FT                   DPESASSLIESIVHDARHTLSSNPTNTIDEDTLHTQLLVIAESSRIKLLNPELVKLVTE
FT                   SIVPITIKFQQTKVNKISGHQIRDATNFVCWSLARNCDINSESENLFLNSLICSLLDRD
FT                   LLIRKSSAAALQEILGRYGNTLLERENVMRVIELPNKNLETSYLQSVPQLFKIFKEEDS
FT                   RYSNALLDWLLDYNVLQSNDLHIVKLTCGLIRILLEKQDANYLPDCFWNRVSESAALVF
FT                   KGNDALRKCCFSYLATEAQLLKNDTVRKCCSEWLPSLLAVLSPRSPNPSERFKTLCVLK
FT                   MLRSFSIENTGSFQIDVHTLDILFQIVRHRSISDRDYNEVKMCFVSLVSILSCKKGETK
FT                   VTTIVDSFKQKFETLIRQNNPLCCAGLAYIDPDQFIKVFRELCPHMDCEARREVVSGIS
FT                   DRLLSIEAPRVLSILTATVDLLDDYTVTDRGDVGSLVRNSVVELIERHRDVFMQIDPAL
FT                   KSTVCSKLLRIAAEPNEKLRQKSFQVLTRGHDLNQGDSHDSAILNFFQKYYQDKDTEFW
FT                   VGFMFSAGAMYSTDQLIRTSIDSFLKFYEALSKERKLNLLNHLMRILPSFSEIEAWQAS
FT                   KEHRNALGCQKKDLVKQALASITFWRRIFESGMDVDPAFNATGAYAKFYNLHLIKKFAP
FT                   LKLAVVRLMPFIAISFKRRAPHEDRMFANIVLKRLKTLACGAKSKSQKLTQIQAMSLEG
FT                   MVIIYLAFGDDKKVIELEEVSREGPKSLLTFQESI"
FT   gene            complement(<136785..>138086)
FT                   /locus_tag="KLTH0D01452g"
FT                   /old_locus_tag="KLTH-ORF12628"
FT   CDS_pept        complement(136785..138086)
FT                   /locus_tag="KLTH0D01452g"
FT                   /old_locus_tag="KLTH-ORF12628"
FT                   /product="KLTH0D01452p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22349"
FT                   /db_xref="GOA:C5DG07"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG07"
FT                   /protein_id="CAR22349.1"
FT                   /translation="MSFGKSFRSHFPFLDPSVTPVNHGSFGLTPGCVIEQQKRVSEAHE
FT                   SYSDRFHFSDAEHLYARQIQALARYLRLDPRNLALVTNATCGVNTVLRSIKWDFSRDKV
FT                   LVHSTSYTSCANTVKFLADYYGLQYDVVKLDYPIEDSDLLTRFHEKLATGNYRLCMFDL
FT                   ISSMPGVMLPCEQLIQLCKQHDVLSLVDGAHGAGLVDLQFLDTLQPDFFTTNLHKWLSA
FT                   PKSCGLLYVNPKHHSTIQTLPISWNYSNQNCQYIPNPTTAEDRLQNENLMHNKFWFVGT
FT                   MNYAQYFSIEEALKFREETCGGEDRIREYQWQLQREAVPLIVAEFGPGARLLQNSTNTL
FT                   AVAGMFNVNIPLPEKYSALKQKLASDPYYFMDFKQKCFALMFSRKAFLPFIYHNGELWV
FT                   RFSVQVYNELEDYKIGARSIKSAVMEVLDAEHGA"
FT   gene            <139116..>140990
FT                   /locus_tag="KLTH0D01474g"
FT                   /old_locus_tag="KLTH-ORF12623"
FT   CDS_pept        139116..140990
FT                   /locus_tag="KLTH0D01474g"
FT                   /old_locus_tag="KLTH-ORF12623"
FT                   /product="KLTH0D01474p"
FT                   /note="similar to uniprot|P15380 Saccharomyces cerevisiae
FT                   YOR348C PUT4 proline-specific permease (also capable of
FT                   transporting alanine and glycine) putative proline-
FT                   specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22350"
FT                   /db_xref="GOA:C5DG08"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG08"
FT                   /protein_id="CAR22350.1"
FT                   /translation="MKNLKCLASYRPPASYCKDTPVRLEPLRIVSAAAPTTFFHHLASY
FT                   RHLNLAMSTPRDLKDAGETSIVDKQTGQVFELDTESLSALNTSGSPGSGAAAAGAEANG
FT                   LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGE
FT                   MVCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWT
FT                   TAVPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPT
FT                   HDRLGFRYWQHPGAFAYHITTGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR
FT                   RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNA
FT                   HIKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVA
FT                   LSAAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYERV
FT                   PFKSPLQPYGTYFFIVVVSLICLTNGYASFVNWNASDFVAAYITLPIFVVLWVGHKIYT
FT                   RTWSTWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKFEQWLL"
FT   gene            <142438..>143943
FT                   /locus_tag="KLTH0D01496g"
FT                   /old_locus_tag="KLTH-ORF12621"
FT   CDS_pept        142438..143943
FT                   /locus_tag="KLTH0D01496g"
FT                   /old_locus_tag="KLTH-ORF12621"
FT                   /product="KLTH0D01496p"
FT                   /note="highly similar to uniprot|P00549 Saccharomyces
FT                   cerevisiae YAL038W CDC19 Pyruvate kinase functions as a
FT                   homotetramer in glycolysis to convert phosphoenolpyruvate
FT                   to pyruvate the input for aerobic (TCA cycle) or anaerobic
FT                   (glucose fermentation) respiration"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22351"
FT                   /db_xref="GOA:C5DG09"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG09"
FT                   /protein_id="CAR22351.1"
FT                   /translation="MESRLGWLSNLQTDTGSNLRRTSIIGTIGPKTNSPETLVALRKAG
FT                   LNIVRMNFSHGSYEYHQSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNEVDYPI
FT                   PPNHEMIFTIDDKYAKSSDDKIMYIDYKNITKVIEKGRVIYVDDGVLSFEVLEVVDDKT
FT                   LKVKSLNAGKICSHKGVNLPGTDVDLPALSEKDKADLRFGVKNGVHMVFASFIRTANDV
FT                   KTIREVLGEDGKDIKIIVKIENQQGVNNFDEILEVTDGVMVARGDLGIEIPAPQVLAVQ
FT                   KKLIAKCNLAGKPVVCATQMLESMTYNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGN
FT                   YPINAVTMMAETALMAEQAIPYIPTYDDLRNCTPKPTSTTETIAAAAVASVFEQRAKAI
FT                   IVLSTTGSTPRLVSKYKPNVPIILVTRNPRTARISHLSRGVFPFVYEKGTESDWTKDVE
FT                   SRLQFGIEQAKEFGMLKEGDTIVTIQGFAAGVGHSNTLRVLTV"
FT   gene            complement(<144017..>147001)
FT                   /locus_tag="KLTH0D01518g"
FT                   /old_locus_tag="KLTH-ORF12617"
FT   CDS_pept        complement(144017..147001)
FT                   /locus_tag="KLTH0D01518g"
FT                   /old_locus_tag="KLTH-ORF12617"
FT                   /product="KLTH0D01518p"
FT                   /note="similar to uniprot|P12689 Saccharomyces cerevisiae
FT                   YOR346W REV1 Deoxycytidyl transferase forms a complex with
FT                   the subunits of DNA polymerase zeta Rev3p and Rev7p
FT                   involved in repair of abasic sites in damaged DNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22352"
FT                   /db_xref="GOA:C5DG10"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR012112"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG10"
FT                   /protein_id="CAR22352.1"
FT                   /translation="MDYEELAQLLSDASSLDASPQEPPPPPPPDSPLRLYDSSRGAIAR
FT                   ERSQRPFSQQQRLLSTLDDDSLVGLVNTFDRPTQRARLRRPAAPADDAADAEDDPCIVT
FT                   SSPEPPSSVVPSTPPASSRLSESDSSSDRSRSSSPTAARVGPLKFGDYAQYFSDKTAHQ
FT                   HSRDEYMRKLYQDALNGGREYPPIFKDCTIYINGRTFPDRLQLHQKIIIHGGSFKHFLS
FT                   GKKSVTHIVASNLTAKKRIEFQNYKVVAPAWITESIAASKRLPWQDYALITGEYGQQKL
FT                   QIARPPAAALPAPEQQPADGFDANSLDCKQPGFLQSFFAKSRLHQLSAWKADLRALFCE
FT                   KYVEGAHLQPPPKGARLAIFHVDFDCFFATVSALSDARYDLSRDPLAVAHGNNSSEIAS
FT                   CNYVARSFGVKNGMWVRSARRLCPNLICLPYNFEQYEVNSKLLYQILAGSGFFQMILPI
FT                   SIDEAICVKYLDGLPDGDASAHQQCEAITRQIRRDVFDATNGCTVSIGCSNSLVLARLA
FT                   LKKAKPNGQCVMASLEQDSIDAFIEELPLRDLPGVGATIVDKVQQHILFEQTAEPTIGD
FT                   LKRNSSLQLLASKLGTKTGHKLHLFLSGKDDEENSRVLRDPLDYFARKSISVDINYAIR
FT                   FDTIHEIDEFIDRICEHLTTKLGELDMVTPQVTLKVTRRCEHAPIEPAKYLGSGECDTF
FT                   SRSSRFGVPTCEAGLISTEVKSSFRMLGCPPKDLRGIAVQLNKLEKVSDRVCQLRLPFR
FT                   EQDASSAGSRFPALNVNAFNSLPGALKEDVRTELLKRKINLPPSPPSKRSASNSPVKDY
FT                   WGRHGKRTETLKQEMPSTLDEDFMNHLPTQIQREIKWDHAIVKKASSSVRNRLSRKGTG
FT                   VLNLSKNRPSKPEAVKFQSLERPLGISRLIKSWIDDTIDNGPHIDDLNLFDKYLTKLAA
FT                   KGKTHHILKIARTMSSHLEYHSSFTKSNPQGRQEWEEYLLIRMIPTLTASAAKSDSGVQ
FT                   VTFDL"
FT   gene            <148109..>149155
FT                   /locus_tag="KLTH0D01540g"
FT                   /old_locus_tag="KLTH-ORF12603"
FT   CDS_pept        148109..149155
FT                   /locus_tag="KLTH0D01540g"
FT                   /old_locus_tag="KLTH-ORF12603"
FT                   /product="KLTH0D01540p"
FT                   /note="some similarities with uniprot|P33122 Saccharomyces
FT                   cerevisiae YOR344C TYE7 may be involved in glycolytic gene
FT                   expression TYE7 a 33 kDa serine-rich protein is a potential
FT                   member of the basic region/helix- loop-
FT                   helix/leucine-zipper protein family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22353"
FT                   /db_xref="GOA:C5DG11"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG11"
FT                   /protein_id="CAR22353.1"
FT                   /translation="MDGPGSSTMTMAAAPSAQGAGAGASSFDDWLFPEASRMGAFGEYG
FT                   NDAEADAEAGGWAADAGAEADAEVDLDADADPEADADAGVGAAVGADPGAGVLAAGSLS
FT                   SSSSSSSAGSPLDQFSSLFDSNAMLARGSDSDTLFTASNSASGSPTFVKREDAQMCGPA
FT                   GLGASAGGLSAEGEAPGSLPLALDVPELSAFDGLDAAAAAADADVGGSAAANAAAAAAA
FT                   AAAAGARKKRAPRKRLTAHQKQAHNKIEKRYRININTKIAKLQQIIPWVASEETAFEVG
FT                   ETSRGNSRGGESVATATPKLNKSMILEKAVDYILYLQNNERLYEMEVQRLKKEVERART
FT                   ERDTAARS"
FT   gene            <151489..>152424
FT                   /locus_tag="KLTH0D01562g"
FT                   /old_locus_tag="KLTH-ORF12592"
FT   CDS_pept        151489..152424
FT                   /locus_tag="KLTH0D01562g"
FT                   /old_locus_tag="KLTH-ORF12592"
FT                   /product="KLTH0D01562p"
FT                   /note="weakly similar to uniprot|Q12182 Saccharomyces
FT                   cerevisiae YOR342C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22354"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG12"
FT                   /protein_id="CAR22354.1"
FT                   /translation="MSFHHQFTLASAKNQLIPQQLTNNVFFGPLNALSQREFIQENRIR
FT                   FFVAVGIATKRVAQYCRDMPARDCLVVNFDSEFSPQVSLSATELELVSQYSQQHSTSLS
FT                   QLAAGLAGDAATGCTADSRLTPQPELDQQLHNSPAQYTCNIVTSQGAQKFASFNDLLTL
FT                   FKLSGSGNVLVFSSNGNDEDLVALLSSHVVITNSSASLLEAFQYVKSLRPSINQCQPDS
FT                   VFWCQGLMEYLEGSRSYNNPFYDNGMSPASPLSTTGVTSNAFVTKRRNSWSSDCEEECP
FT                   NSATGTISVSGTPKTRRIAAIRADNMALPH"
FT   gene            complement(<152846..>153952)
FT                   /locus_tag="KLTH0D01584g"
FT                   /old_locus_tag="KLTH-ORF12588"
FT   CDS_pept        complement(152846..153952)
FT                   /locus_tag="KLTH0D01584g"
FT                   /old_locus_tag="KLTH-ORF12588"
FT                   /product="KLTH0D01584p"
FT                   /note="highly similar to uniprot|P39729 Saccharomyces
FT                   cerevisiae YAL036C RBG1 GTPase that interacts with
FT                   ribosomes member of the DRG family of GTP-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22355"
FT                   /db_xref="GOA:C5DG13"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG13"
FT                   /protein_id="CAR22355.1"
FT                   /translation="MSTTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRREIVTS
FT                   ATQGSGGGGVGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPG
FT                   VIRYKGARIQMLDLPGIIDGAKDGRGRGKQVIAVARTCNLLFIVLDVNKPLHHKQVIEK
FT                   ELEGVGIRLNKQPPDILIKKKEKGGVSITNTVPLTHLGADEIRAVMSEYKMNSAEIAFR
FT                   CDATVDDLIDVLEASTRRYMPAIYVLNKVDSLSLEELELLYRIPNAVPISSGREWNLDE
FT                   LLQIMWDRLNLVRVYTKPKGTMPDFTDPVVLRSDRCSVKDFCNQIHKSLVDDFRNALVY
FT                   GSSVKHQPQYVGLNHILEDEDVVTILKK"
FT   gene            <154310..>157306
FT                   /locus_tag="KLTH0D01606g"
FT                   /old_locus_tag="KLTH-ORF12586"
FT   CDS_pept        154310..157306
FT                   /locus_tag="KLTH0D01606g"
FT                   /old_locus_tag="KLTH-ORF12586"
FT                   /product="KLTH0D01606p"
FT                   /note="similar to uniprot|P39730 Saccharomyces cerevisiae
FT                   YAL035W FUN12 GTPase required for general translation
FT                   initiation by promoting Met-tRNAiMet binding to ribosomes
FT                   and ribosomal subunit joining homolog of bacterial IF2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22356"
FT                   /db_xref="GOA:C5DG14"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG14"
FT                   /protein_id="CAR22356.1"
FT                   /translation="MGKKSKKSAQNYWDEEFEEDTPQPEEIGGTPAESTPEVEAATDGP
FT                   ESSVEPSDQAEVAEDAEAIEADFMSALRQTKKKADKKEEEDVKKPVIKSKKEKEKEKKE
FT                   KEKQKKKEQAAKKKAQQQAQKEKNKELNKQQAEAAAEAKAKKESGAKSSEGQTATGGAK
FT                   KNAKKIPAGLAALKRQLELKKQLEEQERLEREEEERLEKEEEDRLKKEQELAEEARQQK
FT                   REKERAKREKLKAEGKLLTRKQKEEKKLLEKRRAALLAAGNIQVAGLNKSQDGSDSKPK
FT                   KVVYGKKKKKTQQEKDAELAVEEAKKAAEAADAEEDAEEALVDDWENLALDDDEGAASD
FT                   EEDQEQEETAEDEDADATKEKPAQPSSSKVEAAPASTPASAAVSKRPSPTPSSSTQKDL
FT                   RSPICCILGHVDTGKTKLLDKIRQTNVQGGEAGGITQQIGATYFPIEAVKQKTQAMAQY
FT                   EKQTFDVPGLLVIDTPGHESFTNLRSRGSSLCNIAILVIDIMHGLEQQTMESIRLLRDR
FT                   KAPFVVALNKIDRLYDWEPTPNDSFRNSFQKQSRGVKQEFATRLEGIKVALAEQGLNSE
FT                   LYFENKNLAKYVSIVPTSAVTGEGVPDLLWLLLELTQKRMSKQLMYLSHVAATVLEVKV
FT                   VEGFGTTIDVILSNGYLREGDRIVLCGLNGPIVTTIRALLTPQPLRELRLKSEYVHHKE
FT                   VKAALGVKVAANDLEKAVSGSRLLVVGPEDDEEEMMDDVMEDLTGLLDSVDTSGRGVVV
FT                   QASTLGSLEALLDFLKDMKIPVMSIGLGPVYKRDVMKATAMLDKAKEFAVMLCFDVKID
FT                   KEAEHYAEEQGVKIFNADVIYHLFDAFTAYQEKLLEQRRKDFLQDAIFPCVLNTLQIIN
FT                   KRGPMIIGVDVMEGSLRVGTPICTVKLDPTTKEKTVLLLGKVVSLEINHQAVNEVKKGQ
FT                   TAAGVAMRLEDPSGQQPIWGRHVDEKDTLYSLISRRSIDTLKDPAFRDQVSKSDWLLLR
FT                   KMKTVFSIE"
FT   gene            complement(<157597..>162561)
FT                   /locus_tag="KLTH0D01628g"
FT                   /old_locus_tag="KLTH-ORF12580"
FT   CDS_pept        complement(157597..162561)
FT                   /locus_tag="KLTH0D01628g"
FT                   /old_locus_tag="KLTH-ORF12580"
FT                   /product="KLTH0D01628p"
FT                   /note="highly similar to uniprot|P10964 Saccharomyces
FT                   cerevisiae YOR341W RPA190 RNA polymerase I subunit largest
FT                   subunit of RNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22357"
FT                   /db_xref="GOA:C5DG15"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR015699"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG15"
FT                   /protein_id="CAR22357.1"
FT                   /translation="MDISKPVGSEITSVDFGVMTAQDIRNFSAMQITNPTVLDNLGHPI
FT                   SGGLYDLALGAFLRNLCATCGLDEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLY
FT                   CHGFRLKASEVHRYACKLKLLQYGLIDECYKLDELRVGTLQTAVDEAEEDDGDDDKPSK
FT                   LVDVALLRELKVKRREFVDISIATAISEGRTSYNGTFTATVNDERKALIHDFYKRLLSR
FT                   PKCDNCGMFSPKFRKDGFTKIFETSLTEKQQTNNRVKGLIRADMIKKQQQRRKLADDQN
FT                   SAGEPMEVDEDFDNSRDASARPKTGSTYILSTEVRNILRSVFKKEQEVLQYVFHSRPNL
FT                   SKKLVRADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQLLSKILTTSLLIRDLNEEMS
FT                   KLQKDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTKAQGNTGGKVPIPGVKQALEKK
FT                   EGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQA
FT                   VINGPDKWPGATQIQNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKVYRHI
FT                   KNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN
FT                   ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIYGC
FT                   IRPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKIKNE
FT                   YWGKGSTENDVVFKNGELLCGILDKSQYGASKYGIVHSLHEVYGPDVSAKVLSVLGRLF
FT                   TNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDKDVSANDSELL
FT                   KRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPNNSMQAMALSGAKG
FT                   SNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIKPQE
FT                   YYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFLYGGD
FT                   AVDVTQESHMTQFKFCADNYDALLKKYNPAALIEHLDVESALKYSKKALKHRKKTEKVP
FT                   HYSQKVKYDPVVSKFNPSKYLGSVSENFQDKLESFIDSNNDLFKSRDTVSEKKFRALMQ
FT                   LKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTAS
FT                   AAIKTPQMTLPILADVTDPQADTFCKSVTKVMLSEVVDRVEVTESTGFSEGSTGSRSYF
FT                   INMKFFGSDEYGEEYDVSKEELQNVVAEKFLKSLEVAIVKEIKKQKKMASPEIGVAVPR
FT                   SQAAIASGEGGKIDDEDNDEQESRKRTKQAVSYDDPDDDEVETMREAEKSSDEEVDSEM
FT                   DSDSSDSDDAEDVEEEKPLSNKTKSGLTKVQRDRQSAVVSSHRFVTKYNFDDEDGEWCQ
FT                   FTIELAADTEKLLMVNIVEDICRKSVIREVKNIDRCVHPEPENGKRILVTEGVNFQEMW
FT                   DQDAFIDVNGITSNDVASVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMM
FT                   TRQGTYLAFNRQGMETSTSSLMKMSYETTCQFLTKAVLDNECENLDSPSARIVLGKLNN
FT                   VGTGAFDVLAKVPASH"
FT   gene            <162973..>163164
FT                   /locus_tag="KLTH0D01650g"
FT                   /old_locus_tag="Klth0D.mRNA.il.287.p"
FT   CDS_pept        162973..163164
FT                   /locus_tag="KLTH0D01650g"
FT                   /old_locus_tag="Klth0D.mRNA.il.287.p"
FT                   /product="KLTH0D01650p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22358"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG16"
FT                   /protein_id="CAR22358.1"
FT                   /translation="MPEKNAAAHDQGNLAGSIAGSVAGADLGNKLHLGAIGGIASSVLG
FT                   SGQGSKLENKLKEKMDKK"
FT   mobile_element  163739..164828
FT                   /mobile_element_type="retrotransposon"
FT                   /locus_tag="KLTH0D01672s"
FT                   /old_locus_tag="Klth0D.retrotransposon.1"
FT   gene            <166143..>168788
FT                   /locus_tag="KLTH0D01694g"
FT                   /old_locus_tag="KLTH-ORF12558"
FT   CDS_pept        166143..168788
FT                   /locus_tag="KLTH0D01694g"
FT                   /old_locus_tag="KLTH-ORF12558"
FT                   /product="KLTH0D01694p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22359"
FT                   /db_xref="GOA:C5DG17"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG17"
FT                   /protein_id="CAR22359.1"
FT                   /translation="MLPHTAREEQVECDVYLYVLCDRSWAGAYVRVRRRGRATARPRSA
FT                   RRAAPTQLMAGSNHGLGRPQACSRCRNHKIKCVHNGEAPCTYCIHRNVAQECRLTFPEN
FT                   KKAKKSEAGPRVSKGEAGAREASAPLVPMDAIFTAGVRPQIEPHLCVPPVDANTLPAWA
FT                   RGSIFEVVPLIPARVVREAVLRVVRSFPELNLFHLPTVLDSAEKLHPLLAGAAVAFAGF
FT                   FDPWRGGSGDGGGDSGSGSDAGDASASQWLGAGSYQVANKVCERLTLDAIFAKCHFLME
FT                   PSLDVACALLILAVVKWGHSEYYAAWMLHGCATRMIQSMDSEESFLLKAKIYPLLRKMQ
FT                   LRAFWCAYVLDKIICAGQRKTFMLPDTPDMLLPVGDYEFSLATLDAAPEMDLGVKSEQK
FT                   ATLCDFLAQCQRNPAILKKSPYALLVFLWSIWGAVSRRVTRPDRDSPAFECPWDPDSEV
FT                   YKLNSRLDGIWALVPREWKWSREAYLAEKPAVIKDNLMVTINCVYHASTALINREFMPF
FT                   LPHDIDKPAGPTDLKEPPPYHENYWTESARRCFGSIRTLSRILKTLLEEELGRSPGGKF
FT                   RNAVLVTPYHSFLAFTCGLLANYGANFYWMDPDSEKYNNDPTNPDRLENCYNVAISLLK
FT                   AKENDFGAAKNWLAVILKMGEINRFVAQNRNSTKVSEWTKKCSKDLGPSLSMPKVDIKK
FT                   LEKMLPLLPPPHTNGQQNTESLYPSPAADSYYNQVGLFSQREVVPSSSFYRAPPPSASQ
FT                   PASQYRSPALMTHSAPMSFPLAPAASQSPKLSFPALLPASACEPLSSNPAPQPLASFGA
FT                   SSSVRSVPAASYSVVPGSSVLSPQVAPSAPYAGQQPLPAHDERHVETDTDKLSLFFNDS
FT                   ELDLLMQFNS"
FT   gene            <169128..>170021
FT                   /locus_tag="KLTH0D01716g"
FT                   /old_locus_tag="KLTH-ORF12551"
FT   CDS_pept        169128..170021
FT                   /locus_tag="KLTH0D01716g"
FT                   /old_locus_tag="KLTH-ORF12551"
FT                   /product="KLTH0D01716p"
FT                   /note="similar to uniprot|P46669 Saccharomyces cerevisiae
FT                   YOR340C RPA43 RNA polymerase I subunit A43"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22360"
FT                   /db_xref="GOA:C5DG18"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="InterPro:IPR041178"
FT                   /db_xref="InterPro:IPR041901"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG18"
FT                   /protein_id="CAR22360.1"
FT                   /translation="MSSVKRSSEQKRDAEFIKRHKKVCKNPVDESNGVSKCIVQVPVSM
FT                   YVSIAPTYMKEPNRGIKKQHLNPMIMKYSSNVGGVVLGYENLKIEDASVSDESDSENAT
FT                   KLVKITPDTPFGFTWCSVDLYVWQPQIGDVIEGWIFIQSPSHIGLLIHDAFNASIKKTS
FT                   IPQDWTFIHNEDADNNSDSGVGNSAQSRSLGHWVDENGQRLDGKLKFSVRNVYTTGRVV
FT                   SLEGSLLDDKVGQARSPAESLPVVSNKKIIFDDEVSTENRESHRDLELSKRVKEDNGEE
FT                   IVYEKNSSSSESSDSE"
FT   gene            <170277..>171152
FT                   /locus_tag="KLTH0D01738g"
FT                   /old_locus_tag="KLTH-ORF12549"
FT   CDS_pept        170277..171152
FT                   /locus_tag="KLTH0D01738g"
FT                   /old_locus_tag="KLTH-ORF12549"
FT                   /product="KLTH0D01738p"
FT                   /note="similar to uniprot|P39731 Saccharomyces cerevisiae
FT                   YAL034W-A MTW1 Essential component of the MIND kinetochore
FT                   complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
FT                   kinetochore subunits contacting DNA to those contacting
FT                   microtubules critical to kinetochore assembly"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22361"
FT                   /db_xref="GOA:C5DG19"
FT                   /db_xref="InterPro:IPR008685"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG19"
FT                   /protein_id="CAR22361.1"
FT                   /translation="MSAPTMRTTLLLTEHLGYPPISLIDDIINAVNELMYKCTQAMEKY
FT                   LLERSFMEGKDYTDEIKIGIAKLETLWENSVDRSFDKLELYVLRNVLHIPQELIENGSF
FT                   RLRHHDSLVLEDNDSKEALSTELKTKMRQLQESIETHKELRRQKVALQKVLARVRRFKL
FT                   LVSSFLQGQDLDNKEVAAVLSSLSPVNESVRFLASQVHSLYLESDDQCSSERVKSIVSR
FT                   QKELHADLSSRTGYLAQSTKKALEQLLGNQPSEVSHEVPDGAGTTGSSPSTDHAIEVSS
FT                   PDWNAMTEVT"
FT   gene            <171356..>171841
FT                   /locus_tag="KLTH0D01760g"
FT                   /old_locus_tag="KLTH-ORF12547"
FT   CDS_pept        171356..171841
FT                   /locus_tag="KLTH0D01760g"
FT                   /old_locus_tag="KLTH-ORF12547"
FT                   /product="KLTH0D01760p"
FT                   /note="highly similar to uniprot|P52492 Saccharomyces
FT                   cerevisiae YOR339C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22362"
FT                   /db_xref="GOA:C5DG20"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG20"
FT                   /protein_id="CAR22362.1"
FT                   /translation="MEGSSKSSIPDGHSVVSRLQSELMQLMLSPSPGLSAFPEDEEDLT
FT                   KWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFVSPMWHPNVDMSGNICLDILK
FT                   DQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKDMREYKKKLIARYEEIDD"
FT   gene            complement(<172172..>173227)
FT                   /locus_tag="KLTH0D01782g"
FT                   /old_locus_tag="KLTH-ORF12546"
FT   CDS_pept        complement(172172..173227)
FT                   /locus_tag="KLTH0D01782g"
FT                   /old_locus_tag="KLTH-ORF12546"
FT                   /product="KLTH0D01782p"
FT                   /note="similar to uniprot|Q06855 Saccharomyces cerevisiae
FT                   YOR338W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22363"
FT                   /db_xref="GOA:C5DG21"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG21"
FT                   /protein_id="CAR22363.1"
FT                   /translation="MEFNSPQPEHAQLSTVVHPKGTSRLLAALHQQVVGAMAPRSGGPG
FT                   LGGCSIDSALDEHLIPSPPLSPKMSSVDEGSAAPAAPVAPQVPAESTTALWVKPDWESS
FT                   RSPESYRSATSGFLSQYRCFDFMRTKRYTHPNNKTLRKTRNYTCSPNYTSGGSDFEKVY
FT                   RTRRSVKNAENPRTARGHAPAFQEDFTRHGMPSRPATPTNRNTHRKVNSVTSPLGSSAV
FT                   LGAPQYVPNMSWEKLPDYSPPLSTLPANNKCLKVEWKGSSMDLSADPLRHLLHPAELQL
FT                   AQILRLPCDLYLDSKRRLFVEKVHRLKQDLPFRRTDAQKACRIDVNKASRLFAAYERIG
FT                   WLEDENFERFF"
FT   gene            complement(<173650..>175608)
FT                   /locus_tag="KLTH0D01804g"
FT                   /old_locus_tag="KLTH-ORF12541"
FT   CDS_pept        complement(173650..175608)
FT                   /locus_tag="KLTH0D01804g"
FT                   /old_locus_tag="KLTH-ORF12541"
FT                   /product="KLTH0D01804p"
FT                   /note="similar to uniprot|P47988 Saccharomyces cerevisiae
FT                   YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
FT                   mediated Activation Ty1 enhancer activator and to YLR098C
FT                   uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4 Zinc-
FT                   finger protein with Zn[2]-Cys[6] fungal-type binuclear
FT                   cluster domain; DNA-binding transcriptional activator or
FT                   CHA1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22364"
FT                   /db_xref="GOA:C5DG22"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG22"
FT                   /protein_id="CAR22364.1"
FT                   /translation="MGPERLDVLTSTNAGSSEDFSSGSPLLSQKRLACSNCRRRRKKCD
FT                   MGYPCASCVKMKLDCNVNMDDMRKKRYAAGYVKSLEAHVAYLETRLKNLDAAKISGTSS
FT                   LGTSEPTLLISTDGKERRLSDGAAPFSSSVGQSFRGGDNSSSFNASENDILRRKRFVKG
FT                   SIYPEGPASYKPQRREPAISKPQNRIADLKTTVIVRRHQDSSETLNTDKNILGSLSAFY
FT                   KWLYPGPFVFVHRESFLYGFFNHSEDNYENSQYCSEELVYAVASVGSRLVPGLRSLSEG
FT                   YYQKAKGKLLSIVFDEHSTAKITTVQALLCLAFCELGKGNNQLAWYFSGLAIRVGYDMG
FT                   FQLDPKVWVTDDASSSELSQSELEIRSRIYWGCYIADHFICLLLGRTSTLSVSNSTVPE
FT                   SDELPEVDGTGEFRFNSKHVLQVSLPLKNLVILSRIVQVFTAKIFIESGSTAQRIGYLT
FT                   RFNIKVYNWRQSLPQFLKWSKNSIKDTDWSTDPTISYFWYHYYIVLLTFNKPFMEDCEE
FT                   SKILVLEVLGELHTLLSNFRVRFGSVDTASIYQLYSCLLAVTCLKKLTKMSLDGQPASV
FT                   LASLDRDLRFYTDLFHEFHLTYGLPQRLQDEPDLHVVDQLNTLAYTHDFSLSDEIDDLI
FT                   KQVFGFDTWTINPSHTV"
FT   gene            complement(<175846..>179820)
FT                   /locus_tag="KLTH0D01826g"
FT                   /old_locus_tag="KLTH-ORF12540"
FT   CDS_pept        complement(175846..179820)
FT                   /locus_tag="KLTH0D01826g"
FT                   /old_locus_tag="KLTH-ORF12540"
FT                   /product="KLTH0D01826p"
FT                   /note="similar to uniprot|P22023 Saccharomyces cerevisiae
FT                   YOR336W KRE5 Protein required for beta-1 6 glucan
FT                   biosynthesis mutations result in aberrant morphology and
FT                   severe growth defects"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22365"
FT                   /db_xref="GOA:C5DG23"
FT                   /db_xref="InterPro:IPR009448"
FT                   /db_xref="InterPro:IPR040497"
FT                   /db_xref="InterPro:IPR040692"
FT                   /db_xref="InterPro:IPR040693"
FT                   /db_xref="InterPro:IPR040694"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG23"
FT                   /protein_id="CAR22365.1"
FT                   /translation="MLLWTLLVWSYAIFASCTTVRLSNASSGVKLRLWNAVVGLVNDEQ
FT                   LVQDLYFLIAGVSDELDELKTDSTPLDQIVEALARHNPELASLLSLRYALEPGFSNDTS
FT                   NQNYFLLNNKRFENADDIFYLKTDDLNAQKSACINDVLDNEDVVMGSNRDAPVILFYGC
FT                   DRVEDWEEFNRNLYMEAQAGKVRFVWRSTCPNDLPFEFEPSAVALTVKGSQWNTEFGHA
FT                   LDVPESLVLGTEPSFRAQQVSDEQLQDLDMKVGTLVYDFYEKSQNATETIRYFRQIVNN
FT                   FPVLARSLAEQGDITIDNRWEAALKKLAKEGIDNTMLGLFVNGQFHKLSNLNKWSVLQS
FT                   VILELQRVNFLMDLLQKYQNITPGESLVLAKKLLNTFSKRSLTTQQLLQPVKYDLHRIP
FT                   GFSESIIYFNDIELDSDYAEKLKDDIAMFFEESEFGELPAYRENWNEIVFVIDFSDLRS
FT                   KDTWEALQGLLRALQVVKKGYPQRIGLLPFSTSAQDHGVLGKIYELKQNKPLETLVSYL
FT                   EDLSPIERPQQSVFQKLPPVLEIINDRLKINETSIVINGEIYPFKSNLWNYLVSKVLKK
FT                   DVSFIKSELLRINTKNFKAREILHAKSFIERNKKYAPDYFEDATYSNTNVTALLSLAHR
FT                   IVETSTGGGLNTIHTVTIVEDFNTPLGLQRLIHLLQIKLHGVRVRAVHSGLLGKNWDKL
FT                   KFTISNADTSKLQNYLRSLKSNGECNYIEPAIVGQWLLDLPRKILQRTSYLAVNGRFIH
FT                   FEQGELPTIYEYEMIVQREATRVLDAVASLQEVFPDSLKEPLDPNYVEMVSAVLAKMFY
FT                   DGERLYNNGIDFTAEASISRINLGELLPSESFGAFQTSEEPRKVEVTLILDPLEERTQN
FT                   LLALASYLGSLDFLKLQVVLMPTTDLKVFPNHRLWIEGEKDLSIIDTRKFYVDVEVPPY
FT                   LHVGERKDNVFELEYIKVEVNAFENKEEPSKGLVEGIGNVCLNLLNANHEVIDTATTTD
FT                   TFGYTQFRLRRLEQGLTIESCSSNYRVSSFTSNSKADYIASDHFDVTSLAPTRLYVRLE
FT                   KTQGMLPEVSEDNRIINILSIIENAEDEVSFEKQASSVMRSRGSFDTKFWIILGEEPSA
FT                   SFLSFVEFMTAESAGEVTFEYLTVDWPRWLRPQRFRPRQLAAAKVMMLDTLFPKGVTKV
FT                   VYMSPGARVPNITELWEYDFDSVFCAPRAYQRDGTPYWKQGYWRNFLSKNNLKFHATEP
FT                   LFIVNLGKYRQEHAGSKFRIHYQRLSPGINFLVQLDQDLLNDMQTLFPISSLNKRLLKV
FT                   APHLQTLDDNLYQSLQEKFNAKKSGQKLEDLSETIVHDEL"
FT   gene            <180421..>183288
FT                   /locus_tag="KLTH0D01848g"
FT                   /old_locus_tag="KLTH-ORF12536"
FT   CDS_pept        180421..183288
FT                   /locus_tag="KLTH0D01848g"
FT                   /old_locus_tag="KLTH-ORF12536"
FT                   /product="KLTH0D01848p"
FT                   /note="highly similar to uniprot|P40825 Saccharomyces
FT                   cerevisiae YOR335C ALA1 Cytoplasmic alanyl-tRNA synthetase
FT                   required for protein synthesis point mutation (cdc64-1
FT                   allele) causes cell cycle arrest at G1 lethality of null
FT                   mutation is functionally complemented by human homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22366"
FT                   /db_xref="GOA:C5DG24"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG24"
FT                   /protein_id="CAR22366.1"
FT                   /translation="MTIGDRQKWTASNVRSTFMEFFKQREHTFVASSPVIPYDDPTLLF
FT                   ANAGMNQYKPIFLGTVDPSSDYYSLKRAMNSQKCIRAGGKHNDLEDVGRDSYHHTFFEM
FT                   LGNWSFGDYFKKDAIQYSWELLTKVYGIPSERLYVTYFEGDQKQGLEPDLEAFELWKSV
FT                   GVSEDHILPGNAKDNFWEMGDQGPCGPCSEIHYDRIGGRNAASLVNMDDPNVLEVWNIV
FT                   FIQYNREQNGTLKSLPSKHIDTGMGFERLVSVLQDVKSNYDTDVFQPLFARIQEITGAR
FT                   PYEGKFGAEDADGIDTAYRVLADHVRTLTFALADGGVPNNEGRGYVLRRILRRGARYAR
FT                   KYMNYPIGNFFSSLAPTLIDQSKAMFPEINRDPSYLFEILDEEEASFAKTLDRGEKLFE
FT                   KYAQAAAQTKDKTLDGLQVWRLYDTYGFPVDLTELMAEEKGLKIDGPGFEKAKQESYEA
FT                   SKKGGKKSASDLIKLEVHELSTLNSENVPKTDDSPKYESANIEAIVLRIFDGENFVDEI
FT                   SEVGKQYGVILDSTCFYAEQGGQEYDMGTLVIDDVAEFSVENVQLYNGYVFHTGQLGEG
FT                   KLSVGDKVIASFDELRRFPIKNNHTGTHILNFALKEVLGNDVDQKGSLVAPEKLRFDFS
FT                   HKKAVALDELKEVERICNEQIKANLPVYYKNVPLDLARKISSVRAVFGETYPDPVRVVS
FT                   VGKPVDDMLVDPTSEEWQKYSVEFCGGTHVSKTGDIKEFVIIEESGIAKGTRRIVAVSG
FT                   SEAYEVQRIANKFDSDLIAAEKMPFSPLKEKKLKELGVALGQLSISVVTKQELKDKFAK
FT                   IEKVVKDEIKTRAKKEIKQTVDEVKNYFAENQEASFLVKYINIPTNAKAITEAVNHMKT
FT                   SAKDKSIYLFTGDDRVAHGCYISDVALEKGIDGRALLNTVSSNIGGKAGGKGNVFQGVG
FT                   DKPEGIETAVKEVENLFREKLNITK"
FT   gene            <184749..>185243
FT                   /locus_tag="KLTH0D01870g"
FT                   /old_locus_tag="KLTH-ORF12528"
FT   CDS_pept        184749..185243
FT                   /locus_tag="KLTH0D01870g"
FT                   /old_locus_tag="KLTH-ORF12528"
FT                   /product="KLTH0D01870p"
FT                   /note="similar to uniprot|P28005 Saccharomyces cerevisiae
FT                   YAL033W POP5 Subunit of both RNase MRP which cleaves pre-
FT                   rRNA and nuclear RNase P which cleaves tRNA precursors to
FT                   generate mature 5' ends"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22367"
FT                   /db_xref="GOA:C5DG25"
FT                   /db_xref="InterPro:IPR002759"
FT                   /db_xref="InterPro:IPR038085"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG25"
FT                   /protein_id="CAR22367.1"
FT                   /translation="MVRLKSRYVLFEVLYPEGRTLTSENNVNNLFKREVLLRHHQVTPA
FT                   RVTVKTILQELRRVIQFNFGDYGSGKANSLLQIKYFSNRTSTGIIRCSREDYEIVVIAL
FT                   TLMNKIDELEGVLLNPIKVSGTIKRIEQYAVKRSARLLNVIQGQSEIDKFDYISYDENE
FT                   D"
FT   gene            complement(<185319..>186674)
FT                   /locus_tag="KLTH0D01892g"
FT                   /old_locus_tag="KLTH-ORF12527"
FT   CDS_pept        complement(185319..186674)
FT                   /locus_tag="KLTH0D01892g"
FT                   /old_locus_tag="KLTH-ORF12527"
FT                   /product="KLTH0D01892p"
FT                   /note="similar to uniprot|P28004 Saccharomyces cerevisiae
FT                   YAL032C PRP45 Ortholog of human transcriptional coactivator
FT                   SKIP can activate transcription of a reporter gene
FT                   interacts with splicing factors Prp22p and Prp46p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22368"
FT                   /db_xref="GOA:C5DG26"
FT                   /db_xref="InterPro:IPR004015"
FT                   /db_xref="InterPro:IPR017862"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG26"
FT                   /protein_id="CAR22368.1"
FT                   /translation="MSNSRPLSVLLPPPKHAINASAQHKSGLKELVGLLSEAGNPRETL
FT                   YSVESFQENSVTLESFLPLRHKYPDLKIPQISQSDIQNTYERTKAVFDKILSQKLQPQG
FT                   TGAVGTANKGSAKTIEYKLPDQNSEVRKLKIVDQQVDPLQPKLFKTKKVVAPSTDEPFA
FT                   PVLHKSDDITPQSTKEERDKWNIPSAISSWKNPNGYTINLDRRIASDGRYSKESLGPHE
FT                   ISEGHMKLSEALDAAERKAREEVSLRADAKRMLAEQDVREKEEKLRMIALKAREDRKKN
FT                   TEPYSGPRALDSATRQRQEDQRERLNKIRRELQRSKMSTAERLRALATGEGREVSEKVI
FT                   LGAAAASDTADIQYDSRLFTKAAKARGQSGGDQVYDNPLFVQEGINTMYRPNFSAAVDI
FT                   QARDAADTLESKVQFELASGKRGREGPVEFSAAENTEKSEEGESSVKRHRGG"
FT   gene            complement(<186816..>189233)
FT                   /locus_tag="KLTH0D01914g"
FT                   /old_locus_tag="KLTH-ORF12526"
FT   CDS_pept        complement(186816..189233)
FT                   /locus_tag="KLTH0D01914g"
FT                   /old_locus_tag="KLTH-ORF12526"
FT                   /product="KLTH0D01914p"
FT                   /note="some similarities with uniprot|P39732 Saccharomyces
FT                   cerevisiae YAL031C FUN21 Cytoplasmic protein of unknown
FT                   function potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22369"
FT                   /db_xref="GOA:C5DG27"
FT                   /db_xref="InterPro:IPR026241"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG27"
FT                   /protein_id="CAR22369.1"
FT                   /translation="MYVKAAANASIVAVKGGATLDQYDAKLIQCRVAISRLTEILRILR
FT                   ILEGTLKRTNGTKTIIPLMNYILALYGGLTLNASEILSRRLRLLSEFRLCKITDVNPPL
FT                   NSSPISLDCEFPEVSSDFQEYTAHVYDRQLQNKLLQAAINITQNALQVYDRKYKQCNME
FT                   RSANRPTSISGRPTTFEEGSFEELIQPLDVPMILDLAVLIKDFEVDTSESSFRKLSLQV
FT                   LTKFKDHFNEKALPPIKTYHTSLFRFSKASSLSQSKIIMNLPYWQYTMHRIYALLLRIL
FT                   YILTITKAFLRQAYIPNRAFFESPRTQLHSPNVFEFRELIKNLDTICMGPNDLSDLVER
FT                   LQCYSQQGFSLAVQPSSVLEAYNSEVSVATRKLRFYFQIVESLLSVWKHIQASSLNNEA
FT                   FGSLDELGLSKAVEERLAVDRLDFIERKNKEAQLKEKQKEAAAAASTESSVKTIFRRSS
FT                   IQRSKMSPSPSGSTSPSSLSPASMSRSPSQNLKRGTLPKKPLNGSSISSPLASRRGSVS
FT                   GSTSNAGNRKPSNEGSSNGSPRIDETLQTGGRKRSSSLQSSVLASHNQADNMHRSNSLQ
FT                   AAATLNQRMVRNTFAKLSANIEGNGALNSDSKTDRLATPANSSRQMMRSSSPSPLRQKG
FT                   KSSGASPAGPRSGIELPDVESLVLDEGKLALVSKQSPSGSTSAPTKSLVESSSSEISPN
FT                   SEVEYQTITLETVKKVRFTGVPPMSEKEDPRPKRKGWYKKPQVLYYPPPPPQVAVQQYR
FT                   LRQEGQAFRKSLRDGDGENGGVSKRTAFMSQSDVHLSPTHKFSSKIRDKLSR"
FT   gene            complement(<189479..>190762)
FT                   /locus_tag="KLTH0D01936g"
FT                   /old_locus_tag="KLTH-ORF12523"
FT   CDS_pept        complement(189479..190762)
FT                   /locus_tag="KLTH0D01936g"
FT                   /old_locus_tag="KLTH-ORF12523"
FT                   /product="KLTH0D01936p"
FT                   /note="similar to uniprot|Q01926 Saccharomyces cerevisiae
FT                   YOR334W MRS2 Mitochondrial inner membrane Mg(2 ) channel
FT                   required for maintenance of intramitochondrial Mg(2 )
FT                   concentrations at the correct level to support splicing of
FT                   group II introns"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22370"
FT                   /db_xref="GOA:C5DG28"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR039204"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG28"
FT                   /protein_id="CAR22370.1"
FT                   /translation="MIWSRLRPFRLLAKPFLRSRRLYHRLLPEQNSGILSLKPITPNDA
FT                   FVSCTLFNKNGAVTAVSQKFPKWAFLKDHNLYPRDLRKIDTTSVDVIPSIVVKPTCILI
FT                   NLLHIKALIQHDCVFVFDTSNSEAAMKLGVLMYDLESKLSTNPNAHMAQLYEHRALESI
FT                   LMNVMTSLETEYKQHYSICGIILKDLEDEISRDKLRDLLIKSKNLTSYYKKSLLIRDVL
FT                   DELLDSDEDLAAMYLGEHKNENDDFADLEMLLETYYKQCDEYVQQSETLLQDIRSTEEI
FT                   VNIILDANRNALMLFELKVTIYTLGFTIATLVPAFYGMNLKNFIEDSPLGFGCVVGFSV
FT                   IAALCVTWSNFKALSSVKRLTMMNNHTGVNTARHAANARHELNQEAPILWKKWASSLRT
FT                   VWLGSNHPVRNGKHRDLIWKWLVDDNKK"
FT   gene            complement(<191031..>191723)
FT                   /locus_tag="KLTH0D01958g"
FT                   /old_locus_tag="KLTH-ORF12521"
FT   CDS_pept        complement(191031..191723)
FT                   /locus_tag="KLTH0D01958g"
FT                   /old_locus_tag="KLTH-ORF12521"
FT                   /product="KLTH0D01958p"
FT                   /note="similar to uniprot|P22203 Saccharomyces cerevisiae
FT                   YOR332W VMA4 vacuolar ATPase V1 domain subunit E (27 kDa)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22371"
FT                   /db_xref="GOA:C5DG29"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG29"
FT                   /protein_id="CAR22371.1"
FT                   /translation="MSTAITSLTPSQVNDELNKMQAFIKKEAEEKSKEIMLKADQEYEI
FT                   EKTALVRNETSNIDAAMEEKTKKATLKQQITKSTIANKMRLKVLSTREQMLDDIFESAK
FT                   AELKKLSSDKKKYESVLKSAILESLLRLLEPSVVVKVREQDKQLVNSFKEAVLKEYKAK
FT                   SGREASLTVSSEYLSKDSAGGVIASDESGKIVVDNTLEERLEILNQEALPALRLELFGI
FT                   SESRKFFD"
FT   gene            <192827..>196498
FT                   /locus_tag="KLTH0D01980g"
FT                   /old_locus_tag="KLTH-ORF12518"
FT   CDS_pept        192827..196498
FT                   /locus_tag="KLTH0D01980g"
FT                   /old_locus_tag="KLTH-ORF12518"
FT                   /product="KLTH0D01980p"
FT                   /note="similar to uniprot|P15801 Saccharomyces cerevisiae
FT                   YOR330C MIP1 Catalytic subunit of the mitochondrial DNA
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22372"
FT                   /db_xref="GOA:C5DG30"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002297"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR041336"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG30"
FT                   /protein_id="CAR22372.1"
FT                   /translation="MSLNRAFRGVKLWRKVRAYSTLEAPRINPVGIQHLSKHLHEQVFG
FT                   SINAQPQQPGLSYEEKEMLTRLSRTFLKNHGLLGKKTAISAPISFDLPQLQGRSLDEHF
FT                   QKLGHFASQPYRDLAGSKFTNIPPRPKTWLRKSGWVRYASGKAPEAVDYPAEATIVFDV
FT                   ETLYKISPYPTLAVALSEEAWYCWTSPFLSGESDNPSHLIPLNTLDTTRLVIGHNVGYD
FT                   RARVLEEYNCQESKAFFLDTMSLHVASSGMCSRQRPQWMQKRKAQDSQSCDGAQYSNVP
FT                   DEEDPWTTVSTLNSLKDVALLHCGIKLDKAQRDYFATLDRNDIINDFTQMVDYCATDVE
FT                   ATSKVFDVVFPLFLSKCPHPVSFGALRLLSTSLLTTRGDSWKDYIEKSENLYQHSKQSI
FT                   EKKILAIVEEVVKLKDKKTLIEQDPWLSQLDWTIKPLRITKKGLPAKGQKLPGYPEWYR
FT                   QLFPTKNSKQAQITIRNRLIPLFFKLSWEGEPVIWTSSHGWCFAVPVSRSEELEAKNYL
FT                   KINPGDVVSPEFTLFKVPHPNGQQFNCTTLVSKQYVQFFEKGILTSHSELAHEALKINS
FT                   SCAYWISARERVMSQFVVSTRDFPDQFKDLQHKTFSDEEISIILPSVIPMGTVTRRSVE
FT                   NTWLTASNAKKNRIGSELKAQVQAPPGYVFVGADVDSEELWIASLVSDSVFNIHGGTPI
FT                   GWMCLEGSKSEGTDMHTKTAQILGCSRNEAKIFNYGRIYGAGVKFATQLLKNFNPGLTD
FT                   YEAKETAEKLYSSTKGLVKRSKTFKKFWYSGSESILFNKLEHIAEQAAPRTPVLGAGIT
FT                   SSLMKGNLGSNTFLPSRINWAIQSSGVDYLHLLCCSMNYLIKKFSLRARLALSIHDEIR
FT                   FLTAEKDKYKTAMALQISNLWTRAVFCEQMGIKDLPQNCAFFSAVDIDHVMRKEVDMDC
FT                   VTPSNKIPIPHGESKDIVSLLKIPESSLKDGREDIDVSGFPFQKREPVFSTYDKAHSRD
FT                   YLYYFLRMQIQSSKWKVEELEQEFTRRSAENDHQSKYRSDEYMFLDYINDTKNKNRPTA
FT                   ELGGGPLENAVHGSMNLTLRTQPIAESQGKFTDELASGLNVENDLEAQHFLAANNTEDT
FT                   ENTDKVQRCTSAVAKRKRLRKSVFGGAEAYKLFSSCVDKSRAYAGRKQEELLSSDLAIK
FT                   TIVNEVVATGGSRSTKKVAKIRKAASIKSPALKKDISKTAASTSKVLKKMNKTLRAG"
FT   gene            complement(<196550..>197293)
FT                   /locus_tag="KLTH0D02002g"
FT                   /old_locus_tag="KLTH-ORF12515"
FT   CDS_pept        complement(196550..197293)
FT                   /locus_tag="KLTH0D02002g"
FT                   /old_locus_tag="KLTH-ORF12515"
FT                   /product="KLTH0D02002p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22373"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG31"
FT                   /protein_id="CAR22373.1"
FT                   /translation="MKRPRKRAFHHSEEEASDSGDDQDFSQYIKRKSAAVQKVQHERKF
FT                   DLDDASLQASAHVTPKPSSTSLIESFKASKKQREMDKLFSQSVKARIERESETCVMKDK
FT                   EVYITKEYEDVKKDLDKAFELAHEEEDSELRDKDGPHTPLLQATPQINSGECVIRGVYA
FT                   SDQSCIKMPRNGDEKPKAYKNDIYVTRPSRFKPQEQGYRQLQQGVEPTLNKRALVQQFL
FT                   LPKKSKQMIEIEIKRYQNRTHKKAA"
FT   gene            <197416..>199332
FT                   /locus_tag="KLTH0D02024g"
FT                   /old_locus_tag="KLTH-ORF12513"
FT   CDS_pept        197416..199332
FT                   /locus_tag="KLTH0D02024g"
FT                   /old_locus_tag="KLTH-ORF12513"
FT                   /product="KLTH0D02024p"
FT                   /note="some similarities with uniprot|P34758 Saccharomyces
FT                   cerevisiae YOR329C SCD5 Multicopy suppressor of clathrin
FT                   deficiency and of ts ipl1 mutants"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22374"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG32"
FT                   /protein_id="CAR22374.1"
FT                   /translation="MSFDWLNVPGLSGSGNENIEAAEPPPSVSFNFGNSASEPPTERES
FT                   HVTMPQRADRADAFHSQSSYDSASSSAKSQARPDNYMETKEDLQVPLSLSRTQLTREEV
FT                   RTYLRWYGYIASRKHTKLIALDDVFHFMTNFPLGQDVKERIAHIFKTCKNALNIGQFFA
FT                   ILRLIARALTDGVLPTRKMIMKAAPVPKPKPILAAGNEEVYEEIDDSQDGPELKVDFDS
FT                   FASLLLTGQKKKRMRRRITNDHKRSKRVRFTDKLVTFQDHVQSPENEQGTEDEEKSGDN
FT                   EPLDLSLPMDQLLKKMAARKKNNSALVSEPPSQKVPESQEEKEVLEDMKESLNHFHQIH
FT                   NVDSVSLGGVPAQVPSAGTPSANATAQIEPLKPTATGSANYLFRSSQQQPQSVNQEPLQ
FT                   PLKPTATGSANYLFRSSQQQATSQKPEHNSFNFMHAVSPDPSNNAMHRNNTTFQSPTPE
FT                   IPQIRAPLAANFAGQPLHSSSQAPSNLNVPFSNQSFLPPPSSGFGISPQPTSQNNFSPN
FT                   LSANNYFQNLLSSSPSPNASTLQLPQSASVGPYANAYSSNSKVAQDSNYLKPNLTGPSN
FT                   PQYQINPNQYQRREYQSFTPSPVPTLPSYPQAPQNTYKSHDYLGDLRALQEHVDQLQNA
FT                   YNR"
FT   gene            <199583..>199990
FT                   /locus_tag="KLTH0D02046g"
FT                   /old_locus_tag="KLTH.mRNA.200AT.p"
FT   CDS_pept        join(199583..199663,199742..199990)
FT                   /locus_tag="KLTH0D02046g"
FT                   /old_locus_tag="KLTH.mRNA.200AT.p"
FT                   /product="KLTH0D02046p"
FT                   /note="similar to uniprot|P33328 Saccharomyces cerevisiae
FT                   YOR327C SNC2 mediate the targeting and transport of
FT                   secretory proteins vesicle-associated membrane protein
FT                   (synaptobrevin) homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22375"
FT                   /db_xref="GOA:C5DG33"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR016444"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG33"
FT                   /protein_id="CAR22375.1"
FT                   /translation="MSSSVPYDPYIPAEESQSQTKTAALKAEIDDTVGIMRDNINKVAE
FT                   RGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLCLVLAVIILLVVIIVPI
FT                   VVHFS"
FT   gene            complement(<200288..>204958)
FT                   /locus_tag="KLTH0D02068g"
FT                   /old_locus_tag="KLTH-ORF12510"
FT   CDS_pept        complement(200288..204958)
FT                   /locus_tag="KLTH0D02068g"
FT                   /old_locus_tag="KLTH-ORF12510"
FT                   /product="KLTH0D02068p"
FT                   /note="similar to uniprot|P19524 Saccharomyces cerevisiae
FT                   YOR326W MYO2 One of two type V myosins involved in
FT                   polarized distribution of mitochondria required for
FT                   mitochondrion and vacuole inheritance and nuclear spindle
FT                   orientation moves multiple cargo"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22376"
FT                   /db_xref="GOA:C5DG34"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036103"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG34"
FT                   /protein_id="CAR22376.1"
FT                   /translation="MSFEVGTRCWYPDKNEGWVGSEVTKLSQPADGKYLLELTLENGES
FT                   VEIETNTIAEGQDDRLPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYS
FT                   GIVLIATNPFDRVEQLYSQDMIQAYAGRRKGELEPHLFAIAEEAYRLMKNDKQNQTIVV
FT                   SGESGAGKTVSAKYIMRYFASVEQANNDNTSSDHQLEMSETEQRILATNPIMEAFGNAK
FT                   TTRNDNSSRFGKYLEILFDQNTSIIGARIRTYLLERSRLVFQPQTERNYHIFYQLLEGL
FT                   SESEKAELHLTKVEDYHYLNQGGDYRIKGVDDAAEYRTTIDALKMVGFAQDTQHQLFKI
FT                   LAALLHIGSIEVKKTRNDSSLSSDEPNLQIACDLLGIDAYGFSKWITKKQITTRSEKIV
FT                   SNLSFNQAIVARDSVAKFIFSALFDWLVENINTVLCNPEVSNQVSSFIGVLDIYGFEHF
FT                   EKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYMNEQIEWSFIEFNDNQPCIDLIENKL
FT                   GILSLLDEESRLPAGSDESWTQKLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYD
FT                   VDGFIEKNRDTVSDGHLEVLKASKNETLLAILDTIDNNAAALAKKQEANKKPGPARMVK
FT                   KPTLGSMFKQSLIDLMTTIDSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETI
FT                   RISCAGFPSRWTYNEFVLRYHILIPSENWTKIFTSEATEDDIRDLCKQILDVTVKDSTK
FT                   YQLGNTKIFFKAGMLAYLEKLRGTKMHNACVMIQKKIKGVYYRNKYLAIQSAIHKSQAA
FT                   VAGALCRQRVDYEIKTLAATSLQSLLRAHTQRKHLKNTFCSIIRVQSLVRRRITQKELL
FT                   ERREFDAAIAIQKKIRGFVPRKHFNTTRGSSVRIQSLVRRKLAQKQLKQLKADAKSVNH
FT                   LQEVSYKLENKVIQLTQSLADKVKENREMTSRIEELQKSLSESANIKTLLESQKEEHSR
FT                   DLQEQKNSHDAELANKRAELEQAKEEIAAAKQEIDSLMTKQEELRNDVRLKIENLNKAQ
FT                   QEYADAQTQNSDLKNEVKSLKDEISRLQATIRSGVSANTALAHTPTKNRRFSTHSSLAD
FT                   GMSPRQLNVISMNNGMEDDVRSTASALSQINDELYKILEDTKSLNTEIVEGLLKGFKIP
FT                   ETGVAAELTRKEVLYPARIMIIVLSDMWRLGLTKQSESFLAEAMSTIQKLVTGLKGEDM
FT                   ICHGAFWLTNVRELYSFVVFAQESILNDDSYNSGLNEDEYKEYVTLVTELKDDFESLSY
FT                   NIYNIWLKKLQKDLEKKAVSAVVMSQSLPGFIANESSQFLPKLFTQSNYYKMDDILTFF
FT                   NNIYWSMKTYHVEQEVFREVIITLLKYVDSICFNDLIMRRNFLSWKRGLQLNYNVTRLE
FT                   EWCKSHHIPEGTDCLQHMLQASKLLQLKKANLDDIDIIWEICSSLKPAQIQKLITQYAV
FT                   ADYEVPIPQEILTFVANRVKSESSLSSNGKSQTHSSDIFLHVENGPFEDPFSLIETRRF
FT                   GKIEAYIPAWMNLPLTRRVVELVTQHVTVQEVERAS"
FT   gene            <206308..>207483
FT                   /locus_tag="KLTH0D02090g"
FT                   /old_locus_tag="KLTH-ORF12509"
FT   CDS_pept        206308..207483
FT                   /locus_tag="KLTH0D02090g"
FT                   /old_locus_tag="KLTH-ORF12509"
FT                   /product="KLTH0D02090p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22377"
FT                   /db_xref="GOA:C5DG35"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG35"
FT                   /protein_id="CAR22377.1"
FT                   /translation="MPSANEGLGLSPYHRYSQHGSAKISSVSNSDIPRHSFHLRCSAER
FT                   NAVTEHDFTSASAGKFSDCLFHSCQGGSAGLNGAASSSSPSLSSIHNTDKAPYSSSNSL
FT                   LNPGSARSGNTARNSSYEPPYLSAPRLRNDRKRLVHQFLNFEEEGQSKHDAQVSLASQH
FT                   SLIYENSRGESLSQIVLKDLKEIPTCQDSNLDLVRSQSKAKSTALSCQPIMSEISKFDS
FT                   SLKDLILSISSKDNEMSRSFNDLDVLQHNIQETRAIIQSIQSQVKENDLSRLKGSFEAG
FT                   SDTSFIKRFSAAISAYSDSLTSFEERIAKCKAELAAQKATVHKLETTIKLNEMLEDSNT
FT                   NKCTIDRIREYRGIITDAVGLLFLALVIITLKRYLAGRNSSSTYKLHVPEH"
FT   gene            <207735..>208643
FT                   /locus_tag="KLTH0D02112g"
FT                   /old_locus_tag="Klth0D.mRNA.at.307.p"
FT   CDS_pept        join(207735..207816,207874..208643)
FT                   /locus_tag="KLTH0D02112g"
FT                   /old_locus_tag="Klth0D.mRNA.at.307.p"
FT                   /product="KLTH0D02112p"
FT                   /note="similar to uniprot|P39735 Saccharomyces cerevisiae
FT                   YAL027W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02112g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22378"
FT                   /db_xref="GOA:C5DG36"
FT                   /db_xref="InterPro:IPR021624"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG36"
FT                   /protein_id="CAR22378.1"
FT                   /translation="MVQVQSGVVLPIRIFINRQQVAKTIQDSSTSFETPLLPNNSIIRL
FT                   KSPLIRVYLSNTDARDLCNDIKKEILLIIYELTSKDVHDTVTGKLKIGNCVDIKEAFGK
FT                   TRAFSFLYDSDPDRCNLTTLERIGKHQYKLHYDKNWELDIFITDLRKLARIRSVLLARM
FT                   SWQGSVFPGAAIPVGDLSGTRILRRCREEIMSKKSPTDEPSILLESDDEGALLDTAAVD
FT                   SSTSTTTRPLKEADLDEDKKPAFKFIHSPMVNLGNCIDIHVLKRPKRARTNRSQAHLDV
FT                   ET"
FT   gene            <208745..>210118
FT                   /locus_tag="KLTH0D02134g"
FT                   /old_locus_tag="KLTH-ORF12506"
FT   CDS_pept        208745..210118
FT                   /locus_tag="KLTH0D02134g"
FT                   /old_locus_tag="KLTH-ORF12506"
FT                   /product="KLTH0D02134p"
FT                   /note="highly similar to uniprot|P54885 Saccharomyces
FT                   cerevisiae YOR323C PRO2 Gamma-glutamyl phosphate reductase
FT                   catalyzes the second step in proline biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22379"
FT                   /db_xref="GOA:C5DG37"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG37"
FT                   /protein_id="CAR22379.1"
FT                   /translation="MSSTAEIIAKNARLGGNTLKTISNENRSRLLYKIHDGLKANAKSI
FT                   KEANQLDLQKAKEDSLADSLYKRLDLFKGDKFDTMLIGIKDVAELEDPVGKVRLARQLD
FT                   ENLDLYQVTAPVGALLVIFESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRII
FT                   NTVISENEESTGIPASVIQLIETRQDVSDLLQQDLYIDLVVPRGSNELVRKIKSSTKIP
FT                   VLGHADGICSIYLDSEADLAISKRITIDAKTSYPAGCNAVETILVNPEMPKWWEVLENL
FT                   SKVGGVTLHVSADVKASYLDFLKQSGAQDDDAQGKIVDADESKDFDREFLSLDCAVKFV
FT                   HSTEDAIAHINQHSSKHTDAIITENKAKAELFMKGVDSSGVYWNASTRFADGFRYGFGT
FT                   EVGISTSKIHARGPVGLDGLVSYQYQLRGNGQVASDYIGSGGKKAFIHKNLDISNLRL"
FT   gene            complement(<210244..>214179)
FT                   /locus_tag="KLTH0D02156g"
FT                   /old_locus_tag="KLTH-ORF12505"
FT   CDS_pept        complement(210244..214179)
FT                   /locus_tag="KLTH0D02156g"
FT                   /old_locus_tag="KLTH-ORF12505"
FT                   /product="KLTH0D02156p"
FT                   /note="highly similar to uniprot|P39524 Saccharomyces
FT                   cerevisiae YAL026C DRS2 Integral membrane Ca(2 )-ATPase
FT                   potential aminophospholipid translocase required to form a
FT                   specific class of secretory vesicles that accumulate upon
FT                   actin cytoskeleton disruption mutation affects maturation
FT                   of the 18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22380"
FT                   /db_xref="GOA:C5DG38"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG38"
FT                   /protein_id="CAR22380.1"
FT                   /translation="MNHQNRKSNEDTLFDIDFLDDEFTSAPRTDSSAGNPFQQAQVVDS
FT                   DYDLLEDIRRGTIPEETIDLDRHSANLPHEDNIENDIIQNPFLGEEGLNDHSQGIHRAP
FT                   KKRSGLRNVFRKFNFGLIGNKNRNNYQGFEMHSYDDLGAEDRYARSRNKFDIKVLFRRF
FT                   ILRRNELSDEDKSSPRQIFINDREANRARSYGDNHISTTKYNLATFLPKFLFQEFSKYA
FT                   NLFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAVKEIVEDLKRAKSDNELNDSRAE
FT                   IFSDQLQDFSLNKWVNISVGDIIKVKSEEPVPADMIVISSSEPEGLCYIETANLDGETN
FT                   LKIKQAKVETSKIIDTAELARMRGKVLSEHPNSSLYTYEGTMTLNGKNIALTPEQMVLR
FT                   GATLRNTAWVYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALIS
FT                   SIGNVIKVTSDAKHLGYLYLQGTNKAGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQ
FT                   AYMIASDLDLYDEATDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGK
FT                   CYIETIPEDKTPTMEDGIEVGYRKFEEMQEKLGEHSDPESGVINDFLTLLATCHTVIPE
FT                   FQEDGSIKYQAASPDEGALVEGAASLGYKFIVRKPNTVAIVLEGSGQEQEYQLLNICEF
FT                   NSTRKRMSGIFRMPDGQIKLFCKGADTVILERLSESGNPYVEATLRHLEDYAAEGLRTL
FT                   CLATRTIPESEYSEWKAIYDEASTTLDNRTQKLDDAAELIERDLHLIGATAIEDKLQDG
FT                   VPETIHTLQDAGIKIWVLTGDRQETAVNIGMSCRLLSEDMNLLIVNEETREATKKNLVE
FT                   KLKAISEHQVSQQDMNSLALVIDGKSLGFALDSEIEDYLLSVGKLCKAVICCRVSPLQK
FT                   ALVVKMVKRKTGSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYL
FT                   KKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVF
FT                   FTVLPPFVLGVFDQFVSSRLLDRYPQLYKLGQKGQFFSVTIFWGWVINGFYHSAVTFIG
FT                   SILFYRNGDVLNMHGETADHWTWGVSIYTCSVIIVIGKAALITNQWTKFTAFAIPGSFV
FT                   FWLVFFPIYASIFPHANVSTEYYGIVSHVYGSATFWLMCIVLPVFALLRDFAWKYYKRT
FT                   YTPESYHVVQEMQKYNIGDYRPRVEQFQKAIRRVRQVQRMKKQRGFAFSQSEDSGQDKV
FT                   IRMYDTTLKRGVHGELQDASANPFRDS"
FT   gene            complement(<214421..>215329)
FT                   /locus_tag="KLTH0D02178g"
FT                   /old_locus_tag="KLTH-ORF12503"
FT   CDS_pept        complement(214421..215329)
FT                   /locus_tag="KLTH0D02178g"
FT                   /old_locus_tag="KLTH-ORF12503"
FT                   /product="KLTH0D02178p"
FT                   /note="some similarities with uniprot|P10962 Saccharomyces
FT                   cerevisiae YAL025C MAK16 Essential nuclear protein required
FT                   for normal concentration of free 60S ribosomal subunits
FT                   required for maintenance of M1 satellite double- stranded
FT                   RNA of the L-A virus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22381"
FT                   /db_xref="GOA:C5DG39"
FT                   /db_xref="InterPro:IPR006958"
FT                   /db_xref="InterPro:IPR029004"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG39"
FT                   /protein_id="CAR22381.1"
FT                   /translation="MSDEIIWQVINQHFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPL
FT                   ANAKYATVKNVDGRLYLYMKTAERAHTPAKMWERIRLSKNYAKALKQVDDHLLYWNKFL
FT                   IHKCKQRLTRLTQVAVTERRMELREEERHYVGIAPKVKRRDENRERKALAAAKIEKAIE
FT                   KELLDRLKSGAYGDKPLNVDEKIWRKVLGHVEDEQEDDEEEYDDEEEDESDAEIEYVED
FT                   DGDEELVDVEDIERWLDDPEASDSDSFEEDEMSDSSEDEPESGFTSGKGKKGTSAARKK
FT                   RPRVEIEYEEETQPAHRELAH"
FT   gene            complement(<215729..>219868)
FT                   /locus_tag="KLTH0D02200g"
FT                   /old_locus_tag="KLTH-ORF12500"
FT   CDS_pept        complement(215729..219868)
FT                   /locus_tag="KLTH0D02200g"
FT                   /old_locus_tag="KLTH-ORF12500"
FT                   /product="KLTH0D02200p"
FT                   /note="similar to uniprot|P07866 Saccharomyces cerevisiae
FT                   YAL024C LTE1 Putative GDP/GTP exchange factor required for
FT                   mitotic exit at low temperatures acts as a guanine
FT                   nucleotide exchange factor (GEF) for Tem1p which is a key
FT                   regulator of mitotic exit physically associates with Ras2p-
FT                   GTP"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22382"
FT                   /db_xref="GOA:C5DG40"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR036964"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG40"
FT                   /protein_id="CAR22382.1"
FT                   /translation="MVPEDLQDEIEQGGRIFGTDDYYPMPSEEKLSFSKRGSSTLIIKT
FT                   DISALIVKLTSPMDPIDYPFLSDFFLSYRKFLAPQELLKLLVSRLQWAFNESLSADSNK
FT                   QQIGQIASVRTFVLIRHWILNYFAQDFLTDDALRSQFVNSVNSLSWGASDVAPKSICGI
FT                   VINIKKSWGFCLRLMWEGLSFEDQPTSANEWLEFKIKDVATHLSTKNGKRLSFYALQSS
FT                   QNPEFRNRSVLSLYVGKENFQLPEHNARVNTKQGAKIKQRTASMFLFPQDNLSSAVLKV
FT                   SNDKVGNSDEVSQNAPNSSGVSEVIKDLQYPPSPSIDKVIPPTPAKKVEFILRSSYFPS
FT                   EILSEEEANTSSTSQKLKKEPHLHSYNKGMMGLLSKWKKNHTLRSANQKINQESPSAEF
FT                   ENLIKLVFSITSLENKQYSSEELKSVVSSKFDILSARTIDEVEYFLAVENDLLSKIRKQ
FT                   DHFTTVEGGADEQTQERDAETVSAMDNLNLYKTVSSIASSVISLSKTLQFQHAVSPSAA
FT                   ARERRRVRSTDGLLGNKSVLNFTDALLTSDVNTRILENDAPRKLVFHGHSTTRERHTNS
FT                   ELKFRYSNMADAVIRLNHSTPSVMQTSALTKSTNGTRSRGSPTKGVRISSSITEIDDTF
FT                   SKHNESTPQAEEVSNAGSHISRPLKRKESLDNLREFNFEENFDQKNGSQSKLDHKINHN
FT                   ELQSDADDDNSSFFTTLDDMSMSRNSKHMTPASSAAQKSVTSSGRISIIRSRGPSVSNA
FT                   VTISTTNLVAKDGAFLKLDEELLNNQEEIRNLEERTSALFFDKVEEEGAKNIRSSIATS
FT                   VSTQLLFSSKQSSPNKIEKNDLLDNDEFPQGNKLIRLSSIPSMHSIVSGDSFSSFHTIN
FT                   SFEQNSRADISHKLTVDTPSTGAKPEKNAPNDSLLVPDAEGSSGNKYLFSPDTDSLDFA
FT                   SPEKNMEDLKNKFISPITSETTSFNEDDLSRDNEGEEGEPTEEQQLDNGYQEKPHNEHH
FT                   RRSITPIVSPYKANDSRLNRFAKLTDESLHGDPVNVALMKLEGTFSKTDQNKEQSDSDM
FT                   ERLKERRLTGLGARERNSFLIERRRQVKSEVPFTPCTKDFSYERDQKVTNDQITELLQN
FT                   YKIQDSRLNISNAEQHVPFILMYDSKSIAEQLTLIEREILNEIDWKDLLDLRVKRKVLP
FT                   VTSWLQLLLQNEQLSGIDLAIARFNLTVDWIISEIVLTRDNKLRRNTIQRFIHVAEHCK
FT                   LFQNYNTLMQIVLALSSLVVQSYRDAWRLVEPGDLLSWESLKNVPSLEKNYYNIRMLLN
FT                   DIEPIKGCIPFIVVYLSDLTLNSEKSNWITPHQVLNYSKFQTNVQIVKNFIQRAQWSKF
FT                   YNISVNDELLSKCVYISCLTHEEIDHLKSQQTKSAT"
FT   gene            <220570..>223113
FT                   /locus_tag="KLTH0D02222g"
FT                   /old_locus_tag="KLTH-ORF12494"
FT   CDS_pept        220570..223113
FT                   /locus_tag="KLTH0D02222g"
FT                   /old_locus_tag="KLTH-ORF12494"
FT                   /product="KLTH0D02222p"
FT                   /note="weakly similar to uniprot|P52960 Saccharomyces
FT                   cerevisiae YOR363C PIP2 peroxisome induction pathway 2
FT                   (PIP2) transcriptional activator of peroxisome
FT                   proliferation may form heterodimer with Oaf1 to activate
FT                   oleate-inducible gene expression activator of peroxisome
FT                   proliferation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22383"
FT                   /db_xref="GOA:C5DG41"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG41"
FT                   /protein_id="CAR22383.1"
FT                   /translation="MDRNGLTNSTSSDSLELAVRSKKSRLRLSFVCRNCRKRKIKCDKA
FT                   QPKCGRCAKLGLECNYDLSEQISLKKTPGRPVTIHEQLEELEHKFEDMRHSLNLSGMRA
FT                   WNEDLDNRSKPIKINFFVGLQPNCFESIFKRDCKPFSDMGMIQKHKRLNPFLKFVTRSF
FT                   KPLNYAVKKILQSVGDSLDPHSDELESVAEILFLTPQVREVLKQHSMNPEGITQETANA
FT                   IRRCLLEKGSRGDEKSLFEPVDLEFSSSKISQAELIDQIVAVLPPRDQIEHLLAYFMKV
FT                   VYPLVPYVNKSCFFRRVTETIKYSENGKVIGLDIGDYQDAIRKIGCMAIFLVVLRISHT
FT                   ALTLVKNLPYNGEHLDRFISVSQKCLAHLITLSHKTNEDILSCLILMRWSLIYSPTEGE
FT                   VVAGSVTDMLLSLIVNHAIRIGLYRDRIQANGPKKNDKMERYFIHYRAKLWMGCLILLR
FT                   SDLFLKGNFPVVSPEYAAMAPKEENPENYEDEAEAQIHRILHKQLDIYSKMSILDKLTL
FT                   QVEESTDIEEIYSKIRRLEYDLQSYCPLSDVENLNNTTLENTIIQSMNNALYFKVNVMV
FT                   KIYFLAIRASIVAILERQITEALTDTEHLSLRYREVTAECFESAVDLCEILCAYMSVAD
FT                   DDQNSPVMPDHRYILNQIVQIGIFRVSYYFIGVILTLLQVKNGLENFMWQNENKQSLVT
FT                   EIEYKITLIESTSKAIFQSVQKLIHLGSHTLSDRYFTSFKQFLFLEYAMQVIQNEINPN
FT                   TPSRLREVLGDIGLPVAMDYSPSDWEKFASYVKKAIGQAEPTPPFTSSDDIPSAPSTHA
FT                   KSAPNDPALDSMLLFDDQVNIQNMLDGDYTWTDFI"
FT   gene            <223460..>225718
FT                   /locus_tag="KLTH0D02244g"
FT                   /old_locus_tag="KLTH-ORF12492"
FT   CDS_pept        223460..225718
FT                   /locus_tag="KLTH0D02244g"
FT                   /old_locus_tag="KLTH-ORF12492"
FT                   /product="KLTH0D02244p"
FT                   /note="similar to uniprot|Q12502 Saccharomyces cerevisiae
FT                   YOR322C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22384"
FT                   /db_xref="InterPro:IPR024391"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG42"
FT                   /protein_id="CAR22384.1"
FT                   /translation="MVFSKLGHQSDKKSASNGALDRVFSDSSNDGLVELLIDIESPPCV
FT                   LYGSATESTGALLSGLLKLRVRSRSDHISHSEPLTPTTSHGRKKKSSSGLNALSQTLSN
FT                   LSLSNSAMSPVTSPKPSRTSSMMFTKVSVKSVSLSLVQKVRYTKPFVAHSSSIQSCLNC
FT                   RMKQTELARWDIVKKETEIPVGDHAYPFSHLIPGSVPATVCLGSEAHTEVKYELVGEAT
FT                   YRAVPSHNSRGEKTSTVHLKLPIPVTRSILRGPDKNSLRIFPPTDLTATVVLPNIVYPK
FT                   STFTLELKLDGVSSEGRRWRMRRLNWKIEEKGRVRLQACATHKGKLKQLEKEVKETETG
FT                   KKPSKGKPLKRTHDAAPQVTTTVCTLEDALSMTNAPEDPNAPDETETQEETSNRNQGED
FT                   DGLIHPSDSAMRQARVEEQQRLRQEMLQKELSEGTALFTEELRTIAHGEVKNGWKSDFT
FT                   GSGKIELVTEVNCMGLNSGVSNPVNRASSSKPVHDNGRQHVTVACDVEDPHLGIYVQHL
FT                   LILEIIVAEEALQYANGQPLHTEHSPLTKTSSNATNPDQRLAELSPMLAARSSVPQNIN
FT                   DEAHPNQPEHGAPSPHSASRRNSNSRIVGVPTGAARVLRMQFRLNITERSGLGISWDDE
FT                   VPPTYQDVRLLSPPSYNNATSGSNTPLVHSDMDRNDYSTRTNFNSGRSEFTELSRPPQA
FT                   HAYDSPYQSLSPVQSPQLENVVSIQGNAHHTHLLTPQNTQEVHLPSLSELLDTDRITQ"
FT   gene            complement(<225886..>228108)
FT                   /locus_tag="KLTH0D02266g"
FT                   /old_locus_tag="KLTH-ORF12491"
FT   CDS_pept        complement(225886..228108)
FT                   /locus_tag="KLTH0D02266g"
FT                   /old_locus_tag="KLTH-ORF12491"
FT                   /product="KLTH0D02266p"
FT                   /note="highly similar to uniprot|P31382 Saccharomyces
FT                   cerevisiae YAL023C PMT2 Transfers mannosyl residues from
FT                   dolichyl phosphate-D-mannose to seryl and threonyl residues
FT                   in proteins acts in complex with Pmt1p dolichyl
FT                   phosphate-D-mannose:protein O-D-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22385"
FT                   /db_xref="GOA:C5DG43"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG43"
FT                   /protein_id="CAR22385.1"
FT                   /translation="MSSTGFSDRTSDGSLKQRNVSKIDQISDSEAEDAPKDIKVQTSPL
FT                   AHLESIVMPIVFTLLGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGK
FT                   MLVGLSGWIAGYNGSWDFPSGEEYPEYLDYVKMRIFNATFSALCIPVAYFTAKAIGFSL
FT                   PTVWLFTILVIFENSYATLGRFILLDSMLLFFTVTSMLCFVTFHNQRSKPFSRKWWKWL
FT                   LLTGLSLGCAISVKMVGLFIITLVGIYTVIDLWTMLSDKGVSKKTYVNHWLARILCLII
FT                   VPFLVFLACFKVHFDLLSHSGTGDANMPSLFQAGLVGSDVGVGPRDVALGSSHVSIKNQ
FT                   ALGGSLLHSHVQGFPEGSNQQQVTCYGHKDSNNNWIFDRIRPLPFWTEEETEIEYVVPG
FT                   ESYRLVHPNTGKNLHTHPIPAPISKSAWEVSGYGSATVGDPKDHWVLEVVAQYGSENQS
FT                   RVHPLTSSFRIKNAELGCYLAQTGESLPEWGFRQSEVACLKNPFKRDKRTWWNIESHTN
FT                   ERLPDRPADFQYPKLNFIKNFIHLNLAMMATNNALVPDPDKLDTLASSAWQWPTLNVGI
FT                   RLCGWGDETVKYFLMGSPASTWPSTAGVLAFMVLVVVLLLRWQRQYADFSSPRDFNLFM
FT                   MGGFYPLLGWGLHFMPFVIMSRVTYVHHYLPALYFALLILCYLFEAGLKNLQKHKGGRL
FT                   ARTLIYFTYGAIVICGFYYFSPISFGLVGPSSNYAYLNWIKTWTIK"
FT   gene            complement(<229079..>230371)
FT                   /locus_tag="KLTH0D02288g"
FT                   /old_locus_tag="KLTH-ORF12487"
FT   CDS_pept        complement(229079..230371)
FT                   /locus_tag="KLTH0D02288g"
FT                   /old_locus_tag="KLTH-ORF12487"
FT                   /product="KLTH0D02288p"
FT                   /note="similar to uniprot|P31381 Saccharomyces cerevisiae
FT                   YAL022C FUN26 Nucleoside transporter with broad nucleoside
FT                   selectivity localized to intracellular membranes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22386"
FT                   /db_xref="GOA:C5DG44"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG44"
FT                   /protein_id="CAR22386.1"
FT                   /translation="MDNFREGSPSTELHRHIGEELELENATLWVKLQDLNYTTFLLIGI
FT                   ALLWPWNSFLSASLYFQHDVFHDKTVFAKIYISTMMSISTISSVIFNYWLSKRQHSYSR
FT                   RIVRGLIWEIMVFGLLSMFVFVHKSLPDWLNFTFLMSTVLVSSLGTAMTQNGAMALANV
FT                   FGPQFSQGVMVGQAVAGVLPSLVLFLVSYIGDPRDQSVGGIFAYFGSTVLVSVACIVLY
FT                   RVSSIGSADKHDFLNRELDPEATVSVPFSLLFDKLRYLVLSIFTTFVVTLLFPVFAANT
FT                   FVSGLPMRNAQYIPFIFTVWNLGDLYGRAISDYSFFQSPSFTPFKTFLYSIARIGLVPL
FT                   FFCFNLNSSARPSSSFSAIVSDLLYILLQFAFGVTNGNVLSVSFMKVSSQLNSDKQRKA
FT                   AGGFTNIFLSAGLAFGSLLSYLFTYIVLSKS"
FT   gene            complement(<230632..>232851)
FT                   /locus_tag="KLTH0D02310g"
FT                   /old_locus_tag="KLTH-ORF12485"
FT   CDS_pept        complement(230632..232851)
FT                   /locus_tag="KLTH0D02310g"
FT                   /old_locus_tag="KLTH-ORF12485"
FT                   /product="KLTH0D02310p"
FT                   /note="similar to uniprot|P31384 Saccharomyces cerevisiae
FT                   YAL021C CCR4 Component of the CCR4-NOT transcriptional
FT                   complex which is involved in regulation of gene expression
FT                   component of the major cytoplasmic deadenylase which is
FT                   involved in mRNA poly(A) tail shortening"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02310g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22387"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG45"
FT                   /protein_id="CAR22387.1"
FT                   /translation="MNNPAPMMGYSGLAGQQNAVQPAIPSVIGTPGTMHQQLHMQQPHM
FT                   QNPQQAQNAQVQQPLPPGLVNGGQPIMGLTNSAGAGVANVTSNAGNPLYHPHQGDPALL
FT                   NNPIWKLQLQLAAVSRQSAGRANVYARQSAMRKYLLNKNQGAAGTLNEMSASLVDHTKQ
FT                   LLLDMAGEPAGSLNNTSSSAASTPITPNAELSNGNPTTPSLLLQHKKLSQYNIDEDDEI
FT                   EHRMVAPTDTKHDDQLWHALDLSNLQVFNLTESLFKYEFLTRLYLNGNNLTTLPKSVKA
FT                   LTNLRVLDVSHNKLTELPAELGLCHQLKYLYFFDNMVSSLPWEFGNLFNLQFLGLEGNP
FT                   MDRQIIKILTEKSVTGLIFYLRDNAPEIPLPTERKFIDINIDGEATQECSSLQESDAHQ
FT                   SRETLKKSFTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQ
FT                   EVECKTYEDFWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKE
FT                   AVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALVVKLQHIKSGEHVWAATTHLHWDPQFN
FT                   DVKTFQVGVLLDYMEKVIKEQNNCNNTQELKKVPVVICGDFNSQTNSAVYELLNTGNVS
FT                   KHRDIEGRDFGYMSQKNYAHNLPLKSSYDSIGELPFTNLTPTFTDVIDYIWYSSQGLRV
FT                   RGLLGEIDPEYASKFIGFPNDKFPSDHIPLITRFEFTKGGGSRKA"
FT   gene            complement(<233733..>234704)
FT                   /locus_tag="KLTH0D02332g"
FT                   /old_locus_tag="KLTH-ORF12479"
FT   CDS_pept        complement(233733..234704)
FT                   /locus_tag="KLTH0D02332g"
FT                   /old_locus_tag="KLTH-ORF12479"
FT                   /product="KLTH0D02332p"
FT                   /note="weakly similar to uniprot|P31386 Saccharomyces
FT                   cerevisiae YAL020C ATS1 Protein with a potential role in
FT                   regulatory interactions between microtubules and the cell
FT                   cycle as suggested by genetic and physical interactions
FT                   with Nap1p and genetic interactions with TUB1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02332g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22388"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG46"
FT                   /protein_id="CAR22388.1"
FT                   /translation="MITPQSTFKSLSKPLKVTGGGNFTAILLENGELYVAGECTLVSRE
FT                   KTAGWCQIEGLFRDVACGWSHIIAVTCEQEVVTAGIGVKGELGLGSKNKTNQFERVLAV
FT                   QSPGAQVFACFYNTYVQDGGKLYGWGSNTKCQVLSPKSKAVSCPALVYEGKISNVCVGK
FT                   NSVCFVGDGLIRAQGAIAKYLPQMRSEPVLGEKLELRSMWTSITAFDHRNFRFFGPAGQ
FT                   MQDAITFCKQPPAYAVSCWGTGSEHGVMCCEDRVYCWGWGEHGNCGPTNATTAASLTSG
FT                   INDQSNTKSGVNMVYITSHQEEVVSCFGGCATTWICIKKTGA"
FT   gene            <235169..>238312
FT                   /locus_tag="KLTH0D02354g"
FT                   /old_locus_tag="KLTH-ORF12477"
FT   CDS_pept        235169..238312
FT                   /locus_tag="KLTH0D02354g"
FT                   /old_locus_tag="KLTH-ORF12477"
FT                   /product="KLTH0D02354p"
FT                   /note="some similarities with uniprot|P31380 Saccharomyces
FT                   cerevisiae YAL019W FUN30 Protein whose overexpression
FT                   affects chromosome stability potential Cdc28p substrate
FT                   homolog of Snf2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22389"
FT                   /db_xref="GOA:C5DG47"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG47"
FT                   /protein_id="CAR22389.1"
FT                   /translation="MSSMTPKKDEEIQVPGSSPVEDTKVASSSPLKTDSSTAALLRDKF
FT                   VYKPLERRELGANLKNGSGDNASDNSGGHSDADVAKLINEYPDFSETLVKAVFKSNSYD
FT                   LNLTRERLRRIHSQKSSRSWAWRPGEKKPTSRLMSLGSYSDSVNTSSNGGHVPRHSSTI
FT                   VASPEKSSKVTLEKQKTSIFDRYSHVMNQRHKPTMESVVVDPSTISQLEPSTRKRRKLL
FT                   RADDPNRDPSMAAISNTKKSSVSLSDEDEDEISGDENVSGEDYQEYTPDVNIDDEILKF
FT                   INDADEKDIADVADTTLDKASMVVKSRPFKSLVEFSQMDFLTEQEIQKQQEKKKSSRRG
FT                   QQKKDGDKLLDKMIQTMKGYNAIDSLIKRCSSYGSLIASQIQKWGVNVEDIQSGELNFI
FT                   DIGDDESESDEGAEIGITQESGSTGITKKSGKTKKSGDESDFDDEEDDYQDSEDEDYGS
FT                   RRTRHSGRGRGRPKHKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYQNNMSCILAD
FT                   EMGLGKTCQVIAFLSYLKQNNEHGPHLVVVPSSTLENWLREFNKFCPDMKIEPYYGSQQ
FT                   ERAELRDILEDNDGQYDVIVTTYNLASGNKHDVSFLKNRGFNAVIYDEGHMLKNSMSER
FT                   FNKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFVSKKSDLSAVFRQRARTSDS
FT                   NKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMTDVQRSIYNKE
FT                   IQQVLEHKKMVKEREERGETAPLPSKNGGAQASKNLIMSLRKASLHPLLFRHIYDDKVL
FT                   DKMSRAILKEPEYAENGNKEYIQEDMSYLNDFELHRLCLKFPKSLGKFQLKNDEWMESG
FT                   KIGALGKLLKDIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQAL
FT                   IDKFYEDESIPVFILSTKAGGFGINLVCANHVIIFDQSFNPHDDKQAADRSHRVGQTKT
FT                   VHITTLVTRNSIEEKILQLAKNKLALDTYISEDDNKATEALENKVSDMLEDIIYDESK"
FT   gene            <238729..>241989
FT                   /locus_tag="KLTH0D02376g"
FT                   /old_locus_tag="KLTH-ORF12474"
FT   CDS_pept        238729..241989
FT                   /locus_tag="KLTH0D02376g"
FT                   /old_locus_tag="KLTH-ORF12474"
FT                   /product="KLTH0D02376p"
FT                   /note="some similarities with uniprot|P19659 Saccharomyces
FT                   cerevisiae YOL051W GAL11 Component of the Mediator complex
FT                   interacts with RNA polymerase II and the general
FT                   transcription factors to form the RNA polymerase II
FT                   holoenzyme affects transcription by acting as target of
FT                   activators and repressors"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22390"
FT                   /db_xref="GOA:C5DG48"
FT                   /db_xref="InterPro:IPR008626"
FT                   /db_xref="InterPro:IPR033789"
FT                   /db_xref="InterPro:IPR036546"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG48"
FT                   /protein_id="CAR22390.1"
FT                   /translation="MEADWRTTLSNQERSKYITELAQILAQISQVNGGDRGNFNLEKLK
FT                   KTAEQFEKSLYASSSSKELYLDSMRKRIAAMDTAKKKAIANIQHNAANVAAHQQSQQQA
FT                   AVAAAQSAQQQRASQFPPSNMNSQMFFNQQAQVRQQAAQQFRNGVGSNMPVNSAPTRPQ
FT                   LTPQQQQLINEMKGAEIPRELLQRIPNLPPGVNTWQKVTELAQQKRLGPKDLQIAKQVY
FT                   KMHQQIVFKSKMQQASANNRGIPQQRAMPQGPNMAQMPQPRSVVNQPLQQQQHQQQQQQ
FT                   QQHQQHQQQQQQQQQHQQHQQQQQQQQQHQHQQHQQQQQQQQQQRQTGQVPQPSGQEMP
FT                   NVLNRLNQIFTPAEQKALYENGKKLIEDLQRTNRLPTVLTPQQQAIYIKKYINQMALKK
FT                   LQAARMNQMGTTNPQQQMAPAPAPQGQSVPAMSQFTSNVAPSNANLAGMAQRRAYERAN
FT                   AGGASDVNSVGSSTQAQLSSGSSQQAPPAQQQPQPQPKFSLPRPTEQDLMVLRRISAEI
FT                   QKSHLRLSNITNQISQEQKQAIRNKLQLNRQLFTNVDSFIPTLYMITRNEENVRQLLQI
FT                   RMLAKEITEHATRGVFIVPPEVVDKVIFRYQKYYEFIKDQVLRRHQQIIAARQQQQQQQ
FT                   QAPSTTIDPAFNQQRIQGSFQQIQQQMQMRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
FT                   QQQQQQQQQQQQQKIQPSPQLNNWTRLNADGRSTSGADGDNAVAPQTAPEHVRRSSSGM
FT                   DFLNSPEFMNARSSPQQPGLSPAKKQAQMRKKMAMKQVPGQGTPGSTVPTSNNTPVPVS
FT                   GPVPAVASRTGTPQVGTAGISSISPMVNRATGLNQSPSPRSHPNGTLPPPADYPYKEDE
FT                   ENLKKMAIRKTEIIARFKCRQEILGKSSVDLFLCSLGDCLGLPSASVDLISPIPSEIVE
FT                   HVNGGCKGKNNGAPGQRVKGQDLTDVSIVNNSIVFADSNSPEAKAEPYVIGLNDVASVF
FT                   RDVYGSTDLSSFSFETKTFSGEGGAKKRKAGDLDNSPDASPASSAIMSESKKLKIDSPE
FT                   DMYFTAPGEDTKQLLTKSGAMKFSPENKIWDWSFWETS"
FT   gene            <242227..>243681
FT                   /locus_tag="KLTH0D02398g"
FT                   /old_locus_tag="KLTH-ORF12471"
FT   CDS_pept        242227..243681
FT                   /locus_tag="KLTH0D02398g"
FT                   /old_locus_tag="KLTH-ORF12471"
FT                   /product="KLTH0D02398p"
FT                   /note="similar to uniprot|Q08220 Saccharomyces cerevisiae
FT                   YOL049W GSH2 Glutathione synthetase catalyzes the ATP-
FT                   dependent synthesis of glutathione (GSH) from gamma-
FT                   glutamylcysteine and glycine induced by oxidative stress
FT                   and heat shock"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22391"
FT                   /db_xref="GOA:C5DG49"
FT                   /db_xref="InterPro:IPR004887"
FT                   /db_xref="InterPro:IPR005615"
FT                   /db_xref="InterPro:IPR014042"
FT                   /db_xref="InterPro:IPR014049"
FT                   /db_xref="InterPro:IPR014709"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR037013"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG49"
FT                   /protein_id="CAR22391.1"
FT                   /translation="MVGEYPKFPQFSRSEISEQLVPEIRHWALTNGLVMYPPNPNFVQG
FT                   AVAPTTLYPTPFPRQSFDQAISVQTLYNGLYAKIAQDQDGWLSKEIESLAEFDPEFTGR
FT                   LWNLYVQAKEKGISQKLALGVFRSDYLLDVGNLEVKQVEFNTVSVSFGGLSTRVGQLHK
FT                   FLNDSGRYSGGSGRPFYREEIPVSDSAFLLAKSLADAAHHFQASNDTTIVAFVVQKGER
FT                   NVFDQRILEYNLFEHFGIKSVRLTIHEVNTKTFVDPDTSRIYYKPSGEEISVVYFRAGY
FT                   SPSDFVEEQDWQNRLTLETSYAIKAPNLLTQLAGAKKIQQLLTDESILQCFISDASARR
FT                   KLGSSFVKIHPMDNSEAGLSARKLALKSPERFVLKPQREGGGNNIYKGDIPAFLRSIPE
FT                   QDWSGYILMELIKPKPTTENFVVKADQFAQEPILSELGIFGYVLFDESTIYLNEYAGWL
FT                   LRSKSSSSDEGGVAAGFGCVDSVVLY"
FT   gene            complement(<243691..>244697)
FT                   /locus_tag="KLTH0D02420g"
FT                   /old_locus_tag="Klth0D.mRNA.2881.m"
FT   CDS_pept        complement(join(243691..244410,244482..244697))
FT                   /locus_tag="KLTH0D02420g"
FT                   /old_locus_tag="Klth0D.mRNA.2881.m"
FT                   /product="KLTH0D02420p"
FT                   /note="similar to uniprot|Q870H5 Saccharomyces cerevisiae
FT                   YOL048C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22392"
FT                   /db_xref="GOA:C5DG50"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG50"
FT                   /protein_id="CAR22392.1"
FT                   /translation="MSDAHLVAPLNNNSATAATTAPAEAEVHLVKRLRRETFVQALAVK
FT                   LRRRVSYVRKNFLFGLFVDQTYVYPVLGFLRFVVTPSFWLYSFVLAFCFAFIFVTVAVL
FT                   YYLFLLPILLIWAVSTLGPVGFVIVHIQWLLQSNALAITLTNILIAPIFADSIFDATLT
FT                   KLGHAEFLERAKHLPVTSPKQASWRSLEFWLVVFPSKTVSLMFSLSSKVALSMLSLIPI
FT                   VGPTIVNQLLSPTRGFSYGKRFYVLKNLSGSQLKDKFYEHLGQYTAFGMMAGLLELIPI
FT                   MSIITIPSNVIAGALWASNELKKGEMSINA"
FT   gene            complement(<244834..>245499)
FT                   /locus_tag="KLTH0D02442g"
FT                   /old_locus_tag="KLTH-ORF12468"
FT   CDS_pept        complement(244834..245499)
FT                   /locus_tag="KLTH0D02442g"
FT                   /old_locus_tag="KLTH-ORF12468"
FT                   /product="KLTH0D02442p"
FT                   /note="some similarities with uniprot|P31379 Saccharomyces
FT                   cerevisiae YAL018C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22393"
FT                   /db_xref="GOA:C5DG51"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG51"
FT                   /protein_id="CAR22393.1"
FT                   /translation="MIIFLIYVSKFLLFTLLYYFTLFPFVLGISTVLFGPLGITIAVVH
FT                   SMLHVNLYATSVTRVGCLGHAAAILEKLFTDKGTPKENIRRLHQPAYPVVLEKRNWTQS
FT                   LSIFAAKTMAHFIIFSVLLCISLIPIIGIVLAKLLRSAPIGYDYYLIHLARRKALEKRG
FT                   RDEFYREIGKFTAFGIVSGALELIPILSGITITSNFLGSGICVLEQSQSFENSSLSSI"
FT   gene            complement(<246019..>247056)
FT                   /locus_tag="KLTH0D02464g"
FT                   /old_locus_tag="KLTH.mRNA.269AT.m"
FT   CDS_pept        complement(join(246019..246765,246832..247056))
FT                   /locus_tag="KLTH0D02464g"
FT                   /old_locus_tag="KLTH.mRNA.269AT.m"
FT                   /product="KLTH0D02464p"
FT                   /note="similar to uniprot|P31379 Saccharomyces cerevisiae
FT                   YAL018C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22394"
FT                   /db_xref="GOA:C5DG52"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG52"
FT                   /protein_id="CAR22394.1"
FT                   /translation="MSFTGSLVLSGIGGLVFKYGGQQSEKEKDVPTGFRDLTLGFIEAK
FT                   GKLIRERSEAVTINFWRELVQTGAYQYPIRGISELFSSGIYFFSSARCFGFYLVLYLTT
FT                   ALLYFLTILPMYLACFAFLGPLGLAVAYVQFLLQSNMLAMMVMRTTQLNNPLFDECLIK
FT                   NGKEAFVKTALQKPTLPVRFYVPFNTYYFWLNYLPWRIAVYTLGFLSIVALLSISFIPI
FT                   AGPIIFNALISPFIARIYFSRFLRLKKLDNKQRNDEFYLNFGTYVSFGFVAGQLEVLPF
FT                   VSGFTYSSNMVGSGLFAIKTLDSESLVPVTLESHLENARTFS"
FT   gene            <247566..>251237
FT                   /locus_tag="KLTH0D02486g"
FT                   /old_locus_tag="KLTH-ORF12464"
FT   CDS_pept        247566..251237
FT                   /locus_tag="KLTH0D02486g"
FT                   /old_locus_tag="KLTH-ORF12464"
FT                   /product="KLTH0D02486p"
FT                   /note="similar to uniprot|P31374 Saccharomyces cerevisiae
FT                   YAL017W PSK1 One of two (see also PSK2) PAS domain
FT                   containing S/T protein kinases coordinately regulates
FT                   protein synthesis and carbohydrate metabolism and storage
FT                   in response to a unknown metabolite that reflects
FT                   nutritional status"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22395"
FT                   /db_xref="GOA:C5DG53"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG53"
FT                   /protein_id="CAR22395.1"
FT                   /translation="MPCTSPPLSPTKNEQVEREAVRMAAQNKVKADETDEKQHANNSGG
FT                   MGDYKPTGALGGAANLGPLSTQPLSSSDSDVRELLTFPNESTHAYSYNPLSPNSLAVRL
FT                   RILKRSLEIMIRNPTLLQENRSGRHLRVETPNGTQKEFRFSTDSAISPKKRPQFSRSYS
FT                   HEGVTPLSTSKLRNASSAALSALVTNAKGPSVAELSESSQPWTRPIAPFHSSQTSPRSA
FT                   AGRFASPYQRVASAEGPSRAQRRSLDANADPNSMPQMNEVEPFYKTGNNTSAELIDAKR
FT                   SELESLLLLLNETLENNSSEKASDLHMISLLNFNKLSLDMDHEEKDKDDASQHSSRYEQ
FT                   TLKRSLLESLAQPFFESSNTASTAGFDESGTLQGQDSFILPDSSFADMRTAPVSNRLLH
FT                   TFVSSKNSSPQAIFTCLQQYPWQFKSANDLACLTFGISQNALKALTLLDLIHTDSRNFV
FT                   LHKIMSTEGQELVFTGEIVAIVQPGESSNDLVWSSVWAKRRDGMIFCVFEKVPCDFMDV
FT                   LLDLDDFSVEHISGGAGLKGLKQQTSNRGNQFSSVEKEKGGKKTVKFPNEVHDVADISI
FT                   SLKKLIEDVESGKVRSVDDDLLPMSIRVSNTINNVRYFTLNHLSLNIPCAISSSILENE
FT                   MKLKIHSLPYQAGIFILDSNNFSMISFNKSISKNMFGMHASELVGQSICKVIPSFAELV
FT                   SFIKIKYPALDITLQKNRGLVLTEHFFRKMQAEMSNNTESFFESIGIDAIHRDGSVLKV
FT                   DIQLRVINSSNSLLWITHSRDVVFENYKTNPSQLLMLKESEVALVGSGTSSRSSMKAPS
FT                   GTIHVDDLPNLKDSLKLDGSTVGSFDSASGDSRDNMEEPPDTPTEDKKQQDSDKLEMHK
FT                   LGDQISAKFDVAKNYVQDKASFVKDKNFKLDENLIMSLKSLSPNKGNGSLASTSPPVPN
FT                   SSSEEAGGQGEVFLSTPEPNIGSLKHVKKFSEFEVLQKMGEGAYGKVDLCLHKKDRYIV
FT                   VIKLIFKERILVDTWVRDRKLGTIPSEIQIMATLNTKPHENILMLLDFFEDDEYYYIET
FT                   PIHGTSGSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLHDNGIVHRDIKDENVIVDS
FT                   NGFVKIIDFGSAAYVKSGPFDVFVGTIDYAAPEVLGGEPYEGKPQDIWAIGVLLYTIIF
FT                   KENPFYNIDEILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKINDDKWLEL"
FT   gene            <252131..>253195
FT                   /locus_tag="KLTH0D02508g"
FT                   /old_locus_tag="KLTH-ORF12462"
FT   CDS_pept        252131..253195
FT                   /locus_tag="KLTH0D02508g"
FT                   /old_locus_tag="KLTH-ORF12462"
FT                   /product="KLTH0D02508p"
FT                   /note="some similarities with uniprot|Q08215 Saccharomyces
FT                   cerevisiae YOL044W PEX15 Phosphorylated tail- anchored type
FT                   II integral peroxisomal membrane protein required for
FT                   peroxisome biogenesis cells lacking Pex15p mislocalize
FT                   peroxisomal matrix proteins to cytosol overexpression
FT                   results in impaired peroxisome assembly"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22396"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG54"
FT                   /protein_id="CAR22396.1"
FT                   /translation="MSSPQVSSTKLLEELLENKAFQPDSHKALESETENQLQDCLNAFL
FT                   KGDCKGCLEKMFQAGLLRGEYLENDPKLWKLYLSACSQIKFDVLEVSLSKVGRSNFSKA
FT                   DVSRAQRILAQEPLCEQMAGVLMYLTCCYKCARADNSMEAMKNLEMASGDYIRKCSECS
FT                   EHSGDTREANQVLELVWFYMFSLQGGRSHKRMSRILYEQLCKSAPAVPRVLQAPSKTNP
FT                   AVTLENQLISRIEALAPEKPNIVQPLQQRKLKPTNSHPFSSDRTSEAIPVLAPVPTIIK
FT                   PDKAASINTSKFKALITRLQPFLNSKSIPVLVFVLLLSLKKAQKVAGLPNKLAHILNVI
FT                   LRRLGGIINIILSI"
FT   gene            <253509..>255377
FT                   /locus_tag="KLTH0D02530g"
FT                   /old_locus_tag="KLTH-ORF12461"
FT   CDS_pept        253509..255377
FT                   /locus_tag="KLTH0D02530g"
FT                   /old_locus_tag="KLTH-ORF12461"
FT                   /product="KLTH0D02530p"
FT                   /note="highly similar to uniprot|P31383 Saccharomyces
FT                   cerevisiae YAL016W TPD3 protein phosphatase 2A regulatory
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22397"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG55"
FT                   /protein_id="CAR22397.1"
FT                   /translation="MSGNKQAKNKSGDKDDNGQNSEDLYPLALLMDELKHDDIANRVEA
FT                   MKKLDTIALALGPQRTRDELVPFLTEVAQDDEDEVFAVLAEQLGKFVPFIGGAKFATLL
FT                   LPALEILASTEETLVRDKAVESLNNIAQELSEEQLFHDFIPLIEHLATAEWFSSKVSSC
FT                   GLFKSVLARVKDDKFRKELLALYLQLVQDDTPMVRRAAGKNLPVLIDLLTQNPDLSTSE
FT                   DWDYISSMFQKIVSDTQDSVKFLAVDILVSILKFFNTKHDTTHSKDLLRSAIQLITDEA
FT                   WRVRYMAADRFDDLASQFKSNPEYIEELSGPFLALCEDNESDVRKGVAKQLPGFSKLLG
FT                   DPQVVLKKVLPAVQNLSMDESEIVRASLASEITNLAPLIPKQDAIDSLIPILLNMLKDE
FT                   YPDVRLNIIAKLKVVNEVVGIDLLSESLLPAITELAKDVNWRVRMAIIDYIPLLAEQLG
FT                   VQFFDQQLGDLCLSWLWDTVYSIRSAAVVNLKNLTKIFGSEWSSSKIISRLLKSDSQLL
FT                   ENFVYRITLLSALTELVPVVSTEVTTEKILPFINHLAEDSVPNIRFNVAKSYAVVVESL
FT                   AEEKGKYKDLINKSIISSLEKLCQDSDIDVRYFASQSLEKCQNLLA"
FT   gene            complement(<255490..>256641)
FT                   /locus_tag="KLTH0D02552g"
FT                   /old_locus_tag="KLTH-ORF12456"
FT   CDS_pept        complement(255490..256641)
FT                   /locus_tag="KLTH0D02552g"
FT                   /old_locus_tag="KLTH-ORF12456"
FT                   /product="KLTH0D02552p"
FT                   /note="similar to uniprot|Q08214 Saccharomyces cerevisiae
FT                   YOL043C NTG2 DNA N-glycosylase and apurinic/apyrimidinic
FT                   (AP) lyase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22398"
FT                   /db_xref="GOA:C5DG56"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR030841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG56"
FT                   /protein_id="CAR22398.1"
FT                   /translation="MVMRTRRAKRARVEVEYEGGEESKYFKKEKPAAEVVPERPKPGPP
FT                   EDSKVDVEMVKKMGSDTYYDWVNARTKDEITYAPLKDEPHFPRNFVPIYSKIRLMRSKI
FT                   ETPVDHVGCAMIPMTVGHEFGIEQEQITPRTYRFQLLIALMLSSQTKDEVNAKAMFNLV
FT                   EYCKEELGEPEGVTLDAMFKIDQETIAQLIYPVSFYTRKALYIKKTIELLRDNFDGDMP
FT                   PDIAGLVSLPGVGPKMGYLALQKAWGKVDGIGVDVHVDRLCKMWKWVDPSKAKSPEHTR
FT                   KLLEEWLPYEYWYEINPVLVGFGQVICLPRGKRCDLCMASDVCNAADQKLLQKVRNPKE
FT                   ERKSRGNVSEWVKYMEKSTHAKEVVKEEGDVKIALDQDEIKDA"
FT   gene            <257847..>258953
FT                   /locus_tag="KLTH0D02574g"
FT                   /old_locus_tag="KLTH-ORF12453"
FT   CDS_pept        257847..258953
FT                   /locus_tag="KLTH0D02574g"
FT                   /old_locus_tag="KLTH-ORF12453"
FT                   /product="KLTH0D02574p"
FT                   /note="similar to uniprot|Q08213 Saccharomyces cerevisiae
FT                   YOL042W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22399"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG57"
FT                   /protein_id="CAR22399.1"
FT                   /translation="MFTRKLLPVSNSALKPSLPEIRNSVSRSTFTLMTYNMLSPYYMWP
FT                   QVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDYEGFWKNHFKTKMNYGS
FT                   SYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYLNDLIGLFNISELNYLKSTI
FT                   ITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLFVVVNTHLYWKYDEVKLCQ
FT                   CLTIMRKLHRVIKSLLMGMEGVTYSKVKILFAGDLNSAPDSPVIKFLKGESVHRADLSL
FT                   INPLRPYLNRYIYQDTSADLFEHTCYSGKLKGIFDYIWYHDKDFRLKRILSGAEVSQEL
FT                   RELQEFGLPNKDHPSDHIPVLAELELLD"
FT   gene            <259063..>259707
FT                   /locus_tag="KLTH0D02596g"
FT                   /old_locus_tag="KLTH-ORF12451"
FT   CDS_pept        259063..259707
FT                   /locus_tag="KLTH0D02596g"
FT                   /old_locus_tag="KLTH-ORF12451"
FT                   /product="KLTH0D02596p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22400"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG58"
FT                   /protein_id="CAR22400.1"
FT                   /translation="MKRIQIITTHKHSYQKRAATEMLGMGLNLQTNVTHANNDKQTVSL
FT                   QDAPHRLLQQHQETILRDARIRLNSKKSFMDDEFYLPEMTPFGVSRIPSENGRGFASPA
FT                   NMRAVPKSGYPLAQTHKKAKENSLKAMQASEANGRALEQQFYQNQLAAAVQQQQQQQQQ
FT                   QQQQQQQQQQQQQHHQQQIHQHNPYLTNNGFRGYSMQQEACVMDGPRNWQH"
FT   gene            complement(<260346..>261161)
FT                   /locus_tag="KLTH0D02618g"
FT                   /old_locus_tag="KLTH-ORF12449"
FT   CDS_pept        complement(260346..261161)
FT                   /locus_tag="KLTH0D02618g"
FT                   /old_locus_tag="KLTH-ORF12449"
FT                   /product="KLTH0D02618p"
FT                   /note="similar to uniprot|P31377 Saccharomyces cerevisiae
FT                   YAL014C SYN8 Endosomal SNARE related to mammalian syntaxin
FT                   8"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22401"
FT                   /db_xref="GOA:C5DG59"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG59"
FT                   /protein_id="CAR22401.1"
FT                   /translation="MEVLKISYGVEKLQGLVDERRRLVSVLKMKPSTNDTINMKRQMNA
FT                   VLDSLQAAANAATSEDFVQLNALIEKYNDAVADIPDDSLDKELYKFASIDKPPETAISK
FT                   LPEPKKVRFKDDVLEYDESTQDAPTAFAPYSDDVSDEERLEHDKTRLFQTGSSESTGLD
FT                   GLAVAPQLSNQELFIQQQQQLLEQDSHLDNLSRSVHSSHVLSLDIHHEVADQNDGVLQD
FT                   LESLVNNSGRNLDRAKKRLRIFENTARENGPCFIIVVLFVILIVLLIIL"
FT   gene            complement(<261313..>262701)
FT                   /locus_tag="KLTH0D02640g"
FT                   /old_locus_tag="KLTH-ORF12447"
FT   CDS_pept        complement(261313..262701)
FT                   /locus_tag="KLTH0D02640g"
FT                   /old_locus_tag="KLTH-ORF12447"
FT                   /product="KLTH0D02640p"
FT                   /note="similar to uniprot|Q08208 Saccharomyces cerevisiae
FT                   YOL041C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22402"
FT                   /db_xref="GOA:C5DG60"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034777"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG60"
FT                   /protein_id="CAR22402.1"
FT                   /translation="MGSIDKLFGPAASKVESGLSKLFGSSAGPVDVAKVKSKIRTVLPG
FT                   VEPEAKPETKEASAEASTEQGSQGEGESGSEEGAKPAKRGLEAEEAPAQPKKLSKRQKR
FT                   KALDADNENLESEYYSKLLEKEQGEAEETSAAEPESKDGEAEASVQATAASASRKDLKE
FT                   EELQKAERTVFVGNVPVDVVTSKPLKKQFKKLFAVAKKHSGGDDSDEDKATGPDTFAVE
FT                   SIRFRSISFEEALPRKVAFVQQKLHKSRDSANAYVVYAEKAAVKAACQTLNGTVFYDHH
FT                   LRVDSVAHPAQHDNKRSVFVGNLDFEEAEENLWKHFEKSGEIEYVRVVRDSKTNMGKGF
FT                   AYVQFRDFQDINKALLLNDQKLNGTGRKLRVTRCKNMKKTQPSSQKHPKALTDDQRTKL
FT                   GRAKKVLGKADRSTVGKDVTIEGLRATKGASTPILKKKKQRSKSGRVTKRSTAFKKANA
FT                   SNSR"
FT   gene            <263089..>265008
FT                   /locus_tag="KLTH0D02662g"
FT                   /old_locus_tag="KLTH-ORF12436"
FT   CDS_pept        263089..265008
FT                   /locus_tag="KLTH0D02662g"
FT                   /old_locus_tag="KLTH-ORF12436"
FT                   /product="KLTH0D02662p"
FT                   /note="some similarities with uniprot|P31385 Saccharomyces
FT                   cerevisiae YAL013W DEP1 Transcriptional modulator involved
FT                   in the regulation of structural genes involved in
FT                   phospholipid biosynthesis also participates in regulation
FT                   of metabolically unrelated genes as well as maintenance of
FT                   mating efficiency and sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22403"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG61"
FT                   /protein_id="CAR22403.1"
FT                   /translation="MLTKTADENRLTKENLALVDAASATEDRKKSSNEDDKSSVLSKID
FT                   SKHSGDLDLSEYCVSSDAETEKMDEESVSQRNSEHPVLSELAGASAPGDAGAAESGETN
FT                   GAAAGNAAVESTPKAPEQHSPREEAAAPAVEEPTVSAVNEGVAAAAAAAAVDPPNEPEK
FT                   AIMTAAPAEQPVDITGSGSLGEPPAAGGPSTEVAVSEPTITEPAAEPAAEPVAEPAAIE
FT                   EQAAVPEQILQEAVPPVESPVVDPLKPSSPVPPSEEPLGPSSVVGPAEVASKQSGPVEP
FT                   VEDTLGLAQGDAAPTKRAHEDEEDHDAHFKKPRPPAHELKHVENNNYDDNDNDNDNDND
FT                   NDNDNDADEDEDEVEEDYQDKTDGAEVLAAAAAGASAAGGPSKVGTGAKKPVPSIKGDG
FT                   NSPMEQETLRMNALREITDIEHQFAELRQRLFESKLAKLQTETQMCLEGSHPALQSYYQ
FT                   KIDSVRDYKLRRAYQRQKYELECIDKETKATRCFIHQDFYRKVADLKHELLVSTTQKWY
FT                   DINKERREMDVVVSDVGYHVPVKIDGKTLSCITGYAAPAQPRREGDPLAEDLQCEGIRF
FT                   RFKNNPVDKLEVIVDRMRFNNELSDLEGLRQFFQGFPGAPGLSGLKDSEIYEDLQSAGR
FT                   PGRA"
FT   gene            complement(<265105..>265533)
FT                   /locus_tag="KLTH0D02684g"
FT                   /old_locus_tag="KLTH-ORF12431"
FT   CDS_pept        complement(265105..265533)
FT                   /locus_tag="KLTH0D02684g"
FT                   /old_locus_tag="KLTH-ORF12431"
FT                   /product="KLTH0D02684p"
FT                   /note="highly similar to uniprot|Q01855 Saccharomyces
FT                   cerevisiae YOL040C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22404"
FT                   /db_xref="GOA:C5DG62"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG62"
FT                   /protein_id="CAR22404.1"
FT                   /translation="MSTAAAPRKRSFKSYSYKGVDLEKMLEMPTEEFVKLAPARVRRRF
FT                   ARGLSSKPAGLMKKLRAAKLAAPENERPAVVKTHLRNMIVVPEMIGSVVGVYNGKVFNQ
FT                   VEVKPEMVGHYLGEFSITYTPVRHGRAGATTSRFIPLR"
FT   gene            <266107..>266430
FT                   /locus_tag="KLTH0D02706g"
FT                   /old_locus_tag="KLTH-ORF12427"
FT   CDS_pept        266107..266430
FT                   /locus_tag="KLTH0D02706g"
FT                   /old_locus_tag="KLTH-ORF12427"
FT                   /product="KLTH0D02706p"
FT                   /note="similar to uniprot|P02400 Saccharomyces cerevisiae
FT                   YDR382W RPP2B Ribosomal protein P2 beta a component of the
FT                   ribosomal stalk which is involved in the interaction
FT                   between translational elongation factors and the ribosome
FT                   regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the
FT                   cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02706g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22405"
FT                   /db_xref="GOA:C5DG63"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG63"
FT                   /protein_id="CAR22405.1"
FT                   /translation="MKYLAAYLLLNAAGNSAPSAENVKTVLESVGIEVEEDKVSSLVSS
FT                   LEGKSVEELVAEGNEKLSAVPAASGSGAPAAGAAAGGEAAEEDAPEEAAEESDDDMGFG
FT                   LFD"
FT   gene            <267019..>268197
FT                   /locus_tag="KLTH0D02728g"
FT                   /old_locus_tag="KLTH-ORF12424"
FT   CDS_pept        267019..268197
FT                   /locus_tag="KLTH0D02728g"
FT                   /old_locus_tag="KLTH-ORF12424"
FT                   /product="KLTH0D02728p"
FT                   /note="highly similar to uniprot|P31373 Saccharomyces
FT                   cerevisiae YAL012W CYS3 Cystathionine gamma-lyase catalyzes
FT                   one of the two reactions involved in the transsulfuration
FT                   pathway that yields cysteine from homocysteine with the
FT                   intermediary formation of cystathionine"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22406"
FT                   /db_xref="GOA:C5DG64"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG64"
FT                   /protein_id="CAR22406.1"
FT                   /translation="MTVLPSDKFATLAIHAGAHTDVHGSVIEPISLSTTFKQSAPAQPI
FT                   GAYEYSRSQNPNRANLEAAVAALERAQFGLAFSSGSATTAVVLQSLPTDSHAISIGDVY
FT                   GGTHRYFTQVAHAHGVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVAD
FT                   AAHAANPDILVVVDNTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPL
FT                   YERLRFLQNAIGAVPSPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFLEASDRVEHVNY
FT                   PGLSSHPAYAVVQKQHRDALGGGMISFRIKGGAGAAARFTSTTRLFTLAESLGGIESLV
FT                   EVPAVMTHGGIPREQREASGVFDNLIRLSVGIEDIDDLLEDVRQALEKAGAQ"
FT   gene            <268438..>269559
FT                   /locus_tag="KLTH0D02750g"
FT                   /old_locus_tag="KLTH-ORF12412"
FT   CDS_pept        268438..269559
FT                   /locus_tag="KLTH0D02750g"
FT                   /old_locus_tag="KLTH-ORF12412"
FT                   /product="KLTH0D02750p"
FT                   /note="similar to uniprot|Q6B1H9 Saccharomyces cerevisiae
FT                   YOL031C SIL1 ER-localized protein required for protein
FT                   translocation into the ER interacts with the ATPase domain
FT                   of the Kar2p chaperone suggesting some role in modulating
FT                   its activity homolog of Yarrowia lipolytica SLS1 GrpE-like
FT                   protein in the ER"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22407"
FT                   /db_xref="GOA:C5DG65"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR031884"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG65"
FT                   /protein_id="CAR22407.1"
FT                   /translation="MRWLLLAVPALANQLVTLAPEPQLTTSVAPAVSAASLEPSAQAAS
FT                   IFEPKPFWQPILPSQHIPAGLEVRMNLESGLREARLPQEDQDQSYEFSSQFDHARELAH
FT                   SGDFAATDAALDDLLEFSHDYRYGYKIIGHEFPWLAQLLCDSQTPVSTKKICLSMLAAC
FT                   LRNNPPAVELVHQADPHFVSAVFTEMRALAQLPATSDRAVLAKRYLSVVQALAPESSPQ
FT                   IDQDVLLELCRWGDQHVRMKALDIAALLYRDAQPGGSQALAKRSQDTHDVQKWVDEFSS
FT                   GIQQEHVDELHIRNFFNSLYNIKQQMGRNVKVSSGFLDWLSKEAAARKESLGSGLHERD
FT                   PDQLEFDRRLVESRHLVFGNPMAHRAKHFDDEL"
FT   gene            complement(<269632..>270336)
FT                   /locus_tag="KLTH0D02772g"
FT                   /old_locus_tag="KLTH-ORF12407"
FT   CDS_pept        complement(269632..270336)
FT                   /locus_tag="KLTH0D02772g"
FT                   /old_locus_tag="KLTH-ORF12407"
FT                   /product="KLTH0D02772p"
FT                   /note="similar to uniprot|Q08202 Saccharomyces cerevisiae
FT                   YOL032W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22408"
FT                   /db_xref="InterPro:IPR008493"
FT                   /db_xref="InterPro:IPR031318"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG66"
FT                   /protein_id="CAR22408.1"
FT                   /translation="MFAAIASGNPLQLSTEVPNSGGLQHTIVLSSTKPKSYSHISLFIL
FT                   PNVTFPSEFAGTVYFKLSPTEEFKLFGYLSAEKPSAIFKVKLPNANMNSAADPGDGLGE
FT                   IDMEDDTPGGGLPSSNISELIIGISIEPKDQAILKLQESKAKQTALQGSSSLVLARSGT
FT                   NSIATPGQLARVYPLLTQQLAAKIVQHAYNYLTGFLDPQGNVSIKRFDTWWDKFKARLE
FT                   NDAQFLDEVTQD"
FT   gene            complement(<270516..>272156)
FT                   /locus_tag="KLTH0D02794g"
FT                   /old_locus_tag="KLTH-ORF12404"
FT   CDS_pept        complement(270516..272156)
FT                   /locus_tag="KLTH0D02794g"
FT                   /old_locus_tag="KLTH-ORF12404"
FT                   /product="KLTH0D02794p"
FT                   /note="similar to uniprot|P48525 Saccharomyces cerevisiae
FT                   YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase encoded
FT                   by a nuclear gene"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22409"
FT                   /db_xref="GOA:C5DG67"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG67"
FT                   /protein_id="CAR22409.1"
FT                   /translation="MIDGMRFILARRWNSVLSRPNRLFTSKKSILSKKPVKDIQPKTPA
FT                   RTRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLS
FT                   WCGIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTNKLLDSGHAYRCFCTKERLDGLRESA
FT                   QKLQPPTTASYDRHCSHLSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQPQ
FT                   VNPNDRRYDDPILVKSDALPTYHFANVVDDHLMDITHVVRGEEWLPSTPKHIALYHAFG
FT                   WNPPEFIHIPLLTSVTDKKLSKRRGDADVMALRAKGVLPEALVNFSVLFGWSPPREEAA
FT                   KNHECFSLPDLVRLFNLNSLTKGNAKVDEKKLWFFNKHYLTLRLQNPEVLDKMANELLG
FT                   SMQSLYPSVTVSQIRRALGLVGASLNTPNELATDFPYLFSKPQYERNQYVREFIQKQDL
FT                   YQIRALLQKMEGKMSTENSVLTVIERLSRDNGIRKNVVFEAARFALTGSVPGVKLPLLI
FT                   EFLGAEEANLRISEALDKLDSVLCLKGEE"
FT   gene            complement(<272310..>275594)
FT                   /locus_tag="KLTH0D02816g"
FT                   /old_locus_tag="KLTH-ORF12403"
FT   CDS_pept        complement(272310..275594)
FT                   /locus_tag="KLTH0D02816g"
FT                   /old_locus_tag="KLTH-ORF12403"
FT                   /product="KLTH0D02816p"
FT                   /note="similar to uniprot|Q08204 Saccharomyces cerevisiae
FT                   YOL034W SMC5 Structural maintenance of chromosomes (SMC)
FT                   protein interacts with Rhc18p and Nse1p to form a large
FT                   complex S. pombe homolog forms a heterodimer with S. pombe
FT                   Rad18p that is involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22410"
FT                   /db_xref="GOA:C5DG68"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027131"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG68"
FT                   /protein_id="CAR22410.1"
FT                   /translation="MLSSGEERHKYDPNALPRTHNEEDGAPSSKRLKLGEDDLALFRAG
FT                   SIVTLRLENFVTYALTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSTKI
FT                   EDYIKNGEDRSVIEVTLKRDPEAEDRYVASDGTTKVTRVLHRNRKASEYFLNGQSVTES
FT                   AVKRLVSELNIQLDNLCQFLSQERVEEFARLKSDKLLVETARSVDVNMVADLEDLKALQ
FT                   GEELVEAKELELKSSRVLELKATRDKLTASVRALENFKKKKEELGMHEKLLPYVQVKDH
FT                   KVRIKQYKREYEKMRKQLKDLISDKKPFRHTQQLIETETVERNENKKKLEVQLKVSKRT
FT                   FPSYLEKLEHLKEKVRGKQAQLKYYEDRTGKIKDEIVVVEHNLKEEQAKREALPVPDQG
FT                   AFERIQAERKEITDKGVELEQQRTDLNANLVNADYHMDILKRKLQQENESLVSTDRIGI
FT                   LDGKRFEELRNAVLFMRSRPEMQGKVLEPPIMSISVKDPQFASYLGTCTDFATSLALTV
FT                   VDSDSYRTFGDELLNKFRVNIRELSAAPTTSPLPLSELRKLGFQGYLSDFLSGDNGVLK
FT                   MLCQQHKLHTIPVSRTAMSSRLMDYLMKPDESNNLKFRRVIAGNYVYDFKRSAYGRRQI
FT                   FSSEFKVRPCQFFKGSVLTEERKGEIKESMARINGQIQAKKDEVQFITQKIQELRSELQ
FT                   SNKQEDAELHKITSKLNDQKKTIAHCSHRIKALENKLSMLKTDLQQDVTTKINDCRESI
FT                   KSSLREQVKVMSGITQFVAKLQGLQREISLATIEHLEAFNTERSMNEVIGFFNEKEEQL
FT                   RGAYEEAKNKYASMKETDEYRGWMDKIRHYTDAEKTQLADLAEKYQQSNNFDLSFISNT
FT                   IDRLRSEIGMLNQDESVLEIMRQTEAELGELDCVVPRKEAALLEIRRTIQEKRSQLEPK
FT                   LDAIVEKISQNFCALFKNVGSAGAVRLDKPEQFSDWKIEIMVKFRDNATLKRLDSHTQS
FT                   GGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL
FT                   VTPKLLTQLHYHEKVRIHCVMAGAWIPDPIVDHDKIRFGQTSNYVF"
FT   gene            <275812..>277566
FT                   /locus_tag="KLTH0D02838g"
FT                   /old_locus_tag="KLTH-ORF12400"
FT   CDS_pept        275812..277566
FT                   /locus_tag="KLTH0D02838g"
FT                   /old_locus_tag="KLTH-ORF12400"
FT                   /product="KLTH0D02838p"
FT                   /note="weakly similar to uniprot|P31376 Saccharomyces
FT                   cerevisiae YAL011W SWC3 Protein of unknown function
FT                   component of the Swr1p complex that incorporates Htz1p into
FT                   chromatin required for formation of nuclear- associated
FT                   array of smooth endoplasmic reticulum known as karmellae"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22411"
FT                   /db_xref="GOA:C5DG69"
FT                   /db_xref="InterPro:IPR037651"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG69"
FT                   /protein_id="CAR22411.1"
FT                   /translation="MSRSSRLRTRTVGAERSRSSKRGKSEEELDTYGLVEENGGRPFQL
FT                   IEGLPCSIELPQYASTLTHPLSVKDSAVLYSSMLSSRRTWISSEMFDMLWSKQYLSPSE
FT                   KERLEQEGIDPESVDASAAREKMHKLCDCAMAGGPHAFSVRLFILKNDEIEKKWNDAIE
FT                   QKRRNKADRKNRELEEKKKKQEERKQQQWIKKQEKEHGTSTAADSSRNSGSTDGAKKPV
FT                   KRRSRKEDTTQQRSRSHTPRQRKSVPQSTEDQKMITNLNLMAQKNPELNSLMIVVAGGR
FT                   ASTDQVEEFKKYIEKARKMPVPPGWKPTANASSSTPQKLKSGGSDSSLDRADSVAAPAR
FT                   AAKSLGASQVKSEETAQLSSETNSAGGTAEPRKKRKYTKRKNVDTPVEPEDKSMQLTTF
FT                   QQKYMHNADIVFEYVENPNKRFSLPKDAILEPLEDGESYLMSWILIHNRKELEKYKEKR
FT                   KKTLDKKAKPEKTAEVSTEDSANKEEEDDYDIFEDPKAPDPLFTPMTVKFSNIHKKFQP
FT                   IMTNSVNPAEKVRKRMSNIIERGTRLSGYNLWFQLDAYDDSGFAESLRCDLKDYESGFR
FT                   SKRHRKQL"
FT   gene            complement(<277582..>278958)
FT                   /locus_tag="KLTH0D02860g"
FT                   /old_locus_tag="KLTH-ORF12396"
FT   CDS_pept        complement(277582..278958)
FT                   /locus_tag="KLTH0D02860g"
FT                   /old_locus_tag="KLTH-ORF12396"
FT                   /product="KLTH0D02860p"
FT                   /note="similar to uniprot|P18409 Saccharomyces cerevisiae
FT                   YAL010C MDM10 Subunit of the mitochondrial sorting and
FT                   assembly machinery (SAM complex) has a role in assembly of
FT                   the TOM complex which mediates protein import through the
FT                   outer membrane required for normal mitochondrial morphology
FT                   and inheritance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22412"
FT                   /db_xref="GOA:C5DG70"
FT                   /db_xref="InterPro:IPR027539"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DG70"
FT                   /protein_id="CAR22412.1"
FT                   /translation="MIDYMEHVLRSFEQCTGWNRDNSYENVTATSENLLSFRVPSGVKF
FT                   QVSNKSTPNTFTTFELSNNKVINGSLAYLYTNCQGLENYVSNSRDILLQEASETYRQIR
FT                   PLYPCHSLRSSSDGAKEFGPSSLWYGRMYYPTSTLEAMVVSRSSAQTQFVAKCISSLAN
FT                   ASVLTLYWQKDSGQNCQEWVASTNEGLLGYRILHNFVGSQSKLNTSLYNDSSLSVGGEL
FT                   WFGVLNTTPACSTTLRYCTHSANTGKPLTLTLSWNPLFGHVSSTYSVKTSSGATFSSKY
FT                   DFNLYSIESNLSFGCDLWRRGHTKQLDQRRTEPLDAPNTNSSVFSKERVQKKQGPKEDS
FT                   PMFYHLMAGSTSSQKLIEDLNVTFASSLQKLTKEKSTIQRFENSLIDANFASVWKLSTS
FT                   LRHKNLRVLWEGKYKGFLISAGAEFTGAPLELPSNLAGESKTPALIRPGKFGIQLQYST
FT                   "
FT   gene            <279103..>280044
FT                   /locus_tag="KLTH0D02882g"
FT                   /old_locus_tag="KLTH-ORF12395"
FT   CDS_pept        279103..280044
FT                   /locus_tag="KLTH0D02882g"
FT                   /old_locus_tag="KLTH-ORF12395"
FT                   /product="KLTH0D02882p"
FT                   /note="similar to uniprot|P18410 Saccharomyces cerevisiae
FT                   YAL009W SPO7 Integral nuclear/ER membrane protein of
FT                   unknown function required for normal nuclear envelope
FT                   morphology and sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22413"
FT                   /db_xref="GOA:C5DG71"
FT                   /db_xref="InterPro:IPR005605"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG71"
FT                   /protein_id="CAR22413.1"
FT                   /translation="MDHSLELSTDKIGKLDEPQIEPGNALGNAFPVVKIEEYQDNSDET
FT                   PIKVRRRGGKAQSKPSSPQPASLNISQGATRRRRSSSRTSSKNLKSTTDISPASMIFRN
FT                   LLILEDDLRRQAREQKILKWQFTLFLSALVGIAAAAFYELYFSQESVKGIYKVMLEFVL
FT                   IFILVTVVLFHLSGEYRRTIVIPRKFFTSTNKGIRQFNVKLVKVKSSIPDLCIDLVRWV
FT                   CRKSAVVNLLLSRKCLPARIAEDSWLLRFWTSVALRSQPRIGAVDVKLILNPRAFSAEI
FT                   REGWEIYRDEFWAREGARRRKKVNETSPRKDE"
FT   gene            <280411..>282445
FT                   /locus_tag="KLTH0D02904g"
FT                   /old_locus_tag="Klth0D.mRNA.ml.2.p"
FT   CDS_pept        join(280411..280434,280502..282445)
FT                   /locus_tag="KLTH0D02904g"
FT                   /old_locus_tag="Klth0D.mRNA.ml.2.p"
FT                   /product="KLTH0D02904p"
FT                   /note="similar to uniprot|P38903 Saccharomyces cerevisiae
FT                   YOR014W RTS1 B-type regulatory subunit of protein
FT                   phosphatase 2A (PP2A)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22414"
FT                   /db_xref="GOA:C5DG72"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG72"
FT                   /protein_id="CAR22414.1"
FT                   /translation="MMRGFKQKLIKKTTGSSSSGQKKKDKEEAKKTSSGTSSPGSASGT
FT                   SKSAAEKKSASSSSSSKHTKSKTATNNGSEKKSNPPPSSAQNDSPNAAPTSKNKLEVMG
FT                   NINQPSRSSQPTLIAAAALPPSPTTATVSLAVPGTQSSKEPTTASGIEIPRSSHSFERL
FT                   PNASKLNPEADLDLIKTPQRHSSSRFEPSRYTQITKLPHFDDVSPEEQIPLFIAKVDQC
FT                   NTIFDFGDPSFDIQGKEIKRVTLQELIEFVVTNRFAYTEEMYAHVVNMFKNNLFRPIPP
FT                   PVNPIGDVFDPDEDEPVNELAWPHMQCIYEFFLRFVESPDFNHQIAKQYIDQDFILRLL
FT                   ELFDSEDIRERDCLKTTLHRIYGKFLSLRSFIRRSINNIFLQFVYETERFNGIAELLEI
FT                   LGSIINGFALPLKEEHKVFLVRVLMPLHKVRCLSLYHPQLAYCIVQFLEKEPLLTEEVV
FT                   MGLLRYWPKINSTKEIMFLNEIEDIFEVIEPLEFIKVEVPLFVQVAKCISSSHFQVSEK
FT                   VLSYWNNEYFLNLCIENAEVILPIIFPALYELTSQLDLESQSDENGHPTSDPYVLVEQA
FT                   ISSGSWNRAIHAMAFKALKIFLETNPVLYDNCNSLYLTSVKETQRRKVEREENWHRLES
FT                   YVEKLKISGTAGGDESSPQD"
FT   gene            <282956..>283561
FT                   /locus_tag="KLTH0D02926g"
FT                   /old_locus_tag="KLTH-ORF12387"
FT   CDS_pept        282956..283561
FT                   /locus_tag="KLTH0D02926g"
FT                   /old_locus_tag="KLTH-ORF12387"
FT                   /product="KLTH0D02926p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22415"
FT                   /db_xref="GOA:C5DG73"
FT                   /db_xref="InterPro:IPR007014"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG73"
FT                   /protein_id="CAR22415.1"
FT                   /translation="MSFARPFLFQKTALGQLRKFLSPFSFGKSRLMSSGARAAKAPLYS
FT                   GFVGYKTVGFAAGTSLAMLLSTISSKNIIRSDTILDVKQRNAGLPEEIGLPGQRGKSAV
FT                   SKKVNYRELCLGSVLGLMIGVVVGKISSVLVFVTACGLLSLQWLSNRGLVDKNATWGLS
FT                   KYIVKTGRESVDLNTLIWDKPSFKVPFILTFVLAALNV"
FT   gene            <283762..>284394
FT                   /locus_tag="KLTH0D02948g"
FT                   /old_locus_tag="KLTH-ORF12386"
FT   CDS_pept        283762..284394
FT                   /locus_tag="KLTH0D02948g"
FT                   /old_locus_tag="KLTH-ORF12386"
FT                   /product="KLTH0D02948p"
FT                   /note="highly similar to uniprot|Q06102 Saccharomyces
FT                   cerevisiae YPR107C YTH1 Essential RNA-binding component of
FT                   cleavage and polyadenylation factor contains five zinc
FT                   fingers required for pre-mRNA 3'-end processing and
FT                   polyadenylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22416"
FT                   /db_xref="GOA:C5DG74"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG74"
FT                   /protein_id="CAR22416.1"
FT                   /translation="MSRIHPDTSNYPFRFEPFLRQEYSFSLDPDRPVCEFYNPREGPSS
FT                   CPNGNSCPNKHVLPIFQNKIVCKHWLRGLCKKNDQCEYLHEYNLRKMPECVFFSKNGYC
FT                   TQSPECQYLHINPSSKIQECEDYRMGFCPAGAQCKKRHIKKTMCPRYITGFCPLGRLDC
FT                   EMEHPPFVIPNELSKLRIKNDDEINTKKQDEEKERRLNAIINGEIIA"
FT   gene            complement(<284533..>285945)
FT                   /locus_tag="KLTH0D02970g"
FT                   /old_locus_tag="KLTH-ORF12384"
FT   CDS_pept        complement(284533..285945)
FT                   /locus_tag="KLTH0D02970g"
FT                   /old_locus_tag="KLTH-ORF12384"
FT                   /product="KLTH0D02970p"
FT                   /note="weakly similar to uniprot|Q06098 Saccharomyces
FT                   cerevisiae YPR106W ISR1 Predicted protein kinase
FT                   overexpression causes sensitivity to staurosporine which is
FT                   a potent inhibitor of protein kinase C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22417"
FT                   /db_xref="GOA:C5DG75"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG75"
FT                   /protein_id="CAR22417.1"
FT                   /translation="MRPRVSRWRSSAVRGEPFQRHFLRWGAISPCFPSSRAPLTSPSAL
FT                   QQHTALLPVSTRMDCGHTETPPSSPAVLALRKRRGLDSAVLSTPPAQAKQDTKLFQQQL
FT                   PSPVTPTASSGFPALSPVRPCDADPVREAVSEICSSINNNTDLVNNLSFHTSGHSAVSI
FT                   QQARALLSPIDPIHDPEWKTSSTPLGRGTYACVYDLCNASRQAAFALKVPQTSRKSSHI
FT                   YKEATILSRLQCTRAPLYAPVIPFYGLTLVNKSHHKKLRSNETVPAIVLERMNCSLKHF
FT                   YTYNTEFDNTHWRVLAESLLSGLQLLKSRSVVHGDIKTENILMDFDSDAMPRYYLADFS
FT                   SARVVFAGDTRPPSLETTLEYCAPEQMSQCANSSFETDLYSVGLTLLAAITKAEPYAEL
FT                   MAAMTHGEPGGGASLPQTQWLMSAISKNSPLEFNVLREELWVQWRNELAFLAQILQDRM
FT                   PLEHCLRSLQDI"
FT   gene            <286526..>287836
FT                   /locus_tag="KLTH0D02992g"
FT                   /old_locus_tag="KLTH-ORF12375"
FT   CDS_pept        286526..287836
FT                   /locus_tag="KLTH0D02992g"
FT                   /old_locus_tag="KLTH-ORF12375"
FT                   /product="KLTH0D02992p"
FT                   /note="highly similar to uniprot|P53252 Saccharomyces
FT                   cerevisiae YGR086C PIL1 Long chain base-responsive
FT                   inhibitor of protein kinases Phk1p and Phk2p acts along
FT                   with Lsp1p to down-regulate heat stress resistance via
FT                   regulation of the Pkc1p and Ypk1p pathways phosphorylated
FT                   by Phk1p and Phk2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22418"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR028245"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG76"
FT                   /protein_id="CAR22418.1"
FT                   /translation="MPSSALTACGTRFRADGAQRAAAAQTGAHADASRTDASGLAPRVA
FT                   KFSQSQPLNHFRNRGRGLGVYKGKPWNGPPVSPLKKRALFQSTLSVAATSQQQALQLQP
FT                   PNPMHRTYSLRNSRAPTAAQLQNPPPPPSSTKNRFFGKGGLANSFRKNTAGAFGPELAR
FT                   KLSQLVKIEKNVLRSIEVAANERRDAAKQLSIWGLENDDDVSDITDKLGVLIYEMSELD
FT                   DQFIDRYDQYRLTIKSIRDIEGSVEPSRDRKAKITDKIAYLKYKDPQSTKIEVLEQELV
FT                   RAEAESLVAEAQLSNITRSKLRAAFNYQFDSVIEHSEKLALIAGYGKALLELLDDSPVT
FT                   PGETRPAYDGYDASKQIIIDAETALNDWTLDSAQVKPSLSLRHADYDYEGEEDEDEEEV
FT                   ADHEHHWVDEDEPQHEHTTTEATETTTTNTTAAPTTA"
FT   gene            <288113..>290551
FT                   /locus_tag="KLTH0D03014g"
FT                   /old_locus_tag="KLTH-ORF12371"
FT   CDS_pept        288113..290551
FT                   /locus_tag="KLTH0D03014g"
FT                   /old_locus_tag="KLTH-ORF12371"
FT                   /product="KLTH0D03014p"
FT                   /note="similar to uniprot|Q06096 Saccharomyces cerevisiae
FT                   YPR105C COG4 component of oligomeric Golgi complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03014g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22419"
FT                   /db_xref="InterPro:IPR013167"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG77"
FT                   /protein_id="CAR22419.1"
FT                   /translation="MDALDLDKLSTNLARYHTLLSKITTVSQLTKLQSAIENEQSSTAR
FT                   QLDAFLQPSHTNTNQAVRTLELNRARLTQTLSKLHHALESVAESKQLALQVSTRIRAVD
FT                   RERQLVTRVLQFVSHVTSLRQNIFMVHQAIDRSDYKLAAAGIDTILKLPEESVYSEFAR
FT                   RVVPSAEIPEDPQDLLKQWINQLAQVFHDNFVKAAREQDITQLTAVFQLFPLIRKSDMG
FT                   LDLYSKYVCDMIATQSRKVMTSTTSKSPGFFAQALLHLFKIVSTIINEHSKIIAKYYGK
FT                   QHMVHIMAKVQREADMQAGLVLDSFFESRNFKEILQDIRAFKENVSPEEEGLTSNAPSM
FT                   SEVSGIINESSSILQNWSMYCRFFALKWREFSDQSSEDPLTLPAPICDGIFYSKIHSSG
FT                   FLSDLKKLNEFYLNRSFKKSLELEELPSLNEQISKAPLKHDDISSYGFSSIIEDLTVLI
FT                   RSCLVVNVNTGESTLLGQFLDMLVRFLQNEYLIRFLQHRLRQLQPRLTSNVVLKKYVPQ
FT                   TESTMNSRAASPGAVEQSKLSHLRFNFKGAATSAFSNIQSNLQAVYADEETVLKLHQYL
FT                   IYLNTLSIGCVFLQKLLTKELLQDNPQLLPDNFPFGDKSQSLVKKIEATEQTLLAQSSK
FT                   LLQWGVRLLFDGVLQSKIQKILGPLFTQGTETEYLASTANFEDMSHLKQFSDGWLETMN
FT                   PYINVLYKDCYAQLLTYAVDFLVAQISPRLWSLKLNELGSIKLDRELGALIAIVCGEHY
FT                   LLREKFTKLTQIVLIAGFEDDDFDSETSDLKEEVIKGISWVLNPTERIRAGELRVDRRH
FT                   "
FT   gene            <290948..>293524
FT                   /locus_tag="KLTH0D03036g"
FT                   /old_locus_tag="KLTH-ORF12369"
FT   CDS_pept        290948..293524
FT                   /locus_tag="KLTH0D03036g"
FT                   /old_locus_tag="KLTH-ORF12369"
FT                   /product="KLTH0D03036p"
FT                   /note="similar to uniprot|P39521 Saccharomyces cerevisiae
FT                   YPR104C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03036g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22420"
FT                   /db_xref="GOA:C5DG78"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG78"
FT                   /protein_id="CAR22420.1"
FT                   /translation="METSVDALTPSGPAAEDPAEERHNSDEHRSPKDEPENFGEPFAKK
FT                   PSRSNSQVAADEAAAEAKRLIDDPNLKLEIPDSLDHEHFSKLLELDSKNDDDLFSSTDL
FT                   LEHEIAEHPEKLANDIAETVPTDDATQHLHSLENLESLGKLSEEAGGDVHSNPGTESPS
FT                   KIKNENQSPSVLVDPVLADDRAIHPDIYNSDPLSTGAGTREDTPASILEDKHELLDDQK
FT                   QDASTKLGYVSLQPPLPENAVNKIEITQPIEPNSELPMTEFHDGANSETEQSKISAYAR
FT                   LDFQSFTFYVQTLQVIIGRRSENDFSHKVDVNLGPSKSISRRHAQIFYNFGTGRFELSI
FT                   MGKNGAFVDDTFVERGITVQLKNKAKVQIGQIPFQFVLPDQEGKEKKAIEPVDAISLKT
FT                   ALNNNNKLAEISRSVTPIPIPSGESTELKDEELKDQPAKKKTPPKKKEKKEPKAPKPPK
FT                   KIYTLEEIPPEYRTKPTGSYSNLITACLRKFSSPKGMSLSGIYAGIRELFPYYKYCPDG
FT                   WQSSVRHNLSLNKSFRKVSKEGKGWLWGLNEEYIAEREKQKKKQAEAAAEKAKAAQLKL
FT                   EQQQQQKAKKAAESGSMIKSVASIPARPKVKQPNISQTLAANRADRKATADANQRTMKY
FT                   LQEQLMILTKDRKGLDKHVMASILTQALAMTINQVTQAAKSKGITGNPLTALIDKNPQH
FT                   LNLILAAAVNAATVKVTNGSVKQLVSMPPPTVTAPQERRAASPSTSNIQPTSGGTSNLV
FT                   ASANPGPAATVKSSESFDPTSLSKFFQPKQPSRVPTPSPARSVLPLKRASSETESSSDD
FT                   ESTSGDESGSADSDASDGSDSDDDSSSSSGGSSKGSSSDEGSSDGE"
FT   gene            complement(<293867..>294730)
FT                   /locus_tag="KLTH0D03058g"
FT                   /old_locus_tag="KLTH-ORF12366"
FT   CDS_pept        complement(293867..294730)
FT                   /locus_tag="KLTH0D03058g"
FT                   /old_locus_tag="KLTH-ORF12366"
FT                   /product="KLTH0D03058p"
FT                   /note="highly similar to uniprot|P30656 Saccharomyces
FT                   cerevisiae YPR103W PRE2 20S proteasome beta-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22421"
FT                   /db_xref="GOA:C5DG79"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG79"
FT                   /protein_id="CAR22421.1"
FT                   /translation="MQAIAEKYSLKSTLATELEYDNEEGLSRDFVTGNSMFQRLAPQIA
FT                   MPPISSPQEFLRAHTDDSQNPDCKIKIAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQ
FT                   TVKKVIEINPFLLGTLAGGAADCQFWETWLGTQCRLHELKEKERISVAAASKILSNLVY
FT                   QYKGAGLSMGTMVCGYTKKEGPTIYYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWD
FT                   LSVEEALYLGKRSILAATHRDAYSGGSVNLYHVTEQGWVYHGNQNIETLFWEVKEKEGS
FT                   FNNVIG"
FT   gene            <295808..>297730
FT                   /locus_tag="KLTH0D03080g"
FT                   /old_locus_tag="KLTH-ORF12362"
FT   CDS_pept        295808..297730
FT                   /locus_tag="KLTH0D03080g"
FT                   /old_locus_tag="KLTH-ORF12362"
FT                   /product="KLTH0D03080p"
FT                   /note="similar to uniprot|P32581 Saccharomyces cerevisiae
FT                   YJL106W IME2 Serine/threonine protein kinase involved in
FT                   activation of meiosis associates with Ime1p and mediates
FT                   its stability activates Ndt80p IME2 expression is
FT                   positively regulated by Ime1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22422"
FT                   /db_xref="GOA:C5DG80"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG80"
FT                   /protein_id="CAR22422.1"
FT                   /translation="MGYLGRKHGLKSSTNVPPDVNNPPFYIPVRPIANRYTLMQELGNG
FT                   SFGSVTLAKLAGSEGADKDARGQHDHKRLAASTRQHYHNTLMDDAVVPSIEQENYHNKQ
FT                   RGVLAIKTMMTRLPTLNDYTRVREVKFILSMPAHKNLVQIWELFIDDINYQLHIVMECM
FT                   EQNLYQLMRARRKRVFSLPSLKSILSQILAGVRHIHAHNFFHRDLKPENILISPSSHYF
FT                   SKEWILEGHYSDNYVVKIADYGLARHITNKSPYTAYVSTRWYRSPEILLRKGLYSRPLD
FT                   IWAFGCVVVEVATFRPLFPGSDEMDQIWKILEVLGTPHTMPESTLSGYHPHGGLWEKAQ
FT                   VLASRLNLKFPYVEGVSIESIMDNPHLQPLCDVVKACLVWDPKKRATVDEIFCMPYFEE
FT                   AKPWAEPKGLNDSNTDNCPLNDENLNKGLGLRHYWSGGLNRGSRHPHGENASLAPIEVD
FT                   SNGAKIRGPKETEISFRQFLKESLLPLPMSKETSRGSDGNRLHNEAGPEDVADLPLSED
FT                   SVANISPVSSLNDAENVGVLEPPEVDDSFAAFFVSKSAEFEYPAGAEVAAGNLEPSYIH
FT                   YGDSTDDRIIPHHRCNVLDDMSVDSSGSNRVPRTFAVPRISEECNVSAQASHNHSFSHT
FT                   NSLTF"
FT   gene            <299166..>301421
FT                   /locus_tag="KLTH0D03102g"
FT                   /old_locus_tag="KLTH-ORF12356"
FT   CDS_pept        299166..301421
FT                   /locus_tag="KLTH0D03102g"
FT                   /old_locus_tag="KLTH-ORF12356"
FT                   /product="KLTH0D03102p"
FT                   /note="similar to uniprot|P36124 Saccharomyces cerevisiae
FT                   YKR029C SET3"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22423"
FT                   /db_xref="GOA:C5DG81"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG81"
FT                   /protein_id="CAR22423.1"
FT                   /translation="MGGNDISERSVYEDASALLMLSRGKDSSTNHTPLQDIKQPIGSPG
FT                   LRSSSQVHSEPRSPLTSGDVRSRASSISLIQHNSTASPGPAYATLSAEDEDGLSSRMHE
FT                   KTESPSSRSNSNKGIVAAAALAAAATVPLPLRKQDPEHRESKHNSRKSDHSEQRPKRSW
FT                   PVPNSYVVDPDSGIITCICGYDDDDGFTIQCDHCNRWQHAICHGIRNIETAPDDYLCSN
FT                   CHPRKLDVKRAKRKQQERLNPRNNKKRRKSSQGEESSGKSNSSHASDSANTSVNNLGGN
FT                   EVASSAELKPTQRHLNSLEHHPVVYVPLTANDFKDRYVEMFVERHCDDDWVLPYSHRIF
FT                   QPVPLEVKSCSESSRSFTGLPKLGLFAKQPCTVGSYIEEVVGEVDFTKKYYGDSRNNYR
FT                   VCGTAKPKVFIHPHWPIYIDCRLSGNLTRFIRRGCQPNVELVSVHLNGDAPQVKFVLRA
FT                   LKDIGDGDELQIGWQWDLRHPIWHLIKGDNKSVDSLDDPDKFTLVHSVDTILSCADCAC
FT                   GAHNRDCYLLKVKKFSQSLIKSVKSKMNGRYKLNEVLQNAQNKNKKLQTPILSRLAHEA
FT                   ISNAARANELLVDFHAAKLKYLKEEGIPVSQLISRQPSLSDTENFDHAKPFKLYLVNKH
FT                   FTTLRGGGEQENHRPSITTGTSNSLRYDESHITDLKSLPLPVELQLPRLSSMGEKALSI
FT                   RENSNGDVAPELSTKAPVTPSVALPAVAVAAGPAINSRHTLKKKLSFADYKKKMKPI"
FT   gene            <301688..>302095
FT                   /locus_tag="KLTH0D03124g"
FT                   /old_locus_tag="KLTH-ORF12350"
FT   CDS_pept        301688..302095
FT                   /locus_tag="KLTH0D03124g"
FT                   /old_locus_tag="KLTH-ORF12350"
FT                   /product="KLTH0D03124p"
FT                   /note="similar to uniprot|P42949 Saccharomyces cerevisiae
FT                   YJL104W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22424"
FT                   /db_xref="GOA:C5DG82"
FT                   /db_xref="InterPro:IPR005341"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG82"
FT                   /protein_id="CAR22424.1"
FT                   /translation="MAHRALFQVIFTGAQVFGRAFSEAYKQAAVQATKTGANAARAGAA
FT                   KAEYGGITLDESCKILNIENEADMASPEKIEERFKYLFDVNDKEKGGSFYLQSKIYRAA
FT                   ERLKYELAEKQQVDKAAEGQKGPEKPPSAEQ"
FT   gene            complement(<302961..>304298)
FT                   /locus_tag="KLTH0D03146g"
FT                   /old_locus_tag="KLTH-ORF12348"
FT   CDS_pept        complement(302961..304298)
FT                   /locus_tag="KLTH0D03146g"
FT                   /old_locus_tag="KLTH-ORF12348"
FT                   /product="KLTH0D03146p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22425"
FT                   /db_xref="GOA:C5DG83"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG83"
FT                   /protein_id="CAR22425.1"
FT                   /translation="MSSDIGKTELLAKLERLDQEINDYFDLTLDKARLRYKRVGRGNKV
FT                   KVVDKIQEKRVAVQKWRDSVKTDYETAVTKFKRAWDLLQNNPELDLCAVTDNLGNSRIF
FT                   QVHKLGAVLENVSLTNLEVSALKQHDTEFPRTLASMGASKEDYDGFLEWQVNILGRSAT
FT                   LYEQLPKVYWNSHKYQWSKNSYRICATAKNLGSYATYCKFFSKLGICTNANCKFVHDPR
FT                   NIAACKDFLASDNCKYGSKCRLSHKLGNEYVTPHCKDFAQRSCKFERGAEQWTQSREQD
FT                   SAVCCRYIHSTIVNSSYPVCRQFAHMGFCYRGLHCKFPHYLECPDSNYTSTCFLNHCKF
FT                   PHIERKVLPDERAVALIDIPSSCLLLPPAREKDHRAPNSSWYGLRTKQQSINIKDGPGE
FT                   KFTTEAVPALQLEPGSSTDDVSSSEVSSTGSSDISSDELDADFIKL"
FT   gene            <304459..>306024
FT                   /locus_tag="KLTH0D03168g"
FT                   /old_locus_tag="KLTH-ORF12347"
FT   CDS_pept        304459..306024
FT                   /locus_tag="KLTH0D03168g"
FT                   /old_locus_tag="KLTH-ORF12347"
FT                   /product="KLTH0D03168p"
FT                   /note="similar to uniprot|P36119 Saccharomyces cerevisiae
FT                   YKR023W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22426"
FT                   /db_xref="GOA:C5DG84"
FT                   /db_xref="InterPro:IPR009349"
FT                   /db_xref="InterPro:IPR039128"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG84"
FT                   /protein_id="CAR22426.1"
FT                   /translation="MGKSSAISFAVREIPHIIPIDEESARQLCEQILSEYGEDPQAIAE
FT                   KFMDILGPEDASLNFVLQFTEKLSHEESEKASKSALSPKPSTKNDTFASRSGRQGVNKP
FT                   ESAELRKSEEPSGVPAAPKANAPRKAVVRPSTRPNPKESSKKASKTRKVQSLTEIDDIL
FT                   KALELEQTESDPTKYACNCQGTRHPLFEVAPNCLSCGKIICLREGLNLNHCTFCHTEFL
FT                   SAEERAQIIEVLNQEKQDLESSKPVAALEKPKKPKGYKITSGAGTNLFSEQDKLFDRVE
FT                   KERQRELKRAEVLEGIDKEQSKAMHSQNGEDNADPELKVAQERLEKLLHFQDTSAQRTK
FT                   IIDNASDFSMSNDGSVWGSAQDRALLLKKQQRNMRRWEKLERERHGGRDKVVMDLSIGK
FT                   DGKVTMTEARRAPKTAHAFDEENVEDISDEEDLQDLQEITELKSTLMDEKKRIDKDLES
FT                   NVWDPEKDKKQFQKPVYVNNESEISPEKGKPEKDGTRDRGWKNRVQISQGDENSLEQNI
FT                   LAVL"
FT   gene            complement(<306459..>308609)
FT                   /locus_tag="KLTH0D03190g"
FT                   /old_locus_tag="KLTH-ORF12343"
FT   CDS_pept        complement(306459..308609)
FT                   /locus_tag="KLTH0D03190g"
FT                   /old_locus_tag="KLTH-ORF12343"
FT                   /product="KLTH0D03190p"
FT                   /note="similar to uniprot|P36120 Saccharomyces cerevisiae
FT                   YKR024C DBP7 Putative ATP-dependent RNA helicase of the
FT                   DEAD-box family involved in ribosomal biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22427"
FT                   /db_xref="GOA:C5DG85"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG85"
FT                   /protein_id="CAR22427.1"
FT                   /translation="MSDDDGMMLLNLDTTSSVDQTPGKVKVSGGRWKDRRKAKAMLNGK
FT                   SVNSKDDRLVTSGSVKRPVSTEQGVEERKEQPARKQAKKVQIKATPADQQIVSSLFTSN
FT                   RGIVTSINNNVHDENSGVGPSNAPLLQDSFEALGITSPLLQHLSEVMHITKPTRVQKMS
FT                   IPTLLEADNDVFVHAQTGSGKTLAFLLPILSRILSMGARVDRQSGCFGMIITPTRELAS
FT                   QIHSVMLTLTKCCHYLIPCLLIGGERKKSEKARLRKGCNFIIGTPGRILDHLQNTQVIK
FT                   EQLSSSLRYLVLDEGDKLMELGFEETITQIIKFLYEVPLNHFKYPELPKRIIHVLCSAT
FT                   LKGGVNKLGNLALQDYKLISSGRKQQEVNTVPDQLIQKIVMVPPKLRLVTLAAELNNIT
FT                   VRHLASETGETRRTIVFLSCSDSVEFHYAAFSSDSGHGRALVGDSVKVLSGNSTSLPCL
FT                   ADVSQPSVVCYKLHGSLSQQIRTATLKSFSSDSDATKGKHLIMFCTDVASRGLDLPCVS
FT                   SVIEMDPPFAVEDHLHRIGRTARAGVSGESLLFLLPGEEEGYMDHIKPHHPQGWKLLKY
FT                   DVDILKPAFMESKVQRSDGVSGKPISDEWDNNATTWHLNIERRVLGDPTFKEIAAKGYT
FT                   SHIRAYATHLSQEKKFFSIKCLHLGHLAKSFALRERPKVMGGMNAKNSANGEQKKPKET
FT                   SKSKMLRMAKKALDQSMSEFNY"
FT   gene            <308786..>309532
FT                   /locus_tag="KLTH0D03212g"
FT                   /old_locus_tag="KLTH-ORF12339"
FT   CDS_pept        308786..309532
FT                   /locus_tag="KLTH0D03212g"
FT                   /old_locus_tag="KLTH-ORF12339"
FT                   /product="KLTH0D03212p"
FT                   /note="similar to uniprot|P36121 Saccharomyces cerevisiae
FT                   YKR025W RPC37 RNA polymerase III subunit C37"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22428"
FT                   /db_xref="GOA:C5DG86"
FT                   /db_xref="InterPro:IPR006886"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG86"
FT                   /protein_id="CAR22428.1"
FT                   /translation="MSEQIENQLFVTEDSGDVVMEDANLQESEEGDPIVREIPINLTNG
FT                   PFPLHILQYPNKPKKNGNDPVLHPPVSQVRYKSKSSLWELDVPVNTEIFYDKNRAEDEW
FT                   DSVAQQTLKGVGVQTEGQYVGMVVDEEVYLLPVQAVAQMRPFFKYIDTVAQSKRENEAR
FT                   GAQPSNPAARRAQVVTMSVKSSSEANQPRLGGALLAHKVADEEPPQDLEWIEGTFNQFR
FT                   ESVITEDSRTMMLPLGDENDYLSKAM"
FT   gene            complement(<309575..>310492)
FT                   /locus_tag="KLTH0D03234g"
FT                   /old_locus_tag="KLTH-ORF12338"
FT   CDS_pept        complement(309575..310492)
FT                   /locus_tag="KLTH0D03234g"
FT                   /old_locus_tag="KLTH-ORF12338"
FT                   /product="KLTH0D03234p"
FT                   /note="highly similar to uniprot|P14741 Saccharomyces
FT                   cerevisiae YKR026C GCN3 Alpha subunit of the translation
FT                   initiation factor eIF2B the guanine-nucleotide exchange
FT                   factor for eIF2 activity subsequently regulated by
FT                   phosphorylated eIF2 first identified as a positive
FT                   regulator of GCN4 expression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22429"
FT                   /db_xref="GOA:C5DG87"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042528"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG87"
FT                   /protein_id="CAR22429.1"
FT                   /translation="MSEEFNITETYLKFLEEDSEMTMPIAAIESLVTMLRVKNPETSAE
FT                   MINTIKSAADTLTSSIPNSMSLRAGCDIFMRFVFRNTHLYGDWESCKKHLIENGQLFVS
FT                   RANRSREKIAQIGLDFISDDDIILVHGFSRAVYSVLSHAASKFIRFRCVVTESRPTKQG
FT                   AQLYKLLQEKNIPVKMVVDSAVGSIIHKVDKVLVGAEGVAESGGVINLVGTYSIGVLAK
FT                   NTNKPFYVVSESHKFVRMFPLSPDDLPATAGPLDFTRHEDCEQSLLEPAIDYTSHEYIT
FT                   ALITDLGVLTPSAVSEELIKMWYD"
FT   gene            <310691..>313087
FT                   /locus_tag="KLTH0D03256g"
FT                   /old_locus_tag="KLTH-ORF12337"
FT   CDS_pept        310691..313087
FT                   /locus_tag="KLTH0D03256g"
FT                   /old_locus_tag="KLTH-ORF12337"
FT                   /product="KLTH0D03256p"
FT                   /note="similar to uniprot|P39677 Saccharomyces cerevisiae
FT                   YJL102W MEF2 mitochondrial elongation factor G- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22430"
FT                   /db_xref="GOA:C5DG88"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030851"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG88"
FT                   /protein_id="CAR22430.1"
FT                   /translation="MRLPRLKLWSQCRHIASRTDVTKLRNIGIIAHIDAGKTTTTERML
FT                   YFSGKTKRIGNVDEGDTVTDFLPQERSRGITIQSAAITFNWQNSFGINLIDTPGHADFT
FT                   FEVIRSLKVLDGCVTILDAVAGVEAQTEKVWSQAKGIPKICFINKMDRVGAGFSRTVKE
FT                   LIVKMNTRVLLINIPVFSQPGPTMEPIFEGVLDVVNKTVLRWTATDVNLVNIEDVTSDS
FT                   PHWNELVKLRESLIETLSEYDEDLVEYFLETANGDYMAIPAKKIDHSVRKCSLANFATP
FT                   VLCGASFRNIGVQPLLDAVIKYLPSPVEARLPDFNHNLPVEVSNKKGVVVNKNHNLCVA
FT                   QAFKVITDPIRGIMVYVRVYTGVLNSGFAIFNSTTGAKFKVGKLVIMHANVAEEVKQLN
FT                   AGEIGVLTGSTVSENVRTGDTIIAHNMKRDGLRSLNKEKELSLKINPIITPPPVFSAAI
FT                   EPRTLGNRKAMEESINALIREDPSLRVSVDEESGQTLLSGMGELHLEIAKDRLLNELNA
FT                   DVEVGKVVVSYNETLNVSSPLQEHKSEDGYHFGIQVEPLEVATETRNENEEWHYLSNDN
FT                   NYLVMEKGAHRLKESNWPYQIPYDSIVNAILSSCLVAFQRGGKRARFPLHSCVVRVKSD
FT                   WSIPPDLNSVTPILKISKSMILEGLDKIADRDYSILEPIMNITVTVKQQDMGQVLQDLT
FT                   GACKANILSIEDEHDVSSEENFDLTFQKIAEEQYLPSDNTMDKANISSGSSINKIIKAL
FT                   VPVGEMVSYTSKLRSLTQGRGSYHMEYSGMEKVTGDRLPMILENY"
FT   repeat_region   314187..314449
FT                   /locus_tag="KLTH0D03278t"
FT                   /old_locus_tag="Klth0D.LTR.4"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <314511..>314600
FT                   /locus_tag="KLTH0D03300r"
FT                   /old_locus_tag="Klth0D.tArg.ACG.1"
FT   tRNA            join(314511..314547,314565..314600)
FT                   /locus_tag="KLTH0D03300r"
FT                   /old_locus_tag="Klth0D.tArg.ACG.1"
FT                   /note="tRNA-Arg (ACG) cove"
FT   gene            complement(<314732..>316684)
FT                   /locus_tag="KLTH0D03322g"
FT                   /old_locus_tag="KLTH-ORF12332"
FT   CDS_pept        complement(314732..316684)
FT                   /locus_tag="KLTH0D03322g"
FT                   /old_locus_tag="KLTH-ORF12332"
FT                   /product="KLTH0D03322p"
FT                   /note="similar to uniprot|P32477 Saccharomyces cerevisiae
FT                   YJL101C GSH1 Gamma glutamylcysteine synthetase catalyzes
FT                   the first step in the gamma-glutamyl cycle for glutathione
FT                   (GSH) biosynthesis expression induced by oxidants cadmium
FT                   and mercury"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22431"
FT                   /db_xref="GOA:C5DG89"
FT                   /db_xref="InterPro:IPR004308"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG89"
FT                   /protein_id="CAR22431.1"
FT                   /translation="MGLLSLGTPLEWPESRQYNDHVRKNGIEQLLYIFLAANGRKNDPL
FT                   LWGDEIEYMMCKIDDAGRNAVLAVDDDDVLCALNTEDVGVCQAHNTSFHPEYGRYMIEA
FT                   TPARPYTGFMSNYVEENMGERRAIVDSKLEKRGVELLSLAVFPRMGCPGFTDLSESWDH
FT                   HNSASRSLYLPDEIINRHARFPTLTANIRTRRGEKVCMNVPMYKDKRTPDHDDTVFVRD
FT                   WFTIEDKEGPLASKPGHIYMDSMGFGMGCSCLQLTFQAPTVDKARYLYDSLVNFAPIFL
FT                   AATAASPAFKGWLADQDVRWNVISGAVDDRTPYERSTEPLLPEYNNGNGKSLNEHPMRI
FT                   PKSRYSAVDLYLGGNSFFDREFNDTDVPVNQEVLERLQSNDIFPMDFDLARHFSHLFIR
FT                   DPLVVFQERVDQDNKHSTDHFENIQSTNWQTLRFKPPTQEATPENKKCPGWRVEFRPME
FT                   IHLTDFENAAYANFIYLVVECLLTFSDDINAYVPMSEVWKNMEIAHRRDAVLDEEFYWK
FT                   IGFNKEGTRKLSFTEIFHHPESGIFPQFIDRILVHKGFVSSSWTELKNSRQSAHLRLYY
FT                   YLKLISDRATGALPTTARFLRDFILNHPDYKEDSRLTSVINYDMLKLASRLTHLDDTNG
FT                   ELTRFFGEEIVQFLR"
FT   gene            <317628..>319313
FT                   /locus_tag="KLTH0D03344g"
FT                   /old_locus_tag="KLTH-ORF12326"
FT   CDS_pept        317628..319313
FT                   /locus_tag="KLTH0D03344g"
FT                   /old_locus_tag="KLTH-ORF12326"
FT                   /product="KLTH0D03344p"
FT                   /note="similar to uniprot|P42951 Saccharomyces cerevisiae
FT                   YJL100W LSB6 Phosphatidylinositol 4-kinase that binds
FT                   Las17p which is a homolog of human Wiskott-Aldrich Syndrome
FT                   protein involved in actin patch assembly and actin
FT                   polymerization"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22432"
FT                   /db_xref="GOA:C5DG90"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR039756"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG90"
FT                   /protein_id="CAR22432.1"
FT                   /translation="MAQQSNNLGNANQVVTTNTYDWLQNREQQERLSDTAHNSTAFIGT
FT                   LGRWTSFVWHGGDGTPSRLTLGEEHYEIQYSVFEPLRGYTEIPVLPDRDALTQHFRCVV
FT                   KDCVDAITNYNIELQRIKAGSSGSYFVYGTGDSQTPLGVFKPKDEEPYGPLSPKWTKWA
FT                   HRTFFPCFFGRSCLIPNLGYICESAASVLDELLGTGLVPHTDTIVLMSQNFYDKRRAWF
FT                   ATEPRKLQKSGSFQLFVKDYVGAGEFLDKHPFPGMFRERVDHKQEEEFHWNAQTLQTFR
FT                   LKLEKLIILDYIMRNTDRGLDNWMIRVRKLSDNTWDLELAAIDNGLAFPWKHPDEWRSF
FT                   PYGWLYLPVNILAQPFSESTRRHFLPLLTNKKWWENCHSQLREQFSRDAEFKTRMWKKQ
FT                   WSVLKGQAFNVVETLKNPTQGPLELVRRTRTLVIDEIMQVPSSTLPLAIIQSAMRESIP
FT                   FSPSSPMVLSSLPEEGTNSGTAKDFISQRPNFTEHLQEVGEGGRPMTGESRVHNTKPST
FT                   TTDAQHGPSEEGTSVGIQASYKTKKVVIERLMLVNSKPPVFTWW"
FT   gene            <319479..>321656
FT                   /locus_tag="KLTH0D03366g"
FT                   /old_locus_tag="KLTH-ORF12324"
FT   CDS_pept        319479..321656
FT                   /locus_tag="KLTH0D03366g"
FT                   /old_locus_tag="KLTH-ORF12324"
FT                   /product="KLTH0D03366p"
FT                   /note="similar to uniprot|P36122 Saccharomyces cerevisiae
FT                   YKR027W FMP50 The authentic non-tagged protein was
FT                   localized to the mitochondria and uniprot|P40955
FT                   Saccharomyces cerevisiae YJL099w CHS6 chitin biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22433"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG91"
FT                   /protein_id="CAR22433.1"
FT                   /translation="MNILPWRKKNASSVAVNEHPRDALFKDDDHLVQKLGANLEENPRI
FT                   LEVKFGESFGIRGRLLRTLAEQDLLGIGPPDMAHVTQFDRFHQTETGEYHYLTGLDTSS
FT                   EATPIAYLNTLKLAGGSSKNKNRVSTYCCTNVFSNVDIRIRYESPKHYQINVIDCISGS
FT                   SNIQLTPALWEEAFVSGFVRSIITNMDRERKLPGLVELPFALENGLAYCKKCISLVCRY
FT                   LPRGPELGCDMTKHSFPSYKNNYILDSLLSLLQVANKLNGFVVGTLEDLCMQDPENSVC
FT                   YKTAMAAVLIKSEAKDIVAIQTINSSMQNLFPNGLKDLEQSQLIHAADLLNLQIDFLMV
FT                   RGDFALALPLAQKVTSICSDGFEAWNKLARCYVELGNHEQALFAINSLPALPSSDPCKD
FT                   AMLQEAAKEHFYNRPLCSTPRSRLQSNEYHFISSTLGSVKDHDLTSMIYGRIVMPPQAK
FT                   RGCIKEIWEGPCVELGPIYGPQSKNLINFVSPQEVASLGDKNLLARNSMASQLSWSMTC
FT                   AYDLLVHIISKIGWNSLLELRSSIFVMERERGLGDAGVLRPEFKAKRLCEKWLDQLFLN
FT                   LYEDLKITFNSQEHREELYSGLEWELLGLTHLRTWLWADAVACLRTSIMARFDPVSAEK
FT                   LLDLYLTRRYPSSDVLDQDVLLALVVDKISYESRFYNFLNLADLRVLIDLSASSGVDTV
FT                   RNHIYTLPSAQTGIVALTDKLLNYVQELNDD"
FT   gene            <322117..>325185
FT                   /locus_tag="KLTH0D03388g"
FT                   /old_locus_tag="KLTH-ORF12323"
FT   CDS_pept        322117..325185
FT                   /locus_tag="KLTH0D03388g"
FT                   /old_locus_tag="KLTH-ORF12323"
FT                   /product="KLTH0D03388p"
FT                   /note="similar to uniprot|P36123 Saccharomyces cerevisiae
FT                   or to YJL098W uniprot|P40856 Saccharomyces cerevisiae
FT                   YJL098W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22434"
FT                   /db_xref="GOA:C5DG92"
FT                   /db_xref="InterPro:IPR007587"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG92"
FT                   /protein_id="CAR22434.1"
FT                   /translation="MSGSFWKFGQNYASESPLSKLLNRAFIKVSSEEGAQDKQQDNDSQ
FT                   EKINRLLASPGGSSSDGSESLEKSDADAEHGSADQNNALPDSEAEYRDYEPNMEVLDEL
FT                   LDDEELYTELMCSNFKLLIFFKYPQVLAKLVDYVTNEHVLSESLEESEEEDEKPISDAP
FT                   KSGADDSEEPQNKESLGGDKNDREPMSDQLSVSSNETSITLPPDSEEQSDSRRARMAAE
FT                   ILSADVWPISSAFMDHEELLGRLWAMLDHPAPLSIVASTYFMKINERLLDMDISGMLHF
FT                   ILAQDDLVDRFLKHTDNPPLMDYLLKVISTDKPDTSTGVIEKLGSQELIPKLLDHLAAG
FT                   HSSSTKSAAGDFLKALITISANSNNEIASAIGPNGLTRELVSPPMVEKLMNIMLSGGTS
FT                   LSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLIKCAAEHLPEFNKM
FT                   LVETELPPLETPFGSIEPLGFERFKICELVAELLHCSNMTLLNEPSGGSIVAERDAVRE
FT                   KILQQEKSEGSHKKDENEDVLQKMSDLRIAATNSENSSDEDGIQTKEDADAAGEEIQSE
FT                   GSSENELSEKSLRENPVVGDQLKIALQDNRVITSILEMFFDFPWNNFLHNVVFDIVQQI
FT                   FNGPLKTGFNRFLIADLFTGAKLTHMIMDGDRKCEDYENETGLRLGYMGHLTLIAEEVA
FT                   KFAAYVDEMKITFSNSAIVESLNEPRWKEYTETVLADTRENYSSVLGDFEEEEDDHEDP
FT                   DIEDENPGGKTSVTGNDEGDGYRDFDNGAGSTGNYTEYDSVDNPRYYQYEDEHGNKTEL
FT                   HLNPDIDYDIGPGTFSENNAQELEDHDITEGGKDGKNKFSNYMSRQLSKDYNTSSSSDD
FT                   DDEDIWGSSAPGSAQSSEFLKHGSKAGSSEFKDSGAFNPSHFGLEDDDDDYMDPNDDGQ
FT                   SYAKPHHPLYDSMLSQGKSENQLYYDQGDASLAENDDEDSDDSDKEDAGDEDDQYSLCR
FT                   TSSKDNMAWDHAEQNRIINTAQYRQNQQELADK"
FT   gene            <325452..>326096
FT                   /locus_tag="KLTH0D03410g"
FT                   /old_locus_tag="KLTH-ORF12321"
FT   CDS_pept        325452..326096
FT                   /locus_tag="KLTH0D03410g"
FT                   /old_locus_tag="KLTH-ORF12321"
FT                   /product="KLTH0D03410p"
FT                   /note="similar to uniprot|P40857 Saccharomyces cerevisiae
FT                   YJL097W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22435"
FT                   /db_xref="GOA:C5DG93"
FT                   /db_xref="InterPro:IPR007482"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG93"
FT                   /protein_id="CAR22435.1"
FT                   /translation="MGKVSFVNPLALYNLFSAGLWGYLLYNAIVVYPKIGQPEFFYEIK
FT                   STLNAIQCGALIEVFNSLFGIVRAPLLTTFAQVASRLLLTIGVFQYLPEAENAHNKTFV
FT                   SLVIAWSITEVVRYSFYYFNLTLTCGAPKLLVLLRYNLFWVLYPLGVASELLIIYSALP
FT                   VGESKYSANVRWALIAAMLTYIPGFPMLFSHMVVQRKKIMRSIRSTTKKEN"
FT   gene            <326296..>326769
FT                   /locus_tag="KLTH0D03432g"
FT                   /old_locus_tag="KLTH-ORF12320"
FT   CDS_pept        326296..326769
FT                   /locus_tag="KLTH0D03432g"
FT                   /old_locus_tag="KLTH-ORF12320"
FT                   /product="KLTH0D03432p"
FT                   /note="some similarities with uniprot|P40858 Saccharomyces
FT                   cerevisiae YJL096W MRPL49 Mitochondrial ribosomal protein
FT                   of the large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03432g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22436"
FT                   /db_xref="GOA:C5DG94"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG94"
FT                   /protein_id="CAR22436.1"
FT                   /translation="MNSLRRLFPALNSFRQCAHFPTAQFSRSISSTAVSSQKFDITPLK
FT                   LSNELYAVIRIHNRPYLVTKGDKVTLPFKLKQAEVGDILNMNDVTAIGSRNYKVVDSPL
FT                   DPSLYTIKATILEKTKRPMRVREVTKRRNRKVRHAVSKPDLTVLRISELSLND"
FT   gene            <327039..>331340
FT                   /locus_tag="KLTH0D03454g"
FT                   /old_locus_tag="KLTH-ORF12319"
FT   CDS_pept        327039..331340
FT                   /locus_tag="KLTH0D03454g"
FT                   /old_locus_tag="KLTH-ORF12319"
FT                   /product="KLTH0D03454p"
FT                   /note="similar to uniprot|Q01389 Saccharomyces cerevisiae
FT                   YJL095W BCK1 Mitogen-activated protein (MAP) kinase kinase
FT                   kinase acting in the protein kinase C signaling pathway
FT                   which controls cell integrity upon activation by Pkc1p
FT                   phosphorylates downstream kinases Mkk1p and Mkk2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22437"
FT                   /db_xref="GOA:C5DG95"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG95"
FT                   /protein_id="CAR22437.1"
FT                   /translation="MAFLKKKLANVNHSSRSRSGSTSSSRFHASPSTPNSPEFKLPELP
FT                   PKIPADKNSLKATPFHSHTHPIARIVPRPLDEKTDVQNSSGFTFEEDQSNEVRQNEARQ
FT                   NEVKFPSKKNSTVKNTPNYAVSNSAPGSTYTGITNSPQQGLLFSWDVTNPDEWNMVRVL
FT                   SWFRFNDFDESWVAYFKKRQIHGRSFLKLMAYDNFLEHENNLIQTKTSSYKRFQYLLKR
FT                   TLEQNVVSGHNRNRSDKSNGSRSSSDSVKIRNKMKQEFEHSRSISETMVAENKSSAIDV
FT                   NDEKIVPLRSHQKTSSASSLYRRSFISLLGSSSQDQIKPDPNINIKIPPRPVSSAESIN
FT                   QPDRCNNRTCSSPISPSYSGIFRRQHKSSSSESSIFNTLFGSNTGGSSNSIAEKPAEEH
FT                   KKPRPVKSSSLESLPREKSSLNSSEFPLPKQSYPLNDEKSRLWGKLKRKSLQPDLSATR
FT                   STSAPSEIELSEENTLVNTNLPESQEFNWEDFVLEKRFYPLKNSKTDDRFILITKDNKS
FT                   FIPLNIGIITNLDELKDSMALTLGIKHKNYTIHLTDFGCDIGCAIEDDLLETLRGNMFS
FT                   NVPSKLFIKDQTPIQSKPEIVEPSSEVTASGQLVKNKRTELSANSSIINSNDDTSTITS
FT                   CSDATSFDDIARAAGRAVYPQTPNSYYGAVVTNPNSEVDYWTVKDNLPEDPQQSRGSKT
FT                   RQRFRPRKSSGADSNVPSGSTDSDQSFQIIRKKSNDEIDFNNRRASPYVNPDFAPRREA
FT                   PKPPSSSQNSLVSTGSNSLANSPKFNRIRANTASLKRKARPPPPASILNQLSTRSSNGS
FT                   LRTSKNTAVSPSESVVHSYTPGSTQVLVPQPYKGNSDTIKPGILEDSIISYTHPPFVSR
FT                   SGSLQSTANSVLPSPPHLSKRFSTKRIVSSASAADIFDENDISFADAPNLTESDEDRHS
FT                   DSSDEIIWSSQRKQCEPKKLDGTKQATEDSDCDIDEKSLNSVDSATNTHLHFPTRKMTL
FT                   RPSPEVVYQNLERFFPGTDLDRPIVEGTTPPPSPRIVKASSPKISSLGNDQPGPDPEPR
FT                   SPNNSRVGTPQTMISKSMNDSQEVLSQSSNVLKIPRRTKTIRIIAREASDARRNSKTRS
FT                   LGRKNTKMWGTRVVEVTDKKTVAINKSKNSNGEYKEFAWIKGEIIGKGSFGSVYLGLNV
FT                   TTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDLDHVNIVQYLGFENKNHVYS
FT                   LFLEYVAGGSVGSLIRLFGRFDEDLIRFLAVQVLRGLAYLHSKGILHRDMKADNLLLDV
FT                   DGICKISDFGISKKSNNIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCVVLE
FT                   MFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTA
FT                   DDLLSHPFCGVRSRFVFQETSLARFIRSKPA"
FT   gene            complement(<333077..>334864)
FT                   /locus_tag="KLTH0D03476g"
FT                   /old_locus_tag="KLTH-ORF12314"
FT   CDS_pept        complement(333077..334864)
FT                   /locus_tag="KLTH0D03476g"
FT                   /old_locus_tag="KLTH-ORF12314"
FT                   /product="KLTH0D03476p"
FT                   /note="similar to uniprot|P40310 Saccharomyces cerevisiae
FT                   YJL093C TOK1 Target Of K1 Killer Toxin outward- rectifier
FT                   potassium channel"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22438"
FT                   /db_xref="GOA:C5DG96"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG96"
FT                   /protein_id="CAR22438.1"
FT                   /translation="MVRKNSSDAEREYKRLLDESLSFNRDKVIILNAEPSSRSFVIWFI
FT                   ISSYFPVITACLGPISNTIAVAGIVGKWRADAAGKTHPDPKGVYAVNVVSLALGCVSNF
FT                   VLLLHFSKRVGYIRAQLTNIVGWTLAGGLLLADVIVCSQRDFPPNLQRTVGFWYASFTV
FT                   LLYFGSTVLLSIHYCGYKAGKYPAKFNLTDSERNVMIFTFVLSIWFIWGSAMFSKLIEI
FT                   SFDEALYFCTVSILTIGLGDIVPLSVSAKIMTLVYSMSGVIILGLIVALTRSILQSSSG
FT                   PILFFNRVETARTKVYEKLIASGEQLEGREAFEVIKNIRKVSVQRQKRWSVLSTLVIFI
FT                   AFWLLGALVFHFAERWNYFNCLYFCFLCLITIGFGDYAPKTGCGRAFFVIWAICAVPLM
FT                   TAIINTVGETLHSMSSNLEINIAKSSALLLSPVFSMFDKICSFCSNSPKETQMDHSVAD
FT                   EHGPQSASESQAEGNGELLSIHSPERPPSKPDFDSGSDSSIDSKIATKLKDYLQVIKWL
FT                   RELSHRKPDSKLDFDEWARLFSSISDDGDRTLGDPHFWVSEDSPLRYPIDEPRYVMHNL
FT                   LINLENDIERLVRKNSDEA"
FT   gene            <335566..>338838
FT                   /locus_tag="KLTH0D03498g"
FT                   /old_locus_tag="KLTH-ORF12311"
FT   CDS_pept        335566..338838
FT                   /locus_tag="KLTH0D03498g"
FT                   /old_locus_tag="KLTH-ORF12311"
FT                   /product="KLTH0D03498p"
FT                   /note="weakly similar to uniprot|P12954 Saccharomyces
FT                   cerevisiae YJL092W HPR5 DNA helicase and DNA-dependent
FT                   ATPase involved in DNA repair required for proper timing of
FT                   commitment to meiotic recombination and the transition from
FT                   Meiosis I to Meiosis II potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22439"
FT                   /db_xref="GOA:C5DG97"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG97"
FT                   /protein_id="CAR22439.1"
FT                   /translation="MERLLSSLNERQCESVTFDHTKALQVVAGPGTGKTKVLTTRVAYL
FT                   LLEKGINPGDIIITTFTKKATLEMIERLSFLLEGTNINPSSLWIGTFHSICARILRQHG
FT                   WKIGLPKDWRTFSDSDTDPIIHKLVEKVPDQIRDYAHSYTRKANLLRPNSKGNWEVHPA
FT                   SVKKMISWLKSEGVMADEYRANNEHDPALLHFYEAYQCELHSQHALDFDDLLLHAFKLL
FT                   SKERCLPHIKHVLVDEFQDTNSIQLNLMYLFARGNSTTSQGITAVGDPDQSIYAFRNAL
FT                   ASNFEDMAAKCPIPCSRIVLVENYRSSQKILTTSEMLIKQQLSGREDRLPLKAQFDSDF
FT                   PPVYIEFPAKFLEARALAREILYLRSLPKLWNYNSFALLVRHRRQIRPLETSLIEHRIP
FT                   YKIVNGRAFWELKEINGLMDLLKCVYSNYEKNAILRALQYPNRGLGPATVRKVEATFAD
FT                   YESPFVALKNIVANPNNGAYASKALNVITEFLSLIESCRELMAEATDLSAMTEIFDKLY
FT                   EGSGLKFEYLHVDGKRKAEVDPNGEPNLLNKRHINVNILRKHLANFKPFEEDLSQRQGP
FT                   GDDEVDVKEEDTDVEGKINAHDILREFINSVNLYSTETEVEESQMSEKERRQKKKREKD
FT                   GFVTISTIHGAKGLEWPVVMIPGCVEGVIPCVFGGKDDADDSDSATDGGEEGNNRGNNG
FT                   TSSPKKNRPRRNEGTLDEERRMFFVAQTRAKFLLYLTATNSNDTESRYESSTPSRFLTT
FT                   DLVNTMCEDQKVFTDVESVRKLYHNLNQPPPQESATFSLDVLVKDYEQFVNARRERLTW
FT                   KGRAVFDASRLNLGENITPSPTGFGITTAAAQLRNASTNHIEGRQNSPYGISGVSHNQG
FT                   NRNMAPVYRPSRNNSNTVLAPSRTFAPKTSPTQVKNAQAPVYAPKVEDSAKVLREKAKA
FT                   SSESANSSKIKTGQLSRSASFECSKRRTGGRSRRTIVADSINLGAMNYNHDGTDVETNE
FT                   GQVLVKGEMSAGERGNLNKTAGEMLHNPRDLRNDSRPILTNAKTLADSVRSQTSKRSSA
FT                   PSEVPKKKVKSEPMDKGYDIMSRLSQARRRADSDKDTVIVID"
FT   gene            complement(<338875..>340320)
FT                   /locus_tag="KLTH0D03520g"
FT                   /old_locus_tag="KLTH-ORF12309"
FT   CDS_pept        complement(338875..340320)
FT                   /locus_tag="KLTH0D03520g"
FT                   /old_locus_tag="KLTH-ORF12309"
FT                   /product="KLTH0D03520p"
FT                   /note="similar to uniprot|P47026 Saccharomyces cerevisiae
FT                   YJL091C GWT1 Protein involved in the inositol acylation of
FT                   glucosaminyl phosphatidylinositol (GlcN-PI) to form
FT                   glucosaminyl(acyl)phosphatidylinositol (GlcN(acyl)PI) an
FT                   intermediate in the biosynthesis of
FT                   glycosylphosphatidylinositol (GPI) anchors"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22440"
FT                   /db_xref="GOA:C5DG98"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG98"
FT                   /protein_id="CAR22440.1"
FT                   /translation="MEDLKLRKEQFVSGLTGSSIQEINAVASVALCGYVCWSLLRSTVA
FT                   DGKVMLLADFFFNWCAILLSITTYADNPLALNLLLVVPPLLLWLCVRPTRSQRDISRNS
FT                   LQKAEFKLMRHPFITAYRGSMMIVTALAILAVDFRIFPRRFAKVETWGTSLMDLGVGSF
FT                   VFSGGLVSSRALLQNKLSGGRVSALKKIIHALRSSGTILLLGLLRLYFVKNLEYQEHVT
FT                   EYGVHWNFFITLSLLPMAMIPIDAIAEYIPRVAIALVISTVYELFMVFNKDLLTFLISG
FT                   PRETFVGANREGIFSFVGYCAIFLWGQSTGFYTLGNVATKNNLLKPSVQPIKNLNNIGT
FT                   WEKLASKGPLCGLLTWSFITLSATQIVFAWHPFNVSRRFANLPYVLWVVSFNLGALSLF
FT                   CLVDKVFENSAIGSQTSVSLEAMNSNGLFLFLLANVTTGLVNMIMPTIDIAPVEAFSIL
FT                   FLYASFLASVSIFMLKKRIFIKL"
FT   gene            complement(<340512..>342635)
FT                   /locus_tag="KLTH0D03542g"
FT                   /old_locus_tag="KLTH-ORF12307"
FT   CDS_pept        complement(340512..342635)
FT                   /locus_tag="KLTH0D03542g"
FT                   /old_locus_tag="KLTH-ORF12307"
FT                   /product="KLTH0D03542p"
FT                   /note="similar to uniprot|P47027 Saccharomyces cerevisiae
FT                   YJL090C DPB11 Essential BRCT repeat protein required on the
FT                   prereplicative complex at replication origins for loading
FT                   DNA polymerases to initiate DNA synthesis also required for
FT                   S/M checkpoint control"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22441"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG99"
FT                   /protein_id="CAR22441.1"
FT                   /translation="MQKPLQGITFCPTALPEDASRSVSRKVAKLGGGFSKDLTKLVNVL
FT                   VVGSVATNKYRFAVQNRADMAFVGVDAIDTIYDLWLAGDDISMESHSNFSGIKNPRERM
FT                   LSVLRTRHQLGALKDFVVFIGRVGDDQEGKLSPDSLERLCVEQGVHSCNTRHFVKESHW
FT                   NRPTVFVTDCSRGARVDAARSQGLPIVHPKWVLDCHNRSALLDFAYYLLENNEHVSFEV
FT                   VGAGSCMCWDQISFQPSSAAANAHEDDSRLSQRVVLDKFASDGHRLWNSVMHKTKKISP
FT                   AETFPLPNAEKTKELPGLFHDKHCYLLGFPQKHKAVLHNIIVRNSGSCYDYEDGVQVRE
FT                   PSYLVIPSNVPRYTPASVDELFTHVVTEFFFERCLHYKKLLKPDPWCSPFFSNFEVIPS
FT                   DHLRQNLTVSEPLKVAITGFQGVELLHITKILEYLEPSGLKLSQKLNKETNVLIINLGA
FT                   LNSIPESHPLWKNQYASMFGEGKKLEQNQIHRNSMKRKIEFIKQRHSIPVVTAAFILEL
FT                   FSRVSKAKAQLKVSSRIHLNDVNWCISCPKGNKDQFYCDLLAKETDSTDSGLEIASSAN
FT                   DCVNRSIKQNRQEALDIFRNGPTVNSKRSLYEEGIEARHSAEKVPSPLPKIPRLVPTEA
FT                   LKPVQRSSSWGNLLSDQARKVDGLHDSDVEPSTGERELQHTQVTYGSPKQINDVQAPPT
FT                   RRLTRQRMKEIDT"
FT   gene            <343546..>346134
FT                   /locus_tag="KLTH0D03564g"
FT                   /old_locus_tag="KLTH-ORF12304"
FT   CDS_pept        343546..346134
FT                   /locus_tag="KLTH0D03564g"
FT                   /old_locus_tag="KLTH-ORF12304"
FT                   /product="KLTH0D03564p"
FT                   /note="weakly similar to uniprot|P46954 Saccharomyces
FT                   cerevisiae YJL089W SIP4 Possibly involved in Snf1p
FT                   regulated transcriptional activation shows homology to DNA
FT                   binding domain of Gal4p has a leucine zipper motif and
FT                   acidic region lexA-Sip4p activates transcription"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22442"
FT                   /db_xref="GOA:C5DGA0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA0"
FT                   /protein_id="CAR22442.1"
FT                   /translation="MAKRKYGSPLSPKATQLLLSKHARMSQACDRCRLKKIKCDGIKPT
FT                   CTPCTKIGFHCQTSDKLSRRGFPRGYTEMLEKEVVRLQQRLVRAGYDPGDSTEVSVSQQ
FT                   AAIGATADNSESFAGETSGQSEAPGSGATSTEPSASVQPSSEPQKQQLFHLPFINDTFH
FT                   LHENRVAADGRFLGHAAWNDIVGTLGKLPTEAMPDEDEWLCRYLVRQFQLSQHRVPAAL
FT                   LIKYHNDAGFCKKRIRRSITHFLQTSMSLVPILNSSTWEERLFKINESKNTHPAALLAY
FT                   LFIIQWQWSCFSDDKLFAATKIVVLNATQPLFRLQCLLLASYYFMGTPSMSLVYNTSTA
FT                   PYASQLLKLSFAEMINLGLFINSHRLVPLQNSPLSHSERLITFWCFQFLDSWWTLLQGT
FT                   PKSNFTMDEFLPPKISSLRNPRLKPFELLIDFVVGCLDGCNLLYALSQGANTHMIFELE
FT                   SFRKRLFQYSLYHHLKDHDYHNLSTLATCVDKPQAIEIQLTLHYLIMTFFANLKAARSA
FT                   GRSSAKAAESLRDTSYEILTLYYLIVVDSYDMKASIPQQLQVLHLLPCDNLAIVNMCLE
FT                   CLSQWAVASENKAGTDSEYRMNYEKHRSIVKAWCKIWYFDEPEDELLTRLQKNYQFSSQ
FT                   LPSGRSGQLAKLQYLNAMRTHNRRSLLLNLPDDNQVHDNVGSLNILGVESTQFRIPAAD
FT                   SANNLFESLAIQEEDEGYAEDDDDDDDTPLELPFFKKKRSNKTTIAQPPPIPVRSRSLF
FT                   DQHHPGPIIRRQSDAVAANNGRLFSGIDESHLKVLKDNSVQKETEDAKLRSEHYLLVQG
FT                   FQKSPPEVDTPRSLADILSLSGAECKFPASSGSIPEDNAHDKQQASVDHT"
FT   gene            <346309..>347241
FT                   /locus_tag="KLTH0D03586g"
FT                   /old_locus_tag="KLTH-ORF12301"
FT   CDS_pept        346309..347241
FT                   /locus_tag="KLTH0D03586g"
FT                   /old_locus_tag="KLTH-ORF12301"
FT                   /product="KLTH0D03586p"
FT                   /note="weakly similar to uniprot|P36118 Saccharomyces
FT                   cerevisiae YKR022C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22443"
FT                   /db_xref="GOA:C5DGA1"
FT                   /db_xref="InterPro:IPR028211"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA1"
FT                   /protein_id="CAR22443.1"
FT                   /translation="MFRKRAKLQPSVGSNKASGSSQKDSSETSKRRSRVDISTSYEIED
FT                   ENEHIRTSPSSRLKEKKKRAIKPNAHQYLPFEEEDITEIAYRKPLPKSGVQIMNLEELG
FT                   DDCEDDTLEGVPTRREIESIRTQRAMLQQQTDTLKTGFYDSSKNPVEHDEHQYIKLLSK
FT                   DDKHDLMEIIGGESQGAKDVQDSYMDAYLEIHGLEDGRLALSKNDLDRDEQERKLAITS
FT                   ALKNVEGDEWEARQLEKMDRGLSLIAHPILHENDFELEELVSELDSMLLSIQTKKKMFI
FT                   SQRDSVQKENKKLCEAQDKLITSLQKHVA"
FT   gene            <349672..>355387
FT                   /locus_tag="KLTH0D03608g"
FT                   /old_locus_tag="Klth0D.mRNA.185.p"
FT   CDS_pept        join(349672..349685,349747..355387)
FT                   /locus_tag="KLTH0D03608g"
FT                   /old_locus_tag="Klth0D.mRNA.185.p"
FT                   /product="KLTH0D03608p"
FT                   /note="similar to uniprot|P37297 Saccharomyces cerevisiae
FT                   YLR305C STT4 Phosphatidylinositol-4-kinase that functions
FT                   in the Pkc1p protein kinase pathway; required for normal
FT                   vacuole morphology, cell wall integrity, and actin
FT                   cytoskeleton organization"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22444"
FT                   /db_xref="GOA:C5DGA2"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="InterPro:IPR042236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA2"
FT                   /protein_id="CAR22444.1"
FT                   /translation="MSAFRESPGSLRALALAKLVNHSEGSRSIDKLVASLPVSYSSHPA
FT                   KLYTIPLTLNELEVLLGVCQFVPSTAQSAQSLLKKCIIPYFLSNPRQKFTDYVINKYRQ
FT                   RGLKHPTEILSFELSRSIIRISRIFPQFIDEIREQIDEYLQYMSSNLTVENLLSFAGFL
FT                   EALVYEQNNLLSSFVISVLQAFISEDFLYAVEKTVRNSVSKDVLIDYFDHNREISSLLF
FT                   CELIEKLQVTYAASLLNVPKKQTLDSYLLDLKHAQFLDGENKALKDFEKKVGQQRSKLL
FT                   ELCKFSFRQITEVEEGAKYIDLSSQNRLESAYTAKSYMLQILSLGLFLSHEVEEVIEMI
FT                   RDAVIDLPTNSFALKTSLLTTVVCVASLLNYFTDSVSADLLRVFPLMVTTKLITKQKVA
FT                   TISSAVSKGLKPLTEDVIVGTIYNINNLLALAQDGLHMTPVKDRRLTTVLGTSNHFDRL
FT                   LSSRPTRSNTVGTYQSLQKLKIAETSIVLQHESKLENYTSRQEEVESNSTLYHDSLYEN
FT                   VVTATTTMASVYNDQSITALTITILTQKIKSASPRLDRKILEGLAHLALKVNRSEFNLL
FT                   MKFFHLSTNSALDNQDEKMMKSLIAAKSIIAEGLAKEDLHNNLFRIYLRYLLDAIVARG
FT                   DVDRSEHHRSHSEISKVADQIAVYLKPLASLLPKPGEKPLDLIHDEEITNVFRNVWFNA
FT                   AVHGFHGAAALTSKNHEELLVIAYNSPPLASDFASGNRETSLDMNTILRRGSSNHNLKQ
FT                   QKLILSDHLSMSPVQARTLSSSKVMFLAATLLLEGLRCEAGDCSKTLLYCSDRSIVKSG
FT                   LDKFVSSISVSMVQRYTKLVIKGDSVIFSAENVAKQLDNILLLLTHRDAPLQDAAYQSC
FT                   DRFIERIPSSLCHRDSLYTLLDSLTMLFDSVIACEANKHEAVFEFTLKHSNRKMMLPDS
FT                   LNWRSLTLEKLQKYATRWVTMILKTANQDTKILLQSYISDVSSTRRLNSIEFGVSFALE
FT                   MAAKILPVDRELANISQGGYRRPDSISGFLSQHAWRSRFIMDQSVLSTYDGIEAERNFS
FT                   RRKILAHLENKKPLDYKDISAFLDLSASLLILRQGNTASLVYDIVCIPFQIFTSDTIKI
FT                   ATNVWLSVINERSDVGYLLLSEIGHCWRDSIDNNTGLFSMKHNLVAEEFQYMEYSPYNK
FT                   KEINRRAHAASKSLQPHLQLIRFLSSHFEGTMFDSLHLLHIFTKLCLYGLKNLGKASLH
FT                   PFARIARSELLYFGTLVFATNVKHNTLYVPEISRFLVDGALTWFEKPKSWPFGANELKI
FT                   RADLALLIEVYRKLKSQEANLKVHCSKDVSLLEHFLLSEIYSVETWLRPLAKPTDMVKP
FT                   PTDLVSHAFKKKPELAINLVERYPFKKSSEILTQLVKENPLLCAHSQKTLSFFLAGGKD
FT                   MHYVLYWAPASPLKSINLFLPQWAQNTFVIQYNVRAIETHDVNLTFFYVPQIVQCLRYD
FT                   PLGYVERFIIDTAKISVLFSHQIIWNMLANSYKDDDGEIPDDLKPTLDRIHDKMLASFS
FT                   AEQKDFYEREFSFFNEVTGISGKLRPYIKKTKAEKKIKIDEEMQKISVLDGVYLPSNPD
FT                   GVVVDIDRSSGKPLQSHAKAPFMATFKIEKTEQDPDTGEDKKVEKWQGAIFKVGDDCRQ
FT                   DVLALQLISLFRTIWSAVGLDVFVFPYRVTATAPGCGVIDVLPNSISRDMLGREAVNGL
FT                   YEYFTTKFGHENTVEFQHARNNFVKSLAGYSVISELLQFKDRHNGNIMYDDQGHCLHID
FT                   FGFIFDIVPGGVKFEAVPFKLTKEMVKVMGGSPDTQAYREFEELCIKAYLAARPHMDLV
FT                   LECVTPMLGSGLPCFNGNKTIRNLESRFVPHKTDYEAAQHMLSLIKKSYESLFTKGYDE
FT                   FQRLTNGIPY"
FT   gene            <355806..>358145
FT                   /locus_tag="KLTH0D03630g"
FT                   /old_locus_tag="KLTH-ORF12294"
FT   CDS_pept        355806..358145
FT                   /locus_tag="KLTH0D03630g"
FT                   /old_locus_tag="KLTH-ORF12294"
FT                   /product="KLTH0D03630p"
FT                   /note="highly similar to uniprot|P19414 Saccharomyces
FT                   cerevisiae YLR304C ACO1 Mitochondrial aconitase required
FT                   for the tricarboxylic acid (TCA) cycle mutation leads to
FT                   glutamate auxotrophy"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22445"
FT                   /db_xref="GOA:C5DGA3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA3"
FT                   /protein_id="CAR22445.1"
FT                   /translation="MLSARSIAQKPVARGLATVSKLTRDSKVHQNLLEDHSFINYKQNL
FT                   ENVDIVRKRLNRPLTYAEKILYGHLDDPHGQDIERGVSYLKLRPDRVACQDATAQMAIL
FT                   QFMSAGLPQVAKPVTVHCDHLIQAQVGGEKDLKRAIDLNKEVFDFLATATAKYNMGFWK
FT                   PGSGIIHQIVLENYAFPGALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMSDLPWELKA
FT                   PKILGVKLTGKMSGWTSPKDIILKLAGITTVKGGTGKIVEYYGEGVNTFSATGMGTICN
FT                   MGAEIGATTSVFPFNHSMVDYLKATRRGEIADFAKLYNSDLLSADKGAEYDEVIEINLS
FT                   ELEPYVNGPFTPDLATPISKMKEVAVHNNWPLEVKVGLIGSCTNSSYEDMSRAASIAED
FT                   AASHGLKSKSLFTISPGSEQVRSTIARDGQLKTFQDFGGVVLANACGPCIGQWDRQDIK
FT                   KGDKNTIVSSFNRNFTSRNDGNPETHSFVASPEITTALAIAGDLRFNPMTDKLKDKDGN
FT                   EFMLKPPTGVGLPVKGYDQGVNTYQAPPAERSSVEVKVSPTSDRLQLLTPFDAWDGKDP
FT                   VDLPILIKSLGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENKKANCVKNFFTG
FT                   EYAGVPDTAREYKKRGQKWVVVGGENFGEGSSREHAALEPRYLGAYAIITKSFARIHET
FT                   NLKKQGLLPLTFGKPEDYDRINPDDLVDLVGVTELAPGKPVTMRLKTKSGETWETPLNH
FT                   TFNSEQIGWFKAGSALNMITQSKKSA"
FT   gene            complement(<358612..>359946)
FT                   /locus_tag="KLTH0D03652g"
FT                   /old_locus_tag="KLTH-ORF12290"
FT   CDS_pept        complement(358612..359946)
FT                   /locus_tag="KLTH0D03652g"
FT                   /old_locus_tag="KLTH-ORF12290"
FT                   /product="KLTH0D03652p"
FT                   /note="highly similar to uniprot|P06106 Saccharomyces
FT                   cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
FT                   serine sulfhydrylase required for sulfur amino acid
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22446"
FT                   /db_xref="GOA:C5DGA4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA4"
FT                   /protein_id="CAR22446.1"
FT                   /translation="MPSHFDTLQLHAGQEDATENAHNPRAVPIYATSSYVFNDSQHGAQ
FT                   LFGLEKPGYMYSRIVNPTVDVFERRIAALEGGVAALAVASGQAAQALAISGLAHAGDNI
FT                   VSTSFLYGGTYNQFKVAFRRLGIETRFIEGDKPEDFEKAFDDKTKAVYLETIGNPKYNV
FT                   PDFEKIVAVAHKHGIPVVVDNTFGAGGYFAQPIKYGADIVTHSATKWIGGHGTTIGGVI
FT                   VDSGKFPWKEYPEKFPQFSKPSEGYHGLVINDALGPLAYIGHVRIELLRDLGPALNPFA
FT                   AFQLLQGVETLSLRCERHATNALKLAQYLEKSPYVSWVSYPGLSSHSHHENAKKYLQNG
FT                   FGGVLSFGVKDLPNAHEIEDPFKASGAQVVDSLKIASNLANVGDSKTLVIAPYFTTHQQ
FT                   LTDEEKLASGVTKDLIRVSVGTEFIDDIIGDFEQAFEKVFNGQKP"
FT   gene            complement(<361666..>361766)
FT                   /locus_tag="KLTH0D03674r"
FT                   /old_locus_tag="Klth0D.tLeu.TAG.26"
FT   tRNA            complement(join(361666..361709,361730..361766))
FT                   /locus_tag="KLTH0D03674r"
FT                   /old_locus_tag="Klth0D.tLeu.TAG.26"
FT                   /note="tRNA-Leu (TAG) cove"
FT   gene            <362623..>362694
FT                   /locus_tag="KLTH0D03696r"
FT                   /old_locus_tag="Klth0D.tArg.TCT.2"
FT   tRNA            362623..362694
FT                   /locus_tag="KLTH0D03696r"
FT                   /old_locus_tag="Klth0D.tArg.TCT.2"
FT                   /note="tRNA-Arg (TCT) cove score=67.63"
FT   gene            complement(<362790..>364790)
FT                   /locus_tag="KLTH0D03718g"
FT                   /old_locus_tag="KLTH-ORF12280"
FT   CDS_pept        complement(362790..364790)
FT                   /locus_tag="KLTH0D03718g"
FT                   /old_locus_tag="KLTH-ORF12280"
FT                   /product="KLTH0D03718p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22447"
FT                   /db_xref="GOA:C5DGA5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA5"
FT                   /protein_id="CAR22447.1"
FT                   /translation="MSRAPEDGFESMPSSRESEAGGQKRPNDCDQDHLSQKKRVTRRRH
FT                   RNSRLGCDECKRRRIKCDETIPECRNCQNRQKREPGKRCSYLSMNEEELQSFKLKKQQN
FT                   RLVEGTRVNKILEDHPDEIAYEIKMIAHESVELPVSVWTCVSGMESVRVPKALYLQVLL
FT                   NANQDWDMSSRSFVVLALYSIMNSMSHKITLADQGQGDSAQEILLAEREILERIAVKYK
FT                   KEFLTYAREIISMFLTSKAAVGNEYLGTRLLITNTVLQYIQLYSNAQYDSNHYAAMIDM
FT                   CLEIYKNNDPEKVVRTVQFYWSSMPRNLFHLYFPAYSTDLLFELKAVLKEFEPIILAAG
FT                   DERVQLHHKELGDFIHYVIGLLPLSTSVLPLPVDELYEMYRTWFLGIPSEAFCISRTMP
FT                   GVQRVFYTFYHSIASYLNNLFPAGCYLMSRPFHGPTSLYPFSLNIVFEDLDHLLGPFAE
FT                   FSVRLLSFMERREHILQNFFEVKDPLPPGLHKFRFQKGEVRNLKEKFISSLREELITWD
FT                   NYPDLVPNTEHSEGKDMKYFVLTEREAAKSQIQRWRQAKNTYSGAEHFPTESNGLLIDQ
FT                   ILEQMKSADPFLAMQRKKPLGSFGIEYSSDRGYQMGDRGLFQQDCDVSLFFEQSSPAFL
FT                   SVLPSVEHVQDYKADRICVVSNTGSRKLYNY"
FT   gene            complement(<365191..>366253)
FT                   /locus_tag="KLTH0D03740g"
FT                   /old_locus_tag="Klth0D.mRNA.2750.m"
FT   CDS_pept        complement(join(365191..366136,366198..366253))
FT                   /locus_tag="KLTH0D03740g"
FT                   /old_locus_tag="Klth0D.mRNA.2750.m"
FT                   /product="KLTH0D03740p"
FT                   /note="similar to uniprot|P53290 Saccharomyces cerevisiae
FT                   YGR163W GTR2 Cytoplasmic GTP binding protein functions as a
FT                   negative regulator of the Ran/Tc4 GTPase cycle downstream
FT                   of its binding partner and homolog Gtr1p homolog of human
FT                   RagC and RagD proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22448"
FT                   /db_xref="GOA:C5DGA6"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039400"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA6"
FT                   /protein_id="CAR22448.1"
FT                   /translation="MNSEENSDKATILLMGLRRGGKSSICKVVFHNMQPLDTLYLESTS
FT                   NPTMEHFSTLIDLAVMELPGQLNYFEPNYDSERLFKSVGALVYVIDSQDEYMNALTNFA
FT                   IIVEYAYKVNPDINIEVLIHKVDGLSEDFKVDTQRDIMQRTGEELLELGLDGVQVSFYL
FT                   TSIFDHSIYEAFSRIVQKLVPELPFLENMLDNLVQHSKIEKCFLFDINSKIYVSTDSSP
FT                   VDIVTYETCAEFVDVTIDLHDLYKIQGKEDALAGSTGNKPPPEVKGVSALNNGVVIYLR
FT                   QMIRGLALVALIRPDDTDVESCLTVVDYNVDIFKKGLEQVWAHARITSPEGK"
FT   gene            <366599..>367396
FT                   /locus_tag="KLTH0D03762g"
FT                   /old_locus_tag="KLTH-ORF12277"
FT   CDS_pept        366599..367396
FT                   /locus_tag="KLTH0D03762g"
FT                   /old_locus_tag="KLTH-ORF12277"
FT                   /product="KLTH0D03762p"
FT                   /note="similar to uniprot|P53177 Saccharomyces cerevisiae
FT                   YGL050W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22449"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="InterPro:IPR036602"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA7"
FT                   /protein_id="CAR22449.1"
FT                   /translation="MVQDAFQQKKEHILAEIKSSSLDLSPKGTIDELCFPIMNLINSHM
FT                   DMVTTSSCSGRLSVFVEGNKVHDKEIKTGGKGEGGKWLFVTHDREQVKSWFEKLEEPVS
FT                   FQPDYNPGYMDASTRYILYKYEPFILHVKCRDFRSASALFNTAMSCGFRESGIGSNNIV
FT                   ALRVNIKLDVPIGYLNELTSKLVFFVDSKYIELMDHITLGKFTENENKMQELYKKIEAH
FT                   ILKAPLETPKDLDKVETKEERRERKIKEGLLRQKMVRSQDTQN"
FT   gene            complement(<367647..>370937)
FT                   /locus_tag="KLTH0D03784g"
FT                   /old_locus_tag="KLTH-ORF12275"
FT   CDS_pept        complement(367647..370937)
FT                   /locus_tag="KLTH0D03784g"
FT                   /old_locus_tag="KLTH-ORF12275"
FT                   /product="KLTH0D03784p"
FT                   /note="some similarities with uniprot|P39935 Saccharomyces
FT                   cerevisiae YGR162W TIF4631 also called eIF4 (eIF-4) gamma
FT                   mRNA cap-binding protein (eIF-4F) 150K subunit highly
FT                   homologous to Tif4632p homologs of mammalian p220"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03784g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22450"
FT                   /db_xref="GOA:C5DGA8"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022745"
FT                   /db_xref="InterPro:IPR036211"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA8"
FT                   /protein_id="CAR22450.1"
FT                   /translation="MSEQQTGEKPSGTESQQPVQPNQPYQQQQRYPRNSGQKSSGQKGS
FT                   RSNSKSYNGYQGNNGGNGGGNHRYNKNGFHHKNNRSAGAVPGMQWAYGSYGMAGQPQFY
FT                   PSYGYGYVPAMAAQGYNPAGGPSSSASPVEPAATLTPTTPVSKKIEITNRSGEHVDLNA
FT                   IHSQHISSSAGQPAHSPVKESSTPAAPTPEPKAAVEPSKPATPEPSKTEPSADDLLKMS
FT                   FLEQVRMRKAMRAQKKAGDSPSVQTAEVIASAPEVKTESAPEAATPTPKVPSENSSNDV
FT                   TNATQEAVSSDAQGIHEESIPKDAPKDDSATTQNPSVETVAEATSKAPVATDADAPSEQ
FT                   SETVVVKAVSKAAPEVISEAVPEAATEAAPETAPETAPETAPETAPEATPEATPEATPE
FT                   AVPEVAPEAAPESAPEPEKETSIVTENTEASEPVKEDAQPARPLTFSEKLKLKTKASAK
FT                   SDADTTATDTQPGETASTSEPTGEAEPQDASEKASEASEEAEVANTAPVEEEQKIDSAA
FT                   EPELQVSAEAKEPTGEEPKAEGDQEDSDVDDGRITMTEFLARLDQVSPVDDIYSFKYPE
FT                   GIEAPDARYKREKAKYTYGPTFLLQFKDKVNVRPDAEWKEKVASKIVIPPGSVRPGGRS
FT                   RGDSKFGPGAGFKKSGSLRGMEGRSNSRSSSKRKSKKMGDDRKSNRAYTSRKDRERMAE
FT                   EDDKPKEDVAPLIPSANRWVPKSKQKKTEKKFAPDGVTELLNKEEAQRKMKSLLNKLTL
FT                   EKFDPISEEIIKIADQSKWETDCETLKVVIEEIFMKACDEPHWSSMYAQLCGKVVKDMD
FT                   PEIKEEGNEGKAGPKLVLHYLVDRCHAEFQKGWTDKLPTKEDGSPLEPEMMSDEYYQMA
FT                   AAKRRGLGLVRLIGFLYRSHLLTAKMMFECFRRLMKDLADSPTEETLESVIELLNTVGE
FT                   QFEKDRLVQPSGSLEGSTVLDQLFYMLDKITESSEISSRIKFKLVDMKELREVKHWNST
FT                   KRDEGPKTIQQIHEEEAAKKAMEERERKMKGSSRSGSRRNNSNSMMGNRSNSRREPVSV
FT                   SKDSFISTRSSSLRHVQSAAPAKEETPAQKTAVNMFDALMGAESDDDE"
FT   gene            complement(<371457..>372674)
FT                   /locus_tag="KLTH0D03806g"
FT                   /old_locus_tag="KLTH-ORF12266"
FT   CDS_pept        complement(371457..372674)
FT                   /locus_tag="KLTH0D03806g"
FT                   /old_locus_tag="KLTH-ORF12266"
FT                   /product="KLTH0D03806p"
FT                   /note="highly similar to uniprot|Q01939 Saccharomyces
FT                   cerevisiae YGL048C RPT6 One of six ATPases of the 19S
FT                   regulatory particle of the 26S proteasome involved in the
FT                   degradation of ubiquitinated substrates bound by ubiquitin-
FT                   protein ligases Ubr1p and Ufd4p localized mainly to the
FT                   nucleus throughout the cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22451"
FT                   /db_xref="GOA:C5DGA9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA9"
FT                   /protein_id="CAR22451.1"
FT                   /translation="MSAAAVSEVTLNTHESGIKPFFDQKIQDTELKIRAKTQNLRRLEA
FT                   QRNALNDKVRFIKDELRLLQEPGSYVGEVVKVVSDKKVLVKIQPEGKYIVDIAKDINVK
FT                   DLKASQRVCLKSDSYALHKILENKVDPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVI
FT                   ELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYI
FT                   GEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRTMLELLNQLDG
FT                   FETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRIHSRKMNLTRG
FT                   INLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVMNKNDETAIS
FT                   VAKLFK"
FT   gene            <372909..>373505
FT                   /locus_tag="KLTH0D03828g"
FT                   /old_locus_tag="KLTH-ORF12264"
FT   CDS_pept        372909..373505
FT                   /locus_tag="KLTH0D03828g"
FT                   /old_locus_tag="KLTH-ORF12264"
FT                   /product="KLTH0D03828p"
FT                   /note="similar to uniprot|P53178 Saccharomyces cerevisiae
FT                   YGL047W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22452"
FT                   /db_xref="GOA:C5DGB0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB0"
FT                   /protein_id="CAR22452.1"
FT                   /translation="MGSTVVVTCGATVPFPELIAALLDKQVLDTLLRMHYTRLIVQYGR
FT                   GYTSKFAQLLGCVRAHVEEPADNGASNLAAGVEVQVRGHYQSLEVCGFEFTGAIHELLR
FT                   DNADLVISHAGTGSIVDALRLGKRLLVVANTSLMDNHQLQIARKFESRGHLQSAAAQPK
FT                   ALIAALRRVEAAPQVPLPNGYNSSFERLLMDVAQS"
FT   gene            complement(<373652..>373725)
FT                   /locus_tag="KLTH0D03850r"
FT                   /old_locus_tag="Klth0D.tVal.AAC.25"
FT   tRNA            complement(373652..373725)
FT                   /locus_tag="KLTH0D03850r"
FT                   /old_locus_tag="Klth0D.tVal.AAC.25"
FT                   /note="tRNA-Val (AAC) cove score=68.42"
FT   gene            <374437..>375381
FT                   /locus_tag="KLTH0D03872g"
FT                   /old_locus_tag="KLTH-ORF12263"
FT   CDS_pept        374437..375381
FT                   /locus_tag="KLTH0D03872g"
FT                   /old_locus_tag="KLTH-ORF12263"
FT                   /product="KLTH0D03872p"
FT                   /note="some similarities with YGR161c, uniprot|P53289
FT                   Saccharomyces cerevisiae Hypothetical ORF, RTS3
FT                   SGDID:S0003393"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22453"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB1"
FT                   /protein_id="CAR22453.1"
FT                   /translation="MEVTTHAQHKAVTLYKEPHHLDSVNWEEGLGKGCGKSAQQDLDQL
FT                   TVVDSIVVTPDAAPQSPQDYTRSGRPAVPHYTLSSSGSAMADKQHTFKAPSPARTPGRP
FT                   TRPTLNVQSSSSSSLSSLRSRARRLSSEEIINEMENEQDAIVVRLLREIDQLKDENNRL
FT                   RKNLCAVLNGDPQTPAGPALSRRSSLNSCASNSSGSGSLSSSHAGTTPGVLAATPTASS
FT                   PALSRRPSSSATPIDTLTPTLLLQRKRNSLSSSVPATPKNSGDFVDLYAPAPVSKFGAV
FT                   DVSLDAPGSCGYRRRRSSMKSTEGSNKLQRSTR"
FT   gene            <376254..>378374
FT                   /locus_tag="KLTH0D03894g"
FT                   /old_locus_tag="KLTH-ORF12262"
FT   CDS_pept        376254..378374
FT                   /locus_tag="KLTH0D03894g"
FT                   /old_locus_tag="KLTH-ORF12262"
FT                   /product="KLTH0D03894p"
FT                   /note="some similarities with uniprot|P08068 Saccharomyces
FT                   cerevisiae YIR019C GPI-anchored cell surface glycoprotein
FT                   required for diploid pseudohyphal formation and haploid
FT                   invasive growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22454"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB2"
FT                   /protein_id="CAR22454.1"
FT                   /translation="MLCRPILLLFTAFGGFASCISALSTTTITTESITTSFVCGRCTTN
FT                   QHETTLSSSSTTAVETSACHQCVTSQYESSLSSISTSVSSTSTIPTSPLSSTTISSTIV
FT                   STSYVCGKCTTNISFREVVVSSTSETVPSAKHSSSTPTSSTSASDESSSATPSSAMPSS
FT                   ATPSSAMPSSATPSSTTTASSTASSTTISTTTSSSSASSSSTISSFTISSTTPSSIASS
FT                   NATPSIITISSDTSSSSTLSSASSSVARTSSGNVESSPSGPKTTTTLNKSTTTETESCD
FT                   CTTYPGSSISTTTTLVSTISTSSSATTQSSTQSSTTSGTSSLSSEMSSSKSSASSVSLS
FT                   SSSKVSSRTGFSSTETSRATTVSETQHSLSSESNTPTTLTSIPGSLSTSATFSSFSSTA
FT                   FSSVSTSSPTAESVSSLVSSTPSVGSQTSSTLTSSTSFPGVPSSVTSSGNVPSSFSDIG
FT                   TSSTSVLTTTYSTTNSGSTSITLTTDSSFRTLESSASSTPASSTPASSTPASSTPASST
FT                   TASSTTASSTTVTVSSSLPGLNMSTTLSSSTLLSTTSPGQPISTASTSTGPLTIPTASN
FT                   SLPVLLVSTSCTAANDTNCAVPTTDSAPAPTSTSTPPSSSSSNASKSEEVPSSAASSSS
FT                   PATVSGPTSSQSSVHTTSSTFASYAPKSFSFGSTSTQPFPTASSTASLLSSYTGGASKA
FT                   VPRIAFAVLLLL"
FT   gene            <378839..>380356
FT                   /locus_tag="KLTH0D03916g"
FT                   /old_locus_tag="KLTH-ORF12255"
FT   CDS_pept        378839..380356
FT                   /locus_tag="KLTH0D03916g"
FT                   /old_locus_tag="KLTH-ORF12255"
FT                   /product="KLTH0D03916p"
FT                   /note="some similarities with uniprot|P27476 Saccharomyces
FT                   cerevisiae YGR159C NSR1 Nucleolar protein that binds
FT                   nuclear localization sequences required for pre- rRNA
FT                   processing and ribosome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22455"
FT                   /db_xref="GOA:C5DGB3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034272"
FT                   /db_xref="InterPro:IPR034276"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB3"
FT                   /protein_id="CAR22455.1"
FT                   /translation="MAKQVAKKVSKKDVKSKKQEKEAVAAKSESSSSSSSSESSSSSSE
FT                   SSSSSSESESESSSSSSSSDSESSDSSSDSEEEQEVKKDTKKDTKKDTKKEAKKDSKKD
FT                   SKKEAKKETVKEAKKGSKKAVAPESDSESGSESDTESSDSESSDSDSSSSSESESEAEA
FT                   EAETESKKAKESATSSSSSNSSSGSDSSSSSSSSESEGSSSSSDSDSSSEEEEAKEKDT
FT                   SSKKRKAEESDVSEESEDATESKKAKTESNGEPATIFVGRLSWSVDDEWLKTEFEPIGG
FT                   VISARVIMERGTDRSRGYGYVDFENKFYAEKAVKEMHGKEIDGRPINCDMSTSKPAGNP
FT                   RNDRAKQFGDTPSQPSDTLFLGNLSFNADRDNIFETFAEHGEVVSVRLPTHPETNQPKG
FT                   FGYVQYSSVDEAQKAFEALQGHYIDNRPVRLDFSTPKPRDEGSRGGFRGGRGGSRGGSR
FT                   GGFGGGRGGFGGGNRGDFKPSGSGSNSAPLGKGRQTAEFQGNKKKFD"
FT   gene            <380728..>382380
FT                   /locus_tag="KLTH0D03938g"
FT                   /old_locus_tag="KLTH-ORF12251"
FT   CDS_pept        380728..382380
FT                   /locus_tag="KLTH0D03938g"
FT                   /old_locus_tag="KLTH-ORF12251"
FT                   /product="KLTH0D03938p"
FT                   /note="similar to uniprot|P53180 Saccharomyces cerevisiae
FT                   YGL045W RIM8"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22456"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB4"
FT                   /protein_id="CAR22456.1"
FT                   /translation="MGFLTKLKAVSSRNSDPSISSTKVSAVSDAKTRYNYAKRSRFRHA
FT                   CAARDFYINQESPHKVWKPNEQISGEAVLVLKDDLENVAVRLSLIGEVRIRGSGSKTHC
FT                   DQLFEKTTLVYGDQEEVAPETRSIVNGLTKGEHRFPFRLKVPSKNIFTSIKFERGSISY
FT                   CIRCTLEPLRCSDPEKVLAACEKSISVMVPLDVSDMPKPNTKSVVLQSPSAVKQIKLAN
FT                   GEQDASSSFTRRTGGSKNSGSTVNTSGSLKTVTINVDLPSSGYVIGEVIPVKLNLCHYR
FT                   EYSHSTGLIATLVRICRVGGASKENPMEMYRKDICQTVSPIYVNPDTFECSVTVYLKIP
FT                   LDAFPTLRLPDRKFSFQYYVEVLVNLSRKNIAFTESNRVVDTTTNSHVSASPGKTIEET
FT                   FTLLQRKIRSGSETEPFKNNDRESMIFFKDLINVDKLKRLRNVTGMSIEVIVGTNRSEI
FT                   PQDSSLDEVEENPETTNSGLQSIDYTNTAVNNYTVAGYSPLGDCKDVLNFDGGSVLPLP
FT                   VYTPNSHYNAADDKDELELQRLQELESEPPMAT"
FT   gene            <382557..>383288
FT                   /locus_tag="KLTH0D03960g"
FT                   /old_locus_tag="KLTH-ORF12247"
FT   CDS_pept        382557..383288
FT                   /locus_tag="KLTH0D03960g"
FT                   /old_locus_tag="KLTH-ORF12247"
FT                   /product="KLTH0D03960p"
FT                   /note="similar to uniprot|P48240 Saccharomyces cerevisiae
FT                   YGR158C MTR3 3'5' exoribonuclease exosome subunit nucleolar
FT                   protein involved in export of mRNA and ribosomal subunits
FT                   homologous to the E. coli exonuclease RNase PH"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03960g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22457"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB5"
FT                   /protein_id="CAR22457.1"
FT                   /translation="MNITDRRRILGPSNAKPLVFERLESSEQAAQPPQEKNNENESMYI
FT                   KNGLVSNANGSSYLELKRGESSEQCTILLSSVYGPRPSRGAFSSKASLSVQFKEVTIEK
FT                   IPSGELKEICNFLSNIFSAVINLERYPKSGIDIFLSLIKNPITSDEANLEPIIAACVNG
FT                   ITLALADAGIEIFDTVSAGTYKRNVVAFSKNGTEVVGLWKDKEDDTANDILSVIENCRG
FT                   NYLQNRKGIIEYLIRSKNADI"
FT   gene            complement(<383372..>385900)
FT                   /locus_tag="KLTH0D03982g"
FT                   /old_locus_tag="KLTH-ORF12245"
FT   CDS_pept        complement(383372..385900)
FT                   /locus_tag="KLTH0D03982g"
FT                   /old_locus_tag="KLTH-ORF12245"
FT                   /product="KLTH0D03982p"
FT                   /note="similar to uniprot|P05374 Saccharomyces cerevisiae
FT                   YGR157W CHO2 First step in the methylation pathway for
FT                   phosphatidylcholine biosynthesis Phosphatidyl- ethanolamine
FT                   N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22458"
FT                   /db_xref="GOA:C5DGB6"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="InterPro:IPR016219"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGB6"
FT                   /protein_id="CAR22458.1"
FT                   /translation="MIKERKPSKSRAPGKGHKQIPGVAKESQPIARTRTGNVEFTPAKT
FT                   HDMVRSLFDPTLKKSFLECWISLAILSNVVLCYFMATKFGASFTKKFFLWQYVFWRLCY
FT                   NVGIGVVLHFQSNYETLTNFAKMRSLFSKKNQQWLARFCRFEIESKMPNTYCLEEYPEE
FT                   FNVWLLFRQFVDLILMQDFTTYILFVVLSIPKTVLSSHTVSFALGVIMILFNVWVKVDA
FT                   HRVVKDYAWYWGDFFFFQDSKLVFDGVFNVSPHPMYSIGYMGYYGLSLISGDYKVLLVS
FT                   IGGHLLQFLFLKYCENPHIEKIYGSDAVENDNAHIDELLVKENPNYSKPLITKGLWFTN
FT                   VDKLRLTDYFTILTVASIVLFTFFLKPSTKALFWATLVAKITTSLFISLVLHKQSTSKW
FT                   FTRLFLKNGYTQVHSFYQWQFLYNYCLTVSYTLLILQTWSQFRHLESRNYTQIIFGFLL
FT                   CWLQKWCDDEILTAISEFGWFYGDFFLTNYISSRKLNSRGIYRYLSNPERFLGVAGCWG
FT                   AVLITHFSPYNLILAALWTAANIALVKLVEEPHVSKVYGTSERKSGVSKTLMGFKPIRR
FT                   FSEIMDKMELRLVRHLTSNDSPFEEEAPTSEEAQWNEVVQLALQSVTANLAPNCEFKLG
FT                   DGKCDTFIIPGPVEAHWKLPSKLYNNDDWIGLYKVFETGEDRQRTRVSSNGRWTGTNEA
FT                   AFPYSGRPKKSIVKFQRTGDFVNGTVKFDHSLMFYEEGVYELRYHSGNTHKVLMISQPF
FT                   RLSLPIVKAESAEELSEGLHQFLAEVHALDGNSFNPNSNRYLGDRFLKGLIKKASGVDL
FT                   SVKYLRRINYDVSIIGKRVQEIKAVLENLE"
FT   gene            complement(<386364..>387077)
FT                   /locus_tag="KLTH0D04004g"
FT                   /old_locus_tag="KLTH-ORF12243"
FT   CDS_pept        complement(386364..387077)
FT                   /locus_tag="KLTH0D04004g"
FT                   /old_locus_tag="KLTH-ORF12243"
FT                   /product="KLTH0D04004p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22459"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR037047"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB7"
FT                   /protein_id="CAR22459.1"
FT                   /translation="MSHQCEHEHDHHHDSPPPATNNAQSLFSFVNTPNVQCLNTNSHGS
FT                   SDSAACFIKSRDDQYDVSKYLESDADCQMILHIPFTCICRIFSLVLRTSRSSSGTTSPK
FT                   TIKIFKNFSKNIDFDTLEDSKPQHEVEHPRDVGIDLDGAPRTEITDTDDSSFVEHHLPR
FT                   HLFQNAHSLTLFMQSAWEDDEDITRCFYLEMRGESAGQKRGNNAVPLLTVYESAPNPVD
FT                   HQKLENEQQGSSLGM"
FT   gene            <387535..>388557
FT                   /locus_tag="KLTH0D04026g"
FT                   /old_locus_tag="KLTH-ORF12240"
FT   CDS_pept        387535..388557
FT                   /locus_tag="KLTH0D04026g"
FT                   /old_locus_tag="KLTH-ORF12240"
FT                   /product="KLTH0D04026p"
FT                   /note="highly similar to uniprot|P05373 Saccharomyces
FT                   cerevisiae YGL040C HEM2 Delta-aminolevulinate dehydratase a
FT                   homo-octameric enzyme catalyzes the conversion of delta-
FT                   aminolevulinic acid to porphobilinogen the second step in
FT                   the heme biosynthetic pathway localizes to both the
FT                   cytoplasm and nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22460"
FT                   /db_xref="GOA:C5DGB8"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB8"
FT                   /protein_id="CAR22460.1"
FT                   /translation="MHTAEFLDAHPTEISSILAGGYNHPLLREWQNERQLTKNMFIFPL
FT                   FISDDADEETPIDSLPNIKRFGVNRLAQYLAPLIEKGLKAVILFGVPMKEGCKDQYGTA
FT                   ADDPEGPVIQGINLLRREFPDLYIICDVCLCEYTSHGHCGVLYDDGSINREESVRRIAA
FT                   VAVNYAKAGAHSIAPSDMIDGRIRDIKYGLIKAGLAHKTFVMSYAAKFSGNLYGPFRDA
FT                   ACSSPSSGDRKCYQLPSGGRGLARRALRRDLDEGTDGIIVKPSTFYLDIMADASEIARD
FT                   VPICAYHVSGEYAMLHAAAEKGVVDFKTIAFESHQGFLRAGARLIISYLTPEFLEWLGQ
FT                   "
FT   gene            complement(<388657..>389301)
FT                   /locus_tag="KLTH0D04048g"
FT                   /old_locus_tag="KLTH-ORF12237"
FT   CDS_pept        complement(388657..389301)
FT                   /locus_tag="KLTH0D04048g"
FT                   /old_locus_tag="KLTH-ORF12237"
FT                   /product="KLTH0D04048p"
FT                   /note="similar to uniprot|Q04272 Saccharomyces cerevisiae
FT                   YMR077C VPS20 vaculolar protein sorting (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22461"
FT                   /db_xref="GOA:C5DGB9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB9"
FT                   /protein_id="CAR22461.1"
FT                   /translation="MGQKGSKIEVTKTDKAILQIKLSKDELHRYTRRTEILIGREREKL
FT                   KALLREDPKNGKKNPRARILLKKIHYQNHLLEQAADQLINLENLVSTVEFKLVEQQFMM
FT                   GLKQGNEVLTKLNKEFSGAEDLMDSVADQIAYQDEVDQILSSSVVGGFEEELDRELQQL
FT                   DQEVNGPAHEPAKAEPNLPSTEGLPALSEPEAEEPQQEPQSDGRQREAVLT"
FT   gene            <389632..>390534
FT                   /locus_tag="KLTH0D04070g"
FT                   /old_locus_tag="KLTH-ORF12234"
FT   CDS_pept        389632..390534
FT                   /locus_tag="KLTH0D04070g"
FT                   /old_locus_tag="KLTH-ORF12234"
FT                   /product="KLTH0D04070p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22462"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC0"
FT                   /protein_id="CAR22462.1"
FT                   /translation="MSSNLTFVSQRSEKKNYGKPKPIPAYFPTSKKSILIPNFEFYDRV
FT                   KAAPRKLAATHAVPVRSGKAWKASKGSIVRISTPEGPQVCDFNCWEANSGFKEHMWASR
FT                   TRQLHSAHVSVYDKLWSNLPYLRPLLTIIDDSLAGYGPDEHGGRVHDLLGTRCDPYVDK
FT                   LLSGEDNDFHCHSNLYRAIREFGGEEEHVHDVLNIFQLTGLNENDQYFMETCPAKPGDY
FT                   FEFFCEVDVVCAVSSCPGGDLSDWGWGEGGTDSEANVGDMSAKCRPLKVEVFELENPEE
FT                   ALEGWESPQPVKYQGNHGF"
FT   gene            <391381..>392862
FT                   /locus_tag="KLTH0D04092g"
FT                   /old_locus_tag="KLTH-ORF12232"
FT   CDS_pept        391381..392862
FT                   /locus_tag="KLTH0D04092g"
FT                   /old_locus_tag="KLTH-ORF12232"
FT                   /product="KLTH0D04092p"
FT                   /note="highly similar to uniprot|P32582 Saccharomyces
FT                   cerevisiae YGR155W CYS4 Cystathionine beta-synthase
FT                   catalyzes the synthesis of cystathionine from serine and
FT                   homocysteine the first committed step in cysteine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22463"
FT                   /db_xref="GOA:C5DGC1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005857"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC1"
FT                   /protein_id="CAR22463.1"
FT                   /translation="MTQYDSRTSVADLVGNTPMVHLTKLPKALGVKPQVYAKLELYNPG
FT                   GSIKDRIAKSMIEDAEKSGRIHPSRTTLIEPTSGNTGIGLALMGAVKGYRTIITLPEKM
FT                   SNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKKLEKEIPHAVILDQYNNMKNPEAH
FT                   YQGTGKEIQGQLQQLGEYENLHGVFAGAGTGGTISGISKYLKEQNPEIKIIGADPEGSI
FT                   LAQPESLNETEAAEYKVEGIGYDFIPKVLDRGLVDTWYKTNDIDSFRYARQLIANEGLL
FT                   VGGSSGSAFSAMMKYCKDHPELTEKDVLVIILPDSIRSYLTKFADDEWLKKNNLWDDDI
FT                   LKPLGRSQKDIFKGATVKDLNLKPVVSVKENASTSDVVKILTDNGFDQLPVLTEDGKLC
FT                   GLVTLSQLLKGLSSGEEVSSIKGHFFDFRKLNNFDEVSSYNENKSGKKKFVNFDVNSKL
FT                   SDLNQFFEKNSSAVITDGLKPIHIVTKMDLLAFLA"
FT   gene            complement(<392935..>393360)
FT                   /locus_tag="KLTH0D04114g"
FT                   /old_locus_tag="KLTH-ORF12229"
FT   CDS_pept        complement(392935..393360)
FT                   /locus_tag="KLTH0D04114g"
FT                   /old_locus_tag="KLTH-ORF12229"
FT                   /product="KLTH0D04114p"
FT                   /note="similar to uniprot|P0C5N3 Saccharomyces cerevisiae
FT                   YGL041W-A Identified by expression profiling and mass
FT                   spectrometry"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22464"
FT                   /db_xref="InterPro:IPR024558"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC2"
FT                   /protein_id="CAR22464.1"
FT                   /translation="MFKTLLRSASSVPFRQPALPRAIVQTPRSLFYAKRCYAKSWDGNN
FT                   SSPDVEAHLKVQKLLDDIQQHPGVAAKLHAVSEIMVSKGLANESAPPGPWQVVKILTDK
FT                   DVRKAMGEFKAELEKSGIELGPDQLGPLMTVLGMEKK"
FT   gene            complement(<393617..>394498)
FT                   /locus_tag="KLTH0D04136g"
FT                   /old_locus_tag="KLTH-ORF12227"
FT   CDS_pept        complement(393617..394498)
FT                   /locus_tag="KLTH0D04136g"
FT                   /old_locus_tag="KLTH-ORF12227"
FT                   /product="KLTH0D04136p"
FT                   /note="similar to uniprot|P07273 YGL043W Saccharomyces
FT                   cerevisiae DST1 General transcription elongation factor
FT                   TFIIS"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22465"
FT                   /db_xref="GOA:C5DGC3"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003617"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR006289"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="InterPro:IPR035100"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="InterPro:IPR036575"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC3"
FT                   /protein_id="CAR22465.1"
FT                   /translation="MESKEVITLVKNLEKSKNNDESVIEILSLLDKDLKPTEKLLRETK
FT                   VGVVVNQFKKSSNAKIAGLVKKMIGEWRDAISREKKQRAMAKTGTTAASSSSATSSSEP
FT                   KRQGKFVSTKPRNAKNDGVVTTIYNHKLRDMVIRAFYDALAKESEHPPQSILTTAIAIE
FT                   KELNKVNNCELNEKAYKDKYRVVYANVISKNNPDLKHRITGGDVSPEYLVNCDPKELAP
FT                   EHLKKKNEEIARQNLFNAQGATLERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFC
FT                   TCEVCGNRWKFS"
FT   gene            <394755..>395537
FT                   /locus_tag="KLTH0D04158g"
FT                   /old_locus_tag="KLTH-ORF12223"
FT   CDS_pept        394755..395537
FT                   /locus_tag="KLTH0D04158g"
FT                   /old_locus_tag="KLTH-ORF12223"
FT                   /product="KLTH0D04158p"
FT                   /note="similar to uniprot|P25299 Saccharomyces cerevisiae
FT                   YGL044C RNA15 Cleavage and polyadenylation factor I (CF I)
FT                   component involved in cleavage and polyadenylation of mRNA
FT                   3' ends interacts with the A-rich polyadenylation signal in
FT                   complex with Rna14p and Hrp1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04158g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22466"
FT                   /db_xref="GOA:C5DGC4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR025742"
FT                   /db_xref="InterPro:IPR026896"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR038192"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC4"
FT                   /protein_id="CAR22466.1"
FT                   /translation="MMNRSVHNNPPARTVYLGSIPYDQTEEQILDLCSNVGPVANLKMM
FT                   FDPQTGKSKGYAFIEYKSLEASASAVRNLNGYQLGNRLLKCGYYSGGDMGGGGMPGNGN
FT                   ANDEDRSTVFSGLPPGVDVNINMTTPAMMISSVLSQGSKEEQLDLLKTLQKMAQADSDQ
FT                   FASLLEQCPQLSFVVAELLLTAGLSSVDDLTQLAVQQNSTNSTPEASQDPKVQEQQREL
FT                   LRQVLQLTDSEIAVLPDDEKMTLWDLKQRAMRGEFGML"
FT   gene            <395761..>396993
FT                   /locus_tag="KLTH0D04180g"
FT                   /old_locus_tag="KLTH-ORF12222"
FT   CDS_pept        395761..396993
FT                   /locus_tag="KLTH0D04180g"
FT                   /old_locus_tag="KLTH-ORF12222"
FT                   /product="KLTH0D04180p"
FT                   /note="weakly similar to uniprot|P39927 Saccharomyces
FT                   cerevisiae YGR156W PTI1 Pta1p Interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04180g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22467"
FT                   /db_xref="GOA:C5DGC5"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR025742"
FT                   /db_xref="InterPro:IPR026896"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR038192"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC5"
FT                   /protein_id="CAR22467.1"
FT                   /translation="MSDPRWRKARHLLTPELLSSSIQITNLPASWNESTISSIVAGSGP
FT                   IVNVSTKTDPRNGKLLGITVDYATSKDSKRALDVLRKIKKFPCDLERIMPNNKEQKEPR
FT                   KPLDLNRDAFPWEFGLELPFELVSEVPLPRRPTNPVPVSNSGPSGSDASSGVVAFPDIL
FT                   KEASKHLPGLQPNSMTSPDAISANLGKIAPLQLLEMISNLKILASQDANRDQLTKFLAS
FT                   NPDISVAVTQALLEMGFVNYSVVTKVIAEQPASRAHASPVPNNVQSIYSNGSTPGTTPM
FT                   NNSAPLNTFTAPVQQPQPQQPAPAPAVAPPMMFNAPPVPAFGFNGVAGPAPFMPAPMGA
FT                   PMGTPMAPPVVPPMPVANGAPRVNTMKLATLPQNQQDMIKQVLQLSPDQIRLLPPGQVA
FT                   MVENFKREYLM"
FT   gene            complement(<397110..>397223)
FT                   /locus_tag="KLTH0D04202r"
FT                   /old_locus_tag="Klth0D.tLeu.CAA.24"
FT   tRNA            complement(join(397110..397153,397186..397223))
FT                   /locus_tag="KLTH0D04202r"
FT                   /old_locus_tag="Klth0D.tLeu.CAA.24"
FT                   /note="tRNA-Leu (CAA) cove"
FT   gene            <397596..>398858
FT                   /locus_tag="KLTH0D04224g"
FT                   /old_locus_tag="KLTH-ORF12217"
FT   CDS_pept        397596..398858
FT                   /locus_tag="KLTH0D04224g"
FT                   /old_locus_tag="KLTH-ORF12217"
FT                   /product="KLTH0D04224p"
FT                   /note="similar to uniprot|P23542 Saccharomyces cerevisiae
FT                   YLR027C AAT2 Cytosolic aspartate aminotransferase involved
FT                   in nitrogen metabolism localizes to peroxisomes in oleate-
FT                   grown cells"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22468"
FT                   /db_xref="GOA:C5DGC6"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC6"
FT                   /protein_id="CAR22468.1"
FT                   /translation="MSCTIFNNVEQLPPDALFGIKQRLSQDPRPVKVDLGIGAYRDDSG
FT                   KPWVLPSVREAEEVIRQDPGYNHEYLGISGLTALIQGAAKVLFGEDSAALAEGRVVSTQ
FT                   SLSGTGALHVAARFISKFCGDKVVYLSDPTWANHNAIFETMGLKTATYPYWDAASKSLN
FT                   LEGYLEAIKTAPKGSVFVLHACAHNPTGLDPDQSQWTSILDAIIEREHIVLFDSAYQGF
FT                   ASGDLDRDAFAVRLGLQKLADVSPVIVCQSFAKNVGMYGERAGCFHLVLPRQDASVDTS
FT                   AIKSAVLSQLNKITRSELSNPPAYGAKIVATVLNTPRLTEQWHKDMVTMSSRIIKMRHA
FT                   LRDHLAKLNTPGNWDHIVNQTGMFSYTGLRPEMVKRLEEEHAVYLVSSGRASIAGLNSG
FT                   NVEYVAKAINEVVTHFGGAKL"
FT   gene            <399391..>400305
FT                   /locus_tag="KLTH0D04246g"
FT                   /old_locus_tag="KLTH-ORF12210"
FT   CDS_pept        399391..400305
FT                   /locus_tag="KLTH0D04246g"
FT                   /old_locus_tag="KLTH-ORF12210"
FT                   /product="KLTH0D04246p"
FT                   /note="similar to uniprot|Q01590 Saccharomyces cerevisiae
FT                   YLR026C SED5 Sed5p is a t-SNARE (soluble NSF attachment
FT                   protein receptor) required in ER to Golgi transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22469"
FT                   /db_xref="GOA:C5DGC7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC7"
FT                   /protein_id="CAR22469.1"
FT                   /translation="MDIRNRTTEFQRSVFAYSKRNGGGAPKPAAGDAAARKSEFQQKAS
FT                   TVAHEIAQTAQLLAKLAQLAKRKPMLNDNPVEIAELTYVIKRKIYSVEQSMLELSRLGG
FT                   KPGAPLPAQHSKNVMNLLNTKMKNISGDFKSVLEQRQRLEATNRDRWEKLSAQTDDEKA
FT                   RSPQVQQTYNSSNPFMSSVLEESPAGGSEAQLALPQDSSMLLLEEQNASSAYLQERSRA
FT                   VETIESTIQEVGNLFQQLAHMVQEQGEVIQRIDANVDDIDVNISGAQRELLKYFDRVSS
FT                   NRWLAVKIFAVLFVFFLVWVLVN"
FT   gene            complement(<400463..>401158)
FT                   /locus_tag="KLTH0D04268g"
FT                   /old_locus_tag="KLTH-ORF12204"
FT   CDS_pept        complement(400463..401158)
FT                   /locus_tag="KLTH0D04268g"
FT                   /old_locus_tag="KLTH-ORF12204"
FT                   /product="KLTH0D04268p"
FT                   /note="some similarities with uniprot|P39929 Saccharomyces
FT                   cerevisiae YLR025W SNF7 Involved in derepression of SUC2 in
FT                   response to glucose limitation involved in glucose
FT                   derepression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22470"
FT                   /db_xref="GOA:C5DGC8"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC8"
FT                   /protein_id="CAR22470.1"
FT                   /translation="MLSYFFGGGSTSKNKDAPKKAILDLREHITLLGKKEAHLQTQVAS
FT                   QEQQARTLLGKNNKTGAKNALKRKKTYESQLVKIQAQMDSLEQQLYSIESANLNLETMK
FT                   AMKQGASAMKNIHKGMDIDKVDETMDEIREQVELGEEISDAISRPLHAGAEVDEDEIDE
FT                   ELAALAQESVKQEVVAPPQGLPSVPLGKVSTPHAATLPAGQEQDAEAEEEEEDEDERAL
FT                   RELQAEMGL"
FT   gene            <402264..>402911
FT                   /locus_tag="KLTH0D04290g"
FT                   /old_locus_tag="KLTH-ORF12196"
FT   CDS_pept        402264..402911
FT                   /locus_tag="KLTH0D04290g"
FT                   /old_locus_tag="KLTH-ORF12196"
FT                   /product="KLTH0D04290p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04290g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22471"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC9"
FT                   /protein_id="CAR22471.1"
FT                   /translation="MHSESNTSPQQRIITSEQWVFDRRGSREESKAGGRPKRTPISKQE
FT                   RELRRKQRELENEQLQQEHQTVANENARLKAVVARLKQDIDAYTRLILEATAHASPAPA
FT                   QAVAQAQSTQGQAARETQDRGVALPQQALPQLLDELPPMETLLVNTAKRRKHAAAGGVR
FT                   TGAGADAGAQEQDPPVLKSTHADVMLAPQSAEVGPEEVALMRKLKDVLAEME"
FT   gene            <403678..>404184
FT                   /locus_tag="KLTH0D04312g"
FT                   /old_locus_tag="KLTH-ORF12189"
FT   CDS_pept        403678..404184
FT                   /locus_tag="KLTH0D04312g"
FT                   /old_locus_tag="KLTH-ORF12189"
FT                   /product="KLTH0D04312p"
FT                   /note="some similarities with uniprot|Q04487 Saccharomyces
FT                   cerevisiae YMR118C Hypothetical ORF and to YKL141W
FT                   uniprot|P33421 Saccharomyces cerevisiae YKL141W SDH3
FT                   Cytochrome b subunit of succinate dehydrogenase (Sdh1p
FT                   Sdh2p Sdh3p Sdh4p) which couples the oxidation of succinate
FT                   to the transfer of electrons to ubiquinone , member of
FT                   GLR.231"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22472"
FT                   /db_xref="GOA:C5DGD0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD0"
FT                   /protein_id="CAR22472.1"
FT                   /translation="MFSLGLNSGAFWARPLRTASRRMIATAKTSPARQQEILIAQRKNR
FT                   PVSPHLTIYQPQLTWYLSSLHRVSGVILAFGFFATTIAFGTSALLGLGLTSNNLARWYH
FT                   EKVPRWMDLTAKGSFAYLFAFHFANGLRHLIWDAGKALTLRGVYTTGYAVMAVMALGGT
FT                   YLLTW"
FT   gene            <404397..>405824
FT                   /locus_tag="KLTH0D04334g"
FT                   /old_locus_tag="KLTH-ORF12187"
FT   CDS_pept        404397..405824
FT                   /locus_tag="KLTH0D04334g"
FT                   /old_locus_tag="KLTH-ORF12187"
FT                   /product="KLTH0D04334p"
FT                   /note="similar to uniprot|P34163 Saccharomyces cerevisiae
FT                   YKL140W TGL1 Steryl ester hydrolase one of three gene
FT                   products (Yeh1p Yeh2p Tgl1p) responsible for steryl ester
FT                   hydrolase activity and involved in sterol homeostasis
FT                   localized to lipid particle membranes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22473"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD1"
FT                   /protein_id="CAR22473.1"
FT                   /translation="MPTVVPFLGRISFTDYVILFLVSLEKLLAVLLNCIPQALFDAAAL
FT                   LINCVTRKAVNPVDAMARQLRDARGIHEMGRLFDVDIEDHIVRTEDDYLLTVHRIAPRE
FT                   GSSNGQVVYLHHGLLMCSDVWMCNTARERNLPLVLHDLGFDVWLGNNRGNKYSTQHLYR
FT                   RPGSHEFWDFSIDEFAFFDIPNSIEFVLEHTQLPQLICIGFSQGSAQTFASLSVREDLN
FT                   SKISLFVAISPAMTPQGLHNRIVDSLLKSSPRLMYLFFGNRILLPSATVWQKTLHPTIF
FT                   NFIIDVANRVLFNWRSENISPHQKQASYAKLYSTTSVKSVVHWFQILHAQKFQMFEEYD
FT                   IVINSWNPTRSYQITTFPTRTNIRIPVLLLYGGSDSLVDIEVMKSNLPSSQVFDVMIPE
FT                   HEHLDLIWGRDVANLVIPNVLRFIWFFNDVKALDKEASFEGDADDYDDATGALDSVQDL
FT                   ASPFNKSYSASTSTKDI"
FT   gene            <405904..>407401
FT                   /locus_tag="KLTH0D04356g"
FT                   /old_locus_tag="Klth0D.mRNA.238.p"
FT   CDS_pept        join(405904..405987,406076..407401)
FT                   /locus_tag="KLTH0D04356g"
FT                   /old_locus_tag="Klth0D.mRNA.238.p"
FT                   /product="KLTH0D04356p"
FT                   /note="similar to uniprot|Q03957 Saccharomyces cerevisiae
FT                   YKL139W CTK1 Catalytic (alpha) subunit of C-terminal domain
FT                   kinase I (CTDK-I), which phosphorylates the C- terminal
FT                   repeated domain of the RNA polymerase II large subunit
FT                   (Rpo21p) to affect both transcription and pre-mRNA 3' end
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22474"
FT                   /db_xref="GOA:C5DGD2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD2"
FT                   /protein_id="CAR22474.1"
FT                   /translation="MLKNWKLYFLVLRHRKTTRCIKTTPLLDRTGPRPTGPSDASRNGP
FT                   HSAFPERSNGHQVSAAGSLGPERKRPRVGNSRYAGSRYQDAGFHSSSKQRLNVQNIPTG
FT                   HRDVPKRQSRYDPGNAKPKAVPVTVVVRERDSSVYERIQQVGEGTYGKVYKARNTLTGQ
FT                   LVALKRLRLEGEREGFPITSIREIKLLQSFDHRNISTLSEIMVESQKTVYMIFEYADND
FT                   LSGLLMNEQIVLSSANCKHLFKSLLEGIHYLHSNGILHRDIKGSNILIDNKGQLKITDF
FT                   GLARKMRDDSDYTNRVITLWYRPPELLMGSTNYGTAVDMWGCGCLLVELFQKTAIFQGT
FT                   NEVEQLNAIFSIMGTPSVEQWPTLFEMPWFFMMIPQQNRKYEPRFDEKFGAVLPSPAAV
FT                   SLAKGLLLYDEKRRLSASEALRHQYFREEPQPQPLDLSGFDGWHEFEAKRHRRKEREEQ
FT                   KRREKSESQGS"
FT   gene            <407803..>408396
FT                   /locus_tag="KLTH0D04378g"
FT                   /old_locus_tag="KLTH-ORF12173"
FT   CDS_pept        407803..408396
FT                   /locus_tag="KLTH0D04378g"
FT                   /old_locus_tag="KLTH-ORF12173"
FT                   /product="KLTH0D04378p"
FT                   /note="weakly similar to uniprot|Q04477 Saccharomyces
FT                   cerevisiae YMR117C SPC24 Component of the evolutionarily
FT                   conserved kinetochore-associated Ndc80 complex (Ndc80p-
FT                   Nuf2p-Spc24p-Spc25p) involved in chromosome segregation
FT                   spindle checkpoint activity and kinetochore clustering"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22475"
FT                   /db_xref="InterPro:IPR013252"
FT                   /db_xref="InterPro:IPR038066"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD3"
FT                   /protein_id="CAR22475.1"
FT                   /translation="MSEEALIENPSNLIRETRTNFSIVNDTEALSNISKNLNELQRIVK
FT                   EKLDRKSNELSQSESALEKNEARLDTLRRARTESGSGQLQGGSSEDVLEMARELESLER
FT                   RLVELRQEVDRGLEQLIEKNADDGKVQELEESQTEDPEHRTNVLKIQLYRSLGVVLDAD
FT                   NNRALISKDGTLDVVPVGGDASAYFRTKYLWDRI"
FT   gene            complement(<408480..>408875)
FT                   /locus_tag="KLTH0D04400g"
FT                   /old_locus_tag="KLTH-ORF12171"
FT   CDS_pept        complement(408480..408875)
FT                   /locus_tag="KLTH0D04400g"
FT                   /old_locus_tag="KLTH-ORF12171"
FT                   /product="KLTH0D04400p"
FT                   /note="similar to uniprot|P14063 Saccharomyces cerevisiae
FT                   YKL138C MRPL31 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22476"
FT                   /db_xref="GOA:C5DGD4"
FT                   /db_xref="InterPro:IPR016340"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD4"
FT                   /protein_id="CAR22476.1"
FT                   /translation="MFGPFKSSNTLLGGLLWKIPWRMSRPQKQRQRHRLQDVDSVIKSL
FT                   NLGLHAERSVQKGISYDEAINSSKQLKPGVKQLRLLNKPSLFPNEPQMSYKDKYTYFNK
FT                   QAKGYRKGIHKLPKWTKITQRRNPAFF"
FT   gene            <409088..>409414
FT                   /locus_tag="KLTH0D04422g"
FT                   /old_locus_tag="KLTH-ORF12169"
FT   CDS_pept        409088..409414
FT                   /locus_tag="KLTH0D04422g"
FT                   /old_locus_tag="KLTH-ORF12169"
FT                   /product="KLTH0D04422p"
FT                   /note="similar to uniprot|P36064 Saccharomyces cerevisiae
FT                   YKL137W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22477"
FT                   /db_xref="GOA:C5DGD5"
FT                   /db_xref="InterPro:IPR013892"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD5"
FT                   /protein_id="CAR22477.1"
FT                   /translation="MAQEQDTPQARRLPVWVLGPREEKEARQNLKKFAYSKCDEYVKAM
FT                   VECSKLHGLKVFPACEPQRDKMAECILSYQGDNYLDQQRDKLVQRKIEKLEEQLKQQQQ
FT                   NELK"
FT   gene            complement(<409499..>411616)
FT                   /locus_tag="KLTH0D04444g"
FT                   /old_locus_tag="KLTH-ORF12168"
FT   CDS_pept        complement(409499..411616)
FT                   /locus_tag="KLTH0D04444g"
FT                   /old_locus_tag="KLTH-ORF12168"
FT                   /product="KLTH0D04444p"
FT                   /note="similar to uniprot|P36000 Saccharomyces cerevisiae
FT                   YKL135C APL2 Beta-adaptin large subunit of the clathrin-
FT                   associated protein (AP-1) complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22478"
FT                   /db_xref="GOA:C5DGD6"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD6"
FT                   /protein_id="CAR22478.1"
FT                   /translation="MEKMLKKFIQNATRVAPKISKKGELFELRNGLVSQYPQTRKDAIK
FT                   KTIQQMTLGKDVSSLFPDILKNIATSDVEQKKLVYLYVMNYAETHPELCILAVNTFVSD
FT                   AQDTNPLIRCMAIRTMSMIRVDKILEYVEIPLRKTLQDDNPYVRKTAVICVAKLFALNK
FT                   ELCQELGVLEDLISALEDSNPMVVANAIAALSDIYEADESVVPLPKLIQSHVSQFLLAL
FT                   NECTEWARIIILGALAEYTAKDSLEAQEIIDRVTPHLQHVNAAVVLASIKVVIKNLPQV
FT                   QANTESPIFSKLSSALVSLMSTPPEMQYVALRNIRIVLEKYPHILSRELRIFYVKFNDP
FT                   LYVKLEKIDTLVRLVDPSNLKQCTLLLAELKEYAMEFEPEFVSRAILALSQLGVKYSEP
FT                   KFITKVLEIIIELCNTRDSFQDDCLVAMCNLLRHAGPDQEGMVTQVCSLAEAWSSVENL
FT                   LQTDYAKCNYIWLLGQFPQKFNNVERKLQASIDSFTQEESLTQMSLLISVVKLHSILPG
FT                   SMLQNLLELATTSTDEVDVRDMAIMYWRCLSVESSHDGLINELCNSSLPEIATTLDTFS
FT                   PELLETLLRELSLLSSVYFKPVSTMTKPKSSSGNHLKGKQLDELQFMAQDEILKNMNED
FT                   NLLDFDNDWPAASNSNYKSEAQGSTVDYLNDIFGLSSPAPPVENSMADLSLNKKDEKQK
FT                   SSNTQDLLDLF"
FT   gene            <413024..>414238
FT                   /locus_tag="KLTH0D04466g"
FT                   /old_locus_tag="Klth0D.mRNA.267.p"
FT   CDS_pept        join(413024..413560,413816..414238)
FT                   /locus_tag="KLTH0D04466g"
FT                   /old_locus_tag="Klth0D.mRNA.267.p"
FT                   /product="KLTH0D04466p"
FT                   /note="highly similar to uniprot|P38011 Saccharomyces
FT                   cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
FT                   protein) involved in translation regulation required for
FT                   repression of Gcn4p activity in the absence of amino-acid
FT                   starvation core component of the ribosome ortholog of
FT                   mammalian RACK1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22479"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD7"
FT                   /protein_id="CAR22479.1"
FT                   /translation="MSSAEVLVLRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITW
FT                   KLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRLWELASGKCIQRFV
FT                   GHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGECMVTLLGHNDWVSQVRVAPNETPE
FT                   DETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIML
FT                   WNLTEKEALYTLNAQDEVFAVAFSPNRYWLTAATSSGIKIFNLEERKVVDELKPEFAGY
FT                   TKAAEPHAISLAWSADGQTLFAGYTDNVIRVWQVMTAN"
FT   gene            <413639..>413725
FT                   /gene="SRN24"
FT                   /locus_tag="KLTH0D04488r"
FT                   /old_locus_tag="Klth0D_snoRNA_212"
FT   ncRNA           413639..413725
FT                   /gene="SRN24"
FT                   /locus_tag="KLTH0D04488r"
FT                   /old_locus_tag="Klth0D_snoRNA_212"
FT                   /product="snR24"
FT                   /note="C/D snoRNA intronic SNR24 (U24 RNA)"
FT                   /ncRNA_class="snoRNA"
FT   gene            <414739..>415074
FT                   /locus_tag="KLTH0D04510g"
FT                   /old_locus_tag="KLTH-ORF12161"
FT   CDS_pept        414739..415074
FT                   /locus_tag="KLTH0D04510g"
FT                   /old_locus_tag="KLTH-ORF12161"
FT                   /product="KLTH0D04510p"
FT                   /note="similar to uniprot|Q04438 Saccharomyces cerevisiae
FT                   YMR107W SPG4 Protein required for survival at high
FT                   temperature during stationary phase not required for growth
FT                   on nonfermentable carbon sources"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22480"
FT                   /db_xref="InterPro:IPR020485"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGD8"
FT                   /protein_id="CAR22480.1"
FT                   /translation="MGGIFDAFEVYNKKKHSSNPHMFGNTSNTGGTKTDYVYSSEYRAP
FT                   KKNKLMKDELLAPDSEHADGAKAMLTESAAQAGTPNMVDLSKLSQHELESLMKDLRKGE
FT                   PNNRVNF"
FT   gene            <417085..>419121
FT                   /locus_tag="KLTH0D04532g"
FT                   /old_locus_tag="KLTH-ORF12156"
FT   CDS_pept        417085..419121
FT                   /locus_tag="KLTH0D04532g"
FT                   /old_locus_tag="KLTH-ORF12156"
FT                   /product="KLTH0D04532p"
FT                   /note="highly similar to uniprot|P07342 Saccharomyces
FT                   cerevisiae YMR108W ILV2 Acetolactate synthase catalyses the
FT                   first common step in isoleucine and valine biosynthesis and
FT                   is the target of several classes of inhibitors localizes to
FT                   the mitochondria expression of the gene is under general
FT                   amino acid control"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22481"
FT                   /db_xref="GOA:C5DGD9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD9"
FT                   /protein_id="CAR22481.1"
FT                   /translation="MMRQSAGKMMLRRGISAALARNSARIGSLRLYSASATSTQTADDQ
FT                   RPRPAPSFDMEPSRSVKASKLRKSEMPLEAMDDSFIGLSGGQIFHEMMRRHKVNTVFGY
FT                   PGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYARVSGKPGVVLVTSGPGATNVVT
FT                   PMADALADGVPMVVFTGQVATSSIGTDAFQEADVIGISRSCTKWNVMVKNVEELPRRIN
FT                   EAFEIAVSGRPGPVLVDLPKDVTSAILRTPIPVKSTLPSNALSKITKSAAKEFTLANLQ
FT                   RAADLINIAKKPLIYVGGGIFGKEQGPKLLRELAERAQIPVSTTIQGLGAFDQEDPKSL
FT                   DMLGMHGSAFANLSVQNADLIIALGARFDDRVTCNVAKFAPEARKAALENRGGIIHFEI
FT                   SPKNINKVVEAQVAVEGDVTDNLERLIPLVNNVKERKEWFAQIDAWKKEYPYDYQRETK
FT                   DSKIKPQTLVARLSEVASSTGRDVIVTTGVGQHQMWAAQHWTWRHPRTFITSGGLGTMG
FT                   YGLPSAIGAQIARPDALVIDIDGDASFNMTLMELSSAVQAGAPVKIVVLNNEEQGMVTQ
FT                   WQSLFYEHRYSHTHQLNPDFVKLAEAMGLKGMRLSKQEDMDSVLKEFVNTEGPVLLEVI
FT                   VEKKVPVLPMVPAGKGLHEFINFDAEVEKEQNELRHKRTGGKH"
FT   gene            <419630..>423418
FT                   /locus_tag="KLTH0D04554g"
FT                   /old_locus_tag="KLTH-ORF12151"
FT   CDS_pept        419630..423418
FT                   /locus_tag="KLTH0D04554g"
FT                   /old_locus_tag="KLTH-ORF12151"
FT                   /product="KLTH0D04554p"
FT                   /note="similar to uniprot|Q04439 Saccharomyces cerevisiae
FT                   YMR109W MYO5 One of two type I myosins contains proline-
FT                   rich tail homology 2 (TH2) and SH3 domains MYO5 deletion
FT                   has little effect on growth but myo3 myo5 double deletion
FT                   causes severe defects in growth and actin cytoskeleton
FT                   organization and to uniprot|P36006 Saccharomyces cerevisiae
FT                   YKL129C MYO3"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22482"
FT                   /db_xref="GOA:C5DGE0"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035535"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036072"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGE0"
FT                   /protein_id="CAR22482.1"
FT                   /translation="MAIIKRGARNKTAQQPAKRSGQIKKATFESNKKKEVGVSDLTLLS
FT                   KISDESINDNLKKRFQNGTIYTYIGHVLISVNPFRDLGIYTDSVLKSYMGKNRLEVPPH
FT                   VFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASNTHSDSIGKIKDM
FT                   VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITNYLLEKQRVVGQLK
FT                   DERNFHIFYQFTKGASDNYRQLFGVQMPEQYIYTSASGCTSVDTIDDLSDFQATLKAMQ
FT                   VIGITQQEQDELFRLLSAILWIGNISFTENEEGNAQVCDTSVTDFVAYLLQVDAHFLTQ
FT                   ALVERVMETNHGMKRGSVYHVPLNVVQATAVKDALAKAIYNNLFDWIVDRVNVSLQAFP
FT                   GANKSIGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTLKSEQEEYAREQIQWTP
FT                   IKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSNAADQAFAQRLNLFSSNPHFELR
FT                   STKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELIGTSSNTFLSSIFPTTVDKNSKRR
FT                   PPSAGDKIIKSANELVETLSKAQPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENV
FT                   RIRRAGFAYRQTFDKFVERFYLLSPQCSYAGDYIWQGDTLDAVKLILKDASIPPSEYQL
FT                   GVSKVFIKTPESLFALETMRDKYWYNMAARIQRAWRRFLLRRVDAASRIQRAIREKKGG
FT                   NKYEKLRDSGTKLLAGRKERRSMSLLGYRAFMGDYLSCNEPKAKGAYIKRQAGINEKVI
FT                   FSINGESLHSKFGRSALRLRKAFILTPSHFYVIGQNAVQNQITYTVDYKIDVKQIKYVS
FT                   LTNLQDDWVGIFVANSTLPDPLINTYFKTELITHLKSLNKGIEVKIGPTLEYQKKPGKI
FT                   HVVKCQISESAPKYGDIYKSSTISVRKGHPATSKSHPKPKKKSTYQDYAPQHRTSTSIG
FT                   QPSIPTATRSTVVPTTGKQAPAKPPAPKIRQKKPAPPPPAKKQSQPAPSSNVANIAATA
FT                   AQAAYHPQPAVHNSEQEAGVNHGTPPRQTPMGASQGSRSRQEPKSNFATASSPAKSAVP
FT                   PPPPPPPPASKPSVPKFEAAYDFVGTGSPSELPLSKGDIVYISRQEPSGWSLAKTLDGA
FT                   KEGWVPTSYMTEHKGTAHAVSSSRPSQSTQPGVSSSTENSASTATSATFTAHSSGPDQN
FT                   SISNASSNPLASALAARANKVRQDSDEEEAEASEDDW"
FT   gene            complement(<423550..>425121)
FT                   /locus_tag="KLTH0D04576g"
FT                   /old_locus_tag="KLTH-ORF12146"
FT   CDS_pept        complement(423550..425121)
FT                   /locus_tag="KLTH0D04576g"
FT                   /old_locus_tag="KLTH-ORF12146"
FT                   /product="KLTH0D04576p"
FT                   /note="similar to uniprot|Q04458 Saccharomyces cerevisiae
FT                   YMR110C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22483"
FT                   /db_xref="GOA:C5DGE1"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGE1"
FT                   /protein_id="CAR22483.1"
FT                   /translation="MSLQYTPVDDIDEIVKLSKASFEERQAEISKFKNPRNHDLKLRLD
FT                   TLKSLYYSVKDHEAEIIEALLNDFKRSKHETVVMELVVLYNSILQYIKKLPHWIKPEKI
FT                   RESSALFMFSNVSVDRISLGSVLVISPFNYPVLLGLEPVAAAIAGGNSVVWKPSELVPN
FT                   TSRLLGNIISCHVSSKWLKVVQGAVTETTRLIQNPNFDKIFYTGSTKVGAIVAQEAAKH
FT                   LTPYTLELGGKSPVFITEHFSESNMRAALKRVFFGAFSNSGQTCVASDYVIVHESQIKK
FT                   IKELAKGVLDEFWPILDKDTDYTCMVHEKAYESAKKKLECTDGTTVQPSNVAAELPKNC
FT                   LPPTVVFDVGWDHALMKEENFAPFLPFVTYVDLDDAIAKVKKYHNNPLAMYIFSNNKHE
FT                   TERIMTQVKSGACMIGDTLVHVAAQNAPFGGIRQSGSGSYHGRWSYSAFTHERTVIRQP
FT                   FWTELMNGVRNPPYTPTKPKMAQAFIEAKPGFNRDGSTKWDSKKLVVYTVSGALVALGT
FT                   YRLAQS"
FT   gene            <425236..>425946
FT                   /locus_tag="KLTH0D04598g"
FT                   /old_locus_tag="KLTH-ORF12145"
FT   CDS_pept        425236..425946
FT                   /locus_tag="KLTH0D04598g"
FT                   /old_locus_tag="KLTH-ORF12145"
FT                   /product="KLTH0D04598p"
FT                   /note="similar to uniprot|P36068 Saccharomyces cerevisiae
FT                   YKL130C SHE2 RNA-binding protein that binds specific mRNAs
FT                   and interacts with She3p part of the mRNA localization
FT                   machinery that restricts accumulation of certain proteins
FT                   to the bud"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22484"
FT                   /db_xref="GOA:C5DGE2"
FT                   /db_xref="InterPro:IPR024261"
FT                   /db_xref="InterPro:IPR036827"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGE2"
FT                   /protein_id="CAR22484.1"
FT                   /translation="MKNVTFPANENVLKSLQLAIQSYSNYLSSYIDALNKYISHQRRVS
FT                   TLRFERATLIKYVKKLRFFNEELMSMDMVQQYRGGNLIKTAVCSLASFFIRCLEVMDLL
FT                   NYYLTQSLKNETISKTLNRDLVVSEDCVVFLESTYRHYVKFTQWMLEALDIHDATLTVE
FT                   VLQFARKCAKEDGLDLEETDDILLQEVGVVSSASEYQELLDEWCLVLSEQYMGLTKAFE
FT                   AETTRWSEIFEGRK"
FT   gene            complement(<425980..>427110)
FT                   /locus_tag="KLTH0D04620g"
FT                   /old_locus_tag="KLTH-ORF12144"
FT   CDS_pept        complement(425980..427110)
FT                   /locus_tag="KLTH0D04620g"
FT                   /old_locus_tag="KLTH-ORF12144"
FT                   /product="KLTH0D04620p"
FT                   /note="weakly similar to uniprot|Q04461 Saccharomyces
FT                   cerevisiae YMR111C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22485"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGE3"
FT                   /protein_id="CAR22485.1"
FT                   /translation="MMRNELVSNEEAEQNTPNKNSRVSDSVPSPTPVASAFQAVVLDQL
FT                   AKIQEQNEFLKTRVVQLEQEQEDFYIETCKKLEMGLKQFEKCATDVGALKEIFKEVVGV
FT                   MSEKRVLSWDHSNEHVTGQEAEDLVGSHLLHENHEAYRQQRDNEHRLEAAHAGGGTGWC
FT                   KTEESDMWTRLNYQDFEPPSSLVERSQSVSDAYKDDRSRYPCYKLNRSLRTVYEVAQEY
FT                   FAGLRGQPSLLALERRFGPSWRRKPSERTFYAKRMHIINKIIDIKNHPEKYNLPAGTTR
FT                   LQATSVVENIRLKNNSFPGKGRELSLNQLYIYFAKKMDRPSDYSLTLQTAPRRHVEGRS
FT                   SDVRHQQSTPLSNGSGEEDSEDPNVDSHHEGSDQEA"
FT   gene            complement(<427725..>428060)
FT                   /locus_tag="KLTH0D04642g"
FT                   /old_locus_tag="KLTH-ORF12142"
FT   CDS_pept        complement(427725..428060)
FT                   /locus_tag="KLTH0D04642g"
FT                   /old_locus_tag="KLTH-ORF12142"
FT                   /product="KLTH0D04642p"
FT                   /note="similar to uniprot|Q99278 Saccharomyces cerevisiae
FT                   YMR112C MED11 14 Kd mediator subunit of RNA polymerase II
FT                   holoenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22486"
FT                   /db_xref="GOA:C5DGE4"
FT                   /db_xref="InterPro:IPR019404"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGE4"
FT                   /protein_id="CAR22486.1"
FT                   /translation="MPQPEFIQERLESLNAVDNQLLSTLLHASQAVGTIEELKRGNENM
FT                   KSQFENHIRSFYGSLEEATVALRREIRHLDENVGTRLLPINVNKKAVGQDNEKMREQFE
FT                   HLEHEAS"
FT   gene            <428209..>429474
FT                   /locus_tag="KLTH0D04664g"
FT                   /old_locus_tag="KLTH-ORF12140"
FT   CDS_pept        428209..429474
FT                   /locus_tag="KLTH0D04664g"
FT                   /old_locus_tag="KLTH-ORF12140"
FT                   /product="KLTH0D04664p"
FT                   /note="similar to uniprot|Q12676 Saccharomyces cerevisiae
FT                   YMR113W FOL3 Dihydrofolate synthetase involved in folic
FT                   acid biosynthesis catalyzes the conversion of
FT                   dihydropteroate to dihydrofolate in folate coenzyme
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22487"
FT                   /db_xref="GOA:C5DGE5"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGE5"
FT                   /protein_id="CAR22487.1"
FT                   /translation="MSIELGLSRITNLLSHLGNPQDKFRVLHVAGTNGKGSVCSLLQSV
FT                   LQQNTLNLVGKFTSPHLIHITDCISVNNKPISTLDFNSIRTRLDHMNAAHQIGCTEFEL
FT                   LTCTALEYFHLKKCNWCVLEVGLGGRLDATNCTVGSQKVCGITKIGMDHQGFLGNTLQE
FT                   IAAEKAAIVTSGVPFVAVDGTNDKRVLDIVEKRASLVGATFSPTTTRISGHFIHTDSWG
FT                   KVAREAVALNGDYQKSNVAVALSMLDFLQREDQVSISREELIDGLKTVSWPGRLQNAEL
FT                   ILPQGQQTLKILLDGAHNGDAAEALASYIKEHVRRDSEPLRFLVAVTQGKDLEPLLSPL
FT                   IRSCDEVVVTKFGPVDRMPWISAMDPSDLARFVSKYTDHVLIQPNLQDAVAYLQNTSPR
FT                   QTVICGSLYLCGQLLQSTEVKW"
FT   gene            complement(<429482..>430489)
FT                   /locus_tag="KLTH0D04686g"
FT                   /old_locus_tag="KLTH-ORF12139"
FT   CDS_pept        complement(429482..430489)
FT                   /locus_tag="KLTH0D04686g"
FT                   /old_locus_tag="KLTH-ORF12139"
FT                   /product="KLTH0D04686p"
FT                   /note="similar to uniprot|Q04471 Saccharomyces cerevisiae
FT                   YMR114C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22488"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGE6"
FT                   /protein_id="CAR22488.1"
FT                   /translation="MCGRYALGYSGIDVGRRLTELDITYESPEDGPVNFESSYNIAPTQ
FT                   RAPVLTNHEHLRSMQWGLVPHWTKDVAKSQPYKTFNARKENIATSKMWATPCNYKRCVV
FT                   PVSGYYEWQTKGKTKIPYYITRKDRELMFLAGMYDHVEAQDFYSYTIITGPAPPELEWL
FT                   HFRMPVVLERGSKEWNMWLDESKTSWKESELEQTLKAYCDKSVLEWWQVSSEVGKVANN
FT                   GKCLVSPAKGAVRDFFKKEDKTKKSLVKGEQSSRSDFESSWKHEEKDDKKPSLHERDEN
FT                   SQKHSKEEPRKLEEASDVKQEPEVSLKSDLNQKTTSKRGIENMLRGSINKRQKR"
FT   gene            <431011..>432444
FT                   /locus_tag="KLTH0D04708g"
FT                   /old_locus_tag="KLTH-ORF12134"
FT   CDS_pept        431011..432444
FT                   /locus_tag="KLTH0D04708g"
FT                   /old_locus_tag="KLTH-ORF12134"
FT                   /product="KLTH0D04708p"
FT                   /note="similar to uniprot|Q04472 Saccharomyces cerevisiae
FT                   YMR115W FMP24 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22489"
FT                   /db_xref="GOA:C5DGE7"
FT                   /db_xref="InterPro:IPR040201"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGE7"
FT                   /protein_id="CAR22489.1"
FT                   /translation="MMLGSRFGVRSALRRAIQVKPKIKIPARALNTFASSASKYSTWQR
FT                   WAYTAGAFGALSLGLYYLYWPRHTFPQSVAKILRKALWEESDKKDHDYQCALKFYLQAI
FT                   GECDKLSMDRVSDEYTGIELKIAEMYERLNMNDEAHDLYLEMLYRYFDALHTPGRIPDD
FT                   KRPHLIQKDLRILIKSLEINKDIQVGKRNLLAHLLLAQEEVLSRSPELKEYFDKRKERT
FT                   TKLFQGKLDDEGVDFDNFLSEDNIKLNDESYLIVNLAKNSSAWEPFKEEFFTARDLYTA
FT                   YCLSTKDISSALSCKLTTVEWMVMADMPPGQILLSQANLGSLLYLQAETFETKIHQLNK
FT                   RREQDKSKAEDETMIRALRQLNRNKDTCFKMATQCYDSVIKFSRKNKKLRFNVKDFMDP
FT                   SAAHAIALSVYGMGVIHLHKHNLAKAERLLNDSINMAEETGFHELLKEAKQELKKVAKA
FT                   SQVDAIKLEDRDSSASDTV"
FT   gene            <432572..>434890
FT                   /locus_tag="KLTH0D04730g"
FT                   /old_locus_tag="KLTH-ORF12132"
FT   CDS_pept        432572..434890
FT                   /locus_tag="KLTH0D04730g"
FT                   /old_locus_tag="KLTH-ORF12132"
FT                   /product="KLTH0D04730p"
FT                   /note="similar to uniprot|P35999 Saccharomyces cerevisiae
FT                   YKL134C OCT1 Mitochondrial intermediate peptidase cleaves
FT                   N-terminal residues of a subset of proteins upon import
FT                   after their cleavage by mitochondrial processing peptidase
FT                   (Mas1p-Mas2p) may contribute to mitochondrial iron
FT                   homeostasis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04730g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22490"
FT                   /db_xref="GOA:C5DGE8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR033851"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGE8"
FT                   /protein_id="CAR22490.1"
FT                   /translation="MLSQALHVRKPSLLKSVCQLRVYSSFPVYHAKHDLRKVFDNQNYW
FT                   REINKDIYKYEESKGIGIFGKLGKHATPLQTGLFKNPFLTSSQGLRNFSMQSLKEAQQL
FT                   VDQMRQDRSHQGHLNYIRNLDRLSDMLCRVIDLCEFIRASHPDSQFVRAAQLCHEEMFE
FT                   FMNVLNTDSTLCEILKRVLSDDLIASKLSEEELKVGKILLEDFEKSGIDMAPEVGEQFI
FT                   NLSQQISIVGQEFISNTDFPKSEYVKVSCNELETSGISPLLLNHLSRDTKGQNYKVPTY
FT                   GYIAFSILRSCPSENIRMKVWTAVHSCPEKQITRLKHLVKLRGLLAQIMGKNSYSDYQL
FT                   EGKMAKSPVYVRGFVESLAEAIKPLAMRELRALANLKSSHLDLPIPKTDEEVLKFVRPW
FT                   DRDFYSTLISLQQQRKTLENEQINSYFSLGTVMQGLSSLLEDIYGIRLEPAVAKVGETW
FT                   SPEVRRINVVSDQEGVIGVVYCDLFERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQ
FT                   QPSSGQIFQLPVISLVCSFSQNSGSKKDVCLLQLSEVDTLFHEMGHAIHSMLGRTSLQN
FT                   ISGTRCATDFVELPSILMEHFAHDSRVLSRIGKHYITNEPVPDELLHLNQNELKYLQNT
FT                   ETFSQAKMAMLDQEMHSPRMLTDGPVDVVEIYHEVEKQMGVLTDDKSNWCGRFGHLLGY
FT                   GASYYSYLFDRAIASKVWQHLFANDPFSRKSGEKFKNSVLRWGGSRDPWNCIADALDKQ
FT                   SLSKGDEEAMKFIGNTEDV"
FT   gene            <435155..>435227
FT                   /locus_tag="KLTH0D04752r"
FT                   /old_locus_tag="Klth0D.tLys.CTT.3"
FT   tRNA            435155..435227
FT                   /locus_tag="KLTH0D04752r"
FT                   /old_locus_tag="Klth0D.tLys.CTT.3"
FT                   /note="tRNA-Lys (CTT) cove score=77.79"
FT   gene            <435339..>437147
FT                   /locus_tag="KLTH0D04774g"
FT                   /old_locus_tag="KLTH-ORF12131"
FT   CDS_pept        435339..437147
FT                   /locus_tag="KLTH0D04774g"
FT                   /old_locus_tag="KLTH-ORF12131"
FT                   /product="KLTH0D04774p"
FT                   /note="similar to uniprot|Q04437 Saccharomyces cerevisiae
FT                   YMR106C YKU80 Forms heterodimer with Yku70p known as Ku
FT                   binds chromosome ends and is involved in maintaining normal
FT                   telomere length and structure in addition to participating
FT                   in the formation of silent chromatin at telomere-proximal
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22491"
FT                   /db_xref="GOA:C5DGE9"
FT                   /db_xref="InterPro:IPR005161"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="InterPro:IPR024193"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGE9"
FT                   /protein_id="CAR22491.1"
FT                   /translation="MGSEATTFIVDVSPSMVGLGYVEQATAYIEYTLFLKSKKQRKTDW
FT                   VNCFLANCPYSRNNHETANVFELMPFTAPIGAHKVIEILKELKSLVTRSAPGKHNINSM
FT                   VQCLLVSSVSMRDEFKKRKVRKRIIVFTDNLDGLDLTEEELATLEQELDCSIVLVTCGL
FT                   KVEERKTSEIPIWEKCIQKISGSMEVSMTALLQEISTHRPAVVKPVRIFQGELRLGAPI
FT                   SDEDVTGPSYDSITVKVEGYPATKAVSSLNRRVVAKSEDGTFGPVKSVIEYEAIDDGED
FT                   SEGGVASVSKEYVTKAYRYGSDYVVLPQAIESERTYKTKPGLDLRGFVGNESIPRHFLS
FT                   SESTFIIPATKDGTRADFVSFSALVDSMIKLRKFAIARYVQKLNGEVQMCLLCPILIPK
FT                   KRKEPGDDETYTRALVLNRLPFAEDERCSDYPRLAQAAASSDAETAEIDALMGELIDTM
FT                   DLGPGPDQTWCSTTLYRSFDPTVLEPTLPLPRPTEPRDSSVQDALCVPAIGIYRQQQIL
FT                   IEYMHQRIVQGSADFEVPGLPNDLQKKLFPSNELSKGTLLKLQELLAIEVNNSRASSAT
FT                   PNDEQQDEDEFQEIPSLESLLARGRT"
FT   gene            <437416..>439128
FT                   /locus_tag="KLTH0D04796g"
FT                   /old_locus_tag="KLTH-ORF12128"
FT   CDS_pept        437416..439128
FT                   /locus_tag="KLTH0D04796g"
FT                   /old_locus_tag="KLTH-ORF12128"
FT                   /product="KLTH0D04796p"
FT                   /note="highly similar to uniprot|P37012 Saccharomyces
FT                   cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
FT                   conversion from glucose-1-phosphate to glucose-6-phosphate
FT                   which is a key step in hexose metabolism functions as the
FT                   acceptor for a Glc-phosphotransferase and to YKL127W
FT                   uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
FT                   Phosphoglucomutase, minor isoform; catalyzes the conversion
FT                   from glucose-1-phosphate to glucose-6- phosphate, which is
FT                   a key step in hexose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22492"
FT                   /db_xref="GOA:C5DGF0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGF0"
FT                   /protein_id="CAR22492.1"
FT                   /translation="MSLQIETVPTKPYNDQKPGTSGLRKKTKVFMNEPHYTENFIQAIM
FT                   EAIPEGSQDAVLVVGGDGRYYNNEVLQKIGEIGAANGVKKLIVGQNGLLSTPAASHIIR
FT                   SYPEKSTGGIILTASHNPGGPENDFGIKYNLSNGGPAPESVTNSIFEKSKQLASYKTVK
FT                   NFPKINLSKIGKNQEYGSLLVDVIDVTAEYVKLMKEIFDFDLIKKFIDHQRSTKGFKIL
FT                   FDALNGITGPYGKAIFADELGLPAEEVLQNYEPKPDFGGLHPDPNLTYAHTLVERVDKE
FT                   QIAFGAASDGDGDRNMIYGCGPAFVSPGDSVAIIAEYASEIPYFKKQGIYGLARSFPTS
FT                   AAIDRVAKAQGLNCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIVA
FT                   WLNILAIYNREHPDSDVSIKVVLDEFWAKYGRTFFTRYDFEQVSGEAAAKVLRVLEDLV
FT                   VSKESAIGKLLPGNTDLTVTDCGDFSYTDLDGSVSEHQGLYAKLSNGCRFVVRLSGTGS
FT                   SGATIRLYLERYTDDASKYSLNVEQFMKDDIKAVLKFLKFREYLGTDEPTVRT"
FT   gene            <439491..>441566
FT                   /locus_tag="KLTH0D04818g"
FT                   /old_locus_tag="KLTH-ORF12127"
FT   CDS_pept        439491..441566
FT                   /locus_tag="KLTH0D04818g"
FT                   /old_locus_tag="KLTH-ORF12127"
FT                   /product="KLTH0D04818p"
FT                   /note="similar to uniprot|P12688 Saccharomyces cerevisiae
FT                   or to YMR 104C, YKL126W YPK1 Serine/threonine protein
FT                   kinase required for receptor-mediated endocytosis involved
FT                   in sphingolipid-mediated and cell integrity signaling
FT                   pathways localized to the bud neck cytosol and plasma
FT                   membrane homolog of mammalian kinase SGK"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22493"
FT                   /db_xref="GOA:C5DGF1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGF1"
FT                   /protein_id="CAR22493.1"
FT                   /translation="MYSWKLASKFKFGRSKEEKEKEKEREKNKDKEKHGLFHHKSHRSE
FT                   SPYMEPPRGSVDRKETIVPSSSSIAPVRLSSDVNKSSATNSSASTGRTSMSTSGDQDTV
FT                   EDKNAASSFVGDKSSGKDSLIEEPRFSGIMTIKVYGGEGFMLPVSITSNVQILKKLLQS
FT                   GVINQASDDANVDELISSLSQLQVADPGDDENIIDGETAARYIPATITLPTSTTLNPLL
FT                   YFTLEFDNTVATIEPESGTISNLTFNKISTFDVTRKLNFLKMDVFARIPSILLPSKAWQ
FT                   QMNSSDPYIKDILDRINSNQDIHVGSCNLPLTLDFDSASTFRLYNHQWISLEQGNGKLN
FT                   ISVDYKPATNRALSIDDFDLLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSE
FT                   VTHTLAERTVLARVDNPFIVPLKFSFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRA
FT                   RFYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQEKTNTFC
FT                   GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP
FT                   DGFDKDAKDLLIGLLSRDPKRRLGFNGAEEIKSHPFFSQLNWKRLWMKGYIPPYKPPVM
FT                   NSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQFGGWTYVGSEQLGSSMAPTKSIR"
FT   gene            <441811..>443730
FT                   /locus_tag="KLTH0D04840g"
FT                   /old_locus_tag="Klth0D.mRNA.314.p"
FT   CDS_pept        join(441811..442005,442087..443730)
FT                   /locus_tag="KLTH0D04840g"
FT                   /old_locus_tag="Klth0D.mRNA.314.p"
FT                   /product="KLTH0D04840p"
FT                   /note="some similarities with uniprot|P36070 Saccharomyces
FT                   cerevisiae YKL125W RRN3 Required for transcription of rDNA
FT                   by RNA Polymerase I DNA-independent RNA Polymerase I
FT                   transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22494"
FT                   /db_xref="InterPro:IPR007991"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGF2"
FT                   /protein_id="CAR22494.1"
FT                   /translation="MMAIEKAAKRGADGMINSVETKKRRVEFADEVMVHDEDGEKHSNQ
FT                   DFSAKLYRNFVLSAIEDVERNDASQINTLASQLSLPSSSPDRISPGNLSILLQTLSYNI
FT                   SKLDTPLCTSLIQSVINFEKWWELPTATLGTYIFFIKILCSSLPKWWQDVSLPLISEFT
FT                   LPVDQTVQHHEMLKYFLRTIPTCTGFIDSYIAKFFPNKNDSKRNLVNYIANVLLLTDYC
FT                   NELRFQSWSLVIEKVISIDVELQNELDELDDDLENNIDDELDDGEVESDEDDQNLDNDS
FT                   DDDSANDLDDDDLMDGQEEYNVDVTQNIKQLSSKLDAILSLITKRLSQSLTAQSIENGD
FT                   GVSIFNTLISLFKSHILPTYYTRSIQYILFHVSQQQLELMDAFLVTLIDIAFSPNETIE
FT                   KRIKSLQYIGSFIARAKKLTNTQIIFVSSYLTSWLNRYVLEREEEVNQPGGVERFKHFY
FT                   AAFQALCYVFCFRHAIFRDGDTWECEIDKFFQRMVLSKFNPLKYCNENVMMMFARIAQH
FT                   EGVAYCFSIIENNNNERMKGIMGKSDSQGYNGVVSNWSLATRQQFIDLQSYFPYDPLFL
FT                   KTYKRMMRDYYIEWSDVSREYESDESDELDELNRDL"
FT   gene            complement(<443978..>445681)
FT                   /locus_tag="KLTH0D04862g"
FT                   /old_locus_tag="KLTH-ORF12121"
FT   CDS_pept        complement(443978..445681)
FT                   /locus_tag="KLTH0D04862g"
FT                   /old_locus_tag="KLTH-ORF12121"
FT                   /product="KLTH0D04862p"
FT                   /note="similar to uniprot|Q03162 Saccharomyces cerevisiae
FT                   YMR100W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22495"
FT                   /db_xref="GOA:C5DGF3"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGF3"
FT                   /protein_id="CAR22495.1"
FT                   /translation="MRDSNHRCVLLNRPSVTITSAVYDRRGLDCISEIPLINSLNHLTY
FT                   LTSNSAKVRETVANDGALVRLVSILHDCNIPLSEISEVQLTDEITPVERIQRQRKLAMV
FT                   AWKWTLAFQCLVLTGTRGTEHIRKQVVSSGVIPILATVLDNYLLLEKNYDFMAGGDLDF
FT                   DFKRTVLDGSISFEELTSSCGDEGLVEKCRELRTPSVMQLNTDFSSLWRASLGPGSNED
FT                   LEVDTYDNIAVSVPRTFIWGKIAPKADDVIWSLQLLAFISKYTHMKPYLQRVHLVKSLS
FT                   LRTEVSTVRKHLEQAFDISPLKISTEEEAKPVQNESDVAEEPKERTVDHNDPYLIEMEA
FT                   FCKNLNGSGLVFHNSRHCSSHREEFIDAPHRVIKMAKIEDKFSTKWDYDVFPKVLDEGT
FT                   WNHIIGTQYLNLFPLVERFTVKKENERDMTYWSSVVMRNSCRKNETTGVRQCANFACGK
FT                   WEDYPKRFAKCRRCKRTKYCSRECQLQSWNFHRYWCQEVTSSSAGNGSVNNGSERNTPH
FT                   EATSTAGSAVENATTDIPSATNEHSAFDATGSNTDNSQHINNRNTITGET"
FT   gene            <445884..>446492
FT                   /locus_tag="KLTH0D04884g"
FT                   /old_locus_tag="KLTH-ORF12119"
FT   CDS_pept        445884..446492
FT                   /locus_tag="KLTH0D04884g"
FT                   /old_locus_tag="KLTH-ORF12119"
FT                   /product="KLTH0D04884p"
FT                   /note="similar to uniprot|P32341 Saccharomyces cerevisiae
FT                   YKL119C VPH2 Protein involved in vacuolar H - ATPase
FT                   assembly or function required for the biogenesis of a
FT                   functional vacuolar ATPase (V-ATPase) but not part of the
FT                   final enzyme complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22496"
FT                   /db_xref="GOA:C5DGF4"
FT                   /db_xref="InterPro:IPR021013"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGF4"
FT                   /protein_id="CAR22496.1"
FT                   /translation="MFGIKLNSTLTKLLERLEGNAEAQDILEKGSISMKALLAFHSEHW
FT                   SHVGVKELLTPLDFAFKKVPERGTAYTDEFKEHLEKLRSEQEEKDYQAMVRRDGLGAML
FT                   EDREELTPAQMAKQVKEQITTVFNVLVSVVSVVFAVWYWTGSSTHMEPPTRVLLCLFGG
FT                   ILVLVADVVVYNSYLRKIEEARVRERSKKERKTVVKTLD"
FT   gene            complement(<446504..>447592)
FT                   /locus_tag="KLTH0D04906g"
FT                   /old_locus_tag="KLTH-ORF12117"
FT   CDS_pept        complement(446504..447592)
FT                   /locus_tag="KLTH0D04906g"
FT                   /old_locus_tag="KLTH-ORF12117"
FT                   /product="KLTH0D04906p"
FT                   /note="similar to uniprot|Q03175 Saccharomyces cerevisiae
FT                   YMR101C SRT1 Cis-prenyltransferase involved in dolichol
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04906g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22497"
FT                   /db_xref="GOA:C5DGF5"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGF5"
FT                   /protein_id="CAR22497.1"
FT                   /translation="MVEHNRSSNTVDVIEKELKQTKERFKPKAPPFPYVLSPMSILEYA
FT                   HAQKLRLWSFILSLACVSWALLQIQMTLTNILKMGPLPEHVSFIMDGNRRYAKSLSLPV
FT                   KSGHEAGAITLLNLLTVCRALGVKTVSAYAFSIENFNRPQEEVDTLTSLLAEKLDEVAR
FT                   RAQDCNSELFGLRLCVVGERSRISKELNDRISSVERMTSEGDSMMLYICFPYTSRNDIY
FT                   HAIYDCAETAKYHGFPAAQIDESVLTNHMMLRENSNNCDLLVRTSGHTRLSDYMLWQVH
FT                   QNGHVEFSSTLWPDYGFLEFFRVLLKWSFFTSVQRRRNSRRLLRLHTACHLKETLFPRA
FT                   PKHVSIEDLPSPPQAISVADRS"
FT   gene            complement(<447820..>448797)
FT                   /locus_tag="KLTH0D04928g"
FT                   /old_locus_tag="KLTH-ORF12114"
FT   CDS_pept        complement(447820..448797)
FT                   /locus_tag="KLTH0D04928g"
FT                   /old_locus_tag="KLTH-ORF12114"
FT                   /product="KLTH0D04928p"
FT                   /note="highly similar to uniprot|P32332 Saccharomyces
FT                   cerevisiae YKL120W OAC1 Mitochondrial inner membrane
FT                   transporter transports oxaloacetate sulfate and thiosulfate
FT                   member of the mitochondrial carrier family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22498"
FT                   /db_xref="GOA:C5DGF6"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGF6"
FT                   /protein_id="CAR22498.1"
FT                   /translation="MSKEAEISRVKTDADKPAAQKVTKTGSFIAGGLAACIAVTVTNPI
FT                   ELVKTRMQLQGEMSAESQRIYKNPWQSLKIIFKNEGIRGLQKGLSCAYIYQIGLNGSRL
FT                   GFYEPIRSLLNKTFYPNQDPHKVQNVAVNVVSGASSGIIGAIMGSPLFLIKTRMQAYSN
FT                   AIQIGQQTHYTSIWNGLSSIYRAEGLKGLYRGVDAAILRTGAGSSVQLPIYNTAKRFLL
FT                   NHDIMKEGTGLHLVASTLSGIGVGVVMNPWDVILTRVYNQKGNLYKGPIDCLIKTVRIE
FT                   GVSALYKGFEAQLFRIAPHTILCLTFMEQTMKFVYAVEKQILGA"
FT   gene            complement(<449060..>451402)
FT                   /locus_tag="KLTH0D04950g"
FT                   /old_locus_tag="KLTH-ORF12111"
FT   CDS_pept        complement(449060..451402)
FT                   /locus_tag="KLTH0D04950g"
FT                   /old_locus_tag="KLTH-ORF12111"
FT                   /product="KLTH0D04950p"
FT                   /note="weakly similar to uniprot|Q03177 Saccharomyces
FT                   cerevisiae YMR102C Protein of unknown function
FT                   transcription is activated by paralogous transcription
FT                   factors Yrm1p and Yrr1p along with genes involved in
FT                   multidrug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22499"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040324"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGF7"
FT                   /protein_id="CAR22499.1"
FT                   /translation="MHGPKPEFELSGSSTEDLILSKPSSQNSSETTSESSHSNGGDTES
FT                   GRRSVGGATCREFTTHIAPVQFEMSKPSFKIQDFSTRVLGPKEEAKELQKAHTASDDPA
FT                   DPVLNNIFGRINREQFKRYLKQPAYLRVFNKQPRIKQFRRLFLAQELRLDNGDITSSSN
FT                   TTLSTLSENNGRAVWATKFSRDGRFLATGGKDCTLRIWKVIASPLERNDLSNSTTKPQA
FT                   KRISLRMPPSAATGRSNKDELDQVTAPGLMDLYAPVFHPLPYRTFQGHTQDILDLDWSK
FT                   NGFILTTSMDKTARLWHCDRPKALKTFEHPDFVTCAKFHPNDDRFFLSGCLDHKLRLWS
FT                   ILDHSVSFEHYCGDIITAIDTSFGDGKYTAIGTFNGHISILYTRGLEMISTFHVMESSK
FT                   GRIRKSTESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFSVKNRTLLEVLRGFENAH
FT                   SQISAHTLSTTRKKMYVIAPSENQWVYCWKLESSAGAADLDESSNNKAHRHGSIRGLLR
FT                   RSLSIGSAHSSEKRSPPASDQLSGLTPSHKGKHEPIKNHHYIAFHAHHCTVTTTAVAPV
FT                   NTAKTLALSDDFICELTMALSEGEDDVAVMRQQHRKSLLHTKKQHQRENDLLQKRFPSM
FT                   IEAIGTIFVSTDSSGVIRVFRSDISTNVRKKVLSCLKRSSTPPKSESGSESNGSYMHSG
FT                   LLGSTVKAATSTLTKSRALGSSPSIKSLKSVSPSNEAPTSASPQAPCDLCGSTDLTRTK
FT                   GDPKLRLNTQAPVYICNSCGNQLVRAS"
FT   gene            <451606..>452004
FT                   /locus_tag="KLTH0D04972g"
FT                   /old_locus_tag="KLTH-ORF12108"
FT   CDS_pept        451606..452004
FT                   /locus_tag="KLTH0D04972g"
FT                   /old_locus_tag="KLTH-ORF12108"
FT                   /product="KLTH0D04972p"
FT                   /note="weakly similar to uniprot|P32342 Saccharomyces
FT                   cerevisiae YKL122C SRP21 Component of the signal
FT                   recognition particle (SRP) ribonucleoprotein (RNP) complex
FT                   that functions in protein targeting to the endoplasmic
FT                   reticulum (ER) membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22500"
FT                   /db_xref="GOA:C5DGF8"
FT                   /db_xref="InterPro:IPR039432"
FT                   /db_xref="InterPro:IPR039914"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGF8"
FT                   /protein_id="CAR22500.1"
FT                   /translation="MSVDALDSFITNSVTLLEANPSETVLSVTYNPKAKSGKVAFKTHN
FT                   SKLSTRFKFTTSRSKDVSRLLSALGPRGVSINNGKIEKKRTGKKVQAVGGMSTLLANVD
FT                   VPEALEEPIQQAKPSKPASGKKKKNKKR"
FT   gene            complement(<452121..>453644)
FT                   /locus_tag="KLTH0D04994g"
FT                   /old_locus_tag="KLTH-ORF12105"
FT   CDS_pept        complement(452121..453644)
FT                   /locus_tag="KLTH0D04994g"
FT                   /old_locus_tag="KLTH-ORF12105"
FT                   /product="KLTH0D04994p"
FT                   /note="similar to uniprot|P32343 Saccharomyces cerevisiae
FT                   YKL124W SSH4 Suppressor of SHR3 confers leflunomide
FT                   resistance when overexpressed (putative) involved in ER
FT                   functions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22501"
FT                   /db_xref="GOA:C5DGF9"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027713"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGF9"
FT                   /protein_id="CAR22501.1"
FT                   /translation="MQKLSAYSPTGFQISGDPLFDPPIGDHQDGEAISLVFLISLSVTF
FT                   AVLMLMLIIVAVYVTFCSTDESEYDEEVASALPNLFKKKRSGVLLDGSFLTPGQYDDEQ
FT                   ALLEQEAQELPRMSTFEVELYQRCREFQKMCPPIVKEFGTYTNINDKQFIKDRGIQSYY
FT                   FLPSINDNVDQYGNFLPSFIVQDKLDVTFTKFNRSSSAVMNYPLPHNKKDAVYFEVKVF
FT                   KYPAKSNSIFSCGLVTCPYPYFRMPGMAQFSIAYESTGKLRMNNPFYANTLLPKLQEGD
FT                   VIGFGYRYKTGTILITHNGKKLMDLTHNVGIDLFIGIGAMNAAYTRSYTREGLMEDCDN
FT                   VSLRERILASDMDQKAPRAIHEQLENVHDSHDEDLASDEIELQVNLGQLGFVYVEANVK
FT                   KYAFGSVYGEIGVPPAYNGDEIKKDVVLQKGEDLPPMYPTEELAPLAETTVTIREGEPS
FT                   SKDLEEYENRSSTFDREDGAEEVRPLKPRSNKKKNRKKNRKRGAKRGFK"
FT   gene            <454939..>455011
FT                   /locus_tag="KLTH0D05016r"
FT                   /old_locus_tag="Klth0D.tAla.AGC.4"
FT   tRNA            454939..455011
FT                   /locus_tag="KLTH0D05016r"
FT                   /old_locus_tag="Klth0D.tAla.AGC.4"
FT                   /note="tRNA-Ala (AGC) cove score=70.00"
FT   gene            <455340..>455918
FT                   /locus_tag="KLTH0D05038g"
FT                   /old_locus_tag="KLTH-ORF12098"
FT   CDS_pept        455340..455918
FT                   /locus_tag="KLTH0D05038g"
FT                   /old_locus_tag="KLTH-ORF12098"
FT                   /product="KLTH0D05038p"
FT                   /note="similar to uniprot|P28707 Saccharomyces cerevisiae
FT                   YKL117W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22502"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGG0"
FT                   /protein_id="CAR22502.1"
FT                   /translation="MSPTITPEVLWAQRSSSTDAEKNYLLVTIVIPDCSEPSLDLESTH
FT                   LEFKAKSPGHVGDEQEHQYHLRIDFFKEIDAKKSLGRVANGRNYFLKLYKKDLEEEYWP
FT                   RLTKEKLKYHYIKTDFNKWVDEDEQEEQEEEDFGFPGAGAGAGGQDAQAAALQELLKGG
FT                   GQGAGQQDQAAALQELLKNGGQGLGGEDA"
FT   gene            complement(<456032..>456922)
FT                   /locus_tag="KLTH0D05060g"
FT                   /old_locus_tag="KLTH-ORF12094"
FT   CDS_pept        complement(456032..456922)
FT                   /locus_tag="KLTH0D05060g"
FT                   /old_locus_tag="KLTH-ORF12094"
FT                   /product="KLTH0D05060p"
FT                   /note="highly similar to uniprot|Q03161 Saccharomyces
FT                   cerevisiae YMR099C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22503"
FT                   /db_xref="GOA:C5DGG1"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGG1"
FT                   /protein_id="CAR22503.1"
FT                   /translation="MSVEETDTEVILTHPENSKTFVKILKYGATVYSWSLEGQEQLWLS
FT                   SAAKLDGSKPVRGGIPLVFPVFGKNEDDEFLSKLPQHGLARNSTWEFLGQVSANPPTVQ
FT                   FGLGPELANPELTKLWPMDYSLILTVELGSGHLKTHIEVSNTSSSQPLKFNWLFHTYLK
FT                   IADIEDTLVSNLTGAKLYDQMLQESYVDRQPVVSFHEELDRIYQRVQEDRLIQVIDKGH
FT                   PIHTVKRHNLPDVVTWNPWVEKSKGMADFEPKSGFKEMVCVESGHVHSLLELQPGQSWT
FT                   AYQLLYKDELNYQVL"
FT   gene            complement(<457124..>458680)
FT                   /locus_tag="KLTH0D05082g"
FT                   /old_locus_tag="KLTH-ORF12092"
FT   CDS_pept        complement(457124..458680)
FT                   /locus_tag="KLTH0D05082g"
FT                   /old_locus_tag="KLTH-ORF12092"
FT                   /product="KLTH0D05082p"
FT                   /note="similar to uniprot|P28708 Saccharomyces cerevisiae
FT                   YKL116C PRR1 Protein kinase with a possible role in MAP
FT                   kinase signaling in the pheromone response pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22504"
FT                   /db_xref="GOA:C5DGG2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGG2"
FT                   /protein_id="CAR22504.1"
FT                   /translation="MDDKSAAMYRNSAAQAPKIAQAEFPAVEERPGHSDSIEVATTPPK
FT                   LSTSQFGEGDMNMLPTPLVYTPCSPGSAVRSPMEQKFPSTPSSATARAKKGYGGLMPIG
FT                   AELLNRSHILEDRQRILSEYAPHSALAPATASSLSQRVSSLSGVELKLDAIHEYAPASQ
FT                   SSLTAADPAQSDSEDVLTGYSVNDTSTPLYWRKVKQIGVGNFSDVYLYEVTEQNAAMPQ
FT                   KVAVKRVKYPEALTLSASPKSPRFREVLSRVENSLTRELEALLCVSHPCIIQFLAINDP
FT                   TFLNNKRPLSSRDLSRGLPPCDMVMSYCAGGDLFELASQNTLPDWLLRRIFTELTLAVK
FT                   YLHENLIVHRDLKLENVLIKYPLDDILAMREQPELLHNHHLVELADFGLCRRIEPEEMC
FT                   TTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPSAAPGKRQRRS
FT                   STAHRISRFEWRWIKMPESDSPAKEIVGNCLTRKNLRYSIQEIYKNPYVHELVPTLRFA
FT                   S"
FT   gene            complement(<458869..>460086)
FT                   /locus_tag="KLTH0D05104g"
FT                   /old_locus_tag="KLTH-ORF12091"
FT   CDS_pept        complement(458869..460086)
FT                   /locus_tag="KLTH0D05104g"
FT                   /old_locus_tag="KLTH-ORF12091"
FT                   /product="KLTH0D05104p"
FT                   /note="highly similar to uniprot|P22936 Saccharomyces
FT                   cerevisiae YKL114C APN1 Major apurinic/apyrimidinic
FT                   endonuclease 3'-repair diesterase involved in repair of DNA
FT                   damage by oxidation and alkylating agents controls
FT                   spontaneous mutations"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22505"
FT                   /db_xref="GOA:C5DGG3"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGG3"
FT                   /protein_id="CAR22505.1"
FT                   /translation="MRVSPASYHAFHPASNMYVKEFDSKKVVMLSKKNVVTHSTYSLTE
FT                   TVMSQFSRCSTSKYKFGAHISTAGGISNSVTNAYNIGCNAFAMFLKSPRKWVSPDYTQE
FT                   EIDKFKQKCKELGYNPLTDVLPHGQYFINLANPEPEKAEKSYASFIDDLKRCEQLGVGL
FT                   YNFHPGSSLKGNHAKQLRQLASYINKAIAETKFVKIVLENMAGTGSLVGSDLQDLKDVI
FT                   DMVENKDRVGVCVDTCHTFAAGYDISSKDSYDKFWQTFDKTVGFKYLSAIHLNDSKAPL
FT                   AANRDLHEKLGQGFLGLEVFKLVANSEFLRGIPVILETPHTKDEGYGHEIKLLEWLEGL
FT                   DEAKDQPEFESKSKDLLSEGAKSRNEQLAKFDKKKTKATKVSKKRANNGTDISQQLSSK
FT                   RAKKET"
FT   gene            complement(<460113..>461270)
FT                   /locus_tag="KLTH0D05126g"
FT                   /old_locus_tag="KLTH-ORF12087"
FT   CDS_pept        complement(460113..461270)
FT                   /locus_tag="KLTH0D05126g"
FT                   /old_locus_tag="KLTH-ORF12087"
FT                   /product="KLTH0D05126p"
FT                   /note="similar to uniprot|P26793 Saccharomyces cerevisiae
FT                   YKL113C RAD27 5' to 3' exonuclease 5' flap endonuclease
FT                   required for Okazaki fragment processing and maturation as
FT                   well as for long-patch base-excision repair member of the
FT                   S. pombe RAD2/FEN1 family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22506"
FT                   /db_xref="GOA:C5DGG4"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGG4"
FT                   /protein_id="CAR22506.1"
FT                   /translation="MGIKGLNAIISEHVPSAVRKSEIKNFFGRKVAIDASMSLYQFLIA
FT                   VRQQDGVQLASESGETTSHLMGIFYRTLRMIDNGIKPCYVFDGKPPVLKSHELSKRSAR
FT                   RATTEEKLKEAVEEAEKLKHERRLVKVTPEHNEEAKKLLRLMGLPYVEAPCEAEAQCAE
FT                   LAKAGKVYAAASEDMDTLCYRTPFLLRHLTFSEAKKEPIHEINTEILLQGLELSIEQFI
FT                   DLGIMLGCDYCDSIRGVGPVTALKLIKEHKTLENIVEYIESGQANNKWKVPENWPFKEA
FT                   RQLFLDPDVVKGSEVDLKWSEPQEQELVDFMCKEKGFNEERIRSGIKRLQKGLKTGVQG
FT                   RLDGFFKVKPKNKEQLAAANAKAKSTKAGKQATKGKVGKPGRPRK"
FT   gene            <462673..>464220
FT                   /locus_tag="KLTH0D05148g"
FT                   /old_locus_tag="KLTH-ORF12080"
FT   CDS_pept        462673..464220
FT                   /locus_tag="KLTH0D05148g"
FT                   /old_locus_tag="KLTH-ORF12080"
FT                   /product="KLTH0D05148p"
FT                   /note="some similarities with uniprot|P14164 Saccharomyces
FT                   cerevisiae YKL112W ABF1 DNA binding protein with possible
FT                   chromatin-reorganizing activity involved in transcriptional
FT                   activation gene silencing and DNA replication and repair"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22507"
FT                   /db_xref="GOA:C5DGG5"
FT                   /db_xref="InterPro:IPR006774"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGG5"
FT                   /protein_id="CAR22507.1"
FT                   /translation="MSLYEYKHPIINKELATGPDAASRKQFPTLEAWYDVVNDYEFQAR
FT                   CPIILKNSHRNKHFTFACHLKSCPFKVLLSYSGHNKDGPFEQHGGPGGAEHEVGGEHGH
FT                   GHPGASAGSPGAHNGGLKDEHDDVSAAIAAAVAAVTDGSNGNAAGGNGAGGNGLGGQVG
FT                   AGQAPGMGARSGSGSGPASGSPSDHNGSGDDSLLDPDDPQQMSSVRGPFTVTKIDPYHN
FT                   HPLESNLSLSKFVLTKVPRILQNDLKFDSILESLCNDEDNTVAKFRVSQYVEESGILDI
FT                   LKERYGLTDQDLDKKLLSHIARRITTYKARFVLKKKKNGTYGVPSSSMSAAAAAAAAIN
FT                   ANGGAGAGSGPHDQTDELGGKKRGYGAGHHHHNGVNGDVPGDHEDELEGRKRTRTNKIS
FT                   TAVKMGTRSSLVNDPALAQLDDVNDSEDNKPPEDLAEQLRLLSSHLKEVEQQQQQQQQQ
FT                   QQHQEQQHHQHHQHHQHQDDHQLHQHHQQHSQMAGHHHSPGKEDIPDENIQPELRGQ"
FT   gene            <464410..>466272
FT                   /locus_tag="KLTH0D05170g"
FT                   /old_locus_tag="KLTH-ORF12073"
FT   CDS_pept        464410..466272
FT                   /locus_tag="KLTH0D05170g"
FT                   /old_locus_tag="KLTH-ORF12073"
FT                   /product="KLTH0D05170p"
FT                   /note="weakly similar to uniprot|Q03153 Saccharomyces
FT                   cerevisiae YMR098C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22508"
FT                   /db_xref="GOA:C5DGG6"
FT                   /db_xref="InterPro:IPR025210"
FT                   /db_xref="InterPro:IPR040152"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGG6"
FT                   /protein_id="CAR22508.1"
FT                   /translation="MIERLILFNFQSDKNTKHTRVRNMLLRRAAAALPARKTPLHCYRR
FT                   LGGSYRALSGSLLLRDEEKRLPHRVQDERDEAKADTDLAADGDSAATKPWYLNIVERPA
FT                   QNMPLHQQEIVFPANSPKSLETIATFLRDKLGLSDVLIFDLRDSQDEQVTAASKISDFM
FT                   VMATAKSGRHGHKSFIELNTLLKQEFKTVGQVEGNISANELRRRQKRLARHTNLSKSMG
FT                   SRTATTRSGSNLESWYMIDCRLDNIFVNILTENKRQDLNLEELYAPPDQKHLYRREAPA
FT                   EDVAPKEGDDNVLAGLKRLAARNQRRYFTTVPARVQIIDALSRQDFDLVLNVVSASKMD
FT                   SLDILKAANQTLRSMPYGVKIEGESWITFLDEVWPLAPYSQDFWSTRLELFKLLNCAAP
FT                   GQVNVDRVFTGYLKFKLASGESLTKSDLVEFLQLVETNLSENSHVDYEDLVAKNKCVLE
FT                   ALKLYKGLDPRLILDSEVMCLLLSTLSITQSGSTSTLRAFYEMVEFASREFSQEPPVPV
FT                   TATVLRILADKQDYARILRFWEKSIASSPEKDHRPWPLFLDTVASTGDQEFAKKVIRDG
FT                   HLLWIKRNGVKASPELREAIERLFAVADPAEVAFKDVKEFLTVE"
FT   gene            complement(<466301..>467233)
FT                   /locus_tag="KLTH0D05192g"
FT                   /old_locus_tag="KLTH-ORF12070"
FT   CDS_pept        complement(466301..467233)
FT                   /locus_tag="KLTH0D05192g"
FT                   /old_locus_tag="KLTH-ORF12070"
FT                   /product="KLTH0D05192p"
FT                   /note="similar to uniprot|P34253 Saccharomyces cerevisiae
FT                   YKL110C KTI12 Protein associated with the RNA polymerase II
FT                   Elongator complex involved in sensitivity to G1 arrest
FT                   induced by Kluyveromyces lactis toxin zymocin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22509"
FT                   /db_xref="InterPro:IPR013641"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGG7"
FT                   /protein_id="CAR22509.1"
FT                   /translation="MPLVLFTGFPSSGKTSKAKELVELLSAKIEQEPELSKYSIVCHSD
FT                   ESLGIQHTDYVTSQDERKLRSKIMSAVKRDLSRHKIVVVDSLNYIKGFRYQLHCEVKNL
FT                   MTTYCLVHVMSPSAKILEWNESTADGRVPWPTDLLNQLIQRYEEPNPQTRWDSPLIPVL
FT                   ASEDSLQSFAEPIYKALFPQLYRSDNDREADKLLNSLKPNNATILKPATQTNALQVLDS
FT                   ETTAVVKKVMSALQSNVVAGVSRIIVSDVQDINDERCMYVEMPPQGVTVAQLQRIRRQF
FT                   VAMNRLRSLEKHRIAPLFVDYLNKNLRDM"
FT   gene            <467366..>468493
FT                   /locus_tag="KLTH0D05214g"
FT                   /old_locus_tag="KLTH-ORF12067"
FT   CDS_pept        467366..468493
FT                   /locus_tag="KLTH0D05214g"
FT                   /old_locus_tag="KLTH-ORF12067"
FT                   /product="KLTH0D05214p"
FT                   /note="similar to uniprot|Q03151 Saccharomyces cerevisiae
FT                   YMR097C MTG1 Peripheral GTPase of the mitochondrial inner
FT                   membrane essential for respiratory competence likely
FT                   functions in assembly of the large ribosomal subunit has
FT                   homologs in plants and animals"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05214g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22510"
FT                   /db_xref="GOA:C5DGG8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGG8"
FT                   /protein_id="CAR22510.1"
FT                   /translation="MFKRCYTTFVPRFKFPEYRIPLTDFKGHQVRALQRFQQLLPQLNL
FT                   LLELRDSRAPISTRNVIFDDLVARGRGEKTQRLVLYTKSDLCPKETIDKLRNWHGEMGD
FT                   EFMTLDCRSAREVKSLVKLLEWKYDRVVEKMVGQAAGEGGGLPLGYRVLVAGMPNVGKS
FT                   TLVNSLRFVGAARTGNSSESVHGSVAHRRRKVAKTGGQAGVTRATSECIRIADHRGGIY
FT                   LYDTPGVSLPGRVTTREKMLSLSQCGCVKSNLVDPVIQADYLLYLMNLQSPAVYEQYTK
FT                   GVPTNNIYKLLGGVRRTTGIRDDNGAAIHWVDKWRQGPRRGAHRVSFDVETLLDDTSFS
FT                   YRELVSRELELLGPWSVAPSKPSAKAKNSNQLFDL"
FT   gene            <469109..>470785
FT                   /locus_tag="KLTH0D05236g"
FT                   /old_locus_tag="KLTH-ORF12056"
FT   CDS_pept        469109..470785
FT                   /locus_tag="KLTH0D05236g"
FT                   /old_locus_tag="KLTH-ORF12056"
FT                   /product="KLTH0D05236p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22511"
FT                   /db_xref="GOA:C5DGG9"
FT                   /db_xref="InterPro:IPR018287"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGG9"
FT                   /protein_id="CAR22511.1"
FT                   /translation="MPLKHLPIQPATVSIAPNPHPHAGTRDARKPGGAGLVIRTSRQWV
FT                   LPPRPKPGRKPSADPAAGGRAGAHKTTTAAAPAKPELKPIQQVQQSASAQSALSGQSAT
FT                   GTASATSRRSSAAPSTAASTTSTPVTAPAAARRASPAPPVSPHSQDPGLAPQPKQRSSV
FT                   AGTATVSAPATSTATAAAKKPTKTALKKEIQQLKLENFKLKQELGQLAGNLQDLKHRYS
FT                   QCDTSAKACPTFPKKRSFLDSLVDAEFDTTDSFLKFEDDDEDTGHPLIQGVCMKPTMSF
FT                   SSQYSSRTNLTDDEDPGFSSSTPSSLFSAELQRSVTNTSFAGGSSAGGSGSGGCGNASG
FT                   LATSYHCMHSSASATSPHHHTSSPCNVAGVKLAAASIDTAKFLDDYEQSVFQNKYRHLL
FT                   EQDTRAKSVVTTASAKDQLYAAATASVMTPTFTGDLHLDAIKEEDLNFKLDHDFGNDDI
FT                   SILNFLEDNAPDGGPATTTTATAVTDHIPPWVVKEEEQAADINLFQDFDTSPTLPKPDF
FT                   RIPPSLEELMGDAEPAERHLDNEIKREDDDSLLKMDVFEFA"
FT   gene            complement(<471090..>471977)
FT                   /locus_tag="KLTH0D05258g"
FT                   /old_locus_tag="KLTH-ORF12052"
FT   CDS_pept        complement(471090..471977)
FT                   /locus_tag="KLTH0D05258g"
FT                   /old_locus_tag="KLTH-ORF12052"
FT                   /product="KLTH0D05258p"
FT                   /note="highly similar to uniprot|P43545 Saccharomyces
FT                   cerevisiae YFL059W SNZ3 Member of a stationary phase-
FT                   induced gene family transcription of SNZ2 is induced prior
FT                   to diauxic shift and also in the absence of thiamin in a
FT                   Thi2p-dependent manner forms a coregulated gene pair with
FT                   SNO3 and uniprot|P53824 Saccharomyces cerevisiae YNL333W
FT                   SNZ2 and YMR096W uniprot|Q03148 Saccharomyces cerevisiae
FT                   YMR096W SNZ1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22512"
FT                   /db_xref="GOA:C5DGH0"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGH0"
FT                   /protein_id="CAR22512.1"
FT                   /translation="MSEFKVKAGLAQMLKGGVIMDVVNAEQAVIAERAGACAVMALERI
FT                   PADMRKSGQVCRMSDPKMVREIMAAVSIPVMAKVRIGHTVEAQILQALQIDYIDESEVL
FT                   TPADKQNHIRKSEFTVPYVCGAKNLGEALRRISEGAAMIRTKGEAGTGDVSEAVKHITQ
FT                   IRAEIAWAKENLRTAEELEAHAKELRVPVELLKDVLSRGKLPVVNFAAGGVATPADAAL
FT                   LMQLGCDGVFVGSGIFKSSNPDKLARAIVQATTHYEDPMKLLEVSTDLGDLMAGVSIDS
FT                   INKGNGIRLSEVGW"
FT   gene            <472544..>473308
FT                   /locus_tag="KLTH0D05280g"
FT                   /old_locus_tag="KLTH-ORF12048"
FT   CDS_pept        472544..473308
FT                   /locus_tag="KLTH0D05280g"
FT                   /old_locus_tag="KLTH-ORF12048"
FT                   /product="KLTH0D05280p"
FT                   /note="similar to uniprot|P43544 Saccharomyces cerevisiae
FT                   YFL060C SNO3 Protein of unknown function nearly identical
FT                   to Sno2p expression is induced before the diauxic shift and
FT                   also in the absence of thiamin and uniprot|P53823
FT                   Saccharomyces cerevisiae YNL334C SNO2 and uniprot|Q03144
FT                   Saccharomyces cerevisiae YMR095C SNO1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22513"
FT                   /db_xref="GOA:C5DGH1"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGH1"
FT                   /protein_id="CAR22513.1"
FT                   /translation="MSRVKSSIASYETKCVTSDANNIAHNGKSRTVGVLALQGAFAEHV
FT                   EYLEACIAQHGYPVHVMPVRTAAQLERCDALVIPGGESTAMTQIASRMGLHEALARFVQ
FT                   DPRRSVWGTCAGLILLAREAADAAPAAAPQRPAALVEPLKALEVAVRRNAFGRQAQSFV
FT                   ATCDFSAFLGPSETQGFPAVFIRAPVIDHVIDPERVEVLHRLAGADGAPGTGPIVAVRQ
FT                   GRILGTSFHPELADDTRFHDWFLRDFVLGDHK"
FT   gene            complement(<473487..>474623)
FT                   /locus_tag="KLTH0D05302g"
FT                   /old_locus_tag="KLTH-ORF12046"
FT   CDS_pept        complement(473487..474623)
FT                   /locus_tag="KLTH0D05302g"
FT                   /old_locus_tag="KLTH-ORF12046"
FT                   /product="KLTH0D05302p"
FT                   /note="weakly similar to uniprot|P35203 Saccharomyces
FT                   cerevisiae YMR094W CTF13 Subunit of the CBF3 complex which
FT                   binds to the CDE III element of centromeres bending the DNA
FT                   upon binding and may be involved in sister chromatid
FT                   cohesion during mitosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22514"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGH2"
FT                   /protein_id="CAR22514.1"
FT                   /translation="MNGQLTQLRPPTNYELFAEAYPVYKVNKKRKRNRELWTKLHKFVE
FT                   LFEYLPGFVDLWLEYMECLRYDSITLDYMRMNRELDGKLTELEWIVVGSEAKLAMFSRE
FT                   GVLQVQYQIKEYHKFIDSEFRPRVTMNTAHLDEGAEAPSVVRALQKLELLDLVNSVVFY
FT                   QDEDSASEETILQMVANLEALRGLESVRVVGQMLFERVVNFHGVRDHPGRTIGYVVRKR
FT                   VSQLLVERCASIGGKRNIADFTRWDHVSRIKLSKVRELDLTRTMLPLGCRWLRLENIDK
FT                   LKWWEQRTVEAELPESCLVCSNPPRAGEPAVWQVDRAAMGEEVLLRCQALLWEIYGRLS
FT                   CLQLINVREIDRAPVVPRAWRGARFYCWRSMVSRITFV"
FT   gene            <474688..>475833
FT                   /locus_tag="KLTH0D05324g"
FT                   /old_locus_tag="KLTH-ORF12045"
FT   CDS_pept        474688..475833
FT                   /locus_tag="KLTH0D05324g"
FT                   /old_locus_tag="KLTH-ORF12045"
FT                   /product="KLTH0D05324p"
FT                   /note="weakly similar to uniprot|P34252 Saccharomyces
FT                   cerevisiae YKL108W SLD2 Protein required for DNA
FT                   replication phosphorylated in S phase by S-phase cyclin-
FT                   dependent kinases (Cdks) phosphorylation is essential for
FT                   DNA replication and for complex formation with Dpb11p
FT                   potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22515"
FT                   /db_xref="GOA:C5DGH3"
FT                   /db_xref="InterPro:IPR021110"
FT                   /db_xref="InterPro:IPR040203"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGH3"
FT                   /protein_id="CAR22515.1"
FT                   /translation="MFPNLTLLRANTSLDINKPKFHDFSDELTKNIINRLNMDMGQLKL
FT                   ELKRFEKQFQRKYKRLPARDDVRALPEIKEKYKQYSAFQLARQRKDAAPNVGATPRRYE
FT                   GGTPRRHEEVELGPTPQIYGKAISLFEMKLSPLKPVTVVSPQASSHSPQAVTTEVHQVT
FT                   TAEIHQFKSQPDLSLTPKRSPKKTTYGPNSPMKFDNVQLSVHTPRRNLRALLDDSVNDT
FT                   TGSPSPIIKRPPGKPLRQILEEHEKLMEDLEEMSDEEVVRANVKDIFQDDSDATEDEET
FT                   DEAMLIKKPKRKHILRPAKNALAAQQPFQVNIHEEMERLKQQAASGIDGTIPVKKPASD
FT                   AKASNPKTRRGNRKYNLVSNNFRRLKLPKAKGKGGKRWGRR"
FT   gene            complement(<475917..>477440)
FT                   /locus_tag="KLTH0D05346g"
FT                   /old_locus_tag="KLTH-ORF12044"
FT   CDS_pept        complement(475917..477440)
FT                   /locus_tag="KLTH0D05346g"
FT                   /old_locus_tag="KLTH-ORF12044"
FT                   /product="KLTH0D05346p"
FT                   /note="highly similar to uniprot|Q04305 Saccharomyces
FT                   cerevisiae YMR093W UTP15 Nucleolar protein component of the
FT                   small subunit (SSU) processome containing the U3 snoRNA
FT                   that is involved in processing of pre-18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22516"
FT                   /db_xref="GOA:C5DGH4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018983"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGH4"
FT                   /protein_id="CAR22516.1"
FT                   /translation="MSSSRPRATLVRAPVLPEQTTPEQRYWRSYGSTQLVKEHNSVTSI
FT                   SFNPTHPNDFAITSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMGDATGR
FT                   VSIYDSYNPRTQLVSIAASSHPTHVAKFHPADSRTLVTASDDRVVRVWDITQAQEPQVE
FT                   LTGAADYVRSVCMVPQAPHLVVTGSYDGFVRLFDTRSNEAATTLVQGMPVEDVIAVSPT
FT                   QLVSCGGPKFKVWDLTAQRQLLERVNFAKTVTCLDHVELMEDSPMSSTLVASSLDGHVK
FT                   VFDPLDGYKVKFGWKFSSPVLSCAVSPGNAQGNKHLVAGLSSGLLAIRTKRRAEKSEKI
FT                   DIEKVAKSSNFQRMMRGSEYAGDQEHIIHNDKTRPQRKLRAFERHMNQFKWAEALDAAF
FT                   VSGMAKELTLTALHELRRRGKIRVALIGRDESSLEPLLNWCLRGIEDVRSATVVADWVA
FT                   VVLELYGDLIAKSSVLEEMIVALKDKVKQEVHRAEEAQKIEGMLQLLVS"
FT   gene            <479606..>481438
FT                   /locus_tag="KLTH0D05368g"
FT                   /old_locus_tag="KLTH-ORF12039"
FT   CDS_pept        479606..481438
FT                   /locus_tag="KLTH0D05368g"
FT                   /old_locus_tag="KLTH-ORF12039"
FT                   /product="KLTH0D05368p"
FT                   /note="similar to uniprot|P46680 Saccharomyces cerevisiae
FT                   YMR092C AIP1 Actin cortical patch component probable
FT                   binding site on actin lies on front surface of subdomains 3
FT                   and 4"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22517"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGH5"
FT                   /protein_id="CAR22517.1"
FT                   /translation="MANLDLKTVFPPVPAAERNFATKISFNPQIKCVAYGCGKAVYVRS
FT                   LDDDFCVQFIGHGTAKVTVVRFSPAKGSQYLCSGDEHGRVMVWDWTRDENGQVSTALKS
FT                   EFQVLAGPITDISWDMEARRLCVVGEGRDKFGAFISWDTGNSLGELSGHSQRVNACHIK
FT                   QSRPMRCFTVGDDGACVFFQGPPFRFSGSDRTHHDQGKFIRDVKFSPGPGAYAVSVGSD
FT                   RKIVCFDGKSGEFVKYIEDPTDPVQGGLYAVDWIDEGDSSKKFVTASADAAVRMWDVES
FT                   GKCVQKWTLEPTLPNQQVGIATISETQVVSVSLDGSLNIFQVGQKSPVKRIVGHNKTIT
FT                   ALATSPLVSGSYDGRIIEWSSDPNSAKMLNYHSNLVVAIENMNHTATTSWDSTFQIDGK
FT                   VCCTFSSQPKVAASHEGVKAVVTLDNKLQILDCENGNILSSRELSGNASSVGLGKQFIA
FT                   VGYEQSNDIEVFKLSDLSVSFTLTNGLRATPSCLSLSPSEKYLAAGDVMGKILLFDLET
FT                   KGVKTSRWAFHTGRINGMSWRPTEKGSEEEEEDLIATASLDTHVFVYSLKRPMKSIKHL
FT                   NAHKDGATCVAWDGPSTLYSAGADSCIREWHLTL"
FT   gene            <481640..>482977
FT                   /locus_tag="KLTH0D05390g"
FT                   /old_locus_tag="KLTH-ORF12036"
FT   CDS_pept        481640..482977
FT                   /locus_tag="KLTH0D05390g"
FT                   /old_locus_tag="KLTH-ORF12036"
FT                   /product="KLTH0D05390p"
FT                   /note="similar to uniprot|P32832 Saccharomyces cerevisiae
FT                   YMR091C NPL6 Nuclear protein that may have a role in
FT                   nuclear protein import"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22518"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGH6"
FT                   /protein_id="CAR22518.1"
FT                   /translation="MSIDSPSYEGESPVGRRSTSVSERPDYTIEDDGIELKEDDKDEDY
FT                   QEEAAEEEEEANGDGEADGEASGNEEKAPPVTESFPKVHRLPAQPRRGRPPKRKNVADN
FT                   NLTAVDDSRNSSNSSMSGHLKRPHLSFPVDENGEPLPVVNDEYALPDDPEGETKINRDG
FT                   DLLGGRQFLVRTFTLSSRGERKYMLSTEPARAVGFRDSYLFFQYHPNLYKLIISQEERN
FT                   DLIDRGVIPYSYRSRTIALVTARAVFKEFGAKIIVDGKNITDDYYVGRLREEGRVVEGT
FT                   YAREPTNKLMGRSANGLNIPNVSVNPAKNAVEFFDRRNHNIAPGSNISSTNWLYQHAAA
FT                   CSRFNSDLFYDRERALLIEHQGLRDPYTNTLHLPQSTQPTQVLRYVKKPIEFSDKKVIY
FT                   ETVIEDKDLTRRNIGLANVPVEVFEDVVDDDVKQAILEQQRFEQNI"
FT   gene            <483268..>485709
FT                   /locus_tag="KLTH0D05412g"
FT                   /old_locus_tag="KLTH-ORF12033"
FT   CDS_pept        483268..485709
FT                   /locus_tag="KLTH0D05412g"
FT                   /old_locus_tag="KLTH-ORF12033"
FT                   /product="KLTH0D05412p"
FT                   /note="similar to uniprot|P40341 Saccharomyces cerevisiae
FT                   YMR089C YTA12 Component with Afg3p of the mitochondrial
FT                   inner membrane m-AAA protease that mediates degradation of
FT                   misfolded or unassembled proteins and is also required for
FT                   correct assembly of mitochondrial enzyme complexes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22519"
FT                   /db_xref="GOA:C5DGH7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGH7"
FT                   /protein_id="CAR22519.1"
FT                   /translation="MSTLLRPYSRLLWARLRCTRAFTSPRFTPMYKIARLHTNPSLFQK
FT                   PPSDKGSNKDANDEDLENVRREVERYIEEAKNDKSVDWEQRKKRIDEGIARLEETILRQ
FT                   QNKHHDEPKEQSGREAEPSESKEEGPSEFEKKQAFEQNKKLNDRKKAEEEKLSKIMNDP
FT                   NARVLAVNIGFLEIGVLLFLLSFLLNRLYNTEEQREITWQEFRTKLLAKGYVAKLVVVN
FT                   KSFVKVVLNENGKNHPEHNGHDFYFFTIGSVESFEHKLQRAQEEIGIAEDFKTPVVYVQ
FT                   EGNWAKAMYQILPTALMIGGLIWITKRSASGAGGGGPGGIFSVGKSKAKRFNKDTDVKV
FT                   TFKDVAGCDEAKEEIMEFVSFLKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAGE
FT                   AGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPSIVFVDEIDAIGKARQKGNFSG
FT                   ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELE
FT                   GRKQIFQVHLAKVKLAGSMEDLKNRLAALTPGFSGADISNVCNEAALTAARNECTSVKL
FT                   EHFEQAIERVIGGVERKSKLLSPEEKKIVAYHEAGHAVCGWYLEFADPLLKVSIIPRGQ
FT                   GALGYAQYLPGDVYLLSEQQLKDRMTMALAGRVSEELHFPSVTSGASDDFQKVTRMATA
FT                   MVTELGMSDKIGWLNYQKKSESDLTKPFSEETAAIVDAEVFRLVQECHDRCTALLKEKA
FT                   EDVEKITQLLLEKEVLTREDMIRLLGKRPFPERNDAFDKYLNESETKRLRKNEADQGMS
FT                   S"
FT   gene            <486319..>488049
FT                   /locus_tag="KLTH0D05434g"
FT                   /old_locus_tag="KLTH-ORF12028"
FT   CDS_pept        486319..488049
FT                   /locus_tag="KLTH0D05434g"
FT                   /old_locus_tag="KLTH-ORF12028"
FT                   /product="KLTH0D05434p"
FT                   /note="similar to uniprot|Q04301 Saccharomyces cerevisiae
FT                   YMR088C VBA1 Permease of basic amino acids in the vacuolar
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22520"
FT                   /db_xref="GOA:C5DGH8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGH8"
FT                   /protein_id="CAR22520.1"
FT                   /translation="MSGSPPGEDTALLGSISEENECDVGLEREYHEHNLALPKIPILVS
FT                   LWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATG
FT                   RKLATLIAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSIAVSDICTAKER
FT                   GMYQGYANIVFGSGQLLGAPLGGLLITTIGWRAIFAIQVPMALFCMFLTGRNVNIKLAH
FT                   LPSRNERFTLKNLSRLDLLGSCTLVLSISGLLFLFSTSMNRTWISAFTIVTFAIFIYNE
FT                   RFWAKERIIPFDLLCGTSGITSLLTVLSSFIMFGDVFRSPIYLQIVQNVSLAKSGIFIL
FT                   FGSVACAATSVLTGWIIRRTTMDLVKCTYLIVLVMIFLQLVGTASNAILIANLIPNNTT
FT                   YADKDVAIKVALSAKGFTWKVVYVFSTVLNSFGYGGVLVAVLVSIVFTVPKSQQATLTG
FT                   VFYLWRSIGNVLGTSITLALYDLILKSKLRVFMEAHGLSKSYSKLVRDSGYLRNHFSGE
FT                   TLAELLGVYNESFLWSFGPNIVVGLVAVILAYVLVRKYRPLEQQGVHLAAGERSDACKH
FT                   "
FT   gene            complement(<487952..>488734)
FT                   /locus_tag="KLTH0D05456g"
FT                   /old_locus_tag="KLTH-ORF12024"
FT   CDS_pept        complement(487952..488734)
FT                   /locus_tag="KLTH0D05456g"
FT                   /old_locus_tag="KLTH-ORF12024"
FT                   /product="KLTH0D05456p"
FT                   /note="similar to uniprot|Q04299 Saccharomyces cerevisiae
FT                   YMR087W Putative ADP-ribose-1''-monophosphatase that
FT                   converts ADP-ribose-1''-monophosphate to ADP-ribose may
FT                   have a role in tRNA splicing contains an A1pp domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22521"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR028071"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGH9"
FT                   /protein_id="CAR22521.1"
FT                   /translation="MKVILLDKNRALVSAWKKTLDGFKHVSFHIGTLEDLPQKVLGTNA
FT                   AVVSPGNSFGFLGGGFDLAIQSFFGGKQFEKFFRKRIGEFYKPVGETTIVDLDHWARNG
FT                   IRYIVHIPTVVAPTRKVFDTEHPVETGYQLVFNAMWSALVRAPKNVETLIVPGLGTGYL
FT                   GIPKAVCSKAMAFALNLFFANETMSVELRNVLIMHFLGFRYEGFFPADYKEECAKLGIE
FT                   LDKLKHFNVCKHPIAHLLPNEHLAAQEGDTSEPIHKPV"
FT   gene            <488881..>490146
FT                   /locus_tag="KLTH0D05478g"
FT                   /old_locus_tag="KLTH-ORF12023"
FT   CDS_pept        488881..490146
FT                   /locus_tag="KLTH0D05478g"
FT                   /old_locus_tag="KLTH-ORF12023"
FT                   /product="KLTH0D05478p"
FT                   /note="similar to uniprot|Q01802 Saccharomyces cerevisiae
FT                   YKL106W AAT1 Mitochondrial aspartate aminotransferase
FT                   catalyzes the conversion of oxaloacetate to aspartate in
FT                   aspartate and asparagine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22522"
FT                   /db_xref="GOA:C5DGI0"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGI0"
FT                   /protein_id="CAR22522.1"
FT                   /translation="MLKRQLHKVPAAIYKIPRAPPDKILGLTEEFNKDKNPNKTNLTVG
FT                   IYKDNWGHVTTFPSVARAQMVLDQSFEMNTDLSYLPIEGCPDFQSNVLQFLYKESCPEG
FT                   AEFLSKNRISFVQTLSGTGALAVASKLLSLFMSKAVWIPNPSWPNHANVFQNNGFKRIN
FT                   YYTYYRDGGLDVDSWLQDLEQAVRDGDGSPQCIVLHACCHNPTGVDPSLEQWRTILDKI
FT                   NELNLIPIIDMAYQGLDTGDLHKDAYLLRMSLDEERYQWPNGLFLCQSFAKNMGLYGER
FT                   VGSLSVVTPADTELKLNIDSQLKKIVRGMYSSPPGYGSRVANVVLSNPELKKTWFKDVQ
FT                   NMASRLQYVRAELGKRLDWPLLNNTRANHGMFLYTGLDPSKVDQLRRNHSVYLVQDGRL
FT                   SLSGLNDSNLDYVCDALKKVSE"
FT   gene            complement(<490531..>492828)
FT                   /locus_tag="KLTH0D05500g"
FT                   /old_locus_tag="KLTH-ORF12021"
FT   CDS_pept        complement(490531..492828)
FT                   /locus_tag="KLTH0D05500g"
FT                   /old_locus_tag="KLTH-ORF12021"
FT                   /product="KLTH0D05500p"
FT                   /note="weakly similar to uniprot|Q04279 Saccharomyces
FT                   cerevisiae YMR086W Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22523"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGI1"
FT                   /protein_id="CAR22523.1"
FT                   /translation="MFHSRRSRESRAIDSEALAAASAIGRALDSKGTKVNAEKLPRYNS
FT                   LSRSNSMVRAASISSRNNSLRTRRDSRRSSSLQLKGPRVRDSIDESEFYDAEDTFHAFG
FT                   GAQTQTKPVTVKRYVPGPSGLKLIEVPISEVQKPPSRNSSMNRRSASVHSGLSVRNNSL
FT                   GRKTSLNSHASQKQKSSAPVTQKQKKEPMIRRSEPPKNNKPLVEQSLKEETDEQLQLDR
FT                   QNKEVVNPIELTPPSKKAAPEVSILRLREKQVNIVTKTVDSGDLNETKQPPTVLISPPN
FT                   EDISETQNHADLNDASPYPTEEEALKQATVSSEPAPRSGIRGKENESGKENTGKTVEDV
FT                   IKEESNASSRNEANSPTQSASAEEGGGTNGNSMAKYIRSANQYLNKGHKKVLTSAQESN
FT                   AGGLEQQASSQITGNGGGEMAPLNKVPSPMKPALKKTASDNSMRNPYKENFGSKAEEAY
FT                   LSLATAENTRLNAQMSDEHSRRQPPVRKTRPSSMVTNATAVQKNIPAVTKPKHMSMQTP
FT                   LRSEIRPPARSTMRPESIRQDKKIKPKSRTRPQQTINDKRAFFPPEPPQKRSSFEKIRP
FT                   NETHMGFKKLSLRDEVSEEANYGPVVGENFHNDANSISTGRDSSSQIRSQASLPASNSG
FT                   WKSRFHDSDSEDEYSPISTVSPAKPTAKPGVRNGGFSLRNKKDSGFAPPQPNFVQSSTA
FT                   PNSKHNTPNKKISTLSLRSVSNKSDMSPAKGNNNLSQRFFSEQLSPSAEEGDTKKKSSF
FT                   GKKLKKIFGRKK"
FT   gene            complement(<493225..>495330)
FT                   /locus_tag="KLTH0D05522g"
FT                   /old_locus_tag="KLTH-ORF12018"
FT   CDS_pept        complement(493225..495330)
FT                   /locus_tag="KLTH0D05522g"
FT                   /old_locus_tag="KLTH-ORF12018"
FT                   /product="KLTH0D05522p"
FT                   /note="highly similar to uniprot|P14742 Saccharomyces
FT                   cerevisiae YKL104C GFA1 Glutamine-fructose-6-phosphate
FT                   amidotransferase catalyzes the formation of glucosamine-6-
FT                   P and glutamate from fructose-6-P and glutamine in the
FT                   first step of chitin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22524"
FT                   /db_xref="GOA:C5DGI2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGI2"
FT                   /protein_id="CAR22524.1"
FT                   /translation="MCGIFGYCNYLVEKSRGDVIDTLVEGLQRLEYRGYDSTGIAIDGD
FT                   EPDSTLIYKQIGKVAALEKEIEAEKPNRDVTFVSHCGIAHTRWATHGEPKWSNCHPQRS
FT                   DTASDFVIVHNGIITNFRELKQLLINKGYKFESDTDTECIAKLFKHLYDTNLKHGNEPD
FT                   FHELTMQVLLELDGSYGLLCRSVHYPNEVIATRKGSPLLIGVKSERKLKVDFVDVEFPD
FT                   TDEAQPEIPLNSTRGEARNFLPIASNESALRRSQSRAFLSEDGAPNPVEFFVSSDAASV
FT                   VKHTKKVLFLEDDDIAHIYDGELHIHRSRREIGASATRSIQTLEMELAQIMKGSYKHFM
FT                   QKEIFEQPDSTFNTMRGRIDFENNSVMLGGLNSWLPVIRRARRLIMIACGTSYHSCLAT
FT                   RAIFEELSEIPVSVELASDFLDRKTPVFRDDIAVFVSQSGETADTMLALKYCLERGALT
FT                   VGIVNNVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSDDRVSKLDR
FT                   RREIIQGLKKIPEQIRKVLLMEPRIKELCEKELKDQKSLLLLGRGYQFASALEGALKIK
FT                   EISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQVTARKGRPIII
FT                   CNENDEVWAAKAANSNLATLEVPLTVDCLQGLLNIIPLQLTSYWLAVNKNIDVDFPRNL
FT                   AKSVTVE"
FT   gene            complement(<495727..>497262)
FT                   /locus_tag="KLTH0D05544g"
FT                   /old_locus_tag="KLTH-ORF12015"
FT   CDS_pept        complement(495727..497262)
FT                   /locus_tag="KLTH0D05544g"
FT                   /old_locus_tag="KLTH-ORF12015"
FT                   /product="KLTH0D05544p"
FT                   /note="similar to uniprot|P14904 YKL103C Saccharomyces
FT                   cerevisiae LAP4 Vacuolar aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22525"
FT                   /db_xref="GOA:C5DGI3"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGI3"
FT                   /protein_id="CAR22525.1"
FT                   /translation="MSDATQEALAQIKKTLELLALQKPTTGEASQPAAVAHNSSQKYRG
FT                   KDYFEESSKSYINFTYESPTIYHVVEYFSRKLDEAGFSYVSEKSTWSEVKSGKYYTIRN
FT                   GTNLVAFILGSDWKYETGVGAIGSHIDALCAKLKPVSTKKDVEGFQLLGVAPYGGTLNT
FT                   YWFDRDLGIGGRVLVRDPDSGKIESRLINSAPHPIAKIPSLAVHFGEPANGPFDKEDQA
FT                   VPVIGYSGTGDDDEEGDSEDEKRSPLFGKHPIGLLRYIASLAKVKVSQLVQVDLDLFDV
FT                   QKGTLGGLKNDFLFAPRLDDRLCSFSAVNSLIDFANDGPVPRDAFSIVALFDDEEVGSL
FT                   SRQGARGGLLESVVQRVVANLHGDSPELLRTTFANSLIISADVNHMFNPNFSSVYLEHH
FT                   RPKPNVGVTLSLDSNLHMSTDVVGLAVAEELARLNGDKLQYFHIKNNSRSGGTIGPFIS
FT                   SQTGARTIDLGIAQLSMHSIRAATGSKDIGLAIKFFKGFFANWRSVYDKFGDL"
FT   gene            <498055..>501441
FT                   /locus_tag="KLTH0D05566g"
FT                   /old_locus_tag="KLTH-ORF12011"
FT   CDS_pept        498055..501441
FT                   /locus_tag="KLTH0D05566g"
FT                   /old_locus_tag="KLTH-ORF12011"
FT                   /product="KLTH0D05566p"
FT                   /note="weakly similar to uniprot|P34244 Saccharomyces
FT                   cerevisiae YKL101W HSL1 Nim1p-related protein kinase that
FT                   regulates the morphogenesis and septin checkpoints
FT                   associates with the assembled septin filament required
FT                   along with Hsl7p for bud neck recruitment phosphorylation
FT                   and degradation of Swe1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22526"
FT                   /db_xref="GOA:C5DGI4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGI4"
FT                   /protein_id="CAR22526.1"
FT                   /translation="MSMAQQAAMAATGGSDHIDRVVHSVTDATKRLSQISTSTTNTATQ
FT                   SSKRRSRDTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKTKSSRPNALPYGI
FT                   EREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAIHYF
FT                   RQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPH
FT                   YASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQAI
FT                   SLEAQDLISRILVVDPNKRITINDILSHPLITKYDYKRSKSNSDLHILSHTSPQICTIR
FT                   SERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQQRQLKAGPKSP
FT                   PVNAPKILQKSQFSVPSIKSQSSPHKEHVASSSRVFKSNSKKRISASASKRSLHNSSSK
FT                   KSLHKSSSKKSLGSLKNSASKKSLRNSPIKPQHPLPSKRSLYSLNSISKRSVNLKDYVS
FT                   DDSKPPLPQQSEFELLCEEILFGAELGGITEEVGETSTEAARTTNPVFKTGLGKTAKAP
FT                   ESPKSTETSNETELSGDRDGLQSRLEGTSAEVEESVAIAKKAASKAPRSHQAGLGDNAQ
FT                   KKNTETPRKHPQTDGISQIKSERAALQVSKLKSTPSSRNLRVASAPSGKDDTPVSLDPR
FT                   RNVSQPNSIELLLNKYNLRAHLKSKSNLKKLRNSGDWGRTAFETSFASSGNGISLNADD
FT                   LKDFESLSGTDLTNVLAHSSSIKGDDSTDAAKMQHAQRQEESKQVVSLPSANLNSSATF
FT                   KNLSQYILDSNSSTTRASSVVRRPAGGSLKSCTQNVSRKPSTNLPKNTLTVQRSRKVSQ
FT                   VSAYDTRSEMPSDMSFALDIPTQTFTAQAVQVSNGSSQDQFEQAKKPVLLQEEQGEDDI
FT                   NIFEDAPCDNVSIATSSSGLDSQPHVHRKATSIDTLNTTSVLTPSADVRVSLYANNMTS
FT                   SAKLPRETTEEIISKFKLSPEKVPVPPQKRFSYQKARGSISQSVISMFKDLDDDFEDHA
FT                   SEPAAEGHFDSATGMQQDPSSNVEEQIPGEGPVAQKRVTMLFDDESSTVFKSSPIKTSV
FT                   LKPRESVAAQPRPSSTTIPFT"
FT   gene            complement(<502176..>503345)
FT                   /locus_tag="KLTH0D05588g"
FT                   /old_locus_tag="KLTH-ORF12004"
FT   CDS_pept        complement(502176..503345)
FT                   /locus_tag="KLTH0D05588g"
FT                   /old_locus_tag="KLTH-ORF12004"
FT                   /product="KLTH0D05588p"
FT                   /note="similar to uniprot|P07246 Saccharomyces cerevisiae
FT                   YMR083W ADH3 Alcohol dehydrogenase isoenzyme III"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22527"
FT                   /db_xref="GOA:C5DGI5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGI5"
FT                   /protein_id="CAR22527.1"
FT                   /translation="MQRTLYRHTSSTLMQGVRQRLGGYAGLGSQRIGFVGALRFASNIP
FT                   SMQKGVIFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL
FT                   VGGHEGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLSGYTH
FT                   DGSFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVYKALKTADVRPGQWVAISGAAG
FT                   GLGSLAVQYAKAMGLRVLGIDGGEDKKKLFHDLGGETFIDFRTTKDMVGAIQEATQGGP
FT                   HAVINVSVSEAAISMSTEYVRPTGSVVLVGLPANAYVKSEVFSHVVKSISIKGSYVGNR
FT                   ADTREAIDFFARGLVKAPIKIIGLSELPEAYKLMEAGKILGRYVVDTEK"
FT   gene            <503333..>504055
FT                   /locus_tag="KLTH0D05610g"
FT                   /old_locus_tag="KLTH-ORF12000"
FT   CDS_pept        503333..504055
FT                   /locus_tag="KLTH0D05610g"
FT                   /old_locus_tag="KLTH-ORF12000"
FT                   /product="KLTH0D05610p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22528"
FT                   /db_xref="GOA:C5DGI6"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGI6"
FT                   /protein_id="CAR22528.1"
FT                   /translation="MFSAYYAFVRLSASLPLFFFHSLQGTLALRTKYNSSFYGSFKLCA
FT                   VAMPSSLVSVSCLSSFRLRGFLVYGHLYFEFPAPTNSTRCRSWKSSPLVYLIPLGLEVT
FT                   HARALLAKNGNSRDFAMLKAGIRAQEPEFVREKNVRFVNSYFYVPGAIVIVIYVSTASL
FT                   EGALRKCWRRASGEYVSTARRLRQLVSLAYKCRDVAGKRESSLLTSGAMTLVFKSGKTR
FT                   PLTLPKACGAAASWRTRR"
FT   gene            complement(<504315..>505067)
FT                   /locus_tag="KLTH0D05632g"
FT                   /old_locus_tag="KLTH-ORF11997"
FT   CDS_pept        complement(504315..505067)
FT                   /locus_tag="KLTH0D05632g"
FT                   /old_locus_tag="KLTH-ORF11997"
FT                   /product="KLTH0D05632p"
FT                   /note="similar to uniprot|P34247 Saccharomyces cerevisiae
FT                   YKL099C UTP11 Nucleolar protein component of the small
FT                   subunit (SSU) processome containing the U3 snoRNA that is
FT                   involved in processing of pre-18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22529"
FT                   /db_xref="GOA:C5DGI7"
FT                   /db_xref="InterPro:IPR007144"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGI7"
FT                   /protein_id="CAR22529.1"
FT                   /translation="MAKLVHNVQKKQHRERSQVASRSRFGFLEKHKDYVKRAQDFHRKQ
FT                   ATLKVLREKAQQRNPDEYYHAMHSRTLDSKGLLQKSRRAADEDASLSTDQVKLLKTQDA
FT                   NYVRTLRQNERQALERQSQNTMFKSNGSHTVFVDDAESMHAFDAHKHFNTTPDMLHRRE
FT                   NRLTKEQLADQGLQAGAKQAGLDPETLERKRLKKLRQLQQHQDRERQLSGVLQRMEMER
FT                   EGMKKGSKKKIRDAHGNTAFKWKKQRKR"
FT   gene            <505266..>506123
FT                   /locus_tag="KLTH0D05654g"
FT                   /old_locus_tag="KLTH-ORF11996"
FT   CDS_pept        505266..506123
FT                   /locus_tag="KLTH0D05654g"
FT                   /old_locus_tag="KLTH-ORF11996"
FT                   /product="KLTH0D05654p"
FT                   /note="weakly similar to uniprot|P34246 Saccharomyces
FT                   cerevisiae YKL098W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22530"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGI8"
FT                   /protein_id="CAR22530.1"
FT                   /translation="MSGQEPSLPPMGPTLPAALAFRKNLVCYCEDPTVVVEFLQALHLP
FT                   YALWENYDDIDARPKPEAEQVLVLPNVDRLLTLQQDKLAKFLQVMRSRDTPFFAAVATV
FT                   SPGFVPYAHFTPYLKRQFWFACAEPMTGGATDFNEETLPQLRNSLRKVHVHHSIRRYVL
FT                   DIIMHLRVHRFSSQASGGGCSTHSLRDILELCQTLALAEERAFVVPDIVKTASYWYFPF
FT                   HLELIQNPSHEISLQYGSDPDLVAQLVNAMQQFSLQRASEIHYPLYFQYMVLRDVLNLV
FT                   VPAI"
FT   gene            <506564..>507571
FT                   /locus_tag="KLTH0D05676g"
FT                   /old_locus_tag="KLTH-ORF11994"
FT   CDS_pept        506564..507571
FT                   /locus_tag="KLTH0D05676g"
FT                   /old_locus_tag="KLTH-ORF11994"
FT                   /product="KLTH0D05676p"
FT                   /note="some similarities with uniprot|P28319 Saccharomyces
FT                   cerevisiae YKL096W CWP1 Cell wall mannoprotein linked to a
FT                   beta-1 3- and beta-1 6-glucan heteropolymer through a
FT                   phosphodiester bond involved in cell wall organization"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22531"
FT                   /db_xref="GOA:C5DGI9"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGI9"
FT                   /protein_id="CAR22531.1"
FT                   /translation="MKFTSAFTAALLACARLALADSETFGLLVIRSGSSLQYASAYAQD
FT                   SKLYLGSSSDSLSAVVTDDGKLKLSDDKYAVVSSDGSVVEGSESEGSSEFSISEGHLLY
FT                   GGKDGFVAVPSGSAYLLYTNNSDSSSIGVAIRATSTSGSTVPDFSPSGEDSSSAGSSST
FT                   AASSGTSTASQTTLSPSSGADAAVSQIGDGQIQATTATSSKAASSAAAVSQIGDGQIQA
FT                   TTATSSKLTSSAAAVSQIGDGQIQATTATSSKPTSSAAAVSQIGDGQIQAATSVASPSS
FT                   SSSKTTVSAVSQISDGQIQATSSSASVQVQSENGGAQAVVGLGAGFAAAAALLL"
FT   gene            <508215..>510326
FT                   /locus_tag="KLTH0D05698g"
FT                   /old_locus_tag="KLTH-ORF11989"
FT   CDS_pept        508215..510326
FT                   /locus_tag="KLTH0D05698g"
FT                   /old_locus_tag="KLTH-ORF11989"
FT                   /product="KLTH0D05698p"
FT                   /note="some similarities with uniprot|P28319 Saccharomyces
FT                   cerevisiae YKL096W CWP1 Cell wall mannoprotein linked to a
FT                   beta-1 3- and beta-1 6-glucan heteropolymer through a
FT                   phosphodiester bond involved in cell wall organization"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22532"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGJ0"
FT                   /protein_id="CAR22532.1"
FT                   /translation="MKFNSLLVSSVALAGSAVRADSQEFDMLVVRSESPLQYASVYAEN
FT                   GHLFLGGTSVGLSGVVTDNGKLRFSDGTYATLSNNGSLVEETRDRATAGFSISGGYLSF
FT                   EGSIGFTGVLARGGYEFSTVITNPDDLDVLIRANLANGSKAPDFGPSFHRPSIPITTAS
FT                   AKTLCTKIRNSTITITKTEHDTTTATLTSCGNGLATNSSTPIISSTPIISLTSSGFVNV
FT                   TSIQTSGLSNSFFTPSATVTLSSLPFSSFQNSTTIISTASLSSIPISSGFLSSSTGSSS
FT                   LNSTISLPTSTEIITASSFSPSQSSSTVSSSSAVSSPTAIPSSSAIPSSSAIPSSPAIP
FT                   SSSAIPSSSVISSSSAIPSSSVVLSSIIVTSSTTASSSSAIPSSTAASSSSAISSSSAI
FT                   SSSLAASSSSAALSSSAASSSLAASSSSAISSSSAISSSLAASSSSAVSSSLAASSSSA
FT                   ISSSLAAPSSSAASSSLAASSSSAASSSSAASSSLAASSSLAASSSSAISSSLAASSSS
FT                   AISSSLAASSIGSSSAPPETSSTSSSATSSQTTSSSSLASSSTASTVASVSQSSLSLTS
FT                   SSTSVLSSASSVPVSTSTLVSSASGSSRSLPPLTSSTAVTSSGQLSSSTVSSPSSSEMS
FT                   SVSSTELSSSISTETSAVSSSSVASSQAPVSSTSPTQSSTESSTQNGAGQIIPTGLGAS
FT                   FFFVAALLM"
FT   gene            <511398..>512216
FT                   /locus_tag="KLTH0D05720g"
FT                   /old_locus_tag="KLTH-ORF11985"
FT   CDS_pept        511398..512216
FT                   /locus_tag="KLTH0D05720g"
FT                   /old_locus_tag="KLTH-ORF11985"
FT                   /product="KLTH0D05720p"
FT                   /note="similar to uniprot|P28320 Saccharomyces cerevisiae
FT                   YKL095W YJU2 Essential nuclear protein putative
FT                   spliceosomal component involved in mRNA splicing based on
FT                   computational analysis of large-scale protein-protein
FT                   interaction data"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22533"
FT                   /db_xref="InterPro:IPR007590"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGJ1"
FT                   /protein_id="CAR22533.1"
FT                   /translation="MSERKAINKYYPPNFNPLEAEEAARKLSKKLKTMNRDVITIRLMT
FT                   PFSMRCLKCSEFIPKSRKFNGKKELLPEKYLDTIKQYRLSIKCPRCNNMIAFRTDPKSG
FT                   DYVMEIGGVKNFVEEKPEEKLPGDETLDETLERLERQQQQDNNQTKNDDHEDKLEKIEK
FT                   RLAKLQKEQQDYEELEALRRENISKMKKAEALQEKSHLSAQEESQGDEEKAELAFRLFN
FT                   AQKADGETSGPAVHITAAPAAIPQKIRSKKKAKSNALGVIVKKKNRARQT"
FT   gene            <512469..>513410
FT                   /locus_tag="KLTH0D05742g"
FT                   /old_locus_tag="KLTH-ORF11984"
FT   CDS_pept        512469..513410
FT                   /locus_tag="KLTH0D05742g"
FT                   /old_locus_tag="KLTH-ORF11984"
FT                   /product="KLTH0D05742p"
FT                   /note="similar to uniprot|P28321 Saccharomyces cerevisiae
FT                   YKL094W YJU3 Protein of unknown function localizes to lipid
FT                   particles"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05742g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22534"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGJ2"
FT                   /protein_id="CAR22534.1"
FT                   /translation="MFFFSGKKSAPIDFPYKPTSSSFIKDKHQFDGADFIYVKWFVATE
FT                   QTLTAKARLLVVHGFDEYTLLYSRLMDQLSKVGIESFAFDQRGSGETSPGKQRGRTNEY
FT                   HTFNDLDHFIEWNLEDKDPETPLFLFGHSMGGGIVLNYGCAGRFRDQIAGIVCTGPLIE
FT                   LHPHSAPSRLVTALSPLLAACLPNFRIDTGLDIDATTSDERYRNFLSRDPLTVPLYGSL
FT                   RQIYDFLARGKKLLEDKEYVAKLQKPVLIFHGISDTINDPKASEKFNKLCTATDKRLEL
FT                   VPGARHSLCLETDEVFERMFNDMHNWLLEHAP"
FT   gene            <513915..>514739
FT                   /locus_tag="KLTH0D05764g"
FT                   /old_locus_tag="KLTH-ORF11981"
FT   CDS_pept        513915..514739
FT                   /locus_tag="KLTH0D05764g"
FT                   /old_locus_tag="KLTH-ORF11981"
FT                   /product="KLTH0D05764p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22535"
FT                   /db_xref="InterPro:IPR031443"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGJ3"
FT                   /protein_id="CAR22535.1"
FT                   /translation="MEFSEVKDSKKVSCCSRASDPTENICECEDELDIFERFVQDPCMN
FT                   AWEDLDEEGRPSQWEDDELDPVCEGVEGFARKQVRTSKPCICSNCHHPRRWKTSSTAQD
FT                   FDEPVLRCSRTNSFMSQLSRQASRQSLPDPGEGTCGSPTHPGYSQPSLEIGPSRSNSVS
FT                   RTRSRSSFGASSAIPAHIYCLERFVSSELDSAAENFCRKDPLTLNTVSPTTSTICSPSG
FT                   SDSATSPQMAGVLSSSSSTNSAKNNADIQPVFLSKRKSRVSSIEVSLLNSFS"
FT   gene            <515187..>518135
FT                   /locus_tag="KLTH0D05786g"
FT                   /old_locus_tag="KLTH-ORF11977"
FT   CDS_pept        515187..518135
FT                   /locus_tag="KLTH0D05786g"
FT                   /old_locus_tag="KLTH-ORF11977"
FT                   /product="KLTH0D05786p"
FT                   /note="highly similar to uniprot|P30771 Saccharomyces
FT                   cerevisiae YMR080C NAM7 ATP-dependent RNA helicase of the
FT                   SFI superfamily required for nonsense mediated mRNA decay
FT                   and for efficient translation termination at nonsense
FT                   codons"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22536"
FT                   /db_xref="GOA:C5DGJ4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018999"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040812"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGJ4"
FT                   /protein_id="CAR22536.1"
FT                   /translation="MSPAAGPSVTPDAEDKTVKPVSEAGSEAAVTAEMNELYVSNSEIA
FT                   AVMPGENEDFGEPMEAPPSEFACAYCNVDSAKCVVKCNTCNKWFCNSKNGTSSSHIINH
FT                   LVLSHHNTVSLHPESDLGDTVLECYNCGCKNVFVLGFVSAKSEAVVVILCRLPCAQTKT
FT                   VSWDTDQWQSLIENRQFLSWVAEDPSDEELLRARMISPSQISKLEAKWRSNKDATINDI
FT                   EVPDEKEEVPHILMRYADAYQYQRSFAPLVKIEADYDKQLKESQALEHISVSWSLGLSN
FT                   RHLASFALSTFESNGLKVAVGDEMILRYSGVQHPEWEGHGYIVRLPNSFQDQLTLELKP
FT                   SKTPPPTSFNTGFTAEFVWKGTSYDRMQEAMKKFAVVKKSVSGFLYYKILGHEVPDLEF
FT                   DVNLPEQFSIPHFTQLNVSQANAIRHVLQRPLSLIQGPPGTGKTVTSATIVYHLSKLHK
FT                   ERILVCAPSNVAVDHLAAKLRDLGLKVVRLTAKSREDVESSVSNLGLHNLVSRSAKGEL
FT                   KKLLKLKEDVGELSPSDAKKFVKQVRKSELEILKKADVVCCTCVGAGDKRLEAKFRTVL
FT                   IDESTQASEPECLIPIVKGAKQVVLVGDHQQLGPVILDRKAADAGLKQSLFERLISLGH
FT                   IPIRLEVQYRMNPHLSEFPSNMFYEGSLQNGVTIEQRSVTNSTFPWPIHDLPMMFWSNY
FT                   GREEISGNGTSYLNRIEAMNCERVITKLFKDGVKPDQIGVITPYEGQRAYIVQYMQMNG
FT                   SMDKELYMNVEVASVDAFQGREKDYIILSCVRANEQQAIGFLSDPRRLNVALTRSKYGL
FT                   VILGNPRSLSRNSLWSHLLVYFREKGCLVEGALGNLQLCTVQLTKSRNVRPSQKTNFSK
FT                   MEFSHGAEMGQTNFNDFDTQSLMSYGGIDTFGMAGNSNLNALFNNFHPFGQHPQQLNTA
FT                   DTNTFDGYLKFDSSLARGLQAYGGSASKYEGAVKGNGDSRKVPDDAVRELNV"
FT   gene            complement(<518280..>521462)
FT                   /locus_tag="KLTH0D05808g"
FT                   /old_locus_tag="KLTH-ORF11975"
FT   CDS_pept        complement(518280..521462)
FT                   /locus_tag="KLTH0D05808g"
FT                   /old_locus_tag="KLTH-ORF11975"
FT                   /product="KLTH0D05808p"
FT                   /note="similar to uniprot|P33314 Saccharomyces cerevisiae
FT                   YKL092C BUD2 GTPase activating factor for Rsr1p/Bud1p
FT                   required for both axial and bipolar budding patterns
FT                   mutants exhibit random budding in all cell types"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22537"
FT                   /db_xref="GOA:C5DGJ5"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="InterPro:IPR039360"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGJ5"
FT                   /protein_id="CAR22537.1"
FT                   /translation="MGTSQFNISEPTPLREGPFSNGYASSGSDQFSGMNSTESLLISNI
FT                   QSNRGQFKGEVQWCSNLSLDDWKTHFLQIDERGALCHALNEEGIADLRVVTEKPASSNK
FT                   PILKHLQSCKVQLLDSSMGNLSVIKVETYYSTIYLRATEKKTFLSLFSALIFWKSLKDR
FT                   GIFNKISVIQPIFSRQQKPIDLLVCQFNIYGPIPRNKNVPLKSGLATPPPIAGVSVIDE
FT                   MGWYSAMGRLSSDGRLDLLLQSDGSVLWSLDISSLLRSEIRILDPSLFQNDNFLFLGVV
FT                   RRLRDQLKISSNIPFYSSTTKTQVNSQAIYLQFPLRIDLEDWFVALNTFAQVESVSLLG
FT                   TDKSNELRISNRFKVSILEADFSGINLMSYDHERHQEILPRLYSDISIWDHCWARTSIV
FT                   TDAQTPFWREEFDFNFSVKTSPVCVAVKIALGDDGEYSSSDKTLGVIEITQEMINDGSL
FT                   SAETRIPLFDAENKHFQLGTLCIKVASSLNAILPSVNFTKLDSMLSRMSLTKMTEYLND
FT                   ISIADYLKLEDLSVVFLDIFQALNRTNDWFQALIEKEFSNIDNSISKNTNKNLSSANIY
FT                   SSLFRGNSILTKSIERYFNRIGQEYLDKAIGGTIRKVVSSDMCLELDPSRIREIDAQRK
FT                   SEILEGNYSRLLKVAEELWSRISSTSNDLPIGIKEQLKAFRKNLEIICKNDELKSTLNC
FT                   ISGFLFLRFFCPVILNPKLFHIVENHPEEGPKRTLTLLTKIILNLSTLTLFGKKEPWMT
FT                   KMNEFILKHEGELTDYIDKVTDKKLDFSPKALKLSNSVARPRVALNESCLNDLPTNPYL
FT                   IDRYLRETELISVLTIFRRDEEKSMTVPKTVSMNRLSKEPSSSFPSPIIDQTKATIGEL
FT                   EFEKLTENNAEVFGEDLMKYLNIDKANDNVGSESPTVAGFTIEEKDLTKTLEQESLLLY
FT                   HRLEHLTNVLSNYEYPNEIILGKTEFALFLVDNLYMDRNNIVELDLSGSFAKQNGLSKL
FT                   CSDSSLFMKDSDRHQSPPNSGQISRARTVSQRPNLGFSSSKSNPLSKKKGKQSENKSDN
FT                   KQGFKLLRFFRK"
FT   gene            complement(<521663..>522352)
FT                   /locus_tag="KLTH0D05830g"
FT                   /old_locus_tag="KLTH-ORF11974"
FT   CDS_pept        complement(521663..522352)
FT                   /locus_tag="KLTH0D05830g"
FT                   /old_locus_tag="KLTH-ORF11974"
FT                   /product="KLTH0D05830p"
FT                   /note="highly similar to uniprot|P24280 Saccharomyces
FT                   cerevisiae YMR079W SEC14
FT                   Phosphatidylinositol/phosphatidylcholine transfer protein
FT                   involved in coordinate regulation of PtdIns and PtdCho
FT                   metabolism products of which are regulators in Golgi to
FT                   plasma membrane transport functionally homologous to
FT                   mammalian PITPs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22538"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGJ6"
FT                   /protein_id="CAR22538.1"
FT                   /translation="MYENCEKWRKDFGVDTIFEDFHYDEKPLVAKYYPQYYHKTDKEGR
FT                   PLYFEELGSVNLTEMYKITNQERMLRNLVWEYESFVRYRLPACSRQAGYLVETSCTILD
FT                   LKGISISAAAQVLSYVKEASNIGQNYYPERMGKFYLINAPFGFSTAFRLFKPFLDPVTV
FT                   SKIFILGSSYQKELLKQIPAENLPVKFGGKSEVDESQGGLYLSDVGPWRNPKFIGPEGE
FT                   APTAFKL"
FT   gene            <522837..>524945
FT                   /locus_tag="KLTH0D05852g"
FT                   /old_locus_tag="KLTH-ORF11972"
FT   CDS_pept        522837..524945
FT                   /locus_tag="KLTH0D05852g"
FT                   /old_locus_tag="KLTH-ORF11972"
FT                   /product="KLTH0D05852p"
FT                   /note="similar to uniprot|P49956 Saccharomyces cerevisiae
FT                   YMR078C CTF18 Subunit of a complex with Ctf8p that shares
FT                   some subunits with Replication Factor C and is required for
FT                   sister chromatid cohesion may have overlapping functions
FT                   with Rad24p in the DNA damage replication checkpoint"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22539"
FT                   /db_xref="GOA:C5DGJ7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGJ7"
FT                   /protein_id="CAR22539.1"
FT                   /translation="MEGRLEPLIGDSMLFGPMEDQGLSFVNKSGETVHLRRKPARALMD
FT                   LNWKHDESYGIDINQLLQRCEDSSNAAIQSSGASRSKHSPSQLWTEKWKPHTFFDLVGN
FT                   EKTNRRVLKWLRQWSPLVFGQELPKKAPSVRDKVGADGANYDFDDPLQRPQKRILLLNG
FT                   PPGIGKTSVAHVVAKQAGFSVIEINASDERAGPHVKDRIHNALFNHTFDDRPVCLIADE
FT                   IDGSIETGFVKVLIDIVNSDYRATQRLASGASSAVQRGKRKQRSPGKVLTRPIITICNN
FT                   VYASALEKLRPHCEIVTFRRPAESALLERLSHVCRKEKLQLDKKRLKELSELSQGDLRS
FT                   CLNNMQFMASLHAEAPESTDTAKISDQIKDMTVSWYKICNQVFRRNPHEDAKVQFGRLL
FT                   RDIEINSNSQRIVQGCFSMFPEVKFSDHSLQKPSAAADWLYFNDLMFKSLFEHNGDLLR
FT                   YNSVVPMAFFHLFSDIANKDDVRGKVNEFDHREDLRNNESIVLSTFRRAPPTLKIFMNK
FT                   SSLALEVLPLLDYIIVPDFSKIRNNQTKTTVLSNIVAALSSFDLTFSERVDTDLPRVTC
FT                   IEPPFDKVTLMDEKRVKEVFTKRPAILNVVLAKAQESKVRKRTIEQARADKLDLESVRK
FT                   KHKTSSSKPVDYFKSQYANVQTKGSEKFKDSGSVEGDSREPVKIWVKYKEGFSDAVRKD
FT                   VTWNSLWE"
FT   gene            <526061..>526134
FT                   /locus_tag="KLTH0D05874r"
FT                   /old_locus_tag="Klth0D.tVal.AAC.5"
FT   tRNA            526061..526134
FT                   /locus_tag="KLTH0D05874r"
FT                   /old_locus_tag="Klth0D.tVal.AAC.5"
FT                   /note="tRNA-Val (AAC) cove score=68.42"
FT   gene            <526221..>526294
FT                   /locus_tag="KLTH0D05896r"
FT                   /old_locus_tag="Klth0D.tVal.AAC.6"
FT   tRNA            526221..526294
FT                   /locus_tag="KLTH0D05896r"
FT                   /old_locus_tag="Klth0D.tVal.AAC.6"
FT                   /note="tRNA-Val (AAC) cove score=68.42"
FT   gene            <526400..>527332
FT                   /locus_tag="KLTH0D05918g"
FT                   /old_locus_tag="KLTH-ORF11968"
FT   CDS_pept        526400..527332
FT                   /locus_tag="KLTH0D05918g"
FT                   /old_locus_tag="KLTH-ORF11968"
FT                   /product="KLTH0D05918p"
FT                   /note="some similarities with uniprot|P38749 Saccharomyces
FT                   cerevisiae YHL009C YAP3 bZIP transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22540"
FT                   /db_xref="GOA:C5DGJ8"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGJ8"
FT                   /protein_id="CAR22540.1"
FT                   /translation="MMDYSNNFSYSNQYQSSGQAQAVEQGFGADLHSCSNDDCSAASNL
FT                   FDGLTEENKTFHEILAANSNTITPPGSSSPGYQQDLLSSMKTVKRGTEINFDCLEGEAP
FT                   QNLIPEALASAQGFKADTVNSFQQDSNPIEDASARKKKAQNRAAQRAFRERKEAKMKQL
FT                   QEQLVTSERDKQSLLRQMEELRERNLKMLTENHLLLQKNNSNLPTQSNSGLASASRKFH
FT                   FPSQSEFIESAIEGHEVPVKLPLSSTYYEHDGEELLTFPATWEYLHKLSEKEDFDVYSV
FT                   MLNLKGHEVCHGYGPAYRKTVIDKLVKQG"
FT   gene            <527462..>528160
FT                   /locus_tag="KLTH0D05940g"
FT                   /old_locus_tag="KLTH-ORF11966"
FT   CDS_pept        527462..528160
FT                   /locus_tag="KLTH0D05940g"
FT                   /old_locus_tag="KLTH-ORF11966"
FT                   /product="KLTH0D05940p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05940g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22541"
FT                   /db_xref="GOA:C5DGJ9"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGJ9"
FT                   /protein_id="CAR22541.1"
FT                   /translation="MAKKVVKRLRVADKKARSETFFPNEIFELKHQASSFEFYPFPEPM
FT                   LEGKVILIKKFFSDKISQALRSSFSSPGIMELHYQKGTKEYAERINDRLTTQNAEIAQI
FT                   LWERLLKCLRQDDYVMQELGFGQAKGLNPQIRAYRYEKGHKFAKHYDSSVVVSGIGSSR
FT                   WTLLVYLSGGDDLVGGDTVFYAPHTGEATNIHPQTGLALLHKHGDDCLLHEAQVVSNGA
FT                   KWVLRSDVVF"
FT   gene            <529126..>530502
FT                   /locus_tag="KLTH0D05962g"
FT                   /old_locus_tag="KLTH-ORF11963"
FT   CDS_pept        529126..530502
FT                   /locus_tag="KLTH0D05962g"
FT                   /old_locus_tag="KLTH-ORF11963"
FT                   /product="KLTH0D05962p"
FT                   /note="similar to uniprot|P36075 Saccharomyces cerevisiae
FT                   YKL090W CUE2 Protein of unknown function has two CUE
FT                   domains that bind ubiquitin which may facilitate
FT                   intramolecular monoubiquitination"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22542"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGK0"
FT                   /protein_id="CAR22542.1"
FT                   /translation="MMSSQDLALLAELFPSVNENKLRGTLKSAGGDAQVACSMILSEQE
FT                   TLNQMAKNSLSNNTDGRSEGEGMGSRHAKALSEENFPDENHTKARKGAVNLKKRMWRPI
FT                   HSFTKGQSSRLELDQAAAVHSNAWVSATDSIQDIIHYTNAAPKSAQKAFYKKTLNSARA
FT                   IIDIIYHYDEYAEDINGSRLPGDNEPEYGTPQRDFMKAGGRVQSPTGFAHKKKPVGLVF
FT                   SADQERANIFSPRSEENYKYDSSSLEAKELNSIITNNPSLRAISPSFSKRALEFYEGDV
FT                   ERTTLTLIFIIEKNCAQYTFVDAASKAPSLNSQKNLSKVNKGSVKPRRMGAEIGGLDPS
FT                   CFASDENYDRALLIIDNILTMYTADLHGFLPYEAELIAERCLNVWWTKELALREMNGQR
FT                   LNQIKAINLAPFKIITGRGLHSVGGVSKVRIKVKKFLDTCLYSYTEEASYFIVEGKKKA
FT                   "
FT   gene            <530632..>532383
FT                   /locus_tag="KLTH0D05984g"
FT                   /old_locus_tag="KLTH-ORF11962"
FT   CDS_pept        530632..532383
FT                   /locus_tag="KLTH0D05984g"
FT                   /old_locus_tag="KLTH-ORF11962"
FT                   /product="KLTH0D05984p"
FT                   /note="similar to uniprot|P35201 Saccharomyces cerevisiae
FT                   YKL089W MIF2 Kinetochore protein with homology to human
FT                   CENP-C required for structural integrity of the spindle
FT                   during anaphase spindle elongation interacts with histones
FT                   H2A H2B and H4 phosphorylated by Ipl1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22543"
FT                   /db_xref="GOA:C5DGK1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025974"
FT                   /db_xref="InterPro:IPR028386"
FT                   /db_xref="InterPro:IPR028929"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGK1"
FT                   /protein_id="CAR22543.1"
FT                   /translation="MDYMNLGVKSRKTGIQVKGNIGRDEYSMENIDEFFKDDDTLISAR
FT                   RKSRRSSLLPLSKKFLPEDFSETSRRSSNYLPPSVPTIQEEDDENLHEGSDEPAGGLEI
FT                   NETLSRAVEDNRIHQELSEIPTGDHERRLRQPAEKSYEPDYRAEDDFTTDAVVPQTPPS
FT                   DYGNESYRDVPDLVADDDDDVSHGNTTFNTSDNALLEDELQREVRAESEEDRDYIERYS
FT                   NTENSDSSELEDEDNSDTNSPYETHSAQSYNTRVQPALSVSRGRHPLSEPQELSDTSDE
FT                   EFIYDQARELASENSFTTSAGLRKSKRVKVAPLEYWRNEKVVYKRKSRKPVLEIDKIIT
FT                   YEDEDDEEEEISRRRKSSKKPPYNYGTSGKPRGRPRKSKTTNSASSSGLQNPNEDLISK
FT                   IRTGDTQCSSWMRRGVFKASVKSSFHGKEENEELLACAPDSVHTEQRRKTADEDFSLAV
FT                   LFDQHRDLFASGFLTIPTGSCKKLSDSRNAFINFYLIQGVIEVTVGRNKLLCTDGTSFQ
FT                   IPAFNEYAFRNKGKNDAKMYFVQTTIFPRLSQARGIRNLSRSPAEARDNQIPKSTTSPS
FT                   DMSISEL"
FT   gene            complement(<532589..>535453)
FT                   /locus_tag="KLTH0D06006g"
FT                   /old_locus_tag="KLTH-ORF11960"
FT   CDS_pept        complement(532589..535453)
FT                   /locus_tag="KLTH0D06006g"
FT                   /old_locus_tag="KLTH-ORF11960"
FT                   /product="KLTH0D06006p"
FT                   /note="similar to uniprot|Q03497 Saccharomyces cerevisiae
FT                   YHL007C STE20 Signal transducing kinase of the PAK (p21-
FT                   activated kinase) family involved in pheromone response and
FT                   pseudohyphal/invasive growth pathways activated by Cdc42p
FT                   binds Ste4p at a GBB motif present in noncatalytic domains
FT                   of PAK kinases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22544"
FT                   /db_xref="GOA:C5DGK2"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033923"
FT                   /db_xref="InterPro:IPR036936"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGK2"
FT                   /protein_id="CAR22544.1"
FT                   /translation="MSAMSSDSSPRSSSVPDTTTKKKDESIGKLAKQTEGKYELPRAPA
FT                   TLNVNALHAYEEHHNIDEQGYKSMDPGKPKGSQAEEVSEMLQSTTLDDPIQFTRVSSSS
FT                   ALSNSSYEASDIITGSHEPDIGRAKEPQGSNQEPQQPNAFPEIQEQSTIGDKTNSTIRA
FT                   SDHYLAENSRLTNDSMMLVGENEMQLSQEFSTQDSSNLNLENTSHLKSSTPKSDYSRDV
FT                   SKKDILEPGEEGCLSEQTHNVGTPAKEFNYSSSSGEFPEKNIDIPIVDASNTSKQAWTT
FT                   PNLVQGGFTQVQYSTATNNRKQPPRSPFRAVSSPFNSMRRGSREEVTESPKSQSRLASP
FT                   TAENKKRRSGGSRMKGVFSSLMQNMKRTSQGEKRQSSSALKISTPYNAKHVHHVGVDTK
FT                   TGEYTGLPDEWEKLLTSSGISKKEQQQHPQAVMDIVKFYQDVTEANGEDKVFKTFHVGN
FT                   SGKNISSTSSFRTPSSPSLNKLENAHSRPQHPNSLGVNSTAHELQSPVNLREAPNVQGT
FT                   TTNERFMPSRPAPKPPGTPTKNDLTSPLANRNSPATSPKVTHASSLSSGLRSLSRKGTL
FT                   AKTDHQIPPSSHGKAVVSRNGTISEKSADMAPVRPAPPPPVPKDLPREDNAQTDAQKAA
FT                   EKKREDRRKKIQQLYAKLTEICTDGDPSKLYKSLIKIGQGASGGVYTAYEVGTNASVAI
FT                   KQMNLEKQPKKELIINEILVMKASKHANIVNFIDSYLLRGDLWVVMEYMEGGSLTDVVT
FT                   HCILTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNILLSMTGEIKLTDFGFCAQINE
FT                   INLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYL
FT                   IATNGTPELKDADSLSDDLKGFLGWCLHVDPDERATASELLSDPFIATYADDVRSLAPL
FT                   VKLARMKKLAEKMEDGRDSGEESS"
FT   gene            complement(<535827..>540188)
FT                   /locus_tag="KLTH0D06028g"
FT                   /old_locus_tag="KLTH-ORF11955"
FT   CDS_pept        complement(535827..540188)
FT                   /locus_tag="KLTH0D06028g"
FT                   /old_locus_tag="KLTH-ORF11955"
FT                   /product="KLTH0D06028p"
FT                   /note="similar to uniprot|P33202 Saccharomyces cerevisiae
FT                   YKL010C UFD4 Ubiquitin-protein ligase (E3) that interacts
FT                   with Rpt4p and Rpt6p two subunits of the 19S particle of
FT                   the 26S proteasome cytoplasmic E3 involved in the
FT                   degradation of ubiquitin fusion proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22545"
FT                   /db_xref="GOA:C5DGK3"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGK3"
FT                   /protein_id="CAR22545.1"
FT                   /translation="MSRDEIRHSMNRDYDSDGDFVIRPSRQNDYEDEDVAEEENEYSYP
FT                   EEVDDDVESYEGNMYHFGDEENERDEAYENSQDSEHSGENPTEEVDGNEGDDIEDELRN
FT                   TTLRGAQRQSSLQELLGSLAQNMEGPSREHGGENSRRVNIADIFPEMFSMMGAGRSTGR
FT                   GNPRLIKLLDNVTNAQDDPYIAMESLRELSEQLLMMSPLAAERAVPQEDLLKGIVDIFM
FT                   DPLLQGELELQLIAFRCLYNLFEVNPDMISIAVDRNVIAACNDKLAEISYIDLAEQVLE
FT                   TLEIISRLHGRSVLQSGSLLACLQYLDFFTSHAQRKAVTIVVNSCAKIRAVDLGHISDI
FT                   MWRLKEIFVSSQDHSLRQNMLNVFYGICAGLGRGDKTLEGLFDFELIESIMQLISNGET
FT                   NLESRLKAFDILSQVLVSGEVLAPQIIGCGRVLDMLMSSMNEYKKSTASQLHETVMFAP
FT                   KPLLTCISRFIVVLFPGEDKQILSADTPKQYEFQGIEEQSRQLVKGLGPFLVQVYVNAV
FT                   DFQIRRLVLVALARVLSPHIPIETCDIDKGIVSMIASSLARNMALFEQSGFKDQVSGVL
FT                   LLGSLRLVTSLLEKNASEHLPAFVREGVFESFKSFSKELSSIVPESLEKTQAGDPPQNN
FT                   GKFTDISDTNSESNYHSDDDDYNMEFEGMESPDHTRPNRVCFRILKHLKLNYVQNELAN
FT                   TLESVIESYGGEGAVISEISEINSLVERLRLLDVHSDTYEYWQRIWLEVKSKLFMSNFV
FT                   CSGFEFISSGLADEMSKLVLSNSSKSSICQRALIETFGEDLETFAEIIQSALTRLESFE
FT                   LLDCGLHGEDGKGASLGKQVKIRLEYDGDAVEDGIPKNLQAVTVAIHCVATFRSLNEFL
FT                   KHRVLQSQLITSLIPALAMRVDRQDDDVKWSFDFAFNNTKCDHQDTIFGAIFRPIKNAG
FT                   KDSKSLWSEPHIIRYKKAQGKDSDQKLSTLYFGGPRGLNELGRLEGLLVLLKCLRGSSL
FT                   RPECFVNSKISAKLACQLEEPLIVAGGLLPSWTVLLTRNYPFLFPFETRMFFLQSSSFG
FT                   HGRLIQVWRNRVGSDKGDFADALHQLGRPTRRKLKVSRGAVFLSALKILDKYGSTPNIL
FT                   EVEFLNEVGTGLGPTLEFFAIVSKEFAYKSLRMWRSENFNSCKEGELVEEHLFPAPLLA
FT                   SSNQEKTLELFHKLGTFVSRSMLDDRILDFRFSKAFFELAHMYARNEKIRFDDFDLTID
FT                   YMSMVDPHLAKSMKYLFTLKNDHDFESLSLTFYLSGYNIELIENGKDVAVTIENFPDYF
FT                   ERLSDQVLGTGVKMQIQSFIEGFSRTFPYTSLLALTPDELTDLFGSVEEDWTHETLYAY
FT                   VDADHGYSHDSNIIHDLISIMTSFSKAERRLFLEFLTGSPKLPIGGFKSLNPRMTVVRK
FT                   HTENDLEPDHYLPSVMTCANYLKLPKYSNKDVLKSRVLQAMKEGLGAFLLS"
FT   gene            <540476..>541192
FT                   /locus_tag="KLTH0D06050g"
FT                   /old_locus_tag="KLTH-ORF11949"
FT   CDS_pept        540476..541192
FT                   /locus_tag="KLTH0D06050g"
FT                   /old_locus_tag="KLTH-ORF11949"
FT                   /product="KLTH0D06050p"
FT                   /note="highly similar to uniprot|P33201 Saccharomyces
FT                   cerevisiae YKL009W MRT4 Protein involved in mRNA turnover
FT                   and ribosome assembly localizes to the nucleolus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22546"
FT                   /db_xref="GOA:C5DGK4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR033867"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGK4"
FT                   /protein_id="CAR22546.1"
FT                   /translation="MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTFRFVWVLHL
FT                   DDVRTPVLQEIRSAWVGSKLIMGKRKVLQKSLGEKREEEYKENIFALSKLCSGVTGLLF
FT                   TDEEPQVVQEYFKSYVRADYSRPKSKAPLTFEIPAGIIYSRGGQIPAEDDVPMVHSLEP
FT                   TLRNKFMIPTKIKAGKITIESPYLVCTEGETLDVRQALILKQFGVAAAEFRVKVAAYYD
FT                   NETSSVETVNINIESA"
FT   gene            complement(<541229..>541690)
FT                   /locus_tag="KLTH0D06072g"
FT                   /old_locus_tag="KLTH-ORF11948"
FT   CDS_pept        complement(541229..541690)
FT                   /locus_tag="KLTH0D06072g"
FT                   /old_locus_tag="KLTH-ORF11948"
FT                   /product="KLTH0D06072p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06072g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22547"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGK5"
FT                   /protein_id="CAR22547.1"
FT                   /translation="MDTALAQLILDDNEKLGTLIFALGETARHYFEHQLSSSAGTMSSV
FT                   RASTNSRCNIKVLFLNKLQYLFMYLTKLEGEGNGQELGLTNLIIYGLDEALELVDDKLS
FT                   IAQTRLANLIFNVAFKVRARHRVEVQFISSKDDVHDNLNRLEQYWQEVC"
FT   gene            <541858..>543066
FT                   /locus_tag="KLTH0D06094g"
FT                   /old_locus_tag="KLTH-ORF11947"
FT   CDS_pept        541858..543066
FT                   /locus_tag="KLTH0D06094g"
FT                   /old_locus_tag="KLTH-ORF11947"
FT                   /product="KLTH0D06094p"
FT                   /note="similar to uniprot|P32902 Saccharomyces cerevisiae
FT                   YHL004W MRP4 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06094g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22548"
FT                   /db_xref="GOA:C5DGK6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGK6"
FT                   /protein_id="CAR22548.1"
FT                   /translation="MIPRFRVALYAQKRYLVFQNLKRGLASTGSLKEHDEQSSKIHKDE
FT                   AAHEPQDELSVLRQREYNNQVKELLKSFSKTATEDFKDFHGSVTGELSAKEQQLDEELT
FT                   SFLKQFSQLNTVIEPKEDNGKRIAAPTYSRIKTFPFLIPSPEDKPYTNQELFLRQIKHA
FT                   DGTAKLGAAMENVYYPHRDIFNPPAIEELSISKLLAAGVHLGQSTSLWRPSTQPYIYGE
FT                   YKGIHIIDLNKTLSNLKRAAKVVQGVAEKGGTILFLGTRDGQKRALQEAAKRTNGFYVS
FT                   TRWIPGTLTNPTEISSVWERHEIDFADTPTNRPLTSDEEAAIVKPDLLVVLNPTENRNA
FT                   LNEAMQARVPTVGIIDTDSEPSLVTYPIPGNDDSLRSVNIILSVLAKAGEVGLQSRLAK
FT                   AAF"
FT   gene            complement(<543221..>544486)
FT                   /locus_tag="KLTH0D06116g"
FT                   /old_locus_tag="KLTH-ORF11946"
FT   CDS_pept        complement(543221..544486)
FT                   /locus_tag="KLTH0D06116g"
FT                   /old_locus_tag="KLTH-ORF11946"
FT                   /product="KLTH0D06116p"
FT                   /note="highly similar to uniprot|P38703 Saccharomyces
FT                   cerevisiae YHL003C LAG1 Ceramide synthase component
FT                   involved in synthesis of ceramide from C26(acyl)-coenzyme A
FT                   and dihydrosphingosine or phytosphingosine functionally
FT                   equivalent to Lac1p and highly similar to YKL008C
FT                   uniprot|P28496 Saccharomyces cerevisiae YKL008C LAC1
FT                   Ceramide synthase component involved in synthesis of
FT                   ceramide from C26(acyl)-coenzyme A and dihydrosphingosine
FT                   or phytosphingosine functionally equivalent to Lag1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22549"
FT                   /db_xref="GOA:C5DGK7"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR013599"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGK7"
FT                   /protein_id="CAR22549.1"
FT                   /translation="MSSHLQKPVVRTRRTSSVGAINLGDNKVPGLSTMKESEQSKTAAL
FT                   ARMRALSEASKGDVDLLKKFYLTYREMSYRHTWLTPLVILLAVYGAYFLSGNRTASNPL
FT                   HPFVAISYQVGDSDMYGKGIGDLCFVFYYMVFFTFLREFLMECVLRPLASALGVTGEHK
FT                   TKRLMEQAYSIIYYGISGPFGLYIMYHTDLWLFRTAPMYATYPDLTNQYLYKVFYLGQA
FT                   AFWTQQACVLVLQLEKPRKDFKELVFHHIVTLALIWLSYVFHFTKMGLAVYITMDVSDF
FT                   FLSLSKTLNYLDSALTAPVFFVFVASWTYLRHYINLKILWSVLTEFRTVGDYTLNFATQ
FT                   QYKCWISLPIVFVLISALQLVNLYWLFLVMRILYRLLFKGIQKDERSESESEETVQVDK
FT                   HENDENEKTMEGNPDPALKKEN"
FT   gene            <544661..>546130
FT                   /locus_tag="KLTH0D06138g"
FT                   /old_locus_tag="KLTH-ORF11944"
FT   CDS_pept        544661..546130
FT                   /locus_tag="KLTH0D06138g"
FT                   /old_locus_tag="KLTH-ORF11944"
FT                   /product="KLTH0D06138p"
FT                   /note="similar to uniprot|P38753 Saccharomyces cerevisiae
FT                   YHL002W HSE1 Subunit of the endosomal Vps27p- Hse1p complex
FT                   required for sorting of ubiquitinated membrane proteins
FT                   into intralumenal vesicles prior to vacuolar degradation as
FT                   well as for recycling of Golgi proteins and formation of
FT                   lumenal membranes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06138g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22550"
FT                   /db_xref="GOA:C5DGK8"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGK8"
FT                   /protein_id="CAR22550.1"
FT                   /translation="MSSNQSLRDAILRATDGKLRVDNWQFIIEVCDLVREDPEDRGRFA
FT                   TDIVEERLKEDDANVVLRTLSLVVSLAENCGSRLQQAISSKGFTKVLYGLIENPKVHLV
FT                   VKREVAKVVEQLSDSFKNDSSLKSMQDLYVAISAQAPHLLVRERVPQKKEMSHETKRNE
FT                   EKELEEALKLSILEYEQSSSQKAAQNNDNKVANQKHIESSHHNESQTQNTVRKVRALHD
FT                   LTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYVTPVAEKTPEQLRQQK
FT                   AHEDAVFSQISNVDKLHRRMAENANDLELTQDGEVNNLYSVVTPLRPQLTKMIGDYAQK
FT                   KEEYSSLRKVLADAEASYNRMLDRASQVYPTQSLPLERMGSGSYEQPVGLQHTHSRQAS
FT                   AVNPLSRQPQSGIPYVHAQSFLTGQPQPNQHQTHSLKLQQREQRQSPHQIPELYQQGPQ
FT                   NYQRQPQNTHPSETRPVHQVPYPMSNQATGI"
FT   gene            <546275..>547069
FT                   /locus_tag="KLTH0D06160g"
FT                   /old_locus_tag="KLTH-ORF11943"
FT   CDS_pept        546275..547069
FT                   /locus_tag="KLTH0D06160g"
FT                   /old_locus_tag="KLTH-ORF11943"
FT                   /product="KLTH0D06160p"
FT                   /note="similar to uniprot|P28495 Saccharomyces cerevisiae
FT                   YKL007W CAP1 Alpha subunit of the capping protein (CP)
FT                   heterodimer (Cap1p and Cap2p) which binds to the barbed
FT                   ends of actin filaments preventing further polymerization
FT                   localized predominantly to cortical actin patches"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06160g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22551"
FT                   /db_xref="GOA:C5DGK9"
FT                   /db_xref="InterPro:IPR002189"
FT                   /db_xref="InterPro:IPR017865"
FT                   /db_xref="InterPro:IPR037282"
FT                   /db_xref="InterPro:IPR042276"
FT                   /db_xref="InterPro:IPR042489"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGK9"
FT                   /protein_id="CAR22551.1"
FT                   /translation="MSSSFETIIESIISDAPSGEVQDVVKDLTTIAGDQAEEAIIEAMT
FT                   HYNVKNLIPIEVKGKPVIISEYNKKGSKFFDPVRSILFSVDHLNRTGVDVEDCDQKHTT
FT                   EQRGLYEELDKYMSKNFTGNVAYAVYAKDDPDEVAIFIASTRYSPGNFWNGHWRSSYTY
FT                   NMNSQALKGTVDIDVHYFEDGNVSFKFSKDVEHNAASSAVVSIKNLENEVENEMSASFS
FT                   NLNEKEFKLLRRRLPVTRSKINWGKGIGTYRLGKDSAENQLK"
FT   gene            complement(<547103..>547463)
FT                   /locus_tag="KLTH0D06182g"
FT                   /old_locus_tag="KLTH.mRNA.110AT.m"
FT   CDS_pept        complement(join(547103..547360,547428..547463))
FT                   /locus_tag="KLTH0D06182g"
FT                   /old_locus_tag="KLTH.mRNA.110AT.m"
FT                   /product="KLTH0D06182p"
FT                   /note="highly similar to uniprot|P43682 Saccharomyces
FT                   cerevisiae YKL006C-A SFT1 Intra-Golgi v-SNARE required for
FT                   transport of proteins between an early and a later Golgi
FT                   compartment"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06182g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22552"
FT                   /db_xref="GOA:C5DGL0"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR039897"
FT                   /db_xref="InterPro:IPR039899"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGL0"
FT                   /protein_id="CAR22552.1"
FT                   /translation="MSNSRYAQLEGNNDQRLDELANKLSTFRRVNQEIGDEARADSSVM
FT                   DQLQNQFSSLMVNVKNSSSRLTRSMNAGNNIWRMVGLALLLFFIMYALFKLF"
FT   gene            <548471..>549058
FT                   /locus_tag="KLTH0D06204g"
FT   CDS_pept        join(548471..548599,548771..549058)
FT                   /locus_tag="KLTH0D06204g"
FT                   /product="KLTH0D06204p"
FT                   /note="highly similar to uniprot|P36105 Saccharomyces
FT                   cerevisiae YKL006W RPL14A and to uniprot|P38754
FT                   Saccharomyces cerevisiae YHL001W RPL14B Protein component
FT                   of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22553"
FT                   /db_xref="GOA:C5DGL1"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR039660"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGL1"
FT                   /protein_id="CAR22553.1"
FT                   /translation="MSSESIVKNSQWRLVEVGRVVLIKKGPSAGKLAAIVEIIDQKRAL
FT                   IDGPETNVPRQSVNLGHVVLTPLTFALPRGAKTAVVAKKWTSAGVAEKWAASSWAKKIA
FT                   QRERRAALSDFERFQVMVLRKQRRYAVKKAVAKA"
FT   gene            complement(<549266..>550918)
FT                   /locus_tag="KLTH0D06226g"
FT                   /old_locus_tag="KLTH-ORF11938"
FT   CDS_pept        complement(549266..550918)
FT                   /locus_tag="KLTH0D06226g"
FT                   /old_locus_tag="KLTH-ORF11938"
FT                   /product="KLTH0D06226p"
FT                   /note="weakly similar to uniprot|P36106 Saccharomyces
FT                   cerevisiae YKL005C BYE1 Negative regulator of transcription
FT                   elongation contains a TFIIS-like domain and a PHD finger
FT                   multicopy suppressor of temperature-sensitive ess1
FT                   mutations probably binds RNA polymerase II large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22554"
FT                   /db_xref="GOA:C5DGL2"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR012921"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR036575"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGL2"
FT                   /protein_id="CAR22554.1"
FT                   /translation="MLAEGVRRSSRRNKGTNKYLQDQRTAELEYVKARAKKQEVEAEDH
FT                   GISDAVRCLVCGTTDENYDEDNDPYGDMIQCDKCNSWQHIKCMMDQEEANEVETYFCSI
FT                   CSPSSYPNIRYSIDPQSVVTKKHFIKTSKSDDEIEDFQEEISDEDANEYLGKDSTRPKK
FT                   RRKLDSPKNITKAPTGDQGCRLRDSALKMFKDLFTKYVIPDTIQAHRFQLPPEFSCEQY
FT                   ADSLAAELEEELHATNIAQEESKLNGMYKEKVRVLFSNLKDQKNIEMKALVVNKALPFK
FT                   KLVQMSVNELVNPDLKSFKEKVGSEALTQLILEQPHKPRYFKTHKGEELIEDPNDYEPE
FT                   DIIFNKDILITNRGTSSERSQHESPDKKSVKETSLRTRRESDQIQNNSNLDGDEHSWKC
FT                   TVDYKELNCKFSGSVKFIASSQEISYTVQRDAIGDSAFVVEGRLSDEEAEKYIRQMADS
FT                   RAFLVYAIRPDDVSHEVEAFEHLVDFLSSRQRYGALVSKRQYVRHVYVIPRTETLQSEV
FT                   FNHLHLNEIGSKLEAQKCLLVVLILRLDMLDLK"
FT   gene            <551316..>552560
FT                   /locus_tag="KLTH0D06248g"
FT                   /old_locus_tag="KLTH-ORF11936"
FT   CDS_pept        551316..552560
FT                   /locus_tag="KLTH0D06248g"
FT                   /old_locus_tag="KLTH-ORF11936"
FT                   /product="KLTH0D06248p"
FT                   /note="similar to uniprot|P36107 Saccharomyces cerevisiae
FT                   YKL004W AUR1 Phosphatidylinositol:ceramide phosphoinositol
FT                   transferase (IPC synthase) required for sphingolipid
FT                   synthesis can mutate to confer aureobasidin A resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22555"
FT                   /db_xref="GOA:C5DGL3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGL3"
FT                   /protein_id="CAR22555.1"
FT                   /translation="MSEIFKRLFMSHRPANSKVSQLETSLNPTITLKKLRSYTPSLGDL
FT                   CHYAFLGSVLLFVLIVYPAALILKLSVYVLFGVLFLLPATSQFFFNALPIFTWLALYFT
FT                   SSTFEAKHRPPITVQVLPAIETILYGDNLSDILAASLNKPLDIFAWLPYGIFHFGAPFV
FT                   VAIILFLCGPPTLLRGYAFAFGYMNLAGVIMQNLLPAAPPWYKIQYGLTPANYKMKGSP
FT                   GGLKRIDEYLGISVYTEGFSNSAVIFGALPSLHSGCATMEALFFSYVFPKLKPLFIFYV
FT                   CWLWWSTMYLTHHYFVDLMAGSVLSYTIFQYTKYFHLPLPEPSVYSRWSYADIKKFSVW
FT                   QADPLNGDGGDLENLAVPLAVDTDFELNVMENSEPPSIFDQDRSVSRSSATSNTSADVQ
FT                   DDFVSAARPGKQRID"
FT   gene            complement(<552705..>553133)
FT                   /locus_tag="KLTH0D06270g"
FT                   /old_locus_tag="KLTH-ORF11935"
FT   CDS_pept        complement(552705..553133)
FT                   /locus_tag="KLTH0D06270g"
FT                   /old_locus_tag="KLTH-ORF11935"
FT                   /product="KLTH0D06270p"
FT                   /note="highly similar to uniprot|P28778 Saccharomyces
FT                   cerevisiae YKL003C MRP17 Mitochondrial ribosomal protein of
FT                   the small subunit MRP17 exhibits genetic interactions with
FT                   PET122 encoding a COX3-specific translational activator"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22556"
FT                   /db_xref="GOA:C5DGL4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGL4"
FT                   /protein_id="CAR22556.1"
FT                   /translation="MSSSFVEKKCNSIMLYELVSIVRVVNPLAANTEAKELATTIGKLI
FT                   IQNRGVVRRVLPVGNKLLPKIIKKDQEQHFQGYHFLMLFDSSAAVQSEILRTLKKDPRV
FT                   IRSSIVKVDTSKQLDVASSIERAAGYSSILEKVKKDAF"
FT   gene            <553292..>554037
FT                   /locus_tag="KLTH0D06292g"
FT                   /old_locus_tag="KLTH.mRNA.127AT.p"
FT   CDS_pept        join(553292..553351,553408..554037)
FT                   /locus_tag="KLTH0D06292g"
FT                   /old_locus_tag="KLTH.mRNA.127AT.p"
FT                   /product="KLTH0D06292p"
FT                   /note="highly similar to uniprot|P36108 Saccharomyces
FT                   cerevisiae YKL002W DID4 Class E Vps protein of the ESCRT-
FT                   III complex required for sorting of integral membrane
FT                   proteins into lumenal vesicles of multivesicular bodies and
FT                   for delivery of newly synthesized vacuolar enzymes to the
FT                   vacuole involved in endocytosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06292g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22557"
FT                   /db_xref="GOA:C5DGL5"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="InterPro:IPR042277"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGL5"
FT                   /protein_id="CAR22557.1"
FT                   /translation="MALFEWVFGKSLTPQERLKKNQRALERTQRELERERRKLEQQEKK
FT                   LISDIKKSAKDGQVTAAKIQAKDLVRTRKHISKFSNMKTQLQAISLRIQAVRSSDQMTS
FT                   SMREATGLLASMNRSMNLPQLQRISAEFEKQSDLMDQRQEFMDEAIDDVMGDELEEDDE
FT                   ADEIVNRVLDEIGVDLNVKLQSTPQDAVEAPENGSSERVAESLTSNGLGTANADDELQA
FT                   RLNSLKR"
FT   gene            complement(<554066..>554713)
FT                   /locus_tag="KLTH0D06314g"
FT                   /old_locus_tag="Klth0D.mRNA.at.282.m"
FT   CDS_pept        complement(join(554066..554549,554601..554713))
FT                   /locus_tag="KLTH0D06314g"
FT                   /old_locus_tag="Klth0D.mRNA.at.282.m"
FT                   /product="KLTH0D06314p"
FT                   /note="similar to uniprot|Q02196 Saccharomyces cerevisiae
FT                   YKL001C MET14 Adenylylsulfate kinase required for sulfate
FT                   assimilation and involved in methionine metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06314g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22558"
FT                   /db_xref="GOA:C5DGL6"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGL6"
FT                   /protein_id="CAR22558.1"
FT                   /translation="MSTNITWHPNLTYEERSGLRKQNGATVWLTGLSASGKSTIACALE
FT                   QLLLSENVAAYRLDGDNIRFGLNKDLGFSEKDRNENIRRISEVSKLFADSCTISITSFI
FT                   SPYRVDRDRARVLHKDSGLKFVEVFVDVPLDVAEQRDPKGLYKKAREGIIKDFTGVSAP
FT                   YEAPDAPELHLRTDKQTVEECAQQIYLYLKKESII"
FT   misc_feature    555337..555463
FT                   /locus_tag="KLTH0D06336s"
FT                   /old_locus_tag="centromere.klth0D"
FT                   /note="Centromere Klth0D"
FT   gene            complement(<555635..>557710)
FT                   /locus_tag="KLTH0D06358g"
FT                   /old_locus_tag="KLTH-ORF11932"
FT   CDS_pept        complement(555635..557710)
FT                   /locus_tag="KLTH0D06358g"
FT                   /old_locus_tag="KLTH-ORF11932"
FT                   /product="KLTH0D06358p"
FT                   /note="highly similar to uniprot|P21576 Saccharomyces
FT                   cerevisiae YKR001C VPS1 GTPase required for vacuolar
FT                   protein sorting, functions in actin cytoskeleton
FT                   organization via its interaction with Sla1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06358g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22559"
FT                   /db_xref="GOA:C5DGL7"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGL7"
FT                   /protein_id="CAR22559.1"
FT                   /translation="MDEALISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSV
FT                   LENIVGRDFLPRGTGIVTRRPLVLQLINRRSSKNLSSKPDKNELLELENEHPTKGQSED
FT                   NADEWGEFLHIPGKKFYNFDEIRQEIVNETDKTTGKNAGISSVPINLRIYSPHVLTLTL
FT                   VDLPGLTKVPVGDQPADIEKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREV
FT                   DPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEVKKTIRSAL
FT                   EDEKRYFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIELTLKKYQAEL
FT                   MNLGPETMDSPNSIVLSMITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIYKNG
FT                   VRALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIKRFEEPSLRLVSLVF
FT                   DELVRILKQIISQPKYARYPGLREAMSNYFVQFLKEAIIPTNTFVSDIIQAERTYINTA
FT                   HPDLLKGSQAMAMIEEKLHPRQVSVDPKTGKPLPNQAPQPQTQQNEEKSSFFGGFFSSK
FT                   NKKKLVALESPPPVLKATGQMTERETMETEVIKLLIESYFNIVKRTIADVIPKAVMLKL
FT                   IVKSKNDIQKMLLEKLYGNQDLADLTKENDITIQRRKECHKMTEILRNASDIVSSV"
FT   gene            <558139..>559923
FT                   /locus_tag="KLTH0D06380g"
FT                   /old_locus_tag="KLTH-ORF11930"
FT   CDS_pept        558139..559923
FT                   /locus_tag="KLTH0D06380g"
FT                   /old_locus_tag="KLTH-ORF11930"
FT                   /product="KLTH0D06380p"
FT                   /note="similar to uniprot|P29468 Saccharomyces cerevisiae
FT                   YKR002W PAP1 Poly(A) polymerase one of three factors
FT                   required for mRNA 3'-end polyadenylation forms multiprotein
FT                   complex with polyadenylation factor I (PF I) also required
FT                   for mRNA nuclear export may also polyadenylate rRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06380g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22560"
FT                   /db_xref="GOA:C5DGL8"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007010"
FT                   /db_xref="InterPro:IPR007012"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR014492"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGL8"
FT                   /protein_id="CAR22560.1"
FT                   /translation="MNQQKTYGVTGPISTAGPTAAENQLNDALIQELKKEKSFESEEDT
FT                   KKRVEVLRILQNLAQEFVYQVSKKRNMSDGMAKDAGGKIFTYGSYRLGVHGPGSDIDTL
FT                   VVVPKHVTREDFFTVFDQILRTRSELEEIAPVPDAFVPIIKIKFSGISIDLICARLDIA
FT                   QVPVNLTLADKNLLRNLDEKDLRALNGTRVTDEILQLVPKPTSFKIALRAIKLWAQRRA
FT                   VYANIFGFPGGVAWAMLVARICQLYPNACSAVILTRFFHILTKWNWPQPVLLKPIEDGP
FT                   LQVRVWNPRIYAQDRSHKMPVITPAYPSMCATHNISESTKKVILAELERGAQISSEIFS
FT                   NKKTWSDLFQKHDFFYKYKFYLTVMASTSGSSEQHLKWSGLVESKLRLLVQKLETLGGI
FT                   NLAHPFTKPFEASYVYDNEAQCKDIIDNYGTHKAQDILAQYTEVTDDNKDTDGVKDKAQ
FT                   VHITTMYIGLDVALDGKKQVDIHVPCSDFFNLCRSFSEYDDTDMFSLMIKYVKLYDLPD
FT                   NVYVEGEERPVKHSKRKKLGKDSKKSKRPKSNSLKAEEPTSGTTNSEKNNSQGPNKPVK
FT                   HEPPMQTSPNPLAGSQVN"
FT   gene            <560246..>561547
FT                   /locus_tag="KLTH0D06402g"
FT                   /old_locus_tag="KLTH-ORF11928"
FT   CDS_pept        560246..561547
FT                   /locus_tag="KLTH0D06402g"
FT                   /old_locus_tag="KLTH-ORF11928"
FT                   /product="KLTH0D06402p"
FT                   /note="highly similar to uniprot|P38755 Saccharomyces
FT                   cerevisiae YHR001W OSH7 Member of an oxysterol-binding
FT                   protein family with seven members in S. cerevisiae family
FT                   members have overlapping redundant functions in sterol
FT                   metabolism and collectively perform a function essential
FT                   for viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06402g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22561"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGL9"
FT                   /protein_id="CAR22561.1"
FT                   /translation="MPLNKLKTRSAAVPGEPSSATNASSRSLVDTDDIDENDESGQSIL
FT                   LGIISQLKPGCDLSRITLPTFILEKKSMLERITNQLQFPDILLEAHQEKDDLMRFVGVV
FT                   KWYLSGWHIAPKAVKKPLNPVLGEHFTCYWDLPNKQQAFYFSEQTSHHPPKSSYFYMIP
FT                   ESNIRVDGTTVPKSKFLGNSTAAMMEGLTVLQFLDIQDSEGHPEKFTLTQPNMYARGIL
FT                   FGKMRIELGDHMVIKSSQHKVDIEFKTKGFISGTYDAIEGTIKDQAGNEYFEISGKWND
FT                   IIYIRDLQKKTPKTVLFDASKAAPLKPLVRPLEEQGNFESRKLWKKVTDALAARDHATA
FT                   TEEKFKIEDYQRTLAKKRAESGSPFLPKLFRPASRQSDDLEFYIYKDIPEGGSHEDQIR
FT                   SILEIAPVLPGQKFTEKFEVPGQQKHKVQKQNST"
FT   gene            complement(<561640..>562842)
FT                   /locus_tag="KLTH0D06424g"
FT                   /old_locus_tag="Klth0D.mRNA.gf.349.m"
FT   CDS_pept        complement(join(561640..562556,562614..562842))
FT                   /locus_tag="KLTH0D06424g"
FT                   /old_locus_tag="Klth0D.mRNA.gf.349.m"
FT                   /product="KLTH0D06424p"
FT                   /note="weakly similar to uniprot|Q02202 Saccharomyces
FT                   cerevisiae YKR004C ECM9 Non-essential protein of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06424g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22562"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGM0"
FT                   /protein_id="CAR22562.1"
FT                   /translation="MKNSNLSKRLYDCLTDDYNNKQIRLVVLPDYFREGDSDGIVCVSD
FT                   GNAIEIICFRTFYLQVYSEARKVLNDRQSSQAAANEERYYLATTVLLLITPEDHSNIRR
FT                   HEELLLNRLKDKNCSGLWRRDEIAGAFVRRELQFVTSCLTSSLARVNKSPSLWLLYRKL
FT                   YIITNSLFPTIEANYEMCFSKSAEAHSSNYYSWHTLRWMFDVGSKQLKARLAEATETFC
FT                   FKHPKDSSAWWSLAHVLVSSFDTQKNSIAQQNMLTANYSLPPLSELIFGCASSTEIESK
FT                   VKKIVEYIDYAEVSEYPPFQCLEKLFQNLNQTGQKAYVEKWLSQVEVFERENFEIGESS
FT                   ALLSDRQLRENVLIQRDFKTLVMKKRFVQRLLPHNTPKSTP"
FT   gene            complement(<563713..>564462)
FT                   /locus_tag="KLTH0D06446g"
FT                   /old_locus_tag="KLTH-ORF11924"
FT   CDS_pept        complement(563713..564462)
FT                   /locus_tag="KLTH0D06446g"
FT                   /old_locus_tag="KLTH-ORF11924"
FT                   /product="KLTH0D06446p"
FT                   /note="similar to uniprot|Q02204 Saccharomyces cerevisiae
FT                   YKR006C MRPL13 Mitochondrial ribosomal protein of the large
FT                   subunit not essential for mitochondrial translation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22563"
FT                   /db_xref="GOA:C5DGM1"
FT                   /db_xref="InterPro:IPR018305"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGM1"
FT                   /protein_id="CAR22563.1"
FT                   /translation="MLSNRIASCSVKRGLHVSASSKDFMSWFRRKQTAKPAAPIKKTEE
FT                   LINEVESGVGGAEAPLNRLKLTDEFFIGKSNLDLDRRERQSRVNEVPFNKWMSSEKLKS
FT                   SGVLDSILLESYNSTNSEFRAIAIADEKLALPFTDLVFKFHFSKALQSATGTLIPDYQI
FT                   TRLQTPIAFRNYLLKEVVSGKLAKFRESEPNAIELGQGHYSSDSIHVVEDVRFSERKKK
FT                   LSKILSEVEFLEREAARQAVEKARQAA"
FT   gene            <564646..>565104
FT                   /locus_tag="KLTH0D06468g"
FT                   /old_locus_tag="KLTH-ORF11922"
FT   CDS_pept        564646..565104
FT                   /locus_tag="KLTH0D06468g"
FT                   /old_locus_tag="KLTH-ORF11922"
FT                   /product="KLTH0D06468p"
FT                   /note="some similarities with uniprot|Q02205 Saccharomyces
FT                   cerevisiae YKR007W MEH1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06468g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22564"
FT                   /db_xref="GOA:C5DGM2"
FT                   /db_xref="InterPro:IPR028209"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGM2"
FT                   /protein_id="CAR22564.1"
FT                   /translation="MGVIISCCFRDRSSEDEPLIQDSQRGYGANANNDYDALQRKLEQE
FT                   EQKLLVREQELTEIVNSTNDKLIDISMMSNSGIVVQSHDLDNILGAESEDEHGRLDGSG
FT                   IQEGLKELGPPKLQRHHRDAMKKLYAELFSGLDDQLMIDTKEDLIVTL"
FT   gene            <565317..>566975
FT                   /locus_tag="KLTH0D06490g"
FT                   /old_locus_tag="KLTH-ORF11920"
FT   CDS_pept        565317..566975
FT                   /locus_tag="KLTH0D06490g"
FT                   /old_locus_tag="KLTH-ORF11920"
FT                   /product="KLTH0D06490p"
FT                   /note="similar to uniprot|Q02206 Saccharomyces cerevisiae
FT                   YKR008W RSC4 One of 15 subunits of the 'Remodel the
FT                   Structure of Chromatin' (RSC) complex found in close
FT                   proximity to nucleosomal DNA displaced from the surface of
FT                   nucleosomal DNA after chromatin remodeling"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06490g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22565"
FT                   /db_xref="GOA:C5DGM3"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR027180"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037382"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGM3"
FT                   /protein_id="CAR22565.1"
FT                   /translation="MAPKKRKAQDADPTVETTDLQRRYAAGKQPRTEEQLPSVDYHVPL
FT                   DPESELFTENDWFIPKFNLFISFTLDNLVESYRNVFKDFIKLPSRKFHPGYFYKIDQPI
FT                   SINEIKSRDYEYLNGHRTFLLDIELIRKNCYSYNDSDSLIVKNSMQVVNYVKYEVLKAK
FT                   NVTRNYLINAEVKKFLQDTLAKVFDATDKSVAEMMGKPSEGFDTSLRICEPFVELVSKD
FT                   ELPEYYEVIHRPSALKLVRNNLEMDYYSKIYDFYIDMILVFENALVFNDPETLIYQDAE
FT                   KLLRFFRKLMQERFFVSLKDASERGEVKLEYDKFEYKQYLANGGDGDAAEMEDEDVELE
FT                   DYDFNHYEGLGNGYNRTLFSGDYLLGPSKMKLNEMNPKRNVMEAAEELPEAPKYNIFNS
FT                   LAEDAEKKNEEEVAPYTFIREISVTSSKSQYKQDTAPVQGALPPLNQKWVEYVFNGECL
FT                   TKKNNMFSLTLPPIQTSASITAHLNYLPGANYNASLTVDKEKTNPAPNAVAEGNESPIK
FT                   FEVRLLEGNNNLEFTCEDQDTGNTESFKLWIVVLP"
FT   gene            <567443..>567811
FT                   /locus_tag="KLTH0D06512g"
FT                   /old_locus_tag="Klth0D.mRNA.373.p"
FT   CDS_pept        join(567443..567451,567584..567811)
FT                   /locus_tag="KLTH0D06512g"
FT                   /old_locus_tag="Klth0D.mRNA.373.p"
FT                   /product="KLTH0D06512p"
FT                   /note="similar to uniprot|P37299 Saccharomyces cerevisiae
FT                   YHR001W-A QCR10 8.5 kDa subunit of the ubiqunol-cytochrome
FT                   c oxidoreductase complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22566"
FT                   /db_xref="GOA:C5DGM4"
FT                   /db_xref="InterPro:IPR019182"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGM4"
FT                   /protein_id="CAR22566.1"
FT                   /translation="MVAYVSKLAAKTAPHFGQLKLRNLIDYIPNLAIWGGASLAGVFVF
FT                   TEGWPKFQDTIYKKIPIMGPHWQVEIPPEDSPQ"
FT   gene            complement(<568047..>570752)
FT                   /locus_tag="KLTH0D06534g"
FT                   /old_locus_tag="KLTH-ORF11917"
FT   CDS_pept        complement(568047..570752)
FT                   /locus_tag="KLTH0D06534g"
FT                   /old_locus_tag="KLTH-ORF11917"
FT                   /product="KLTH0D06534p"
FT                   /note="similar to uniprot|Q02207 Saccharomyces cerevisiae
FT                   YKR009C FOX2 Multifunctional enzyme of the peroxisomal
FT                   fatty acid beta-oxidation pathway has 3- hydroxyacyl-CoA
FT                   dehydrogenase and enoyl-CoA hydratase activities"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22567"
FT                   /db_xref="GOA:C5DGM5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGM5"
FT                   /protein_id="CAR22567.1"
FT                   /translation="MGDNKLSFKGRVVIITGAGGGLGRIYALEFAKRGAKVVVNDLGGS
FT                   LGGEGQNSRAADVVVSEISEKYKTEAVANYDSVTENAQGIVQAALDNFGRVDVIINNAG
FT                   ILRDSSFVKMSSSAFASVVDVHLNGAYRLTKAAWPYMKEQGFGRIVNTCSPAGLYGNFG
FT                   QANYSAAKMGLVGLSETLAKEGYKYNIRVNCIVPLARSRMTEKVVPPPILKQLSPEKIA
FT                   PLVVYLTHESTEVTNSIFELAAGFYSQIRWERSSGQIFNPDAESFTAEAILNKWPSICD
FT                   YRDKPFNKTQHPTQLSDYNALIAKARDLPQNEQGSQSIKSLKDKVVIVTGAGGGLGKSH
FT                   ALNFAKYGARVVVNDIRDPDSVVLAIEKAYGRGRAIPDKHDIVKNPNEVVETALKAFGT
FT                   VDILVNNAGVLRDRSFAKMTDEEWDIVLKVHLFSTFGLSKAVWPVFLKQKRGCIINTTS
FT                   TSGIYGNFGQANYAAAKAAVIGLSKTLALEGLKHNIKVNVVAPHAETAMTKTIFSKKEL
FT                   GNHFDPSQVSPFFVLLASKELDAKAGKPVTGQLFEVGGGWCGQTRWQRSKGVVSLQPTP
FT                   EFLRDNWRKVVDFSQYAHPSSAQDSTMAILQSVALESKSASSLASKKDGFRYSERDVIL
FT                   YNLGLGCSSTELNYCYENDPNFQVLPTFAVIPFMTSGNSIKLESLVDDFNYAFLLHGEQ
FT                   YIRLNKFPVPTKGTLKTKAEPIQVDDKGGKAALVVGGYQTVIAETNEPLFYNEASFFIR
FT                   GAHVPEEKRLKGNRPKFAVQSFKAPSSKPDFEKIVSTDPNQAAIYRLSGDLNPLHIDPN
FT                   MAKLAKFPRPILHGLCTLGITGKALFEKFGQYKEFKVRFTNAVYPGDRLKIQAWKQQDG
FT                   VIVFQTVDLDQNYVVLDNAAMKVVGSQANL"
FT   gene            complement(<570972..>572342)
FT                   /locus_tag="KLTH0D06556g"
FT                   /old_locus_tag="KLTH-ORF11914"
FT   CDS_pept        complement(570972..572342)
FT                   /locus_tag="KLTH0D06556g"
FT                   /old_locus_tag="KLTH-ORF11914"
FT                   /product="KLTH0D06556p"
FT                   /note="similar to uniprot|P38153 Saccharomyces cerevisiae
FT                   YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
FT                   which functions in transport of alkaline phosphatase to the
FT                   vacuole via the alternate pathway clathrin associated
FT                   protein medium chain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22568"
FT                   /db_xref="GOA:C5DGM6"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGM6"
FT                   /protein_id="CAR22568.1"
FT                   /translation="MFLSFYITDLKNALVFQHLLSYDSPTFMSLWTKLQAMAPESPNDD
FT                   SWFKVSIGRSLQVYRFKSKANKLIYWCLATHQSNPLEPAVFLEGFDNTLLQYFDKDQLT
FT                   ISKMVNNQDRIALLLNCMVDANEPAVTDFNHLRDMVPSREDLSKVINSTASSLSNRISQ
FT                   RNTSQVLNIGDPAKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELT
FT                   SVRGVLDGVVDFRSHLSGNPVIALNLRLRGHDLGMPALHQCCLDSYQGRPDQLRFVPPD
FT                   GKFQLMHYSIDLDSLQSKSKLFSNIGLVSPDYRTELGDLGDEFEVNLNIAGSQHAKVVD
FT                   DLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDKETPTGTLPVLRGCLENA
FT                   TREQVRALQLSVSYTNRGELPSGIKVDSVDILSGLSKNIKPFKGVKYIAKTGDFHLR"
FT   gene            <572515..>574866
FT                   /locus_tag="KLTH0D06578g"
FT                   /old_locus_tag="KLTH-ORF11913"
FT   CDS_pept        572515..574866
FT                   /locus_tag="KLTH0D06578g"
FT                   /old_locus_tag="KLTH-ORF11913"
FT                   /product="KLTH0D06578p"
FT                   /note="some similarities with uniprot|P18480 Saccharomyces
FT                   cerevisiae YBR289W SNF5 Involved in global regulation of
FT                   transcription subunit of the chromatin remodeling Snf/Swi
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22569"
FT                   /db_xref="GOA:C5DGM7"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGM7"
FT                   /protein_id="CAR22569.1"
FT                   /translation="MNNLQTNPFANIGTTSFSLSQVPQHILQNLTPVQLQMIQQKHQQL
FT                   LMERQALMQQQQQQQQQQQQQQQQQQQQPQHHQNQQHPSMSQRHQPGELPQHQRQHQHQ
FT                   QQQQQHHLHQQQQQHQLKQQQQQQQLQQQQLQQQQQQQQQQQQQQQQQQQQQQQQQQLQ
FT                   QQQITANAGQSTALPQQLNLAQRAQILKAKQQQLDTNQQQAASTPTGVPALNLPPQIAQ
FT                   LPPHVQQRVLNNLKQQAAAKNNPAAVAAITAAQQQLAGRMSNHQSPTPPSAQFPQQPIP
FT                   QTPGLPTPPVPQASVPLPKFQTIFQDPPERQMSSHSHWSDKIERGELDIKEPDSNLLIY
FT                   EQTLKRDRENGEQLIKERTGYEPFSKYGFSHKEYLTRLLQDLNYIKEVKAARMKSITAT
FT                   TQGLVSKSIWGDGYSGYGNGFSNTVTSVSTGQTGPDGRQSTHYNVGEIYQQAMYESHEE
FT                   LVPVRLEFDAERDNFSLRDVFVWNKNEKIIKIEELVTEMLRDYRFARNDQFFETVVQSI
FT                   KEQINEFQPDPFLENEGDRFGGDDLRIKIQLDIVVGQNQLMDAFEWDISNPSNSPEEFA
FT                   ETLSQELELPGEFSTAIAHSIREQVHMYHKSLSLTCYQFDGSTVEDEDIRSRLLPLVTL
FT                   NEVFRNSMNTKVFTPSLLKVSHAELERLDRDKDRDTRRKRRQGRFNRRGVGPGTAVTLN
FT                   DGSLPDLSDVPKTFRIPVPSTILPGGVDLGPSVNSYRTESSSEYMARPPEPALEQPNPC
FT                   CRIIDHNPGQYLLVRIKLPSKTDGAISQGV"
FT   gene            <574893..>575855
FT                   /locus_tag="KLTH0D06600g"
FT                   /old_locus_tag="KLTH-ORF11910"
FT   CDS_pept        574893..575855
FT                   /locus_tag="KLTH0D06600g"
FT                   /old_locus_tag="KLTH-ORF11910"
FT                   /product="KLTH0D06600p"
FT                   /note="similar to uniprot|P38356 Saccharomyces cerevisiae
FT                   YBR290W BSD2 Heavy metal ion homeostasis protein
FT                   facilitates trafficking of Smf1p and Smf2p metal
FT                   transporters to the vacuole where they are degraded
FT                   controls metal ion transport prevents metal
FT                   hyperaccumulation functions in copper detoxification"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22570"
FT                   /db_xref="GOA:C5DGM8"
FT                   /db_xref="InterPro:IPR019325"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGM8"
FT                   /protein_id="CAR22570.1"
FT                   /translation="MACKFRKRILSIVHCIQITKRSRYKHKAPACCKRSEHMAELNLGA
FT                   GVVGRSSDAIPESDSHGQDAPQGQRGFASTLQENIMRSFDSVGKKFNVLDRLFKKNNGT
FT                   TGLQFGANADGVFSNLTAKPDESGSVELQDRDKPPNYEEAAADMAPSYYGMDEDGIGMY
FT                   YNEICFEGLPVGNVVNLLWNIIVSVSFQFVGFLLTYILHTSHAAKQGSRFGLGLTFLGY
FT                   GYSMIPNDVTSKVGKSKSISKLKPLDPNEFDDMHLYSGSATKDEFESSLSHGIDEKKSG
FT                   IPFLAILLFVSGFSIMFKSIYDYVKVKRKERRYLTQEQV"
FT   gene            complement(<575930..>576823)
FT                   /locus_tag="KLTH0D06622g"
FT                   /old_locus_tag="KLTH-ORF11909"
FT   CDS_pept        complement(575930..576823)
FT                   /locus_tag="KLTH0D06622g"
FT                   /old_locus_tag="KLTH-ORF11909"
FT                   /product="KLTH0D06622p"
FT                   /note="highly similar to uniprot|P38152 Saccharomyces
FT                   cerevisiae YBR291C CTP1 Mitochondrial inner membrane
FT                   citrate transporter member of the mitochondrial carrier
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22571"
FT                   /db_xref="GOA:C5DGM9"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGM9"
FT                   /protein_id="CAR22571.1"
FT                   /translation="MSQKRQVDPLHSFLAGALAGAAEASITYPFEFAKTRLQLVDKSST
FT                   ASRNPLTLIYRTAKSQGVGALYVGCPAFIVGNTAKAGVRFLGFDAIKNVLRDPQTGELS
FT                   GPRGIVAGLGAGLLESVVAVTPFEAIKTALIDDKQSANPKYHNNGRGMLRNYSNLVYDQ
FT                   GFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQEYTNAPKDKPLSSGLTFVVGAFSG
FT                   IVTVYTTMPIDTVKTRMQSLNSSKYSSTLNCFSTVFREEGLKTFWKGATPRLGRLILSG
FT                   GIVFTIYEKVLIILGA"
FT   gene            <578225..>579274
FT                   /locus_tag="KLTH0D06644g"
FT                   /old_locus_tag="KLTH-ORF11905"
FT   CDS_pept        578225..579274
FT                   /locus_tag="KLTH0D06644g"
FT                   /old_locus_tag="KLTH-ORF11905"
FT                   /product="KLTH0D06644p"
FT                   /note="similar to uniprot|P38702 Saccharomyces cerevisiae
FT                   YHR002W LEU5 Mitochondrial carrier protein involved in the
FT                   accumulation of CoA in the mitochondrial matrix homolog of
FT                   human Graves disease protein does not encode an isozyme of
FT                   Leu4p as first hypothesized"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06644g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22572"
FT                   /db_xref="GOA:C5DGN0"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002167"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGN0"
FT                   /protein_id="CAR22572.1"
FT                   /translation="MCNADNNNEIRASPEARMVDKYSAHYILRSGLAGGIAGSCAKTLI
FT                   APLDRIKILFQTSNPHYLKYSGSMLGLVQAGFHINARDGIRGFYQGHSATLIRIFPYAA
FT                   IKFIAYEQIRNVMIPSKEYETHARRLASGSLAGLCSVFMTYPLDLIRVRLAYVTDHRRI
FT                   RMLPIIKQIYTERASESLTSKPFVPQWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLC
FT                   GDILRSSVLAPYSVLHVSNEELSMRSKKQNNRPLKTWAELVAGGLAGMASQTASYPFEI
FT                   IRRRLQVSVVSPTSIHEFQSIPDMIRVIYKERGWRGFFVGLSIGYIKVTPMVACSFFVY
FT                   ERMKWYLAI"
FT   gene            complement(<579343..>580686)
FT                   /locus_tag="KLTH0D06666g"
FT                   /old_locus_tag="KLTH-ORF11904"
FT   CDS_pept        complement(579343..580686)
FT                   /locus_tag="KLTH0D06666g"
FT                   /old_locus_tag="KLTH-ORF11904"
FT                   /product="KLTH0D06666p"
FT                   /note="similar to uniprot|P36101 Saccharomyces cerevisiae
FT                   YKL027W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22573"
FT                   /db_xref="GOA:C5DGN1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGN1"
FT                   /protein_id="CAR22573.1"
FT                   /translation="MAQDSQWKLIAATAIFAAATTKFVDTLVQNYQTHGTILPKGEATA
FT                   SVKPKGALIEEYNEDLIREQLARNYAFLGEEGMEALKGQNIVVVGAGGVGSWVVTMLVR
FT                   SGVYKIKVIDFDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLEEIAPWCEIDAVHELWN
FT                   KENAERLLFGEDGKEKPTFVIDCIDNIDTKVDLLEFVYRNEIPVISSMGAATKSDPTRI
FT                   NVGDLTNTEEDPLARSVRRRLKQRGITKGIAVVFSAEKPDPRKASLLPLPEDEFQKGKV
FT                   DELSALKDFRVRILPVLGTMPGVFGLTIATWVLTKIAGYPMEPIEGKNRIKIYDGIYQS
FT                   LAGQMSRIGMPDQRVPIALKEIGYICEEVFRGKSPVSGFSTRLTLSKWDPEKPVSLQNV
FT                   VLLTKEEQKEHERRVLNGGERLEDCYSADVLELVAKRFKEEEYYSQFR"
FT   gene            complement(<580861..>582213)
FT                   /locus_tag="KLTH0D06688g"
FT                   /old_locus_tag="KLTH-ORF11901"
FT   CDS_pept        complement(580861..582213)
FT                   /locus_tag="KLTH0D06688g"
FT                   /old_locus_tag="KLTH-ORF11901"
FT                   /product="KLTH0D06688p"
FT                   /note="similar to uniprot|P36100 Saccharomyces cerevisiae
FT                   YKL028W TFA1 TFIIE large subunit involved in recruitment of
FT                   RNA polymerase II to the promoter activation of TFIIH and
FT                   promoter opening"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22574"
FT                   /db_xref="GOA:C5DGN2"
FT                   /db_xref="InterPro:IPR002853"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="InterPro:IPR024550"
FT                   /db_xref="InterPro:IPR039997"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGN2"
FT                   /protein_id="CAR22574.1"
FT                   /translation="MDRPIDDIVKNLLKFVVRCFYPGAYVLVLDAILFHSVLSEEDLAH
FT                   LLGIKRPELRGLLTKLLEDRMLAVHSQQEFHFNTRSIKRYYYYIKYPQAIDAIKWKVHQ
FT                   IVSRLKDDLDKNSAPQGYMCPICQSKYSQLEAVSLLNYEKTQFLCSLCEEPLVEDDSGK
FT                   KSKEKQIKLNRLMDQVQPIIDYLKKIDDSRIEENTFESSLARLIPPQNNSVASYTVNPR
FT                   SKKSKMFTPGDNSNSALDNASSRRAGAKSQATLHVNITTASDEQARNEQEEKEMEEKRK
FT                   QNALPAWHEQSTVGKTALGKLDGDEDVADGAQIPNGNGPEHSDDPADTQATPVAEDIPE
FT                   PAPQLTQKEIEEREAERTLADYYAQLAKKQALEDEDDDGEDDEVDEGVEFEDVGSDNEN
FT                   EGTSPSENVTTSQEVASQVTESKAAEESSANNRKQTEEVDDDDMDAEFEDV"
FT   gene            complement(<582430..>584265)
FT                   /locus_tag="KLTH0D06710g"
FT                   /old_locus_tag="KLTH-ORF11899"
FT   CDS_pept        complement(582430..584265)
FT                   /locus_tag="KLTH0D06710g"
FT                   /old_locus_tag="KLTH-ORF11899"
FT                   /product="KLTH0D06710p"
FT                   /note="weakly similar to uniprot|P53389 Saccharomyces
FT                   cerevisiae YNR055C HOL1 Putative ion transporter similar to
FT                   the major facilitator superfamily of transporters;
FT                   mutations in membrane-spanning domains permit nonselective
FT                   cation uptake"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22575"
FT                   /db_xref="GOA:C5DGN3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGN3"
FT                   /protein_id="CAR22575.1"
FT                   /translation="MTQFLWIQQPKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGDD
FT                   APSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAA
FT                   GSKGLALEFHRSLSDISYLVGGMMLALALGSIIASPCAVIFGKRIVYLVGIIIFFFGSI
FT                   GCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTLLLLGGKNL
FT                   VPLLASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIAR
FT                   AADGARDVAISGYSAPKFQGEEDASLSKSLSPELLKSVTPTQSHRYLSRVRTKIKCSNI
FT                   AQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIIN
FT                   TVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLF
FT                   MVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYA
FT                   QEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRA
FT                   RRWTDSKGLLDFSYVKKNHSRGSTGDRHMEDSYQS"
FT   gene            <585777..>587738
FT                   /locus_tag="KLTH0D06732g"
FT                   /old_locus_tag="KLTH-ORF11896"
FT   CDS_pept        585777..587738
FT                   /locus_tag="KLTH0D06732g"
FT                   /old_locus_tag="KLTH-ORF11896"
FT                   /product="KLTH0D06732p"
FT                   /note="similar to uniprot|P36013 Saccharomyces cerevisiae
FT                   YKL029C MAE1 Mitochondrial malic enzyme catalyzes the
FT                   oxidative decarboxylation of malate to pyruvate which is a
FT                   key intermediate in sugar metabolism and a precursor for
FT                   synthesis of several amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22576"
FT                   /db_xref="GOA:C5DGN4"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGN4"
FT                   /protein_id="CAR22576.1"
FT                   /translation="MSARVESVIKTSIRIGRLARLYTSGSPMNLASTTRDNTFGNGAEC
FT                   GDPAHLKLEPVGSQAKAMLKDPVPKQTRLFVEGPIECPMEGFQLLNSPLFNKGSAFTQE
FT                   EREAFGLEGLLPPMVNTLDEQVERAYKQLCYLKTPLAKNDFMTSMRVQNKVLYFELVRR
FT                   HIRELVPIIYTPTEGDAIAAYSHRFRKPEGVFLDITEPDSIERRLAAYGTSKDVDYVVV
FT                   SDSEGILGIGDQGIGGIRIAISKLALMTLCAGIHPGRVLPVCLDVGTNNKKLARDELYM
FT                   GNRFSRIRGAQYDEFVDKFIKALKKRFPSAVLHFEDFGVTTARPLLDRYRGELACFNDD
FT                   IQGTGAVVMASLLAALKHTKRELADVKVLVYGAGSAGLGIADQIKNHMVTYGLTVEEAR
FT                   SKIYLMDRRGLIMKSMESSSSPAQFLYAKPDEKWSGVNTSSLLEVVSKVKPTCLIGCST
FT                   QAGAFNKAVVQEMHKHNPRPIIFPLSNPTRLHEAVPEDLMKWTNFEALVATGSPFPPVE
FT                   GYRISENNNCFSFPGIGLGAVLSRATAITDTMISAAVDQLAALSPMTENDSKPGLLPPL
FT                   EVINDTSSKVATAVILQALKEGTARIEEEDVPGSEEKVKVPRDFESCLKWVTKQMWKPE
FT                   YRPMVKVQHDPNVFTHQV"
FT   gene            complement(<588021..>590504)
FT                   /locus_tag="KLTH0D06754g"
FT                   /old_locus_tag="KLTH-ORF11895"
FT   CDS_pept        complement(588021..590504)
FT                   /locus_tag="KLTH0D06754g"
FT                   /old_locus_tag="KLTH-ORF11895"
FT                   /product="KLTH0D06754p"
FT                   /note="highly similar to uniprot|P40897 Saccharomyces
FT                   cerevisiae YJL212C OPT1 Plasma membrane transporter that
FT                   transports tetra- and pentapeptides and glutathione member
FT                   of the OPT family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22577"
FT                   /db_xref="GOA:C5DGN5"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGN5"
FT                   /protein_id="CAR22577.1"
FT                   /translation="MLYKEATSSTEAAMHRSSEDKSPAHNSNHLKMGKEVKIVDTLQVV
FT                   EHGENSSDSSSLGQELSPGGSHVTYLSRGHLANEGAGAEGKTEQEIIEEEELTEQTVWE
FT                   GNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLS
FT                   INFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYA
FT                   MNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSL
FT                   FDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTR
FT                   HNFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILP
FT                   ILYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLL
FT                   SYALNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQ
FT                   VIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICG
FT                   YMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVN
FT                   VGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFL
FT                   IGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIR
FT                   KRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKF
FT                   YNLKKGEKFGYDKWW"
FT   gene            complement(<591149..>592378)
FT                   /locus_tag="KLTH0D06776g"
FT                   /old_locus_tag="KLTH-ORF11892"
FT   CDS_pept        complement(591149..592378)
FT                   /locus_tag="KLTH0D06776g"
FT                   /old_locus_tag="KLTH-ORF11892"
FT                   /product="KLTH0D06776p"
FT                   /note="similar to uniprot|P38757 Saccharomyces cerevisiae
FT                   YHR004C NEM1 Protein of the nuclear envelope required for
FT                   the spherical shape of the nucleus required for normal
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22578"
FT                   /db_xref="GOA:C5DGN6"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGN6"
FT                   /protein_id="CAR22578.1"
FT                   /translation="MNAISYLTNNILPPKHEESTATPHRVEDSEKANARIDVAPKEAQK
FT                   RKRARWTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDS
FT                   KSEASAGTISPKNSSRISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRR
FT                   QPLQPQQQQPKTSRQSLKTSSVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKR
FT                   RTLVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIA
FT                   KWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNA
FT                   SLSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLAL
FT                   KSGEHAFTNV"
FT   gene            complement(<594639..>594974)
FT                   /locus_tag="KLTH0D06798g"
FT                   /old_locus_tag="KLTH-ORF11884"
FT   CDS_pept        complement(594639..594974)
FT                   /locus_tag="KLTH0D06798g"
FT                   /old_locus_tag="KLTH-ORF11884"
FT                   /product="KLTH0D06798p"
FT                   /note="some similarities with uniprot|Q6Q5F4 Saccharomyces
FT                   cerevisiae YPR015C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22579"
FT                   /db_xref="GOA:C5DGN7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGN7"
FT                   /protein_id="CAR22579.1"
FT                   /translation="MQRQPASPSWAGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAPK
FT                   LLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL
FT                   GLRRGST"
FT   gene            <596520..>597302
FT                   /locus_tag="KLTH0D06820g"
FT                   /old_locus_tag="KLTH-ORF11877"
FT   CDS_pept        596520..597302
FT                   /locus_tag="KLTH0D06820g"
FT                   /old_locus_tag="KLTH-ORF11877"
FT                   /product="KLTH0D06820p"
FT                   /note="some similarities with uniprot|Q04751 Saccharomyces
FT                   cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
FT                   involved in acetylation of the N-terminal residues of
FT                   histones H4 and H2A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22580"
FT                   /db_xref="GOA:C5DGN8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039949"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGN8"
FT                   /protein_id="CAR22580.1"
FT                   /translation="MVDYPASELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHE
FT                   ERREPRAAGPKPEPGPTPASECDSVPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAG
FT                   RQSWPARKRAEMETPGLVYVVYSDSHSQPLVFMSLLLTDEPELGQELAARVLYLFEIHV
FT                   SDIIRGQGLGTHLLRDCLGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGMHVAA
FT                   WSPQDRRAQVRRRTRAIAYDSSLVTRPAYYILFWPAAS"
FT   gene            <597659..>599179
FT                   /locus_tag="KLTH0D06842g"
FT                   /old_locus_tag="KLTH-ORF11871"
FT   CDS_pept        597659..599179
FT                   /locus_tag="KLTH0D06842g"
FT                   /old_locus_tag="KLTH-ORF11871"
FT                   /product="KLTH0D06842p"
FT                   /note="some similarities with uniprot|P54785 Saccharomyces
FT                   cerevisiae YMR070W MOT3 Nuclear transcription factor with
FT                   two Cys2-His2 zinc fingers involved in repression of a
FT                   subset of hypoxic genes by Rox1p repression of several
FT                   DAN/TIR genes during aerobic growth and repression of
FT                   ergosterol biosynthetic genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22581"
FT                   /db_xref="GOA:C5DGN9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGN9"
FT                   /protein_id="CAR22581.1"
FT                   /translation="MLSVHPYTSPADIDRDARRGSSQLDFRRRSSASSVASIGGAAAGG
FT                   GPAQSPTSALWAAAPAPAPAPPLVPPAAVSSTVHRQPQYSVAQMHSQAYAIRQKHARAS
FT                   STDSSGTPIPGPAAAVTTPGPASVPAPVTAAQQQPPPPPIGGPLYELMEYDTRYLPYHY
FT                   KSAYPMWGPAGPTAAAAGTAPGTAPGAPGAAYPAYQYPPPAWNSYQAPHHVWNGQPAAS
FT                   SGGYPHMQLQIPTQLPQQPQMTTSQQQQQQQQQQQQQPHQPQQPQQQYQFQQQPQQPQQ
FT                   PSLHRQSISHRQSQGFSADQFPSALAATELPLSAYAPDPRSGAQLAGRPYVVAAAPGPA
FT                   AASAPFGLGAVGIGAGAGAGARGPAPYSGTGSDRGSFDDTGSSMAMLYRCSMCEKSFKR
FT                   KSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQELMEAGDLDGSMG
FT                   TNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVIARVHDGEPGQ"
FT   gene            complement(<599324..>599905)
FT                   /locus_tag="KLTH0D06864g"
FT                   /old_locus_tag="Klth0D.mRNA.2474.m"
FT   CDS_pept        complement(join(599324..599756,599835..599905))
FT                   /locus_tag="KLTH0D06864g"
FT                   /old_locus_tag="Klth0D.mRNA.2474.m"
FT                   /product="KLTH0D06864p"
FT                   /note="highly similar to uniprot|Q04767 Saccharomyces
FT                   cerevisiae YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa
FT                   Integral membrane vesicle protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22582"
FT                   /db_xref="GOA:C5DGP0"
FT                   /db_xref="InterPro:IPR019365"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGP0"
FT                   /protein_id="CAR22582.1"
FT                   /translation="MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIAN
FT                   LFHVSAVIVFGIIAIVQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGM
FT                   AAVQWCSLAVMATSLIAVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVV
FT                   REML"
FT   gene            <600181..>602175
FT                   /locus_tag="KLTH0D06886g"
FT                   /old_locus_tag="KLTH-ORF11860"
FT   CDS_pept        600181..602175
FT                   /locus_tag="KLTH0D06886g"
FT                   /old_locus_tag="KLTH-ORF11860"
FT                   /product="KLTH0D06886p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22583"
FT                   /db_xref="GOA:C5DGP1"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR037275"
FT                   /db_xref="InterPro:IPR039512"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGP1"
FT                   /protein_id="CAR22583.1"
FT                   /translation="MSDSASESGRSLAEEESEDELIMSAFDASFEKIGRGFPRISFPSI
FT                   WGAKSAGPGTKDEVEGDFGRWSRRFQMNTFLNDLQKGLSFSNALTRLQTVKAITEEAIS
FT                   NAINSSDTGHGDNSASREDGDADKPEVPAGVVPAAKPKNVPAYNDMVIPQGKGPQVLDE
FT                   HLLKLTELPSDQNNDEATLRQRIQHIRSLDLGPAKTAAMMQRLMMGKFVDELNRPSPTP
FT                   TLEAPLTRDPSEAEKAPTYHNTGALGCAHYQRNCKLQCHQCLGWYTCRFCHDESPEISG
FT                   SSHPHSFQRAETRQVMCMRCNHVQAPQKDCENCDEEFAMYFCPECKLYDNDETKDIYHC
FT                   AKCGICRLGLGLGLDFFHCDGCQACLSIELQGNHKCIERATMSSCPICGDFMFTSVKPV
FT                   VYMSPCGHAIHQHCFDEYTKHSYKCPSCQVSILNMEAQFRVLDKEIEEQPLPAPYCDWI
FT                   CYVSCNDCKAKSTCKYHILGLRCGNCMSYNTSQLKLVKPEEAATHDNAAEFDTITQSNS
FT                   SFDSLNVMRQELLRGQFQREEVSPLITVEKGGMLSNIEQYMNGYFHDDTQGASEGASAD
FT                   HGDFSSQNLFNTAGFFKNNNRNENQSGDATVGSSSMARAPSLTERLRQFINDAPPQLSI
FT                   SDAFQKFIQGSHQGLSSGDEDDCSSQASA"
FT   gene            <603521..>604666
FT                   /locus_tag="KLTH0D06908g"
FT                   /old_locus_tag="KLTH-ORF11856"
FT   CDS_pept        603521..604666
FT                   /locus_tag="KLTH0D06908g"
FT                   /old_locus_tag="KLTH-ORF11856"
FT                   /product="KLTH0D06908p"
FT                   /note="some similarities with uniprot|P33417 Saccharomyces
FT                   cerevisiae YKL032C IXR1 Protein that binds DNA containing
FT                   intrastrand cross-links formed by cisplatin contains two
FT                   HMG (high mobility group box) domains which confer the
FT                   ability to bend cisplatin-modified DNA mediates aerobic
FT                   transcriptional repression of COX5b"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06908g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22584"
FT                   /db_xref="GOA:C5DGP2"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR033311"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGP2"
FT                   /protein_id="CAR22584.1"
FT                   /translation="MNVPNVGTGISPPPKGSSNHGSIPNTNNSLQDQLLPYPDLDPTAH
FT                   QQPSQQVSSKLQQLGPQIHHIPQQQPVHQGVQTNAGHPDIPVQADIYGQALQAHLQTPQ
FT                   QQHHQQQHQQQQQQQQQQQQQQFSDAMFNSFLTQIGQRQVANVLNTFNAGAHSMNAAMN
FT                   SAMVTQPAQRFFHAAMNTPSMMEMTHPAMMQPTPQFQLQVPPPIAKKMSASQSRIEKRK
FT                   MLKKQGPKRPSSAYFLFSMAVREDLVREYPDAKVPELSKLASAKWKEMSDEDKKPYHVK
FT                   FKENWEKYRIARKEYESSLPPKRPSGPFIQFTQEVRPQIIRENPQKDLIEITKLIGEKW
FT                   RSLSPVDKRTYTDTYKRKLKEWEEQYPEEASPTTPKDVLGE"
FT   gene            complement(<604805..>605419)
FT                   /locus_tag="KLTH0D06930g"
FT                   /old_locus_tag="KLTH-ORF11854"
FT   CDS_pept        complement(604805..605419)
FT                   /locus_tag="KLTH0D06930g"
FT                   /old_locus_tag="KLTH-ORF11854"
FT                   /product="KLTH0D06930p"
FT                   /note="weakly similar to uniprot|Q04772 Saccharomyces
FT                   cerevisiae YMR073C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22585"
FT                   /db_xref="GOA:C5DGP3"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGP3"
FT                   /protein_id="CAR22585.1"
FT                   /translation="MVESESEGQGFQGSFRKPSPFKAQPPAINPRTTSRLMRPPAGGDF
FT                   RVPTQAGCSTLGAGGYRNKVVLKPGHSALDWSELSVKKGSQGLLITGIAKLLADPEIQQ
FT                   LNSPQALMALQHNVPTFKIYPPIKVTKAQLQKHNTAEDCWCVLNQRVYCVSSYLDFHPG
FT                   GAEILLRTAAGKDATALFNKYHRWVNYERLLETCLVGVYVP"
FT   gene            <608167..>609231
FT                   /locus_tag="KLTH0D06974g"
FT                   /old_locus_tag="KLTH-ORF11849"
FT   CDS_pept        608167..609231
FT                   /locus_tag="KLTH0D06974g"
FT                   /old_locus_tag="KLTH-ORF11849"
FT                   /product="KLTH0D06974p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22586"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGP4"
FT                   /protein_id="CAR22586.1"
FT                   /translation="MCSNEECRAILPKKERELLLKAAKVEKTRDDGTTVVGFPRVKCDG
FT                   MMLIDDSREDLYNQHRKPGFCNSCKATHSMSWYNDNVYKGKRICHNCNTYQCYTQARCQ
FT                   NEACSLIHHSKHLTEIKLNYRRETGKNAGIEAVLKCIKCQGPVAIDKTKTIRDRKVPYK
FT                   PGACLTCDRRSERKWKRIPWDKVSSQRMCGKCEARYRKTATRCLNTGCSHIHTIGEVAK
FT                   MENMGKIKAHLPDGTIVLGHPCVKCGCTTYKDTSMKLSCRKKAEAGQMCYSCKSQIKGV
FT                   AELVAWDKQNPERLCRACFWRYHTYKAHCDSAECSLVPNKEGLDALKKKGPIEVCEETP
FT                   VKKVYHAPCPKCKG"
FT   gene            complement(<609406..>611460)
FT                   /locus_tag="KLTH0D06996g"
FT                   /old_locus_tag="KLTH-ORF11848"
FT   CDS_pept        complement(609406..611460)
FT                   /locus_tag="KLTH0D06996g"
FT                   /old_locus_tag="KLTH-ORF11848"
FT                   /product="KLTH0D06996p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22587"
FT                   /db_xref="GOA:C5DGP5"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="InterPro:IPR036460"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGP5"
FT                   /protein_id="CAR22587.1"
FT                   /translation="MHIFDPISDAEIRTTARLLKDLNGDAKVHFVQIDRLDPPKKQALR
FT                   YLSVERHGGAPLPRIPRRTYAYYYLNDRMPLYKALCNVSDGRVIANQATPEGTVGPLLP
FT                   EDVEAVEAAILAHPAVQAEIAKLKLDALSYNHSALGPLGYSVVCEPWMYGTDSPHDKIP
FT                   LIQAYMYLKLDHPEANHYSIPLKFSPVFEYLTHAFVRIDYLPSGADESLVHNTLPHTVL
FT                   PTVEYHPELLEDVPPRDGLKPLIVSQPEGASFTVDGSKITWQDWEFRVATNVREGLAIY
FT                   DVHFKGRSLFYRASLEEMTVPYGDSRAPFHRKQAFDLGDCGFGNSANSLALGCHCLGVI
FT                   KYLDTRRSDSEGNPVLIPSTVCMHEQDYGILYLHKNYRNGKTVTTRRREFVVQTIATVA
FT                   NYEYILNFVFDQAGAITVQVRATGILSTMPNDDNNVTDFGTIVGPGVTAAYHQHLLSFR
FT                   FDTRIDGDKNTVVYDDYVPMEENTAMNPYNVGFRQVRSYMDKSGYIDQSPFTNRTYKVI
FT                   NENSINPVTMKPVGYKFEMPAKQMILASKNSYNVKRAHYATKQFWVSKYHDDQLYAAGE
FT                   FTNQSQGDTGLSKWADGTESVRNTDTVVWATLALTHPPVTEQFPVMTSDFMQFLVTPAS
FT                   FFTKNPALDVPLANNNFNKSVYYEDAQKAAGLATGESQSSSASCCKSNI"
FT   gene            complement(<611733..>612215)
FT                   /locus_tag="KLTH0D07018g"
FT                   /old_locus_tag="Klth0D.mRNA.2397.m"
FT   CDS_pept        complement(join(611733..612048,612118..612215))
FT                   /locus_tag="KLTH0D07018g"
FT                   /old_locus_tag="Klth0D.mRNA.2397.m"
FT                   /product="KLTH0D07018p"
FT                   /note="some similarities with uniprot|Q04773 Saccharomyces
FT                   cerevisiae YMR074C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22588"
FT                   /db_xref="GOA:C5DGP6"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGP6"
FT                   /protein_id="CAR22588.1"
FT                   /translation="MDPELQALREARLAELKNHANPAAAAAPGRPQKSAADADAVAALL
FT                   QPQALERLSRVALVRPERARAVEAYLQQLAARGQLSRKVSEPEIVDILNGVARDEQRRS
FT                   TTRIIFDRRDARDASIVTPNGAVTSDDDDDFFD"
FT   gene            <612872..>614896
FT                   /locus_tag="KLTH0D07040g"
FT                   /old_locus_tag="KLTH-ORF11837"
FT   CDS_pept        612872..614896
FT                   /locus_tag="KLTH0D07040g"
FT                   /old_locus_tag="KLTH-ORF11837"
FT                   /product="KLTH0D07040p"
FT                   /note="similar to uniprot|Q04779 Saccharomyces cerevisiae
FT                   YMR075W RCO1 Nuclear protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22589"
FT                   /db_xref="GOA:C5DGP7"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGP7"
FT                   /protein_id="CAR22589.1"
FT                   /translation="MSDPARHPPERSGSPGEPATRARRTISLNVDYNLKKRRIIPSEDA
FT                   RPRKNRPVGRPPGRPPGRPAGSKTASSTPSSTPSSSAASSLSPQDENHRAPQSVIQHDA
FT                   TGAVQFHEPESVDPVNGMTGLPLSAGPPEKVKKESLWSYRKGAGASASASTNASVNAAT
FT                   PAPSESSASVSAPASASASADVETPASSEDAYRARLQTQESEQRTRPSSLRAIATPKDI
FT                   YRTKRQYRKRSAEPRARHFPTHTKIKASTTKENKLFGQNSITNQKALAPPLASSAEAAV
FT                   ENDDFCASCRQPGIFLCCDTCPKSFHFACCNPPLDPDNLPEGDWSCAECQFRIRCPNKA
FT                   AAHRLEKDYLAQLERSKGITLFGKLLFRLEFTNPKQYLPPHPIRDAFADVRTGSHGEYA
FT                   DNSMREPLNEKQIFGSGYGQSLTKMDQYNPELHVDPESGELLVCFKCRKSKMGTLDHPE
FT                   DERLITRCDYCNTPWHLDCVPHVPRASFKNLGSKWMCPLHADSSIPHQERRLARHQRHF
FT                   TPANRYRVPNDGDIDVQLDEISVPVSKDALKEDKINKELAILQLPESSIKIDFVDKIYR
FT                   AKSALMDKHFRQQQALIDNTMHSKPSLLSDARPLLYFSLQDNSQLRKLWDFKELCRVAT
FT                   KELEVPELDSAEISELQTLRKLLESKSKEEVMEFLGIKL"
FT   gene            complement(<615021..>618899)
FT                   /locus_tag="KLTH0D07062g"
FT                   /old_locus_tag="KLTH-ORF11831"
FT   CDS_pept        complement(615021..618899)
FT                   /locus_tag="KLTH0D07062g"
FT                   /old_locus_tag="KLTH-ORF11831"
FT                   /product="KLTH0D07062p"
FT                   /note="similar to uniprot|Q04264 Saccharomyces cerevisiae
FT                   YMR076C PDS5 Protein required for establishment and
FT                   maintenance of sister chromatid condensation and cohesion
FT                   colocalizes with cohesin on chromosomes in an
FT                   interdependent manner may function as a protein-protein
FT                   interaction scaffold"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22590"
FT                   /db_xref="GOA:C5DGP8"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039776"
FT                   /db_xref="PDB:5F0N"
FT                   /db_xref="PDB:5F0O"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGP8"
FT                   /protein_id="CAR22590.1"
FT                   /translation="MLTRLVSDALHVIKLNRPEQAGNTADYSLMVGSKSRLESDFSIIS
FT                   TIKNNIPTQQLLIRLERLHEELSNLKQESVDLRSLERYRADLIDRKILRNKDHGVRAFA
FT                   ACCLSDILRLYAPDAPYTDKELTEIFRLFLAQLKLLQEPENGYLTQQTYLINNLLEYRS
FT                   IVILTDLPSSSQLVEELFNIFYSPTNSTIQGNMFTAIGGILGEVISECDSLPMSALKMV
FT                   FNKFLSHKRAESLDGINYKKDPGFEISLIICQTYSNRLGRHFIKFYSEIMYEVLGESDI
FT                   HEKGIASSAYKTLVKIGNLTSELWKYAPELVGSVTGLLYQLLCSDNELFRESATKCVSK
FT                   MLGTHSLINFAVAHSDTYKIWLSKMADISPHVRQAWVSEIPSILMSRSDLSDDISKGLA
FT                   KALIDSDHTVRLSAIQTFHEVPVKRLWECLPNAAVFAGLVHLTRETRRDLRDECIDAVA
FT                   RIYTESIESIPKTNENKEIWGVVETIPSACFNLYYINDLEINMKVDLLTFEKFLPLGLS
FT                   NEEFVQRLLTLLQGFNEKAFSSFYAFNRRQDQMSTVLWKFIEFCEETNSQSPAASLSDT
FT                   KLIKTVEWISSGFPSHLNVEQILLAFRELNDRRLYRLIKVAVAETSKHLTVRNAVSELF
FT                   KRLEEPELFRKKNIKIESRFTRDNFSTVFRVLIYRAAPIIFNISNLPSFLNTSDSSNED
FT                   EKALKRQLIDNISIIKPGIFKDQVKNLVTIITEGETTGPGNTLSLAEAMRTVYKISKDK
FT                   REHLDIEENTFFFQKLEDYAKEGNPLEAKYAIKLLGLAPNAAEYLSEVATAILPLDLKS
FT                   KHFASNVLVLAEITKMQPQLLEKDSTEIVGLLIKDVLLSNDVVGDEDDQQAWFSDEDIY
FT                   TGKADALSAKVFSLKLFANKIKVMAPDAHADEMTHAFTERTLKLFFYLVASGGELVSES
FT                   NTDNYPTPANYQNKLRCCAGLHILKITKIASLSRFIKPQDISKLMNLVEDESLEVRSSF
FT                   IGRLKDFLGDGSISIKFLPLVFFTAYEPDQALRTSTKMWINYTLSKENFRKGTFFERAL
FT                   PRLIHFIAHHPDVAEGLRLRETAFLTGLTTAIDYLVFYADSVLKASNLALLYYLAGRVR
FT                   QYRDAVTEEDNEGEDEDEDEETDQTSHNSSSNIYIISELAQLVLGEFKEHHEWTLSSYP
FT                   GKLNLPSDLFEPFESIDEARKNTFETYLRTEDTRSLRKVIAAKVSRLYRRTNVHKPLVQ
FT                   KRKNPESSSRPRKRAQASVHSDAELEGESEDDSYVPSRSRRGAVGETRKSSRPKKAVDY
FT                   ADDESEED"
FT   gene            complement(<619124..>621115)
FT                   /locus_tag="KLTH0D07084g"
FT                   /old_locus_tag="KLTH-ORF11829"
FT   CDS_pept        complement(619124..621115)
FT                   /locus_tag="KLTH0D07084g"
FT                   /old_locus_tag="KLTH-ORF11829"
FT                   /product="KLTH0D07084p"
FT                   /note="some similarities with uniprot|P38750 Saccharomyces
FT                   cerevisiae YHL008C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22591"
FT                   /db_xref="GOA:C5DGP9"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGP9"
FT                   /protein_id="CAR22591.1"
FT                   /translation="MSEDEYYISPHETALAVVATAMKKARLTLTTLALNSLAGGVLFST
FT                   GGLLYTSWHGSNQAILENDPGVLNFLGAFTFSIGLFYVVINGTDLFNSNILFFSVAALR
FT                   GAVSIYDLLISWTVSWIGNFTGTLFVVYVMCHLSGTTSSADLVSFTHQMVAKKDSSSFI
FT                   QTFIKGIAGNFYVSLAIYLQLMAKPLHVKYLMMTLPIFTLVAAGFTHVVAEMFLLMVGM
FT                   FNGAELSIGTFVWKHMVAVTLGNIIGGSAFALVIPYYLHLVVVEQDRKRLALPSYEARD
FT                   EQPEINMDSRVVRVPTQEAEKVEEEAEENEEMTSEEKANLELASSDSSAEDRKAAPPVE
FT                   YRPRLSSTSLSRTYSNLRRLNTNKSYSSVRSVKSLPHRTPTGVFPVKGMASPVRTNSGI
FT                   PPQKREESQGLGRFSRPLSRRSSQTSSLRLSKTLGSSRRNSISVLQRPGGAFAHRSKSL
FT                   PHIGLVGERTHFGTNDVLEEKMGTKLERALTRITSRVSREGRNSPGFGLPSTTQDIFPT
FT                   STGLGLHESDATASFSMDDHSSSSMLDGLPANGRRSRTPSIQKTSIQDLYLKPSTSDNL
FT                   SGAINETSGSKSPPTQPQGKNSPSDGTSQKSTSSRSIPTIRRPSSIYVPDAVDQRNSVY
FT                   NAGYKNTLLRNHMTPDNDYDEEQSIKDA"
FT   gene            complement(<621467..>624595)
FT                   /locus_tag="KLTH0D07106g"
FT                   /old_locus_tag="KLTH-ORF11828"
FT   CDS_pept        complement(621467..624595)
FT                   /locus_tag="KLTH0D07106g"
FT                   /old_locus_tag="KLTH-ORF11828"
FT                   /product="KLTH0D07106p"
FT                   /note="similar to uniprot|P36097 Saccharomyces cerevisiae
FT                   YKL033W Protein of unknown function localized to the
FT                   cytoplasm."
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22592"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGQ0"
FT                   /protein_id="CAR22592.1"
FT                   /translation="MASRESVAFQRVQPHCVNLSRQSFLPRDVFNPNSVVLLEGLRSLE
FT                   EELKQLENEGVSLSPKFADYVFVPIASLLRQDSLGSSQTEALLQVIGHLVSLCWSSAGS
FT                   FNKALAQQLFALVTFLISNDKDNTCLLTKTPSFQLTGCIVLRKLFKAFAIQKASGSFDH
FT                   FADPQNLPSLGHSVTILLDILGGNDNEIDLQLAAIEALHVLYQETLNDGEIISFIVPGN
FT                   VSAFSKLLLKPGLTVNPRVVCSTLRLFAVIICIVYSDFDLHVVEHSPSDLNELLEEAEK
FT                   PFETNIAINEVDFKNRNLHRDIKWLRATSAQINRALKGVLPKLVKRDNGSINLALCEFI
FT                   SALMKHCRASLNNCQKLFFSVALELHYVPGELVQTLEGTRTLKLMVDNKVTRISNAIQF
FT                   EDIKALQTIQYGLQTLYSYQCLDFEMVDGLVFSLKSCVSDFLEQKNLRFTEGKLKEQGG
FT                   MVIVGQDFLTLTETSQPLLPKISTALEETLSQLLHTLGTCYSRDHIQGTVSELLTFDGS
FT                   ESGFGKAVSLWMSANLLKAASEVLPDAHDITDEFMTFENDERKVADLPLEPIETCYAIL
FT                   ESSVALIDEVNQNSAALHHDSEFQVVVGLKSIQIMSETLGEEFRTELIDILFPVVDCLA
FT                   SPSSAIRHFAQTTTLSIAKSFYGGSIHDLLLDNIDYLVDAISVRLNNCMTKRVPTLLMV
FT                   LCRVGGYNLIKSFKDVLEIIFRLLDFYHGYEDLCCEFFQLFEVIVTEMRHTYLSSTDVS
FT                   PRLKNEHSVSSSFKPWGMQNILQVLDILDKTGEKGIHEEDFDDLDSNQDDPGTFQEFFD
FT                   KRVHEVDSDDEDEDIQPTEGQSTSSGHASDKWFSPIPRDSYRLLLQIVGYGDRLLTHPS
FT                   RQLKVQILQLMSRVFPMLATQHDMLLPQVSKSWDIIVQLSLDPDFAIAKVACECLRELI
FT                   HCSGDFVTKRFVDLWGAQKAHSPLLGIAAPKGVAPTLSSKKWLTSPKQFPPITREALVS
FT                   LSEMLLEGIVQTELFTSEVQIQEMVYCCLLVLPKEHVQSRSLLLGDIVSLLSL"
FT   gene            complement(<624863..>626494)
FT                   /locus_tag="KLTH0D07128g"
FT                   /old_locus_tag="KLTH-ORF11825"
FT   CDS_pept        complement(624863..626494)
FT                   /locus_tag="KLTH0D07128g"
FT                   /old_locus_tag="KLTH-ORF11825"
FT                   /product="KLTH0D07128p"
FT                   /note="similar to uniprot|P32487 Saccharomyces cerevisiae
FT                   YNL268W Lysine permease; one of three amino acid permeases
FT                   (Alp1p, Can1p, Lyp1p) responsible for uptake of cationic
FT                   amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22593"
FT                   /db_xref="GOA:C5DGQ1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGQ1"
FT                   /protein_id="CAR22593.1"
FT                   /translation="MSLKNDQEVEVIGIATSQSLSSDTQDAGALNRGHVRENLNRSLTP
FT                   RHINMISIAGVIGTGLYLGTGKALANGGPASLLINYGIIGLVVYLIMLCLGEMSTFMPI
FT                   SGSFCSYAKKFGSGSLAFTLMCNYWFNDAVSVASDLTALQLILDYWKNPNSHFPYWAAS
FT                   LIFWFALLLLNVVHVRVYGEAEYWLALLKVIAIIMFFIISIIVNAGHNSDHAYIGFKNW
FT                   GVGDAPFVNGFKGFASLFVSSSFAFGGTESITLTAGEAVNPVRNTPKIIKTVFWRILIF
FT                   YVFTAFFIGMNVPYNYPNLSEKSVMTSPFTIVFQMVGSRGAGSFMNAVILTSVISAGNH
FT                   ALFAGSRVLFNIGLEGYFFPSFITKTNRYQVPYVAVLITWAAGGLCFGSSFIGAGTLWT
FT                   WLQNIVGVSNQLAWLCISVISIRFRRGLARQGKTHELQFVNWTYPYGPYFLVVFVTFII
FT                   FVQGWSSFAPWSVSDFFSYYIELIVFVALYAFWWLWKRDSFVKSDEMDFVTDKYVSPEE
FT                   EVLLNERLDNLKGWKKVRQVVDEYFV"
FT   gene            <627115..>628737
FT                   /locus_tag="KLTH0D07150g"
FT                   /old_locus_tag="KLTH-ORF11823"
FT   CDS_pept        627115..628737
FT                   /locus_tag="KLTH0D07150g"
FT                   /old_locus_tag="KLTH-ORF11823"
FT                   /product="KLTH0D07150p"
FT                   /note="similar to uniprot|P38748 Saccharomyces cerevisiae
FT                   YHL010C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22594"
FT                   /db_xref="GOA:C5DGQ2"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011422"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGQ2"
FT                   /protein_id="CAR22594.1"
FT                   /translation="MSIVLGSAQVFIRPKKPCMSFRYRLVIELDVLNEAKKAHEFWIRD
FT                   EQETTTESTTVRSDLEDSATEDWRHEDVKIGIMNAMSQRDNFIEAEFSSPGIVRLFKIG
FT                   EEKPDAGTAGDSVLRIPGDDTMISVLFVPSYLSARDLLHSFLGDAVTSRVSHFRIIRSN
FT                   KDAGYSFILLMKFRDPESAALFKEQYNGRNFNQMDPETCHVIRIKEVVFQERLFPKPQS
FT                   AGSQFLMNDPFTGHKETGDVELPTCPVCLERLDSEVTGLATIPCQHTFHCQCLNKWKDS
FT                   RCPVCRYSGLKVTKSSLLRQGVRCSTCGANENLWICLICGNVGCGRYNFKHAVQHFKDT
FT                   AHFFSMDVATQRVWDYAGDNYVHRLVQNEVDGKLVEVGSSSSRDSSGKRDKEYHLEYVQ
FT                   VLLSQLESQREYYESKLRQLEINEEELKSVHSLQQQIQELKLQAVVTRSKSEHKVNEMR
FT                   KQLEEERLLSRALQKNLDHLSNTIGDLQKQQEQSVIENQELKEQVTDLMFFLESQEKLK
FT                   DADESVKQGTLVMKPKKNSRKKK"
FT   gene            <629258..>630220
FT                   /locus_tag="KLTH0D07172g"
FT                   /old_locus_tag="KLTH-ORF11821"
FT   CDS_pept        629258..630220
FT                   /locus_tag="KLTH0D07172g"
FT                   /old_locus_tag="KLTH-ORF11821"
FT                   /product="KLTH0D07172p"
FT                   /note="highly similar to uniprot|P38689 Saccharomyces
FT                   cerevisiae YHL011C PRS3 5-phospho-ribosyl-1(alpha)-
FT                   pyrophosphate synthetase involved in nucleotide histidine
FT                   and tryptophan biosynthesis one of a five related enzymes
FT                   which are active as heteromultimeric complexes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22595"
FT                   /db_xref="GOA:C5DGQ3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGQ3"
FT                   /protein_id="CAR22595.1"
FT                   /translation="MATNSIKLLAPDVHRGLAELVAKRLGLKLTDTKLKRDPTGEVSFS
FT                   IGESVRDQDIFIITQIGSGVVNDRVLELLVMINACKTASARRITSVLPNFPYARQDRKD
FT                   KSRAPITAKLMADMLTTAGCDHVVTMDLHASQIQGFFDVPVDNLYAEPSVVRYIREHIN
FT                   FNEAIIISPDAGGAKRAAALADRLDLNFALIHKERARANEVSRMVLVGDVTDKICIIVD
FT                   DMADTCGTLAKAAEVLLDNRAKGVIAIVTHGVLSGKAIENINNSKLDRVVCTNTVPFEE
FT                   KMKLCPKLDVIDVSAVLAESIRRLHNGESISYLFKHSPL"
FT   gene            complement(<630316..>630987)
FT                   /locus_tag="KLTH0D07194g"
FT                   /old_locus_tag="KLTH-ORF11818"
FT   CDS_pept        complement(630316..630987)
FT                   /locus_tag="KLTH0D07194g"
FT                   /old_locus_tag="KLTH-ORF11818"
FT                   /product="KLTH0D07194p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22596"
FT                   /db_xref="GOA:C5DGQ4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGQ4"
FT                   /protein_id="CAR22596.1"
FT                   /translation="MDGLLINTEDIYTLVTNEILTEYGKGPLTWDLKVQLQGLPGPEAC
FT                   RKVLDHFQLPVTPQEFDRKNIELQCKMWPKCSFLPGALDLIRYLHSKNIPIALCTSSAK
FT                   HKFEGKTSHLKHGFELFDAIVTGDDPRIPPGRGKPFPDIWLVGLKELNNKFKANIQPEE
FT                   CLIFEDGVPGVTAAKAAGGYVVWIPHPDAYDVLGDTDAILDGKGELISSLVHLDKAKFG
FT                   L"
FT   gene            complement(<631219..>633462)
FT                   /locus_tag="KLTH0D07216g"
FT                   /old_locus_tag="KLTH-ORF11817"
FT   CDS_pept        complement(631219..633462)
FT                   /locus_tag="KLTH0D07216g"
FT                   /old_locus_tag="KLTH-ORF11817"
FT                   /product="KLTH0D07216p"
FT                   /note="similar to uniprot|P36096 Saccharomyces cerevisiae
FT                   YKL034W TUL1 Transmembrane Ubiquitin Ligase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07216g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22597"
FT                   /db_xref="GOA:C5DGQ5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGQ5"
FT                   /protein_id="CAR22597.1"
FT                   /translation="MEIDGNTILFIFVILYFLYSSPSGDGVTSQYEYNQLQTLRAQYND
FT                   EHSQFANMTLSENFRNITGLKLSYEDVLKSPGINATYPIAGKDYNHWSSNQGHMILPES
FT                   VITEIREDVWSGKEGVFPPNITSTLHGLIKLDSNKDYQKVPMPVPEYYEPPHDFSQNFN
FT                   DPYVDDGTLSNGQHNVTFNEGQVVIEIKAADTALAYSDARRPSFFNSQSDRWRMLHVNL
FT                   HFSDFHDEEKHSINSRAVYDIKRGRILAISESAKFHSLFAFPHYMSLKEDDKLVFDEVK
FT                   LLVEEYWNASNFVDTRTMNYLQESYAVANYKCEFLAYFQLSPWSAYSPEQLKVIDDELT
FT                   WPLGRRANLSSLPPINISSGIVYSPDCGINLRVSSVSGPRYELHVRKMRDTLLFGIVLL
FT                   ASQIYLLLIQMQHTNTPSMVNKISYWCFSLMNSVDGSLAIIFFFMTSAIPELYLPLVIC
FT                   SFACLILASVFEMRYLISIYASQANEQNVSFTTLLRRNTGSEERNAPTVIPDEATISSH
FT                   MYRRYILMMFLSMVLILSVATWSRRIRTPFECVAFFVLNSYWVPQIARNAIKGNEPRRR
FT                   RASPGESQAPRQNKMPLLWSFVIGTSIIRFLPVAYVFTVPSNIFYHHRDIRYVVIVALW
FT                   ILFQIVILYSQDIMGARWFLPKYTIPEGYSYHKGISSADLLEHGSSPNYSIDCAICMND
FT                   VPVYVDDIPKTHKVDKESYMITPCSHIFHTQCLESWMSYKLQCPVCRAPLPPL"
FT   gene            complement(<633807..>635306)
FT                   /locus_tag="KLTH0D07238g"
FT                   /old_locus_tag="KLTH-ORF11814"
FT   CDS_pept        complement(633807..635306)
FT                   /locus_tag="KLTH0D07238g"
FT                   /old_locus_tag="KLTH-ORF11814"
FT                   /product="KLTH0D07238p"
FT                   /note="highly similar to uniprot|P32861 Saccharomyces
FT                   cerevisiae YKL035W UGP1 UDP-glucose pyrophosphorylase or
FT                   UTP-glucose-1-phosphate uridylyltransferase EC:2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22598"
FT                   /db_xref="GOA:C5DGQ6"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR016267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGQ6"
FT                   /protein_id="CAR22598.1"
FT                   /translation="MMQAKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSVKDEDTR
FT                   SKFEGELDSFFSLFRRYLVEKASGSTLEWDKIKSPNPEEVVDFSVIEQQPENVSNLSKL
FT                   AVLKLNGGLGTSMGCVGPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNT
FT                   DADTAHLIKKYSANRIRIRSFNQSKFPRVYKDSMLPVPSSYNDELDSWYPPGHGDLFES
FT                   LHASGELDALIAQGREILFVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKG
FT                   GTLISYDGQVRLLEVAQVPKEHVDEFKNIRKFKNFNTNNLWINLKAVKKLVESSSLEME
FT                   IIPNQKTINRGGHEINVLQLETACGAAIRHFQGAHGVVVPRSRFLPVKTCSDLLLVKSD
FT                   LFCLEHGALKLDPSRFGPNPLIKLGSHFKKVSGFHARIPHIPKIVELDHLTITGNVFLG
FT                   KGVTLKGTVIIVCSEGQRIDIPNGSVLENVVITGNLQILEH"
FT   gene            complement(<635598..>638537)
FT                   /locus_tag="KLTH0D07260g"
FT                   /old_locus_tag="KLTH-ORF11810"
FT   CDS_pept        complement(635598..638537)
FT                   /locus_tag="KLTH0D07260g"
FT                   /old_locus_tag="KLTH-ORF11810"
FT                   /product="KLTH0D07260p"
FT                   /note="some similarities with uniprot|P32862 Saccharomyces
FT                   cerevisiae YKL038W RGT1 Glucose-responsive transcription
FT                   factor that regulates expression of several glucose
FT                   transporter (HXT) genes in response to glucose binds to
FT                   promoters and acts both as a transcriptional activator and
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22599"
FT                   /db_xref="GOA:C5DGQ7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGQ7"
FT                   /protein_id="CAR22599.1"
FT                   /translation="MSASRRESEPKEAETSPEAGGAASDRRRSKTSRACDQCREKKTRC
FT                   DFSDERPICSACQRMGKTCTFERVPMKRGPTKGYTRNSEPPEGFDTSRRGSRKRSSSDV
FT                   FKGDAGRPRADPVSLPPLAQYLPQSGSQPRLQPLLAPGAQPQQQFWKVPYYEYQHQRRG
FT                   SIDSLGSDVSNRNGSEQLAYLPSNASSGSQFYPASQAQYASQLPSDVEGANPEDCRGSL
FT                   SLPAIQKFQQPPSGYYLQYPYSQFSMLPQQQQQQQQQNAQQSYFTSQYVPPAAPPGAEH
FT                   FKEFDEGFHSRKGSDVSVAVSPSSPVQVTRTQQAGLNSESRDTNTATAVSPKPLPKPSK
FT                   PQMQTERSSSKSDGNHNGPRKQKRKNSNRNKPGSQSSIESIASSSHASIIYGKIPDKQL
FT                   IDIYFEFIHPNFPVIPINKETLTDDLLLVNTQPISPVHELNTYILHWFRNSLELLVRVA
FT                   LKKPSGSGQAYSDGAVDILDSQATFINALNECFQRIVDIHPGLRENEKLLSLKTKFIYL
FT                   ATFSILNYILAFVGYDNSFVLGMSVTIYNECKLYRYLMYDELPSNDTEASENEDEAGAG
FT                   DAHASGTPERGKSAKHDLGHQVLFKRLYVLLVVFDSLQSCAFGVPKLISVPLAELTEET
FT                   FKFSTGKWCVERDPQRFETIRQSLVLGQVLSWLSISRKSVRRNSLQAAPQDASWKDEKS
FT                   DSVSSSLFAKFLVQKHEMMEDFLLLAPLENSSHLLTFDLLSKSSTAICGLISSMHRLLA
FT                   LLMKINPTNSVDPNNRPPLRQGDFVHTDTEIQSESSNPPAATAAPDSCDADKFDVYRKL
FT                   LGLNGGQERHVAQGTISPFVISIVVEIRNVLELVKHLPTSIIGVVVNLLPNGEGENYQK
FT                   RSHRLVMSLSNAMNELVQITSLISLLKPFKMFDHTLRSNRPSAKVSTKLLRQKFAPESV
FT                   KTPSSQPPSSSPGPNSDGSNNTSLSQNTVMHAILDAAWDLMDGEELGWL"
FT   gene            <639477..>639548
FT                   /locus_tag="KLTH0D07282r"
FT                   /old_locus_tag="Klth0D.tiMet.CAT.7"
FT   tRNA            639477..639548
FT                   /locus_tag="KLTH0D07282r"
FT                   /old_locus_tag="Klth0D.tiMet.CAT.7"
FT                   /note="tRNA-iMet (CAT) cove score=75.85"
FT   gene            <639765..>640724
FT                   /locus_tag="KLTH0D07304g"
FT                   /old_locus_tag="KLTH-ORF11805"
FT   CDS_pept        639765..640724
FT                   /locus_tag="KLTH0D07304g"
FT                   /old_locus_tag="KLTH-ORF11805"
FT                   /product="KLTH0D07304p"
FT                   /note="similar to uniprot|P38747 Saccharomyces cerevisiae
FT                   YHL013C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07304g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22600"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGQ8"
FT                   /protein_id="CAR22600.1"
FT                   /translation="MDTEEAILARHRAEKKDLQNKIAGMKKQATKSKRKQVNSRCEELE
FT                   HDLLQRQEKELQTFRNEGSSDKQASNEPLQESSDDEITPEKLLAQLELGVSAQNSPSVD
FT                   ADKQQTAPQPKKRRNRQKERLAKRDAEMARIREAAAQEAAVQPNLKQIEQDALDQLCDV
FT                   KGVKQFDIKPDGHCLFASILDQVWLRHPTDAQYFIPSGYDGPHLPRDLDVRALRSLSSN
FT                   YIRQYRDDFVPYLFDEATMSIKDVDDYTKTMEETAQWGGEVELLALAKVLKCCISVMMS
FT                   GRATHMINEQEVANPELKLVYYKHSFALGEHYNSLHDS"
FT   gene            <640849..>642096
FT                   /locus_tag="KLTH0D07326g"
FT                   /old_locus_tag="KLTH-ORF11804"
FT   CDS_pept        640849..642096
FT                   /locus_tag="KLTH0D07326g"
FT                   /old_locus_tag="KLTH-ORF11804"
FT                   /product="KLTH0D07326p"
FT                   /note="similar to uniprot|P38746 Saccharomyces cerevisiae
FT                   YHL014C YLF2 Protein of unknown function, has weak
FT                   similarity to E. coli GTP-binding protein gtp1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22601"
FT                   /db_xref="GOA:C5DGQ9"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGQ9"
FT                   /protein_id="CAR22601.1"
FT                   /translation="MFLATTQRFYSAAKGPVRLGRPSNNLTSGIVGLANVGKSTFFQAI
FT                   TNSKLGNPANYPFATIEPEEAKVVVPSEQLDHLQKLYASSKKVPAVLTIYDIAGLTRGA
FT                   SKGEGLGNKFLNDIRHVDGIFQVVRGFADPEITHIEGTVSPIRDLSIVQDELVLKDLEF
FT                   LEGIREKLDRKISKAAKSSGEFKYMSAELELLNALEDHMYEGKKIAHFKDDWTPEEVSI
FT                   LNKHNFLTAKPTIVLLNVSPKNFLLQQNKYLNDVNDWMENYSPGDQVLLFSAEFETKFN
FT                   EFMADNDVEGLDLYCKLQSGGEVDHKETCLPRLIHEMRKALGLISFYTCGPLEARQWTI
FT                   REGTLAPQAAGVIHTDLEKTFISANITKFSDLAFMAPPLKESQLKAQALVKRGGKQYEM
FT                   EDGDVVLFKAAGAASR"
FT   gene            complement(<642151..>642248)
FT                   /gene="SNR69"
FT                   /locus_tag="KLTH0D07348r"
FT                   /old_locus_tag="Klth0D_snoRNA_238"
FT   ncRNA           complement(642151..642248)
FT                   /gene="SNR69"
FT                   /locus_tag="KLTH0D07348r"
FT                   /old_locus_tag="Klth0D_snoRNA_238"
FT                   /product="snR69"
FT                   /note="C/D snoRNA monocistronic SNR69"
FT                   /ncRNA_class="snoRNA"
FT   gene            complement(<642839..>643195)
FT                   /locus_tag="KLTH0D07370g"
FT                   /old_locus_tag="KLTH-ORF11799"
FT   CDS_pept        complement(642839..643195)
FT                   /locus_tag="KLTH0D07370g"
FT                   /old_locus_tag="KLTH-ORF11799"
FT                   /product="KLTH0D07370p"
FT                   /note="similar to uniprot|P38701 Saccharomyces cerevisiae
FT                   YHL015W RPS20"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22602"
FT                   /db_xref="GOA:C5DGR0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGR0"
FT                   /protein_id="CAR22602.1"
FT                   /translation="MSDFQKEKGEQQEQPQIHKIRITLTSTKVKQLENVSANIIKNAEN
FT                   YKLVKKGPVRIPTKVLKITTRKAPNGEGSKTWDTYEMRIHKRYIDLQAPAQIVKRITQI
FT                   TIEPGVDVEVTVAA"
FT   gene            <643756..>645102
FT                   /locus_tag="KLTH0D07392g"
FT                   /old_locus_tag="KLTH-ORF11798"
FT   CDS_pept        643756..645102
FT                   /locus_tag="KLTH0D07392g"
FT                   /old_locus_tag="KLTH-ORF11798"
FT                   /product="KLTH0D07392p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22603"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGR1"
FT                   /protein_id="CAR22603.1"
FT                   /translation="MTIEAVEYLKSIKSVRDTTSQVFNFAVSNGGGHYFDLDLGQMPRV
FT                   ADFLCEIVKRDYGTEYASIPPHGRWQHLNHGHPGRVEGLIAQWRDSGVDEVEVARKLVD
FT                   LLVFSVLVDAGAGNSWKFTVPGSSTSVGRSEGLAVASYYLFVEGSLSDDRDDPYKVTGR
FT                   ALSNFDAELFSRGFQVSEANPLAGAPGRVSLIQRLGAALLARPDIFGAEARPGALVDYL
FT                   YAKSTVTSDAAGATSPTIDLQDVWDALMQGLTSIWPAGRTVVNGEPLGDAWRLDTKAAA
FT                   SSDHTPAGVPSDIVTFHKLTQWLCYSLLVPLERYGYKFRISNKSLQTGLPEYRNGGLFY
FT                   DFGVLKLKSDALKGGLAFSAQLRDAGHDASDTIPTFEPHQGAIVEWRCLTVGLLDSLLP
FT                   LVNKKLEYELGLPQLIEAGSWKAGREIAAKLRPATGGPPIELYSDGTVF"
FT   gene            <645479..>647713
FT                   /locus_tag="KLTH0D07414g"
FT                   /old_locus_tag="KLTH-ORF11796"
FT   CDS_pept        645479..647713
FT                   /locus_tag="KLTH0D07414g"
FT                   /old_locus_tag="KLTH-ORF11796"
FT                   /product="KLTH0D07414p"
FT                   /note="similar to uniprot|P33413 Saccharomyces cerevisiae
FT                   YHL016C DUR3 Plasma membrane urea transporter expression is
FT                   highly sensitive to nitrogen catabolite repression and
FT                   induced by allophanate the last intermediate of the
FT                   allantoin degradative pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07414g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22604"
FT                   /db_xref="GOA:C5DGR2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR031155"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGR2"
FT                   /protein_id="CAR22604.1"
FT                   /translation="MPSSLEGSPSIETFKQEMALIESPLPQGAGYAVVVGLGFVFAFGM
FT                   ILTTYMLKRYQKEIITAEEFATAGRTVKTGLIAAAVVSSWTWAATLLQSTAMVYKVGIS
FT                   GGYYYGAGACFQIIAFAALAIKAKQRAPNAHTFLEIIYARYGKVAHICYLFYALATNIL
FT                   VTAMLLTGGSAVVNDLTGMNTVAACFLLPLGVIVYTLFGGIKATFLTDYVHTIVIIVII
FT                   LTFAFTVYATGDKLGSPGKVYDLVRAAAQAHPIEGNAGGEYLTMRSKSGGIFFVINLVG
FT                   NFGTVFLDNGYWNKAISASPAASLPGYVLGGVSWFAIPTLISTAMGLACVALESNPSFP
FT                   TYPQRLTSDQVSAGLVLPSAAVTILGKGGAVAALLMVFMAVTSAMSAELIAVSSIFTYD
FT                   IYRTYINPNATGKKLIFSSHAACIIFGFSMAGFAVGLYYAGVSMGYLYELMGIIISAAV
FT                   LPACLTLFWKQQNLAAVVISPILGTGLAIMAWLVCAKSQFNEITIDSTFADDPMLTGNV
FT                   VALLSPMVFIPILTYAFKPQKFNWDLLQVITRADETEEIEAAEGQTEGENGQVSVRGDT
FT                   SDSGNSIEANDREKLAAVKSVTSAAQEVPETQIDAMKREEAERLEVAGKWGTYLCIFFA
FT                   LALLVVWPMPMYGSKYIFSKKFFRGWVVVLIIWLFLSGFCVCIYPLWEGREGIYTTCRG
FT                   IYWDLTGQTYKLREWQNSHPEKLHVVQSQISARAHASRRSLDGNIDDIVN"
FT   gene            complement(<647819..>649285)
FT                   /locus_tag="KLTH0D07436g"
FT                   /old_locus_tag="KLTH-ORF11792"
FT   CDS_pept        complement(647819..649285)
FT                   /locus_tag="KLTH0D07436g"
FT                   /old_locus_tag="KLTH-ORF11792"
FT                   /product="KLTH0D07436p"
FT                   /note="similar to uniprot|P32857 Saccharomyces cerevisiae
FT                   YKL039W PTM1 Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22605"
FT                   /db_xref="GOA:C5DGR3"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGR3"
FT                   /protein_id="CAR22605.1"
FT                   /translation="MIAQGPFLVLAILANFAFGNRESLDGYRQVCSGMYSKEDWGGKVD
FT                   PFISFNLKEISGDEGVSVAVLDFQDYEHLGIKSGERTFYICSDTAIEKGLCTEEHKNEY
FT                   LFEEMIFDSETGENKTLAASIQTFYQTESGLHNPKYFVKSTGYYCVITHTENSNADFDA
FT                   VVNFRNAFGQLPAAEINNLPLYGLLAIFYVVAMALYSFAFWKHKNEILPVQKYLLAFFA
FT                   FLTVEQIFIWAYYDIKNEKGNTAGTKVYMVFVSILSAGKTSFSFFLLLVIALGYGVVYP
FT                   KLNKKLMRRCQIFAGLNFSFSVAYMIQNYLTNPESVTLLPLITLVPAAITILGFYFWIL
FT                   KSMTETLRYLQEQRQVVKLKMYRRLLSTIYFSLFVLFAGIVVTSFVFIGMNSIEMVEQH
FT                   WRTRFIVDFWPSLVYYFVFITVAFIWRPTDTSYMLACSQQLPTDPENVADFDLDDLQSL
FT                   EEPSNHIDDDLNFSDDEDHQQGRNSPRQNK"
FT   gene            <649564..>650310
FT                   /locus_tag="KLTH0D07458g"
FT                   /old_locus_tag="KLTH-ORF11788"
FT   CDS_pept        649564..650310
FT                   /locus_tag="KLTH0D07458g"
FT                   /old_locus_tag="KLTH-ORF11788"
FT                   /product="KLTH0D07458p"
FT                   /note="similar to uniprot|P32860 Saccharomyces cerevisiae
FT                   YKL040C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07458g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22606"
FT                   /db_xref="GOA:C5DGR4"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGR4"
FT                   /protein_id="CAR22606.1"
FT                   /translation="MFVARRIQTVKKSLGCGSQFLHIKSVSTPNENALKFISTDGELLQ
FT                   ERGKPSVEIKNTDESLIKHSPLASRLFTQCPGVEALMIGDDFITVNKDEMVHWNQITPS
FT                   VIDLLTQYLASGREAVTPEFFSVQEQGVGYDVNVPKFEYNEDEQEISDMIDELIQTRIR
FT                   PAIMDDGGDIQYRGYDPQTGTVYLKLQGACKSCSSSEVTLKHGIESMLKHYIEEVENVV
FT                   QILDPEEQVALKEFEKLEKKLESTAA"
FT   gene            complement(<650375..>650704)
FT                   /locus_tag="KLTH0D07480g"
FT                   /old_locus_tag="KLTH-ORF11786"
FT   CDS_pept        complement(650375..650704)
FT                   /locus_tag="KLTH0D07480g"
FT                   /old_locus_tag="KLTH-ORF11786"
FT                   /product="KLTH0D07480p"
FT                   /note="similar to uniprot|P38744 Saccharomyces cerevisiae
FT                   YHL018W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22607"
FT                   /db_xref="GOA:C5DGR5"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGR5"
FT                   /protein_id="CAR22607.1"
FT                   /translation="MYNKVKRVAAFPLSTAEISKHLVKHPKWSYDGLRISRDVAFKDFE
FT                   TTWSFLGQLAMRSHLWGHHPTITTTYNKVNLRLTTHDVNGVSDIDIKLMERIEGYIAGH
FT                   GEASA"
FT   gene            <650799..>652313
FT                   /locus_tag="KLTH0D07502g"
FT                   /old_locus_tag="KLTH-ORF11785"
FT   CDS_pept        650799..652313
FT                   /locus_tag="KLTH0D07502g"
FT                   /old_locus_tag="KLTH-ORF11785"
FT                   /product="KLTH0D07502p"
FT                   /note="similar to uniprot|P38700 Saccharomyces cerevisiae
FT                   YHL019C APM2 homologous to the medium chain of mammalian
FT                   clathrin-associated protein complex Similar to clathrin
FT                   coat proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22608"
FT                   /db_xref="GOA:C5DGR6"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR027200"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGR6"
FT                   /protein_id="CAR22608.1"
FT                   /translation="MSSCVFILDEQLNPLILRNLKSIAHPEWYALYFKRVHPQSRGPVI
FT                   YSKGIIYIYILRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIID
FT                   NFNLIYELFDESLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSK
FT                   ENKDKADIHGFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFK
FT                   NSQVRQTFVYGKINCRSYLSGMPIVRVCINKMLKDKDLFLGSSKFHQCVSLESLSSQDY
FT                   IEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKINERQKKHRLHLSVTIQPHFKAQNSA
FT                   TALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWDAQGIKGGHGETSYS
FT                   MHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNKEGKGQFQSNAITA
FT                   EFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTEYAYQV"
FT   gene            complement(<652426..>653796)
FT                   /locus_tag="KLTH0D07524g"
FT                   /old_locus_tag="KLTH-ORF11784"
FT   CDS_pept        complement(652426..653796)
FT                   /locus_tag="KLTH0D07524g"
FT                   /old_locus_tag="KLTH-ORF11784"
FT                   /product="KLTH0D07524p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22609"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGR7"
FT                   /protein_id="CAR22609.1"
FT                   /translation="MAWRLRLNGLGKRLSSNWSRLSEIYAKAGDKVPDKLPLLKNEANH
FT                   KIRCGVILQSLKSQRQSAFLSALLSDVYSNDQYWHDQFSQRYSKRGPKLIRYGASLEVH
FT                   RLDNSSTLYTLPSPWLQKHDIELLEMDEVSPANDGCHIYLGLGKALPAMVWTTLSISDT
FT                   DSESPMGTREVNCKKALAGMRKLIQSKSNVTEYLKDLESSNFLYITQLLESQLCDKNHI
FT                   MERLKHAVIKNIYETDTSISKYSQHLTEKKTIDGEIDNWAYKAHSALQSQLKPRLKQFV
FT                   HGQLSVYKLHTYSESQLELKLREMCDLSRTSDLTEKINHIRGRLNLPLSSPPVWDMNRL
FT                   HQRANAMHKVINKFIYQQFFKFQLPLILCSVLGVLSGQFSAYSMGSLAALGLVLGVNRT
FT                   MHQWSAILQRFQTEVLEEKRLEIEVARGEIQTESNIKAENESRILRSKVEILEKLSK"
FT   gene            <653992..>655125
FT                   /locus_tag="KLTH0D07546g"
FT                   /old_locus_tag="KLTH-ORF11782"
FT   CDS_pept        653992..655125
FT                   /locus_tag="KLTH0D07546g"
FT                   /old_locus_tag="KLTH-ORF11782"
FT                   /product="KLTH0D07546p"
FT                   /note="some similarities with uniprot|P21957 Saccharomyces
FT                   cerevisiae YHL020C OPI1 Transcriptional regulator of a
FT                   variety of genes phosphorylation by protein kinase A
FT                   stimulates Opi1p function in negative regulation of
FT                   phospholipid biosynthetic genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22610"
FT                   /db_xref="GOA:C5DGR8"
FT                   /db_xref="InterPro:IPR013927"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGR8"
FT                   /protein_id="CAR22610.1"
FT                   /translation="MGNVNAKTEYKEEGIPQDIALAVEALRDLRNSHGRGQRDTLLDKV
FT                   RSNTLINNAVRVYEQSKNQYPKFRKGAEIVERKALIPMVKRLEETSNKWKNRSKRSHEE
FT                   EEDEEEGSQSDEDYCEQDEYDEESDNFMDRATAVNDEVLLVDERLCRKRTSKRQKISNA
FT                   IAKSKVNLKGYQLDMSIESKKRLVTCLHLLKLANYQLSNRVGFLQNLVFKEQQLRRGRL
FT                   RGHDIDSDEEEEFYDASDSIDEQSNVVKMEIVRTVKKVYTLISKFTGNSLPEPARTQVR
FT                   ESLLKLPMNWTSTMNSENLARYTNSKGVSPNGKVLILAKESLGMVHNVMNVVDSTLGKA
FT                   EEWVKQKQEIKELLKEQFLDSRLREKVKKQMSEEKEI"
FT   gene            complement(<655143..>655811)
FT                   /locus_tag="KLTH0D07568g"
FT                   /old_locus_tag="KLTH-ORF11779"
FT   CDS_pept        complement(655143..655811)
FT                   /locus_tag="KLTH0D07568g"
FT                   /old_locus_tag="KLTH-ORF11779"
FT                   /product="KLTH0D07568p"
FT                   /note="similar to uniprot|P36095 Saccharomyces cerevisiae
FT                   YKL041W VPS24 involved in secretion"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22611"
FT                   /db_xref="GOA:C5DGR9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGR9"
FT                   /protein_id="CAR22611.1"
FT                   /translation="MDYLKKAIWGPDPKEQHRKIRTLVRRNGRSLDKSLRELNALQSKT
FT                   QALIKRSAKQNDTRSVRIYARELYQINKQYKRMYTSKAQLQSVGMKIDEAFRMQSLQEN
FT                   MALSAGLMREINSLVRLPYLQSSMMELEKELVKSGLISEMIDDTMEMATEDEDMEEEAE
FT                   REVKKIVDQYTSSKLDELDDIPADELPGKEEEIVPDDKIDDEADNMLNEMRERLKALQN
FT                   "
FT   gene            <656927..>656998
FT                   /locus_tag="KLTH0D07612r"
FT                   /old_locus_tag="Klth0D.tGlu.TTC.8"
FT   tRNA            656927..656998
FT                   /locus_tag="KLTH0D07612r"
FT                   /old_locus_tag="Klth0D.tGlu.TTC.8"
FT                   /note="tRNA-Glu (TTC) cove score=64.23"
FT   gene            <657085..>660924
FT                   /locus_tag="KLTH0D07590g"
FT                   /old_locus_tag="KLTH-ORF11777"
FT   CDS_pept        657085..660924
FT                   /locus_tag="KLTH0D07590g"
FT                   /old_locus_tag="KLTH-ORF11777"
FT                   /product="KLTH0D07590p"
FT                   /note="similar to uniprot|Q03690 Saccharomyces cerevisiae
FT                   YMR012W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22612"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025697"
FT                   /db_xref="InterPro:IPR028275"
FT                   /db_xref="InterPro:IPR033646"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGS0"
FT                   /protein_id="CAR22612.1"
FT                   /translation="MRSARLLPLGFQDHNFKELTKFKSCKKFTFFESSSKSSTKSRNLT
FT                   EYLTTMDAQATDAVTVSVRLPHQKQEVQLNLVKSSSVQVVADILQFSPSSRCLTNLELF
FT                   QKSQKLTGDEILKNLSNSDSLKLDVKFKPYTARDALRHVTLVRDTIGFTSETQDGISDF
FT                   AISTGSQISSMPLRPIKSSPPLKGANGESSAFEISEEEKKDLQQTVRDSLSKRQTVNEI
FT                   LKAKSGIITPCLRSLALSAYNPVPPFYRTKGHLLYLHVITLENEAFHVTATSSGFYVNK
FT                   STSTKFDPSPRSEGEVPKVSLLDLFSTHSKKFKDHLSKLEKKVSSLDSVFTARPSTTFL
FT                   GKPWLVSTTPSGAGHHSRLQLSEADFNTERNFNDEFQAIKDMTSSDFQSIVDTEKLTAK
FT                   VYQEFTETAVKDAMSIFYDDLVPMNPEAPSREHIYLKNNIFYAFVGDVNGNYTKVGGDA
FT                   AAFAASNQDLQAVKLLHRVSLSEIHYLLCVIIDFAGRRVLAQTPVPGLLSAMGSVNKKN
FT                   PETDEIITEDLVSDVNVVYGLDEATGEVLFDEEFDEALESFSKVFHLKNHEAGSAKIKF
FT                   SSNSKGIVGSDKRKYVLDLANSHPLDSQFARKYYDNVPESQRYPHRQTLVRNELVDKWW
FT                   ASKLEGSDLTFEKAFDEKLFAFNPDAYIREGVEDPLVEEVSSYLTNEVLPSFAKDYAIG
FT                   NLTAPYDGDHLTDSMHKNGINMRYLGKLIELAENELKDQVVQHQSKTSEVAASNEEHKK
FT                   WEKDYLIKIEKLIKERQAKINKLVQEGKDIPEDLKGNLKLDEKDIRKPTKGKAAIVNKD
FT                   QLTCLIKVSQLEIAARSLKHVLREYTKDLPIPVLPSVVVYFFNLLFGSSFNETPEVEIV
FT                   DSFYAGKSFSFAKLSRQGLLKEICNQAQRRFIYTLPNDVVEEFCSGAFPLIRAISKKFG
FT                   IQFLNKEYFFTQEQFEKFLQSQDKKTKSKIEVPKATFSVNDLVLIPIVKDGDYRSLTGD
FT                   NFWNQGAAILNEKEADGLVLLSQALTIKEEVNGVIHHSVAESYMAMSTIYHTLKRIPEA
FT                   LTYCRKACAIYERTCGVDSFEVLRCLTNLAILEISNKCPSNGALVLQRIMNTLDALCVA
FT                   IHPAVINAYTMLQQASLASKEPKLAIEVMKKLSETILQIEDGERTIAYGYNQSRLGDLY
FT                   ATLNDLNGSLKAITEAREVFQRELGLNDETTAQCNQWVTSIEALMESQLQQRKLTQQQS
FT                   TVNSSGTAANRKQKPSKKQEEPNPELANKSVDELLSFIEGTKPKNSKGKKKNKK"
FT   gene            complement(<661066..>662568)
FT                   /locus_tag="KLTH0D07634g"
FT                   /old_locus_tag="KLTH-ORF11773"
FT   CDS_pept        complement(661066..662568)
FT                   /locus_tag="KLTH0D07634g"
FT                   /old_locus_tag="KLTH-ORF11773"
FT                   /product="KLTH0D07634p"
FT                   /note="weakly similar to uniprot|P20048 Saccharomyces
FT                   cerevisiae YMR013C SEC59 Membrane protein that catalyzes
FT                   the CTP-mediated phosphorylation of dolichol the terminal
FT                   step in dolichyl monophosphate (Dol-P) biosynthesis
FT                   required for viability normal rates of lipid intermediate
FT                   synthesis and protein N-glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22613"
FT                   /db_xref="GOA:C5DGS1"
FT                   /db_xref="InterPro:IPR032974"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGS1"
FT                   /protein_id="CAR22613.1"
FT                   /translation="MEKQSAQDRERIQKLNEGYSPIHAFLKPEKVIQLMMLGSTIHLVV
FT                   AKFLQNEAGAKLQNSLLVTSVAIFVGFWVSYRTRVANNGTWGSPLQPIATFVPDFNVVY
FT                   LMYLPTLFSLIFAREVTIVNLVMSFNCTDLPVAMKLPVQAIFVLLNDEYQQNRTKNLKA
FT                   IFINWVFASLIERIGQLRSFDRVDSNLFSICLTNVLFLLNRSSLHFQILHNVLKGFMVA
FT                   ISVNYLLSFITRKLNQYLRSVILLTSFIVVFPLTILCSFEVEGQNPAGWLFRYILSDST
FT                   RVKIIVGWLGCLLLLVPNIMIFQSKFSLDTSRKLWHFIILVLVVPPLHQDPEFVKIALA
FT                   GTIVLFLSVEYLRYLKLAPFGEFFDSKLRSFADFRDDRGPIIISYIYLIIGIATPILIN
FT                   GSLVGVISLGVGDSLASIVGYRWGRHRWPGTSKTLEGTLAFITATSSCSLALKNFNNSF
FT                   QDLSNAKLIMTCILSGILEGNSVLNDNILVPAFMLIVREGLK"
FT   gene            <662816..>662900
FT                   /gene="SNR78"
FT                   /locus_tag="KLTH0D07656r"
FT                   /old_locus_tag="Klth0D_snoRNA_248"
FT   ncRNA           662816..662900
FT                   /gene="SNR78"
FT                   /locus_tag="KLTH0D07656r"
FT                   /old_locus_tag="Klth0D_snoRNA_248"
FT                   /product="snR78"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR78"
FT                   /ncRNA_class="snoRNA"
FT   gene            <663012..>663093
FT                   /gene="SNR77"
FT                   /locus_tag="KLTH0D07678r"
FT                   /old_locus_tag="Klth0D_snoRNA_247"
FT   ncRNA           663012..663093
FT                   /gene="SNR77"
FT                   /locus_tag="KLTH0D07678r"
FT                   /old_locus_tag="Klth0D_snoRNA_247"
FT                   /product="snR77"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR77"
FT                   /ncRNA_class="snoRNA"
FT   gene            <663288..>663389
FT                   /gene="SNR76"
FT                   /locus_tag="KLTH0D07700r"
FT                   /old_locus_tag="Klth0D_snoRNA_246"
FT   ncRNA           663288..663389
FT                   /gene="SNR76"
FT                   /locus_tag="KLTH0D07700r"
FT                   /old_locus_tag="Klth0D_snoRNA_246"
FT                   /product="snR76"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR76"
FT                   /ncRNA_class="snoRNA"
FT   gene            <663504..>663592
FT                   /gene="SNR75"
FT                   /locus_tag="KLTH0D07722r"
FT                   /old_locus_tag="Klth0D_snoRNA_245"
FT   ncRNA           663504..663592
FT                   /gene="SNR75"
FT                   /locus_tag="KLTH0D07722r"
FT                   /old_locus_tag="Klth0D_snoRNA_245"
FT                   /product="snR75"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR75"
FT                   /ncRNA_class="snoRNA"
FT   gene            <663703..>663781
FT                   /gene="SNR74"
FT                   /locus_tag="KLTH0D07744r"
FT                   /old_locus_tag="Klth0D_snoRNA_244"
FT   ncRNA           663703..663781
FT                   /gene="SNR74"
FT                   /locus_tag="KLTH0D07744r"
FT                   /old_locus_tag="Klth0D_snoRNA_244"
FT                   /product="snR74"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR74"
FT                   /ncRNA_class="snoRNA"
FT   gene            <663855..>663962
FT                   /gene="SNR73"
FT                   /locus_tag="KLTH0D07766r"
FT                   /old_locus_tag="Klth0D_snoRNA_243"
FT   ncRNA           663855..663962
FT                   /gene="SNR73"
FT                   /locus_tag="KLTH0D07766r"
FT                   /old_locus_tag="Klth0D_snoRNA_243"
FT                   /product="snR73"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR73"
FT                   /ncRNA_class="snoRNA"
FT   gene            <664085..>664167
FT                   /gene="SNR72"
FT                   /locus_tag="KLTH0D07788r"
FT                   /old_locus_tag="Klth0D_snoRNA_242"
FT   ncRNA           664085..664167
FT                   /gene="SNR72"
FT                   /locus_tag="KLTH0D07788r"
FT                   /old_locus_tag="Klth0D_snoRNA_242"
FT                   /product="snR72"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR72"
FT                   /ncRNA_class="snoRNA"
FT   gene            <664551..>666038
FT                   /locus_tag="KLTH0D07810g"
FT                   /old_locus_tag="KLTH-ORF11770"
FT   CDS_pept        664551..666038
FT                   /locus_tag="KLTH0D07810g"
FT                   /old_locus_tag="KLTH-ORF11770"
FT                   /product="KLTH0D07810p"
FT                   /note="similar to uniprot|Q04347 Saccharomyces cerevisiae
FT                   YMR014W BUD22 Protein involved in bud-site selection
FT                   diploid mutants display a random budding pattern instead of
FT                   the wild-type bipolar pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22614"
FT                   /db_xref="InterPro:IPR015158"
FT                   /db_xref="InterPro:IPR037393"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGS2"
FT                   /protein_id="CAR22614.1"
FT                   /translation="MPKENLIFKLDRLEYQYHHLNGSLDGFTPRLANTAKTFNAKGKKT
FT                   SKRIGKLLSASNLEDVEKDLNSLRQEIIEKKSYHLENKLTSLLERTLQQKYTALKKKAN
FT                   DKHKADLETLKELDEKYTLSGFCKLISKSRTCKLLIAHVLPTKILKEEPPTWFQENEYL
FT                   EIFKDKGNDYNPGKVWNEVVLPTKGCEKLLSQSTNDKKIKELLAGFENAMDLFMNLKRE
FT                   RSLGSKKEDAQLSTKSENSESIDNTTSGEQSEQDFDSSGSEDGIDHDEEDVDEEEILKQ
FT                   YEGMLVASDEEEDESVPYSLDPNVNYNEVTDEEPSDLEESMGSDLADSSEDEEPLKKRQ
FT                   KTSRESKNTKHDKATAKLPELMTGYFSGGSENELSEDEVAAQQSSNKPLRKNRRGQRAR
FT                   QKIWEKKFGKNAKHVQKQMEAERSERERKKVEYEQRVVKRAAKTQQRESAVDQKRIDAA
FT                   ARAQRVENTPIHPSWEAKKLAEEKQKGAKFQGKKIVF"
FT   gene            complement(<666271..>667869)
FT                   /locus_tag="KLTH0D07832g"
FT                   /old_locus_tag="KLTH-ORF11767"
FT   CDS_pept        complement(666271..667869)
FT                   /locus_tag="KLTH0D07832g"
FT                   /old_locus_tag="KLTH-ORF11767"
FT                   /product="KLTH0D07832p"
FT                   /note="highly similar to uniprot|P54781 Saccharomyces
FT                   cerevisiae YMR015C ERG5 C-22 sterol desaturase a cytochrome
FT                   P450 enzyme that catalyzes the formation of the C-22(23)
FT                   double bond in the sterol side chain in ergosterol
FT                   biosynthesis may be a target of azole antifungal drugs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22615"
FT                   /db_xref="GOA:C5DGS3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGS3"
FT                   /protein_id="CAR22615.1"
FT                   /translation="MDSVVESYAGDQALMSVQNSTISAGGLQGVVQTLQAISYWKLFFT
FT                   VVCVGLVWDQISYQTKKGSIAGPRWKFWPVIGPFLESLDPKFEEYKAKWDSGPLSCVSI
FT                   FHKFVVIASTRDLARKILQGHKYVKPCLVDVAVKILRPSNWVFLDGKAHSDYRKSLNGL
FT                   FTKSSLAKYLPSQEQVMDKYLEKFVTFSAENDFKPQVFFHEMREIMCALSLKAFCGSYI
FT                   TESQIRKVADDYYLVTAALELVNFPIILPYTKTWYGQKTADMTMKIFEKCAQMAKDHIA
FT                   AGGKPTCVMDAWCQLMHDAKTKNDEDSRLLHREFSNREISEAIFTFLFASQDASSSLAC
FT                   WLFQIVADRPDVMEKIREEQLRVRDNDPNKPLSLELIEEMKYTYMVVKETLRYRPPVIM
FT                   VPYVVKEKFPIAPNYTAPKGAMIIPTLYPALHDPEVYEDPEEFIPERWVEGSPANEAKR
FT                   NWLVFGSGSHVCLGQTYVMLTFTALIGKFAMFTDWKHEVTPLSEKIKVFATIFPKDDLH
FT                   LSFRKRDPLTGKIEV"
FT   gene            complement(<668300..>669376)
FT                   /locus_tag="KLTH0D07854g"
FT                   /old_locus_tag="KLTH-ORF11764"
FT   CDS_pept        complement(668300..669376)
FT                   /locus_tag="KLTH0D07854g"
FT                   /old_locus_tag="KLTH-ORF11764"
FT                   /product="KLTH0D07854p"
FT                   /note="weakly similar to uniprot|P36094 Saccharomyces
FT                   cerevisiae YKL042W SPC42 Central plaque component of
FT                   spindle pole body (SPB) involved in SPB duplication may
FT                   facilitate attachment of the SPB to the nuclear membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22616"
FT                   /db_xref="GOA:C5DGS4"
FT                   /db_xref="InterPro:IPR021611"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGS4"
FT                   /protein_id="CAR22616.1"
FT                   /translation="MSPHTEGPLFAVLKNSRARPRPRESRLRRRVHKQMNISPTPKRYN
FT                   SRGYEFPRSNDEAFHPFNREPPMVPSERILPEEYRVNSQMINKLIKQNKDLTQQLDRKQ
FT                   DEIDRLNVLVGSLRGKLIKYTELNKKLEQAAAGARQSSPDDVLQVNRTRPREPPAGGTR
FT                   LDDRLSDLYSKLETLTELVVGSAAADRGARDHVHVPSAGATRTPSSGASVSHRPLQPGA
FT                   ASEDDILTQESAELKGLEDQIDLLKRKLLIKRENELRKLSLNKELLDLMEKLDVSRPAG
FT                   PVPSSSTPPHCDQCHKAAYQTAAANGGHGVPAGAGSGAGAGASMPSPRNPPYMSMAQVL
FT                   ETPTPAHRSSHKPNDTLW"
FT   gene            complement(<669644..>671941)
FT                   /locus_tag="KLTH0D07876g"
FT                   /old_locus_tag="KLTH-ORF11758"
FT   CDS_pept        complement(669644..671941)
FT                   /locus_tag="KLTH0D07876g"
FT                   /old_locus_tag="KLTH-ORF11758"
FT                   /product="KLTH0D07876p"
FT                   /note="some similarities with uniprot|P53438 Saccharomyces
FT                   cerevisiae YMR016C SOK2 Protein that can when overexpressed
FT                   suppress mutants of cAMP-dependent protein kinase displays
FT                   homologies to several transcription factors"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22617"
FT                   /db_xref="GOA:C5DGS5"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGS5"
FT                   /protein_id="CAR22617.1"
FT                   /translation="MSNEQIHNAYSQQPPQQQQQQQQPQQQPQHGAGGAAGGQGAGQLH
FT                   AHSQAHMVQHSPSQAPSHAHTASAAQGNPYMNQEHWQYQYAPQMHGFYTQTGGGSGSAG
FT                   GAAGGAAASHQTAAHQSPSDHVSYAYSHYPAASAAADPQQQPQQQQQQQQQQQPYASYA
FT                   SSAGYGYYPYAAQTAAVGDEQQQAYASYYRQAQLAQVQAQAQAQAQAQAQAQAQAQAQA
FT                   QAQAQAQAQAAQAQASQLGYQYPGFLGSGRPGAAASHDELSGSSAAGGSAGAGAVSPVA
FT                   YYGEELGGKARRAVSSRGRELGAGSLDGSALLGLAAAGALDPTTGMPGAMPGAMPTGIH
FT                   TGMAGGMATGLGAAARTSAAAAAAGARPRVTTTMWEDEHTLCYQVEANGVSVVRRADND
FT                   MINGTKLLNVAKMTRGRRDGILKAEKIRHVVKVGSMHLKGVWIPFDRALAMAQREKIVD
FT                   LLFPLFVRDIQSIIQQGASTVLAGPAAAAASAGPVQAPTRSMGGMSSGGAGAGGGSAYY
FT                   ADAYQPLAGYGHYQPIDYGYAARPVMHAVSGLGSVGSAGLGSSGLGSAGSVGSVSGGVP
FT                   SSSAIATHGGPLSAAAGHTAASAGHGLGHGHGPGSGVGVGVGPVDGSASNAGPGSDNGP
FT                   GVGVGVGVGVGVGVGSGSGSGAVHGTSPGSGSTAASGVGADLGSHSGGDRAPGSAAPGA
FT                   TSSGDATGASVMGVSHGYPSQAGASSMDSLAKPVASHSTDSSEQTPVGHGAPDQVKPEA
FT                   LDSNDANAAHDE"
FT   gene            <672516..>674534
FT                   /locus_tag="KLTH0D07898g"
FT                   /old_locus_tag="KLTH-ORF11746"
FT   CDS_pept        672516..674534
FT                   /locus_tag="KLTH0D07898g"
FT                   /old_locus_tag="KLTH-ORF11746"
FT                   /product="KLTH0D07898p"
FT                   /note="weakly similar to uniprot|P50104 Saccharomyces
FT                   cerevisiae YMR019W STB4 Protein that binds Sin3p in a two-
FT                   hybrid assay"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22618"
FT                   /db_xref="GOA:C5DGS6"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGS6"
FT                   /protein_id="CAR22618.1"
FT                   /translation="MCLDHHQQDDNARVATLQQDTGRPRIRVRKACGTCKRRKVKCNGQ
FT                   QPCAGCAKHGSVCHYKVEPVTRPASAALKAGAPGPAGTLPALSQVPAPSDFATGPAPAS
FT                   PWQRFSPGKYRFHRRHQNLVPYYLGQALISSLPPALVQKYALRAPRLQFYGWNMSGGHY
FT                   LKQGSTFGAPQGTVWRWDLAVELQRQILEKCASFFFQHVNRFVSIVHEQAFWQQFRGGF
FT                   LDGSDGKNGSSDLFEAILNLIAAIALRFSYSGAGASVCEALTAAEVTWLDLHLTRHGRH
FT                   LEETLFERAYAVTTRLSFEWESFELIQAWLLAAVYLRTCHRQVSCWQALSRAVQMCNGM
FT                   SLYLNRFPEKHTAYDECRARNCYWACFVLDRLISFQMGRFPELAGPGPDMGSPDTAVDT
FT                   WFSAESVALYKLAAIVTTCQRRYGQELTAAETQELGARLDEWHGDCEEVLADPGLCARQ
FT                   VLLTYLDVRIALEIRGLFQLLDVGSDTVRHALPLDAVTLVDLASRVLDQFEAIVESGLF
FT                   FRPWWLNLSLLFTCSVICLTLVQGGLQLARAQALLSRSFHIWHFIEGARPPNPPGMARE
FT                   CLWCLKMLNHMFCQRLTTSAEQLESIIGVDPGDDSVNQNKFRQFGKVDMNRANDDGAAL
FT                   LQSGSDTISPADDSNNLVAHLQWFDQWLDVDNLQTMF"
FT   gene            complement(<674563..>676083)
FT                   /locus_tag="KLTH0D07920g"
FT                   /old_locus_tag="KLTH-ORF11736"
FT   CDS_pept        complement(674563..676083)
FT                   /locus_tag="KLTH0D07920g"
FT                   /old_locus_tag="KLTH-ORF11736"
FT                   /product="KLTH0D07920p"
FT                   /note="highly similar to uniprot|P20457 Saccharomyces
FT                   cerevisiae YKL045W PRI2 Subunit of DNA primase which is
FT                   required for DNA synthesis and double-strand break repair"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22619"
FT                   /db_xref="GOA:C5DGS7"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGS7"
FT                   /protein_id="CAR22619.1"
FT                   /translation="MFRQSKRRVANRRNFGDQVSRTPGKFILNGITSEEEKQLYQSLYE
FT                   SKLSFYEVPPKGEITLEQFELWAIDRLKVLLEIESCVQRNKTAKEIEIIVKPLLQKLLP
FT                   FTTEDLQDRKKDYYSHFILRLCFCRSKELREKFIRSETMLLKLRFNMMTSRDQAKFVQT
FT                   LNLPFLQFISDEEKEQLSTQLYQTISSSLQFQLNLTDETARRQYFEQEKFIKLPFESVI
FT                   ELVGARQVFIKKGYAYLPQFQQLNHIANEFANMLSLALTKTYQTIPRLNEDDRLLPILH
FT                   HLSTGYTITNFQQHDQFGQASQGEINAKSVYSSAIQENFPLCAKNLMSGLKENHHLRYQ
FT                   GRQQLSFFLKGIGMDVDEALQFWSDAFTSGGQMTQEKFNKEYRYNFRHNYGLEGNRINY
FT                   KPWDCRTILSRPRPSRGEYHGCPYRDWNVDKLTLELSQGMSLNPSQVTSVLDSVQRTEY
FT                   TIACTKVFEMTHGGSANTEINDQSHIAHPNLYYERSRQLQKKAGAAIK"
FT   gene            <676761..>678263
FT                   /locus_tag="KLTH0D07942g"
FT                   /old_locus_tag="KLTH-ORF11734"
FT   CDS_pept        676761..678263
FT                   /locus_tag="KLTH0D07942g"
FT                   /old_locus_tag="KLTH-ORF11734"
FT                   /product="KLTH0D07942p"
FT                   /note="similar to uniprot|P50264 Saccharomyces cerevisiae
FT                   YMR020W FMS1 Polyamine oxidase converts spermine to
FT                   spermidine which is required for the essential hypusination
FT                   modification of translation factor eIF-5A also involved in
FT                   pantothenic acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22620"
FT                   /db_xref="GOA:C5DGS8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGS8"
FT                   /protein_id="CAR22620.1"
FT                   /translation="MIENQVVIIGAGIAGLKAASELYKRGFKSCTILEARDRIGGRLHT
FT                   VTGYQNRRYDLGASWHHDTLVNGLFLEELNLPEDQRASFVFDDDSMVVFDAEKGRVDQD
FT                   PEMVLEILLEELVKYSQLHFFEDLSAQDLNYFQMVVKYLYERRGLLTNDQIRFLPQVAR
FT                   FMELWHGIDWKSQSSKCLEIAHQGRNALVLNYDKIVRRIASEIPESWLQLSTEVKEVRN
FT                   DGKNVLVTIDKGETISCKYVIVTVPQSILAHSLQPEPRVGKIEFIPPLNVNIQDAFKKT
FT                   HYGALGKVVFEFDDCCWSTERSRILSLGKSSSNLSQRVREARDLSLLVEELDANTKYQF
FT                   ERGDSWNFPLLFVNMVKHTGIPSFVMLMANPLTKYIESMNDKGKIFEFFTPVLENLLKT
FT                   LGCAEPIVKDFENKLVKSNKKAPILKNIVTTNWTRDDYALGAYSACEPGDDPMDLVLAL
FT                   TENQTSLVRFAGEHTIMDGAGCVYGAWQSGKREADFIADKLA"
FT   gene            complement(<678368..>679543)
FT                   /locus_tag="KLTH0D07964g"
FT                   /old_locus_tag="KLTH-ORF11733"
FT   CDS_pept        complement(678368..679543)
FT                   /locus_tag="KLTH0D07964g"
FT                   /old_locus_tag="KLTH-ORF11733"
FT                   /product="KLTH0D07964p"
FT                   /note="similar to uniprot|P35192 Saccharomyces cerevisiae
FT                   YMR021C MAC1 Copper-sensing transcription factor involved
FT                   in regulation of genes required for high affinity copper
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22621"
FT                   /db_xref="GOA:C5DGS9"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="InterPro:IPR036395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGS9"
FT                   /protein_id="CAR22621.1"
FT                   /translation="MIIYDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVR
FT                   KVILVDASSQVNSGLHEEGDGGSPSCCSSAGARSCSKMNKQPILFLRTMSMQKALLVDG
FT                   ALKIMIEDNDPNFQGRYKFVSEKDYLLNHLDTSQKGCAMSAESITRAGSSEAQSLERFL
FT                   SEGMSPASSSNKQELSEIKFEGHHETLVYPVQNIPREAGNASPEIANNSMVELFTHKGV
FT                   YLSTQCNCADGNCLCVNCLIHRKEEELEKYIQQSGVPLSTIGNGRITFPEEQSPNNTFI
FT                   CRSPAEDCTAQECLLHPEEIIPLNQIFLYGLVNVPLRRKHVIKFRHKLIPSKFWWHLLK
FT                   EELPSMPQDQWSKFELLSWFEHIIKSFDSEIPNEPSGDGVNLHSMGLMMNA"
FT   gene            <679875..>680372
FT                   /locus_tag="KLTH0D07986g"
FT                   /old_locus_tag="KLTH-ORF11732"
FT   CDS_pept        679875..680372
FT                   /locus_tag="KLTH0D07986g"
FT                   /old_locus_tag="KLTH-ORF11732"
FT                   /product="KLTH0D07986p"
FT                   /note="highly similar to uniprot|Q02159 Saccharomyces
FT                   cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
FT                   involved in the ER-associated protein degradation pathway
FT                   requires Cue1p for recruitment to the ER membrane proposed
FT                   to be involved in chromatin assembly"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22622"
FT                   /db_xref="GOA:C5DGT0"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGT0"
FT                   /protein_id="CAR22622.1"
FT                   /translation="MSKTAQKRLFKELQQLLKDSPEGIVAGPRSEDNLFLWDCLISGPP
FT                   DSPYQGGVFNATLEFPKDYPLSPPKLLFTPSILHPNIYPNGEVCISILHSPGDDPNMYE
FT                   LAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWRDSREEFEKQVKRSILKSL
FT                   GF"
FT   gene            <680735..>682081
FT                   /locus_tag="KLTH0D08008g"
FT                   /old_locus_tag="KLTH-ORF11730"
FT   CDS_pept        680735..682081
FT                   /locus_tag="KLTH0D08008g"
FT                   /old_locus_tag="KLTH-ORF11730"
FT                   /product="KLTH0D08008p"
FT                   /note="highly similar to uniprot|P36091 Saccharomyces
FT                   cerevisiae YKL046C DCW1 Mannosidase GPI-anchored membrane
FT                   protein required for cell wall biosynthesis homologous to
FT                   Dfg5p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22623"
FT                   /db_xref="GOA:C5DGT1"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGT1"
FT                   /protein_id="CAR22623.1"
FT                   /translation="MRLLLATFLTALLSFRSSQALDFDVDNEGSIKNATALVAGGLLDY
FT                   YTGQQYGQTIGMFSNPYYWWEAGGAWGSILDFWWYTQNDTYNAMLEEALLYQAGENHDY
FT                   IPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPPETEPQWLYLAQAVFNTMALRWDDESC
FT                   GGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLARYTGNNTYVDWAEKVFDWMKGIGLL
FT                   TENDNSYVYDGAKVDGNCSTITKLIWTYNQGLLMSGCAYLYNYTGSETWHTRTFEFLNS
FT                   SDIFFNNSILYERTCQEANTCNTDQRSFKAYFSRFLGLTAQLVPAARNQIMDWIRASAK
FT                   GAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGEQMAALEIMQNVLCLDRPAPYTAATGGS
FT                   SVGNGAAGTETSATNLSPLDITTGSRAAAGIITAVIGLSIVACTVWLVL"
FT   gene            complement(<682139..>683698)
FT                   /locus_tag="KLTH0D08030g"
FT                   /old_locus_tag="KLTH-ORF11729"
FT   CDS_pept        complement(682139..683698)
FT                   /locus_tag="KLTH0D08030g"
FT                   /old_locus_tag="KLTH-ORF11729"
FT                   /product="KLTH0D08030p"
FT                   /note="similar to uniprot|P36090 Saccharomyces cerevisiae
FT                   YKL047W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22624"
FT                   /db_xref="InterPro:IPR018626"
FT                   /db_xref="InterPro:IPR028115"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGT2"
FT                   /protein_id="CAR22624.1"
FT                   /translation="MRQFTRTLDMRYNPKPYDFEIQEPSHKVPLCCIFLCQFDVKKGNT
FT                   LIWSKKSTETSDISLGNIEFKCIPSGIHELEKDVVSFVIPKGENLVEVYYGVSCFQQNG
FT                   QSLSRNVSHVDRGKVQMFSLGVIVDASFRYKGVSKSKFYDWKPNQFISATEYIDDLQEL
FT                   LSHWLKRQNLGQDFSLFENYFEANRFKADSAMLSSPILQHSWQNAGKFTTNSLLQEKHP
FT                   HMLESLSQWLEYLGPLMFPLWKACITRQRVLIITGNGVSFEKTNSLVYCLSILSLIPRI
FT                   ISDKLKDSPLQPLYCIGISDIDDLERHVAASMSTNDETYEITGFIACTGDEILESRSEL
FT                   YDVCLKIHGRDALPEITTSNGDYLKATPHELELYEKLVSNSLGYQLSQNEKEKVFRLVE
FT                   PTTWSQYLIDGFYWWATAGYMRPSFHEPEDKVIADLDRDNLEIVISLVGYFHEKTLLLY
FT                   NSLKQVVEASTEDTVVVSPIFLATVGLDCFSSGDYAFLNKVCQKWFDRELLVRNVDCTL
FT                   LC"
FT   gene            <683787..>684128
FT                   /locus_tag="KLTH0D08052g"
FT                   /old_locus_tag="KLTH-ORF11728"
FT   CDS_pept        683787..684128
FT                   /locus_tag="KLTH0D08052g"
FT                   /old_locus_tag="KLTH-ORF11728"
FT                   /product="KLTH0D08052p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22625"
FT                   /db_xref="GOA:C5DGT3"
FT                   /db_xref="InterPro:IPR020491"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGT3"
FT                   /protein_id="CAR22625.1"
FT                   /translation="MTWKAGMKERVLRQHIEGCIDQVQEYVDLESAQAISSFESKAVDH
FT                   FRCLDGLKAQYNTREDKISEFKRLQSEYATKVDGLEKSIEHFEKLSEEIEEFLVELEVK
FT                   TKLASKRQS"
FT   gene            complement(<684208..>685701)
FT                   /locus_tag="KLTH0D08074g"
FT                   /old_locus_tag="KLTH-ORF11727"
FT   CDS_pept        complement(684208..685701)
FT                   /locus_tag="KLTH0D08074g"
FT                   /old_locus_tag="KLTH-ORF11727"
FT                   /product="KLTH0D08074p"
FT                   /note="similar to uniprot|P32559 Saccharomyces cerevisiae
FT                   YMR023C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22626"
FT                   /db_xref="GOA:C5DGT4"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGT4"
FT                   /protein_id="CAR22626.1"
FT                   /translation="MQRGLYASYRLYSSVPATAFHPTIYALSTSPGQRSAIAVVRVTGS
FT                   HCKHIYYQLTGAQSPPVPRRCSLRNLYHAAGAKKNLLDSSLVLFFENPKSFTGEDMLEL
FT                   HLHGGRAVIKSVLGAIQSLGDQKKGLDIRYAQPGEFSQRAFQNGRMDLTQAEGVADLID
FT                   AETETQRRSALQSFRGQNKALFDGWRSQIVSGIAQLTAIIDFGEDAEIEDTQAILDSVR
FT                   RNMMNLDKEIKLFVLKIRRSSILQNGVKVALLGSPNAGKSSLLNCITNDDTSIVSDTPG
FT                   TTRDAIDVPIDVDGYKVVLCDTAGIRSESEDQIEIQGIKRAKAKGSESDLVILVIDPTK
FT                   TPLVTEDLQRFVKEQIPHNQVIIAVNKTDLVDTKGLKNVRQEVYQIFNGDFPIKSVSCT
FT                   NFEGIENLVKELSHVFQGLSGTSHDSDPLIVSNRTEEILTKDVMFGLQEFLSFPGTEDV
FT                   VMACENLAYAAEGIGKITGASVGVEEVLGVVFSRFCVGK"
FT   gene            complement(<685802..>685874)
FT                   /locus_tag="KLTH0D08096r"
FT                   /old_locus_tag="Klth0D.tAla.AGC.23"
FT   tRNA            complement(685802..685874)
FT                   /locus_tag="KLTH0D08096r"
FT                   /old_locus_tag="Klth0D.tAla.AGC.23"
FT                   /note="tRNA-Ala (AGC) cove score=70.00"
FT   gene            <686143..>687060
FT                   /locus_tag="KLTH0D08118g"
FT                   /old_locus_tag="KLTH-ORF11724"
FT   CDS_pept        686143..687060
FT                   /locus_tag="KLTH0D08118g"
FT                   /old_locus_tag="KLTH-ORF11724"
FT                   /product="KLTH0D08118p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22627"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGT5"
FT                   /protein_id="CAR22627.1"
FT                   /translation="MKLTSFLNACLVIALPVRICSATALEAQDAQLRQTEILNSWNATT
FT                   TKCQDRTVPLIDKALSYKFSVDSLERGVSSALSTLRASLQGKDEFCALDIVRVATEQMR
FT                   WMSLSDVDFSTKISFAAQFSQVKTIYYSVPMLRQLHRCVSYAVASTADSVQWKGFIGEA
FT                   AKAWYRLISNSASGRDLSQAVELVQNSSKLQKILAKARDEWVLAAPLCERHQDVHTNHI
FT                   NLENAASRVAAFHGPKPGDAPSLLASKDEEDNHTVQGGSVTHAGSMTHVPVNSNESSGV
FT                   VLRKISSWSVMGAVVVVLSGVALF"
FT   gene            <687366..>688490
FT                   /locus_tag="KLTH0D08140g"
FT                   /old_locus_tag="KLTH-ORF11721"
FT   CDS_pept        687366..688490
FT                   /locus_tag="KLTH0D08140g"
FT                   /old_locus_tag="KLTH-ORF11721"
FT                   /product="KLTH0D08140p"
FT                   /note="similar to uniprot|P36516 Saccharomyces cerevisiae
FT                   YMR024W MRPL3 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22628"
FT                   /db_xref="GOA:C5DGT6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGT6"
FT                   /protein_id="CAR22628.1"
FT                   /translation="MSQQLLLSGRLARSLHVVARSKRVWLRGFPAPQRSIHLSPRQRQQ
FT                   QVKLETPELNKYREYYKRLQAAVNDVPEELASKSPSLVTLHRRLNLPESFQLSTLARCL
FT                   TCRSSRLPSDLNVPSSGAAFTSSVPTSNFYDNHGLNIFGKNLLTYHVTRQTMAKYPRLP
FT                   TVVLNAAVDAYISQSVLASVGRSWGIELENSSVLDRYLREEPIQVSLGKLRFFNNALKR
FT                   EDGVELITSHNFSEDAAYALAVRSVIGALWAYTHETDPTFAFRFIDDHILSRKLDVTRI
FT                   FQFEQPARELAVLCRRENLSPPVSKLLAESGRLSKAPVFIVGVFSGAEKLGEGFGSSLK
FT                   EAKARAATDALMKWYCYEPVQGQAPVIDPGAVIV"
FT   gene            <688657..>689418
FT                   /locus_tag="KLTH0D08162g"
FT                   /old_locus_tag="KLTH-ORF11719"
FT   CDS_pept        688657..689418
FT                   /locus_tag="KLTH0D08162g"
FT                   /old_locus_tag="KLTH-ORF11719"
FT                   /product="KLTH0D08162p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22629"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGT7"
FT                   /protein_id="CAR22629.1"
FT                   /translation="MDVNLGLGVIVDANHLKETLLATGGYPTQPLCLLLFGGISGSRVD
FT                   LQRSLELPLIRSEKEDRLVFSETALRDRVHLVESVEPELRLLGVLFITNDLGDVEAIID
FT                   ELRRLAKGLQYFFTYDTCGTRLTLKCYRSRGQARMEEVPFQLSSSDSVLAAVEALSPNV
FT                   GKQYDQDEFEEQTSFNRKLLERVEAMIEYMEGGRVSDQALREMFLLTSLLKKGSTQDIE
FT                   EALLHKEVELQSLDVICSQWETAQSIRGFIK"
FT   gene            complement(<689421..>690575)
FT                   /locus_tag="KLTH0D08184g"
FT                   /old_locus_tag="KLTH-ORF11717"
FT   CDS_pept        complement(689421..690575)
FT                   /locus_tag="KLTH0D08184g"
FT                   /old_locus_tag="KLTH-ORF11717"
FT                   /product="KLTH0D08184p"
FT                   /note="similar to uniprot|Q04370 Saccharomyces cerevisiae
FT                   YMR026C PEX12 RING-finger peroxisomal membrane peroxin that
FT                   plays an essential role in peroxisome biogenesis and
FT                   peroxisomal matrix protein import forms translocation
FT                   subcomplex with Pex2p and Pex10p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22630"
FT                   /db_xref="GOA:C5DGT8"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017375"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGT8"
FT                   /protein_id="CAR22630.1"
FT                   /translation="MDFYSNLPAASSSIASSIFPTLFEVLSADEIDELLTPSVRYIVAN
FT                   LVARNPNKLTIRFSNWFDEWFVLAAKLTLESYYLKTWDATFIEVFYGLKRINASDAVLL
FT                   RTLQSNPPVEIPMRLTRFQRRAVLCEKVLAPYVALKLDLLHSKLLARSLLQHPPAQEMG
FT                   QRVRESLRTLYLRFYPLLKKLLFVLNLAVKLYFLSGRTGSTSLLDLILNIQYTRLSKYD
FT                   YSRNDRSSTAPGQAVRSRPQRLNRSALLFLCRASFSKIKNLLKLSVSQMLPAFIFLLRV
FT                   FQWWSSQDLSGEIQRRLNNIDKDIPPPPGRFEKNTEGTCRICNGPIRNPAVIGTGYVFC
FT                   YPCILDYLPQHEGKCPVTGSQLLGCQYDKDSGHWSIKGVRKLLL"
FT   gene            complement(<690773..>690844)
FT                   /locus_tag="KLTH0D08206r"
FT                   /old_locus_tag="Klth0D.tGln.CTG.22"
FT   tRNA            complement(690773..690844)
FT                   /locus_tag="KLTH0D08206r"
FT                   /old_locus_tag="Klth0D.tGln.CTG.22"
FT                   /note="tRNA-Gln (CTG) cove score=70.60"
FT   gene            <691972..>693133
FT                   /pseudo
FT                   /locus_tag="KLTH0D08228g"
FT                   /old_locus_tag="pseudo-Klth0D-691972-693133"
FT   gene            complement(<693583..>694662)
FT                   /locus_tag="KLTH0D08250g"
FT                   /old_locus_tag="KLTH-ORF11709"
FT   CDS_pept        complement(693583..694662)
FT                   /locus_tag="KLTH0D08250g"
FT                   /old_locus_tag="KLTH-ORF11709"
FT                   /product="KLTH0D08250p"
FT                   /note="highly similar to uniprot|P14540 Saccharomyces
FT                   cerevisiae YKL060C FBA1 Fructose 1 6-bisphosphate aldolase
FT                   required for glycolysis and gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22631"
FT                   /db_xref="GOA:C5DGT9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGT9"
FT                   /protein_id="CAR22631.1"
FT                   /translation="MGAQDVLTRKTGVIVGDDVRALFDYAKEHKFAIPAINVTSSSTAV
FT                   AALEAARDNGSPIILQTSNGGAAYFAGKGISNDGQNAAIRGSIAAAHYIRSIAPAYGIP
FT                   VVLHSDHCAKKLLPWFDGMLEADEAYFKLHGEPLFSSHMIDLSEESDDENIASCVKYFT
FT                   RMAKMGQWLEMEIGITGGEEDGVNNEHVSREDLYTKPETVFAVHKALAPISPNFSIAAA
FT                   FGNVHGVYAPGNVQLRPEILGDFQKYAHGQVKTEEKPLYLVFHGGSGSSNEDFKTAIGH
FT                   GVVKVNLDTDCQFAYLKGIRDYVLKNKDYLMTPVGNPEGADKPNKKKYDPRVWVREGEK
FT                   TMSERITEALGVFNTQKQL"
FT   gene            complement(<695296..>696987)
FT                   /locus_tag="KLTH0D08272g"
FT                   /old_locus_tag="KLTH-ORF11702"
FT   CDS_pept        complement(695296..696987)
FT                   /locus_tag="KLTH0D08272g"
FT                   /old_locus_tag="KLTH-ORF11702"
FT                   /product="KLTH0D08272p"
FT                   /note="highly similar to uniprot|P06169 Saccharomyces
FT                   cerevisiae YLR044C PDC1 Major of three pyruvate
FT                   decarboxylase isozymes key enzyme in alcoholic fermentation
FT                   decarboxylates pyruvate to acetaldehyde subject to glucose-
FT                   ethanol- and autoregulation involved in amino acid
FT                   catabolism and to YLR134W uniprot|P16467 Saccharomyces
FT                   cerevisiae YLR134W PDC5 Minor isoform of pyruvate
FT                   decarboxylase, key enzyme in alcoholic fermentation,
FT                   decarboxylates pyruvate to acetaldehyde, regulation is
FT                   glucose- and ethanol-dependent, repressed by thiamine,
FT                   involved in amino acid catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08272g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22632"
FT                   /db_xref="GOA:C5DGU0"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGU0"
FT                   /protein_id="CAR22632.1"
FT                   /translation="MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRW
FT                   AGNTNELNAAYAADGYARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSL
FT                   ASQAKQQLLHHTLGDGDFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPV
FT                   YLGLPANIVNQMVDRRLLDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACC
FT                   SRHDAKKEAWQLTDATQFPCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADL
FT                   ILSLGALLSDFNTGSFSYSYGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAA
FT                   IQHYSPRPVPTRPARNAPTPRDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTR
FT                   FPNNTYGISQVLWGSIGFTTGATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMV
FT                   RWGLRPYLFVPNNDGYTIEKLIHGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGE
FT                   WDALTNDPAFNRNSRIRLVEVMLEVMDAPSSLVRQAQLTAATNAQN"
FT   gene            <697828..>699273
FT                   /locus_tag="KLTH0D08294g"
FT                   /old_locus_tag="KLTH-ORF11696"
FT   CDS_pept        697828..699273
FT                   /locus_tag="KLTH0D08294g"
FT                   /old_locus_tag="KLTH-ORF11696"
FT                   /product="KLTH0D08294p"
FT                   /note="similar to uniprot|Q04371 Saccharomyces cerevisiae
FT                   YMR027W High level expression reduced Ty3 Transposition"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22633"
FT                   /db_xref="GOA:C5DGU1"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="InterPro:IPR039763"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGU1"
FT                   /protein_id="CAR22633.1"
FT                   /translation="MLSPPYFAPSSTCQHHGFLAVMSLPQTFKNNDKGTFGQFTATSRW
FT                   PTIISNAIDDLQAELDTLEGGSQHFHDGQKIQQSLVELRKEVETDQAIRPFTAGEIKTA
FT                   DVPGSFNEHIASVAQTWHTGGWLFCEVYLYRRINVLFRSYASWREFDIFNRVKQSTFQS
FT                   SMVGVVELAVRYQKLQSQLESADSEAIELLFKEFVEISLWGNATDLSLLTNATLEDIKS
FT                   LQGEQARKASESKILINDTAKAWKQLQSSEHKRVDFVLDNSGFEVYADLMLALFLLDTG
FT                   IVKECIFHAKDIPYMVSDCMIKDFELLLRDMESPDFFDLKQLQHDEQPGRESLAFLVKT
FT                   LRDHIQSGCISFVQDSFWTTDLDYTHIDPSETKYHGAEIHKSLLDSALVIFKGDLNYRK
FT                   LTGDRKWPRTTKWETAIGSLASNGLKTLSLRTCKADVVVGLPSGVDEKLCSEWESSNKK
FT                   GEPGSWWSSSGKYAVICFCDGQN"
FT   gene            complement(<699342..>700532)
FT                   /locus_tag="KLTH0D08316g"
FT                   /old_locus_tag="KLTH-ORF11691"
FT   CDS_pept        complement(699342..700532)
FT                   /locus_tag="KLTH0D08316g"
FT                   /old_locus_tag="KLTH-ORF11691"
FT                   /product="KLTH0D08316p"
FT                   /note="similar to uniprot|P35728 Saccharomyces cerevisiae
FT                   YKL059C MPE1 Essential conserved subunit of CPF (cleavage
FT                   and polyadenylation factor) plays a role in 3' end
FT                   formation of mRNA via the specific cleavage and
FT                   polyadenylation of pre-mRNA contains a putative RNA-
FT                   binding zinc knuckle motif"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22634"
FT                   /db_xref="GOA:C5DGU2"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014891"
FT                   /db_xref="InterPro:IPR025829"
FT                   /db_xref="InterPro:IPR033489"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGU2"
FT                   /protein_id="CAR22634.1"
FT                   /translation="MSSTIFYKFRSQKGTSRILFDGTGITVFDLKREIIQENRLGDGTD
FT                   FQLRLYNPDTGEELEDDSYVIPRSSNVEVRRSPAIKVSGLNGRTSLGNATRYITGKPRV
FT                   MKATSHASPAVSAALNTKGMSEEDAIASMFANQENQWQQTQQEMSSATPIFHKTGAAAG
FT                   QDEGPPPPGYMCYRCGGKDHWIKNCPTNSDPNFEGKRIRRTTGIPKKFLKSVEIDPSTM
FT                   TPEEMAQRKIMVTDDGSFVVQVADQHSWEDYQRKQQSRVMNHADAIWAKDHFANLSEDL
FT                   KCPITGGLLKAPVKTSKCCNKTFSRQALEDLLVEHDFVCPGCGAEETLLDTLVVDEEKE
FT                   KQVEAFLSENSVKRKDADADGRDAKKPKLAMPVPPFGMPFPMFPMPFLPNMNPTKQ"
FT   gene            <700660..>701007
FT                   /locus_tag="KLTH0D08338g"
FT                   /old_locus_tag="KLTH-ORF11689"
FT   CDS_pept        700660..701007
FT                   /locus_tag="KLTH0D08338g"
FT                   /old_locus_tag="KLTH-ORF11689"
FT                   /product="KLTH0D08338p"
FT                   /note="highly similar to uniprot|P32774 Saccharomyces
FT                   cerevisiae YKL058W TOA2 Transcription factor IIA small
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22635"
FT                   /db_xref="GOA:C5DGU3"
FT                   /db_xref="InterPro:IPR003194"
FT                   /db_xref="InterPro:IPR009083"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR015871"
FT                   /db_xref="InterPro:IPR015872"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGU3"
FT                   /protein_id="CAR22635.1"
FT                   /translation="MSASGYYELYRRSTVGATLVDALDTLISDGRIEASLAMRVLDTFD
FT                   RVVAETLKDKTQSKLTFKGHLDTYRFCDDVWTFIIKDCNVKLDQTEDIQGNTVVVDKLR
FT                   IVACNSKKTGE"
FT   gene            <701141..>702229
FT                   /locus_tag="KLTH0D08360g"
FT                   /old_locus_tag="KLTH-ORF11688"
FT   CDS_pept        701141..702229
FT                   /locus_tag="KLTH0D08360g"
FT                   /old_locus_tag="KLTH-ORF11688"
FT                   /product="KLTH0D08360p"
FT                   /note="similar to uniprot|Q04372 Saccharomyces cerevisiae
FT                   YMR028W TAP42 Protein that physically associates with the
FT                   protein phosphatase 2A and the SIT4 protein phosphatase
FT                   catalytic subunits"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22636"
FT                   /db_xref="GOA:C5DGU4"
FT                   /db_xref="InterPro:IPR007304"
FT                   /db_xref="InterPro:IPR038511"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGU4"
FT                   /protein_id="CAR22636.1"
FT                   /translation="MSSVKDVFQQLVSQVDSQIDSSPLRQDSKEFQERLTEIIGAFLEL
FT                   KSTVFSKLALFSDNETLEDLSTASMPLLAIDFYLGKLVSRKQAAQLQDTRDRNVLKLKF
FT                   LRKAVQLYMQFLMSLRNYELLDKATELKLDHLEDADEPKLESLYVQPSSDKDLSGAQLK
FT                   RQQKIEAYQQSKQLEAQIKALELKSSSDSNNDEDLRDLQKYQLIQTAYKALNEIEQNLY
FT                   EIELLSNFITSPPPSKCIKGVTQEDSDSSRTAYTDRVESLNQPLVSKTGKVLRNFTLVN
FT                   KKSQIKDKVFGYGQYAPTMSVEEFLEKELQSGRVLQGGEQDEPQPNEDDEEWQDRETYK
FT                   AREWDAFKEANPKGSGNTLNRG"
FT   gene            complement(<702287..>705355)
FT                   /locus_tag="KLTH0D08382g"
FT                   /old_locus_tag="KLTH-ORF11687"
FT   CDS_pept        complement(702287..705355)
FT                   /locus_tag="KLTH0D08382g"
FT                   /old_locus_tag="KLTH-ORF11687"
FT                   /product="KLTH0D08382p"
FT                   /note="similar to uniprot|P35729 Saccharomyces cerevisiae
FT                   YKL057C NUP120 Subunit of the Nup84p subcomplex of the
FT                   nuclear pore complex (NPC) required for even distribution
FT                   of NPCs around the nuclear envelope involved in
FT                   establishment of a normal nucleocytoplasmic concentration
FT                   gradient of the GTPase Gsp1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22637"
FT                   /db_xref="InterPro:IPR021717"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGU5"
FT                   /protein_id="CAR22637.1"
FT                   /translation="MASVSYFSKVDANLQDFKSEKGNGSVVNLSLNSSSPAVDLRNTFS
FT                   DYSNTIRLLNDEYICYQFSHEYSVLSLYSLSAAIAGKTIVIQLPEHMLNMYHTFTIREI
FT                   DGELVLELILRDGLYLVLYFPLNCILDGAAETPENWFTVLNPYDFTVRRPLYAYSVSAS
FT                   STIIFLEDGGLLGLTKSKNERGEHEVTPVLFNDNSYLQSLTKMFFLRRNPSQNFNVASC
FT                   IVYRDRYLLTLTQNCKLRVWDLKHQTAVFEKDLAVNEKHQNKVYETIGQFMSLYEDKLA
FT                   IFLPFDNGIFQLWDLRLDAQGHIALNPGPTYSSNLSSSSIWSLVDMKLTKPLDSNCFSG
FT                   YMNLVVLWRSNSVTKLQVLNLISEDLQQHQWLEAVNQSLMDLRADLSLLTNGDTDRALM
FT                   NLKSHYTPALYKRAQSTLSESGILLSPESPYNHEYLLNLESVLKDLKKRNDEPSSLTLY
FT                   HGEIIMVNSLSLYSHALYKTNSRLESIFYNLNEEQSSKDDLGDYLRTIEGFASTLSSQV
FT                   LFEVSEAFLDMVTSSFPSEIPIKDKLTEIYTRHLDGNFHMANLRKLFEELSRLDVIKIL
FT                   NIFIDNHLQKEGNEEPLIDSIIPNKLVNVALLESTHQAILVQNNLVLKALLIFAFMDFD
FT                   YSIFQPQIKTLLSLHYKQCLWISLYQLDKDLLASEVFARTSKFGNGYKIKTYSDWSMSS
FT                   TIVLNEIYSMPVSPNPLFIESFDKFVMSGTKSPKLCNSYLRVVQQRFYIHSNVAHEFML
FT                   GLSYFMCGMYDLSFEFLQKHPYPETLPLEFPDRLYMPLQKDGHLWRDVIGSFKLPYKHS
FT                   AYYFNLSKLFSVANSFEYALKCVKKSIKLSSEQREAEEPLNFKKAQLVQYLKTLIVFSN
FT                   YEEILDVLRCSFETLPGDVRAAYYKQILTSLQHREAFFAKLLTLCRDSSGAFLPVDDYK
FT                   ILDEILLEEVSKTSWETYKRLYSFRLINDHDRAAAEILYHYVIHGESVDIKKKCLLLII
FT                   NILSSFNSDGDRWILAGGNPVTLRDVRMELNAL"
FT   gene            complement(<705772..>707580)
FT                   /locus_tag="KLTH0D08404g"
FT                   /old_locus_tag="KLTH-ORF11686"
FT   CDS_pept        complement(705772..707580)
FT                   /locus_tag="KLTH0D08404g"
FT                   /old_locus_tag="KLTH-ORF11686"
FT                   /product="KLTH0D08404p"
FT                   /note="some similarities with uniprot|Q05040 Saccharomyces
FT                   cerevisiae YMR029C FAR8 Protein involved in G1 cell cycle
FT                   arrest in response to pheromone in a pathway different from
FT                   the Far1p-dependent pathway interacts with Far3p Far7p
FT                   Far9p Far10p and Far11p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08404g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22638"
FT                   /db_xref="InterPro:IPR013258"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGU6"
FT                   /protein_id="CAR22638.1"
FT                   /translation="MEGSVGMNPIPTSPMYTLPGVMHYLQTEFTRNERDRIGWELERSE
FT                   MKTRIAQLEGENRTLRYELAKQKSSSDTADQSGLTSDLAIQEPLLLKSKLAVQENVKEI
FT                   IYLLRSPNVTEQLHELGDSADVVHGLEAMNLNLPLNQHQHQQLQRQQQAKSQTQRQSQH
FT                   QRQPPQQDYDNVSTQSIRQAPVESFTPDVGLQARSIGSQSEHVSGVLDGNTSDQNSEVD
FT                   TIVPDDSATTRPRASSLFSSKSGSIAPNHVLRCKRLRYHLAGLEKLIISHHNLLSYARD
FT                   GLMKHWLIEPNLNCNDKLTKSFHGLAPIVLGLYWLDNQTFFTVDNFGLKVWLTTESAPH
FT                   LSLDVFGGSSDVSFSDIGSIDFKNGWLVLTCLDVVHIWEVVVTGKAINIGSRHKVEGTG
FT                   KVVDSILGMTEKSLILFKEDPYELVIYTFGGDILQRISLQEAVSKQTDSADTSNDGCKK
FT                   LLLNKQSSKLLIQLGRFVAVYSFDRKKIVLSKQLTMTPTSAIFRSPKDYVIFAYDDGLI
FT                   EMRNINNFQDVVKTYNHYDEEAEYEDEDDTKANASNTTEKEVMSEVRQTTSKGVIIDMT
FT                   EIDSAAVIVSGGDDGIIRLERMEECG"
FT   gene            complement(<707761..>708264)
FT                   /locus_tag="KLTH0D08426g"
FT                   /old_locus_tag="KLTH-ORF11682"
FT   CDS_pept        complement(707761..708264)
FT                   /locus_tag="KLTH0D08426g"
FT                   /old_locus_tag="KLTH-ORF11682"
FT                   /product="KLTH0D08426p"
FT                   /note="highly similar to uniprot|P35691 Saccharomyces
FT                   cerevisiae YKL056C RBF18 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22639"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR011323"
FT                   /db_xref="InterPro:IPR018103"
FT                   /db_xref="InterPro:IPR018105"
FT                   /db_xref="InterPro:IPR034737"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGU7"
FT                   /protein_id="CAR22639.1"
FT                   /translation="MIIYKDIISGDELLSDAYDVKLVDGVIYEADCDMVKVGGDNIDIG
FT                   ANPSTEGGDDDVEDGSEVVNNVVHSFRLQQTAFDKKSFLTYIKGYMKSIKNKLQETNPD
FT                   EVATFEKGAMVYVKKVVGSFKDWEFFTGESMDPDGMLVLLNYREDGTTPFVAIWKHGVS
FT                   EEKI"
FT   gene            complement(<708475..>709272)
FT                   /locus_tag="KLTH0D08448g"
FT                   /old_locus_tag="KLTH-ORF11681"
FT   CDS_pept        complement(708475..709272)
FT                   /locus_tag="KLTH0D08448g"
FT                   /old_locus_tag="KLTH-ORF11681"
FT                   /product="KLTH0D08448p"
FT                   /note="similar to uniprot|P35731 Saccharomyces cerevisiae
FT                   YKL055C OAR1 Mitochondrial 3-oxoacyl-[acyl- carrier-
FT                   protein] reductase may comprise a type II mitochondrial
FT                   fatty acid synthase along with Mct1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22640"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGU8"
FT                   /protein_id="CAR22640.1"
FT                   /translation="MPRTPVALITGATRGIGRAIVDKLSAEGLSCLMVGSRKESFGPMT
FT                   ADLPVICRELQWHRGLVVDLAQWPQWTQQGRFDGFHFSSVPGARAYRCSDGAWPLLDLP
FT                   PSSELALLVNCAGVTQASPALRCDASEIQRITNINYLSAVSLCNMAAKRMLRSRKHLSR
FT                   PPCIVNISSILGDPATSALPGTALYSASKAALAQFSRTLSAELARAGIRVHCLSPSLVA
FT                   QTDMVQTLEEDAKVRLESTFSQFPAQSPQQIASQVWKLYDSDT"
FT   gene            complement(<709655..>711856)
FT                   /locus_tag="KLTH0D08470g"
FT                   /old_locus_tag="KLTH-ORF11678"
FT   CDS_pept        complement(709655..711856)
FT                   /locus_tag="KLTH0D08470g"
FT                   /old_locus_tag="KLTH-ORF11678"
FT                   /product="KLTH0D08470p"
FT                   /note="some similarities with uniprot|P35732 Saccharomyces
FT                   cerevisiae YKL054C DEF1 RNAPII degradation factor forms a
FT                   complex with Rad26p in chromatin enables ubiquitination and
FT                   proteolysis of RNAPII"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22641"
FT                   /db_xref="GOA:C5DGU9"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR041803"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGU9"
FT                   /protein_id="CAR22641.1"
FT                   /translation="MSTQSRKSNSSKQPHSTHKKLDPELKFKLETLTELFPDWTNDDLI
FT                   DLVQEYEDLETIIDKITSGAATKWDEVKKPSKKERQREQQQQQQQQQQAQLAAQQATQP
FT                   SSQSHHNNHTHISPSHDGDHSHSAQTSHNHHQSKSSKFSSRERDSSSRSHKKSSNNAAA
FT                   SGPNGSGNARRERASGASRVPATSAASAASANASAVQPDHLKTAVSAAKTASSTSWAAM
FT                   ASDKKAAKQSAQAKKAEEQQQEQQSPQQAQHESTAPSPQQEAEPQSQSQSKSQPQSDNK
FT                   SAESVSSTSTPATEDLEKPKKMTWAAIVKPKTKPSVKKSEPLEELEDLKREAAQISTEE
FT                   PEAAEKVIEQVIEQVEQTPEEVVEQVEVTVVPEEVSQESEEASAQQEETAEPAAPVVPA
FT                   EPEAASSEEKAAPAQPEQGTYSPVAQQQQPQQQQQPQQQQQAQQQQQQPTAYSEDKQSQ
FT                   AQQAQSQQAQSFYQAQPQQYGSQTPQQTPQTLQQQNAAAAAAAAQQQYYMYQNQFPGYS
FT                   YPGMFDSQSYPAGYGQQYAPQSQNGSQPQTASTQQSQSGQYGVPPGYASTGRDLGAASP
FT                   MAAQVQLQQQQQQQPYGGSFMPYYHFYQQSFPYGQPQYGMAGQYPYQVPKAYNYMNQYQ
FT                   PQQGGQTPSSQSQQGEEAQQSAQQGQATASQGQAQGSGSQGQAQTNAQQQAQLQQYYQF
FT                   QQQQQQQQAAAAAAAAQQGGVPYGYSGYDFSSQATRGFY"
FT   gene            complement(<712735..>713001)
FT                   /locus_tag="KLTH0D08492g"
FT                   /old_locus_tag="Klth0D.mRNA.gf.386.m"
FT   CDS_pept        complement(712735..713001)
FT                   /locus_tag="KLTH0D08492g"
FT                   /old_locus_tag="Klth0D.mRNA.gf.386.m"
FT                   /product="KLTH0D08492p"
FT                   /note="highly similar to uniprot|O60200 Saccharomyces
FT                   cerevisiae YKL053C-A MDM35 Mitochondrial Distribution and
FT                   Morphology"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22642"
FT                   /db_xref="InterPro:IPR007918"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGV0"
FT                   /protein_id="CAR22642.1"
FT                   /translation="MGNAMSASFAPECTDLKQEYDNCFNQWYSEKFLKGLSMENECSKQ
FT                   WYAYTTCVEAALVKQGIKPALDEARKEAPFEKGGESADSDASK"
FT   gene            complement(<713189..>713944)
FT                   /locus_tag="KLTH0D08514g"
FT                   /old_locus_tag="KLTH-ORF11669"
FT   CDS_pept        complement(713189..713944)
FT                   /locus_tag="KLTH0D08514g"
FT                   /old_locus_tag="KLTH-ORF11669"
FT                   /product="KLTH0D08514p"
FT                   /note="weakly similar to uniprot|P35734 Saccharomyces
FT                   cerevisiae YKL052C ASK1 Component of the DASH complex that
FT                   binds to microtubules and kinetochores and is essential for
FT                   chromosome segregation phosphorylated during the cell cycle
FT                   by cyclin-dependent kinases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22643"
FT                   /db_xref="GOA:C5DGV1"
FT                   /db_xref="InterPro:IPR013964"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGV1"
FT                   /protein_id="CAR22643.1"
FT                   /translation="MAEESLERLDQEITLHLQQIDSNLSYCFSKITQDVIPHVTKYGAV
FT                   CDKAMDSSNWLKVMFQHAGNLQIDSVTGPQQQQQQQAPEAAENGSLQTLFPEKSRLSPA
FT                   SSSILAPPTAAPHQRPAAGLPVPDLNVTTTTTGKVLQLPDSSDDELGDAADRDPTDRST
FT                   TAHSRNDPDGSTLQRQRRKRKLSLLLQQQFGSSSSSVAPSPAQIKRRASSTIDSSPMRK
FT                   DLASHADSTKQQGVQPGTVIYFPTRDETS"
FT   gene            <714887..>715843
FT                   /locus_tag="KLTH0D08536g"
FT                   /old_locus_tag="KLTH-ORF11660"
FT   CDS_pept        714887..715843
FT                   /locus_tag="KLTH0D08536g"
FT                   /old_locus_tag="KLTH-ORF11660"
FT                   /product="KLTH0D08536p"
FT                   /note="similar to uniprot|P35735 Saccharomyces cerevisiae
FT                   YKL051W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22644"
FT                   /db_xref="GOA:C5DGV2"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGV2"
FT                   /protein_id="CAR22644.1"
FT                   /translation="MSLFKKPGNWFFIVPWVAFIPWWGMLVAMLACWAGQGHPIYWFMH
FT                   TSQFPVYISDIGATNLRPLFISCAGWQGLGYCVSLACEYFQRSGRWPFQRRALSHESVA
FT                   DRGSTSASQDSIKSSYGDMLRSARFLMPPYYTRHERNCIFASFVLGAMGEVCLLMCSIF
FT                   STAHYHRVHITMVGLFCAFMFLSVCCNVAEYFMMGRHYAQLHPLASPEDKLQETSWNHW
FT                   VGYKFNKYTISAIAKVVWLASALAWAIAFGAIDDGSKSACFEWLLAFWFGLLFIIISVD
FT                   FYLGGRYKYSKYFHQVTSFQGYYKYDRLLPTPRYDTL"
FT   gene            complement(<715949..>718741)
FT                   /locus_tag="KLTH0D08558g"
FT                   /old_locus_tag="KLTH-ORF11656"
FT   CDS_pept        complement(715949..718741)
FT                   /locus_tag="KLTH0D08558g"
FT                   /old_locus_tag="KLTH-ORF11656"
FT                   /product="KLTH0D08558p"
FT                   /note="similar to uniprot|Q05050 Saccharomyces cerevisiae
FT                   YMR031C Protein of unknown function green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm in
FT                   a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08558g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22645"
FT                   /db_xref="GOA:C5DGV3"
FT                   /db_xref="InterPro:IPR024527"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGV3"
FT                   /protein_id="CAR22645.1"
FT                   /translation="MSLISAAADVNDASSTTSAGSVRSSAVYRKDGKPLSQEALYRAQQ
FT                   KYGVFQSPARQTGSGLKDSKMASDVAANLANNNRTTIEAYKRVLDSNASRAATAVSSRS
FT                   RSSSVTSNATVVTTSSKSTNAAVKALSSKPVEQPVAPKKSNMNMSKILVGAEAAAEKRI
FT                   GIRMKPEKIVYVPSKESGKAAERSMSLTPEIMDKLKTKGDYEAEAEVEADPKKYASKAA
FT                   FAVRDFDPNEATEKELLEREKKKQAYFGMLTSPQVLSLARANAQVKLDQIDKAAPGSLY
FT                   KNEEFNKLAVALAQKNSTKRSEHHGKINMGGGLWLTQADVQNIAQGLITPVLDEVDSRA
FT                   LQQRAIDEDIKQRKIDFKEQNAAWIELQRNKLSNDKMYSRETRMRHKRETEGLHARTER
FT                   KFQDLCASKDSEVAEMEKALQNAKDSYAALQKQMEEDLEKERLRVEAEVAALKKEQEED
FT                   LKAARVEQEQELKPYVDDVKAAEAEHERLTAERDSLNKEIEELRASIESHKVRIEELDN
FT                   EISDSAAKHEEEEGKREELTKHKEEFDQEVSEKFTVIAQAAKEKAQKSSEEARLKQLEV
FT                   DAMINERQSELNSTELELKKEKLSLLEAMRNVTELKGEDKLDENRVKALIGMTSEEFIA
FT                   ENNKSVNVSDDKFEPFNEHTASTKSIKHEEGVLGEGGAKTNSDELPVKDSAEKSSEHLN
FT                   STAEKSIEPAKASSPYPAKPSMVDAVLPKDFKPEVKPKAKPAHKTPQQGAAAGGEPASA
FT                   KSGVKRSPSLKQKFMGIIKGDTKSQSKPAAAATPVHPPATVKKAAPKKAAASSEADTPA
FT                   KVSPAKDTAKTEIQKIAQGGPAPAPEPEHKTAPAVDNATTKSVSTLQKPTNSGIDKSEI
FT                   HKIAQGGPAPTSGHSNHTRTSVYENGDNSDDEDELPDSSEAGENGIGADKKGSLFKEVF
FT                   "
FT   gene            <719409..>721211
FT                   /locus_tag="KLTH0D08580g"
FT                   /old_locus_tag="KLTH-ORF11648"
FT   CDS_pept        719409..721211
FT                   /locus_tag="KLTH0D08580g"
FT                   /old_locus_tag="KLTH-ORF11648"
FT                   /product="KLTH0D08580p"
FT                   /note="similar to uniprot|Q05080 Saccharomyces cerevisiae
FT                   YMR032W HOF1 Bud neck-localized SH3 domain- containing
FT                   protein required for cytokinesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22646"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGV4"
FT                   /protein_id="CAR22646.1"
FT                   /translation="MSHSYNYQLSFWDEQDTGTRILLEHVSQGLESCEGLIDFFEERSK
FT                   LEKDYARRLSAITAKFNSNIQSQPDYGKLGLSVKSLHSSQERLSQSHSKQAVAIYRDGF
FT                   SELKLFVQDLQARYKTISLKTRNLCNDKITKKQLCDVLQGKLEKASTELRDCQLNQDNY
FT                   LGKRDSSQNDRHIQKWRSIVDELQMKLDVLKQEYKNSTKHWLHEWSRLSLELQELERSR
FT                   IQFIKVKLQEFSKQCSDAAVEEQISMDNLTQQLTKFTADQDISSFAYNHGTGRIRGNFV
FT                   HAASADSPRTSSTSSKHVQNVRQLSSQLQRSRLSGYYEEQAADVPHPEVEKQKPEPTKL
FT                   DRLEPPETAAEVYTSSESSNESSNPTEFTSNVRHRASVESMSTSISSLAHSIGDSQRFA
FT                   KSWNSQNRRKSKTRSQLLESSQSSNLNEGSRTSSMETTRFHASSGPRTTQRRKSMVASD
FT                   SSSNPFKEALEAMKRGSSGYDDVEDERPSNSTSSQKKHLIPFQHSRSSTNETCTKRVMD
FT                   KDHYVELPLFSSKGEEVLRYAKALYTFMEPNEQQIVNFHVGDYLLLTEQLDQDWFIGEV
FT                   LDSQNVDPEYRYGIIPRNYIEILP"
FT   gene            complement(<721268..>721804)
FT                   /locus_tag="KLTH0D08602g"
FT                   /old_locus_tag="KLTH-ORF11645"
FT   CDS_pept        complement(721268..721804)
FT                   /locus_tag="KLTH0D08602g"
FT                   /old_locus_tag="KLTH-ORF11645"
FT                   /product="KLTH0D08602p"
FT                   /note="highly similar to uniprot|P36012 Saccharomyces
FT                   cerevisiae YKL049C CSE4 Centromere protein that resembles
FT                   histones required for proper kinetochore function homolog
FT                   of human CENP-A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22647"
FT                   /db_xref="GOA:C5DGV5"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGV5"
FT                   /protein_id="CAR22647.1"
FT                   /translation="MNASIASQTGGRSLSNTNRLSRDINERAISLLQKNRQHRELLQRR
FT                   GEDRRRYVPSEEPSQIDISAPAVTQIRRRKASTKRYRPSDTALQEIRKYQRSTDLLISK
FT                   MPFARLVKEVTDQFTTEEQQLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIM
FT                   RKDMQLARRIRGQFI"
FT   gene            <722066..>723364
FT                   /locus_tag="KLTH0D08624g"
FT                   /old_locus_tag="KLTH-ORF11644"
FT   CDS_pept        722066..723364
FT                   /locus_tag="KLTH0D08624g"
FT                   /old_locus_tag="KLTH-ORF11644"
FT                   /product="KLTH0D08624p"
FT                   /note="similar to uniprot|Q05123 Saccharomyces cerevisiae
FT                   YMR033W ARP9 Actin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22648"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGV6"
FT                   /protein_id="CAR22648.1"
FT                   /translation="MREETFYPPQLEIPTVVYKTPEGLYTSKSDSGNVKVNPLVDGQIV
FT                   DLDGFLFFVKLIYKSYLAQRSRNGASPEVFDMELSNIPMLMLSHSSWTHHQLETIAQFV
FT                   FEQLQINNFMFLPSALASSYALGSLQNCVVIDIHTNGTDVIPILDYIQLGHLAVKVEHG
FT                   GSQIDQELAKLLPQWTPEQIEDLKKSSIFEVLSEDAKKSSSLNFKHGEDEGALDVAALV
FT                   TSDRDTREILEEREKNKDKHNVENSEQENNVFVDRHGKQIIVGKQRFKGCESLVAEISK
FT                   TVGRVLSQIDDFHKLRAMWENILVVGGTTSISGFKEALLQKLVEDHLIGEPAHEKDIRE
FT                   REHSAQNSVKKKAKIANSFLNSVDYVQIPTAISLAKYPEYFPEWKKHGYAEVPFLGAQI
FT                   VAKQAFGHTNESFYVTREKYEKKGPSIVWDVAF"
FT   gene            complement(<723457..>724752)
FT                   /locus_tag="KLTH0D08646g"
FT                   /old_locus_tag="KLTH-ORF11641"
FT   CDS_pept        complement(723457..724752)
FT                   /locus_tag="KLTH0D08646g"
FT                   /old_locus_tag="KLTH-ORF11641"
FT                   /product="KLTH0D08646p"
FT                   /note="similar to uniprot|Q05131 Saccharomyces cerevisiae
FT                   YMR034C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22649"
FT                   /db_xref="GOA:C5DGV7"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGV7"
FT                   /protein_id="CAR22649.1"
FT                   /translation="MREALKTRLALFKILYTNRVTQFLISQWFFITLAVFIVLAHFFPN
FT                   FARHGGTIRAEYTIGYGAVAAIFLQSGLSMKTQKLCYNLGNWRAHLSVLTISFLVTSSI
FT                   MFGLCSGIKKANDPAIDDWVLMGLIVTATCPTTVASNVVMTKKAGGNDLLCLCEVFIGN
FT                   VLGAFVTPALVQMFTSSSLFAFGNPASGSSVSHLYADVMKQIGLSVFVPLFVGQVLQNI
FT                   FPEQVSWCLSTFKLGKVGSFCLLLIMWSSFSTAFHQRAFESVSHACIIFVVFFNIAIYL
FT                   FFTGICYLWARPWFLPLLFPTEPTQDSSKAYKTFYKILSPFYCTKKNAIAVMFCGAAKT
FT                   AALGVSLVTSQYGSDSPHLGKLLVPLVLYQSEQVITANFLVSFFKKWAADENNAVIETA
FT                   QASNDIESGATSSAKKSCNIDRETLASSSAMK"
FT   gene            <725208..>725738
FT                   /locus_tag="KLTH0D08668g"
FT                   /old_locus_tag="KLTH-ORF11640"
FT   CDS_pept        725208..725738
FT                   /locus_tag="KLTH0D08668g"
FT                   /old_locus_tag="KLTH-ORF11640"
FT                   /product="KLTH0D08668p"
FT                   /note="similar to uniprot|P46972 Saccharomyces cerevisiae
FT                   YMR035W IMP2 mitochondrial peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08668g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22650"
FT                   /db_xref="GOA:C5DGV8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR037730"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGV8"
FT                   /protein_id="CAR22650.1"
FT                   /translation="MSFIKSSGRFANSLLIGITWIPVALAFNENVCYIAKIQGSSMMPT
FT                   LNPSKTEPTDWVLLWKWGMKNVNNIKHNDVVLIKAPSNPRKVFCKRVKGKEFDSVQTRY
FT                   PYPREIAHIPRSHIWVEGDNAFHSIDSNNFGPVSTGLVLGKAIAVIWPPSRWNTDLNTS
FT                   LGREDIRVNGFGF"
FT   gene            complement(<725899..>727617)
FT                   /locus_tag="KLTH0D08690g"
FT                   /old_locus_tag="KLTH-ORF11639"
FT   CDS_pept        complement(725899..727617)
FT                   /locus_tag="KLTH0D08690g"
FT                   /old_locus_tag="KLTH-ORF11639"
FT                   /product="KLTH0D08690p"
FT                   /note="some similarities with uniprot|P23748 Saccharomyces
FT                   cerevisiae YMR036C MIH1 Protein tyrosine phosphatase
FT                   involved in cell cycle control regulates the
FT                   phosphorylation state of Cdc28p homolog of S. pombe cdc25"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22651"
FT                   /db_xref="GOA:C5DGV9"
FT                   /db_xref="InterPro:IPR000751"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGV9"
FT                   /protein_id="CAR22651.1"
FT                   /translation="MSDPKIFVRKAKRTTLQEGGNFLKNINLLVGINRRKSGKSRAARG
FT                   GDAPGLNHPQSNLQQNETEKTTFAADSVFGAQVLHISSENSSTSCEEDDEEKGEGEGES
FT                   CNSPVVRQPFFPILDSPSEDVFEHSMRLKPQRAPAPFLARIGNERANSASLAAIKNSDG
FT                   FNLRSRPLKRQPSGVKKEHATSQVAKGQLRRIHSMYASQKEVSKGLEVPKMRSLEEPEA
FT                   ECDIECPAYESKLERSGIPHYFDNKTDDNLPRISVETLVNIMDGDVKKQYDTVHIVDCR
FT                   FEYEYQGGHIGDAINISSQTSLESVFIHNRKNYCKSHLPSLVIFHCEFSSYRGPIMASH
FT                   LRNCDRMLNYDNYPKLHYPDILIVEGGYKSFFEKYSHRCFPRRYIEMGSQDHIDKCESE
FT                   MEKFRRNSKRVATKSNSLHSLNKGNVTSRASTPFRSEFASRNQSCFSDYKKHDRPGLSH
FT                   YTTKSNLSFRYEAPPKLTLSQFSMNSGSGSPSSVSSSAASSRALLLDELQDDLESSDFD
FT                   NISFEENEHPHTYCGGTDPVLALNSPKASLLSSIFQEEEVDSRYPSKQLANATTK"
FT   gene            complement(<728072..>729886)
FT                   /locus_tag="KLTH0D08712g"
FT                   /old_locus_tag="KLTH-ORF11637"
FT   CDS_pept        complement(728072..729886)
FT                   /locus_tag="KLTH0D08712g"
FT                   /old_locus_tag="KLTH-ORF11637"
FT                   /product="KLTH0D08712p"
FT                   /note="similar to uniprot|P32801 Saccharomyces cerevisiae
FT                   YKL048C ELM1 Serine/threonine protein kinase that regulates
FT                   cellular morphogenesis septin behavior and cytokinesis
FT                   required for the regulation of other kinases forms part of
FT                   the bud neck ring"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22652"
FT                   /db_xref="GOA:C5DGW0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGW0"
FT                   /protein_id="CAR22652.1"
FT                   /translation="MNEFEVEVSKSSNTQLPTLIDSKGYAEGGDQVLAQSGFTDKYAVS
FT                   YHQIIEQERALLDKRLRPVVKNTVHSDSKRKVGEYTLVRRIGKGQFGDVYMANTADGGY
FT                   VAIKCVPKRPRKSQQYSMNQVLRQIRRQQSQGRRSLSSDEAILEMNVNKIRWEIFVASG
FT                   FNHKNILGVIECLDSRDSKDIWIVLPFASLGELKWKRSSKPETLEQWDLTLRHKTSVTE
FT                   FSEYVLRSLTAGLLYLWDQGCIHRDIKPSNILIDGSTGNIVLSDFGSSLLSPKKLLLEE
FT                   PAMQKAYSEEVKKIVGTPAFIAPELCNFEENDSSLDGFKIDLWSLGVTIFCLLENRLPF
FT                   WGENEFDTFQKIANNELPLSGDWLHDLVVSKLLRKDPTHRLSIKQLDSLLRNPKKESGM
FT                   KKLVSRLRKISMKKKKGAKVPEASAGKAAIAVPSNVETSDVEFSDIESNISSAASLSDE
FT                   PVQVPGFMDCRPPTDNGSPSVTASELSSRATPLELSPQQPSPLPVTPKHTTHDTSPSPI
FT                   KIDTPLKNLIRAENTPEKAPSLSPMPVIKPQAQVSQQASRLASKGTLDFTKYLQSPSKV
FT                   PKDCAPVGSTKASNSIEDIKRYLNFAES"
FT   gene            complement(<730214..>732247)
FT                   /locus_tag="KLTH0D08734g"
FT                   /old_locus_tag="KLTH-ORF11634"
FT   CDS_pept        complement(730214..732247)
FT                   /locus_tag="KLTH0D08734g"
FT                   /old_locus_tag="KLTH-ORF11634"
FT                   /product="KLTH0D08734p"
FT                   /note="similar to uniprot|P33749 Saccharomyces cerevisiae
FT                   YKL062W MSN4 Transcriptional activator related to Msn2p
FT                   activated in stress conditions which results in
FT                   translocation from the cytoplasm to the nucleus binds DNA
FT                   at stress response elements of responsive genes inducing
FT                   gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22653"
FT                   /db_xref="GOA:C5DGW1"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGW1"
FT                   /protein_id="CAR22653.1"
FT                   /translation="MSPLEPASARVTCHTALIKHSSSGLSHTPNTANPGRAPLHTRTTP
FT                   FTQQHLHLDRAQTAGLQHAPMTAHQQQQYASQEELHTYSSNSLDIRNGFAARERGTPSA
FT                   EPARPLHKQPSPTAVGELLALLDDQGTLVAAATPPHLDSRGFLTGEQMNEPAVELISEP
FT                   GHALTGLPTEQISSSRPGPHAGPRTSLPTQVHTAEHERPSSGSRSRSSASARDSATILF
FT                   DEALAALSPPEELQHLHTPQHLQPEQPCIDPNLLSNSNSYVDSGLQLDDSNVLEAFADQ
FT                   DESHSVLDEFTFSRRPSEPASRAFAPDLPARGSISYATDFWNLPSSGSKSGSERPAERL
FT                   AGDSRLPASSGFRPTHKPHRSFAGVLPSSLGAARPPSVGVRSESLKPSGTSTSPFKIEN
FT                   ELTQLLSDYNLSYSHQKATKFRTGSFNALTISRKSSLSEPQHRVQKQRASTSLVDGNNH
FT                   DLISKLYDDMATPRPRLTNLSWENAIMSDDEEDEEDELAQPLKALGNSHADGAAGYNFN
FT                   SNDILQQLESEAEPSNSKFIPPNLLVNDSNQAADNNAIDMTNLSSGSAGSNTLNPLQLS
FT                   LTASTSPSSYNSNSNAKQRKATSFSKPSRNSKSSSPIEEDEKPFKCQECTKAFRRSEHL
FT                   KRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF"
FT   gene            <733064..>733627
FT                   /locus_tag="KLTH0D08756g"
FT                   /old_locus_tag="KLTH-ORF11625"
FT   CDS_pept        733064..733627
FT                   /locus_tag="KLTH0D08756g"
FT                   /old_locus_tag="KLTH-ORF11625"
FT                   /product="KLTH0D08756p"
FT                   /note="similar to uniprot|P35725 Saccharomyces cerevisiae
FT                   YKL063C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22654"
FT                   /db_xref="GOA:C5DGW2"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGW2"
FT                   /protein_id="CAR22654.1"
FT                   /translation="MQGGVRRKNDLLPRYRGQAHSKKQSFLTTPMKKVAVYVMLLIMMY
FT                   LAIKTVFVDPQNAETKLEIESAVGRAGAGGDALEAQMDAADLQTNPKVSKERFNNEVVM
FT                   QQETKNLENEKDFQKQKVPTKNTKQEVGNDVKAVKPQFENKEQPPVDEQARRINEKAPY
FT                   KKTDKKSDKAVAEGGAAAAAANAL"
FT   gene            complement(<733758..>734492)
FT                   /locus_tag="KLTH0D08778g"
FT                   /old_locus_tag="KLTH-ORF11622"
FT   CDS_pept        complement(733758..734492)
FT                   /locus_tag="KLTH0D08778g"
FT                   /old_locus_tag="KLTH-ORF11622"
FT                   /product="KLTH0D08778p"
FT                   /note="similar to uniprot|P40202 Saccharomyces cerevisiae
FT                   YMR038C CCS1 Copper chaperone for superoxide dismutase
FT                   Sod1p involved in oxidative stress protection Met-X-Cys-X2-
FT                   Cys motif within the N-terminal portion is involved in
FT                   insertion of copper into Sod1p under conditions of copper
FT                   deprivation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22655"
FT                   /db_xref="GOA:C5DGW3"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGW3"
FT                   /protein_id="CAR22655.1"
FT                   /translation="MTSPTSEDSFEATYAVDMHCNGCVEDIKSCLAGIPNLSLDFHVPK
FT                   KLLAVKGTAAPSVIISTLQKCGRDAIIRGTGKPNSAAVSILETFEPVADSDTPVRGLAR
FT                   IVGVSDTKTWVDITLNGLPQPGKYYASVRECGDISKGAQSTGGPVYKFDEPIDCSSPSD
FT                   LGKNLYSGQAFLSAPLRVWELVGRSFMVTSDPQHRAGHGYEICGVLARSAGVWENDKQV
FT                   CACSGKSVWQERKDALEHNIQH"
FT   gene            complement(<734724..>737456)
FT                   /locus_tag="KLTH0D08800g"
FT                   /old_locus_tag="KLTH-ORF11619"
FT   CDS_pept        complement(734724..737456)
FT                   /locus_tag="KLTH0D08800g"
FT                   /old_locus_tag="KLTH-ORF11619"
FT                   /product="KLTH0D08800p"
FT                   /note="similar to uniprot|P35724 Saccharomyces cerevisiae
FT                   YKL064W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22656"
FT                   /db_xref="GOA:C5DGW4"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGW4"
FT                   /protein_id="CAR22656.1"
FT                   /translation="MSDPRELESAPLLGQSKARKAKSKKSGSKKRKRKSAFKGSAASAV
FT                   VEPQNLHVEDSKHHEFNSNDFDKTDSWGILHEGSEEDSGAATRNTSSSDVALASHFPHS
FT                   YFDHRPSIAVMEAINSSGTLKRGRRPSTARAHGSGTGAQVTKGMLPQMSPRDAERWARC
FT                   AKDSHAQGASVARSQGSDVVIDVDELMNHVTRNNHLSQSSAQSPSTLSPRHSSGGYNSQ
FT                   PSSRRTSNSSSLKDVCLPMDDEDSEGPKLWPDISVLEEYSKEETERLRRQAVEDAENFH
FT                   FQYDDEEDYEDNNNNDGVLFSKPIVTNIDVPELGNTRINEAEHMKTGRLRPKKITPWHL
FT                   RRKGSIIPGFSGQTDAKNVKLVSQTSRKGQDDFLVGSNIQYPPHIVSNNPEHFRFTYFR
FT                   EDLDSTIHSPTISGLLQPGQKFEELFVSSIYAGSNHEATPSETKSSTPVQQTPLQRLST
FT                   RQSGSIEIDDVPPFWLDVSNPSEEEMKVLSKAFGIHPLTTEDIFLGEVREKVELFKDYY
FT                   LVCFRSFDIVAERHTRKKKQQQDSSSSINDHENTKKWLPKFLRSRRRSSTNKTVSSSDP
FT                   SYRSKVRKEIEENEKYKRKSGDRRRPRGGELEPLNVYIIVFRTGVLTFHFAPTPHPINV
FT                   RRRARLLKDYLNVTADWIAYALIDDITDAFAPMIEIIEDEVHDIEEYILKMNQSDDSSS
FT                   DDDSSDEETFERGYSSIDRYPKRGSVVNENASLSSLSRSSRSSTSTFDANIIGWKRKGD
FT                   MLRRIGECRKRVMSIIRLLGSKADVIKGFAKRCNEHWEVAPRSEIGMYLGDIQDHIVTM
FT                   VSSLNHYEKLLSRSHSNYLAQINIDMTKVNNDMNDVLGKITILGTVVLPMNIITGLWGM
FT                   NVLVPGQNTDSLTWFTCITTSMLVFAYIAYVYTKRRFGF"
FT   gene            complement(<737718..>738518)
FT                   /locus_tag="KLTH0D08822g"
FT                   /old_locus_tag="KLTH-ORF11612"
FT   CDS_pept        complement(737718..738518)
FT                   /locus_tag="KLTH0D08822g"
FT                   /old_locus_tag="KLTH-ORF11612"
FT                   /product="KLTH0D08822p"
FT                   /note="some similarities with uniprot|P54000 Saccharomyces
FT                   cerevisiae YMR039C SUB1 Suppressor of TFIIB mutations
FT                   transcriptional coactivator"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22657"
FT                   /db_xref="GOA:C5DGW5"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR009044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGW5"
FT                   /protein_id="CAR22657.1"
FT                   /translation="MSYYNRYRGQRKFAGNGETGAAIDEPDAIFELGNNKRVTVRQFRN
FT                   INLIDIREYYADSASGEMKPGKKGISLTEELYDELLKHRQNIDDALRRFGSKRPRTKTV
FT                   NVLSDSEDEPQSMRVAPPQRSKPTRSEQSKPARRDRRTAAPAPPQSQPDEKRRKRDARE
FT                   AGARLVMPGGQPSNPRLDDLHTSRTNVSNPRLDDLHTPPASASNPRLDDHLPRLPSVPK
FT                   PDNDSDLDSSDEDFALALESEFQRDENSARANDHEDEGEISEES"
FT   gene            <738727..>739749
FT                   /locus_tag="KLTH0D08844g"
FT                   /old_locus_tag="KLTH-ORF11606"
FT   CDS_pept        738727..739749
FT                   /locus_tag="KLTH0D08844g"
FT                   /old_locus_tag="KLTH-ORF11606"
FT                   /product="KLTH0D08844p"
FT                   /note="similar to uniprot|Q04212 Saccharomyces cerevisiae
FT                   YMR041C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22658"
FT                   /db_xref="GOA:C5DGW6"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGW6"
FT                   /protein_id="CAR22658.1"
FT                   /translation="MDSLKPIGPTQGLVRGLGVENLPKLILGGATLNTQYNDDPASLPV
FT                   VDMIRFAMQFGVRAIDTSPYYGDSEVLYGAALESLKEELPRENYFICTKVGRIRLEEFD
FT                   YSRSHIHFSVLRSCERLKTKYLDVVFLHDVEFVETEQVLEALQELRKLRDEGVILNFGI
FT                   SGYPVDFLLNIALKCKTHPQIGALDVVLSYANLNLQNRTLHEYAPRFREEAGVKVVENG
FT                   SILSMSLLRSQETKAFHPCSAELRKLSNEAAQYAASQGEDLASLATRYAFSEWADKGPT
FT                   VLGVSSVAELRVALESYTIVADNQGKLSEKDARLANEIQSQIFGAHMNETWSSGIDHEE
FT                   "
FT   gene            complement(<739836..>740459)
FT                   /locus_tag="KLTH0D08866g"
FT                   /old_locus_tag="KLTH-ORF11604"
FT   CDS_pept        complement(739836..740459)
FT                   /locus_tag="KLTH0D08866g"
FT                   /old_locus_tag="KLTH-ORF11604"
FT                   /product="KLTH0D08866p"
FT                   /note="similar to uniprot|P35723 Saccharomyces cerevisiae
FT                   YKL065C YET1 Endoplasmic reticulum transmembrane protein
FT                   homolog of human BAP31 protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22659"
FT                   /db_xref="GOA:C5DGW7"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="InterPro:IPR040463"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGW7"
FT                   /protein_id="CAR22659.1"
FT                   /translation="MSVYLSVLFGALTLEMACLFVLVLPLHYKIRKGLVSTYDRFMSYT
FT                   QVKTVIWITAGLVGLLFVDSWKRAQVSVFLHHHQGVGGPSANPDGAGAITPVQALASRA
FT                   YNQRNTYISGFILYFCFCIPTVISVVRRLVKYETLLRDKDSQHEGQNEAETKAEAEVAK
FT                   LKKELSEKKASIKALAKQKANLEAHFDSSAEAQKNADPKLKKDN"
FT   gene            complement(<740937..>741051)
FT                   /locus_tag="KLTH0D08888r"
FT                   /old_locus_tag="Klth0D.tLeu.CAA.21"
FT   tRNA            complement(join(740937..740980,741014..741051))
FT                   /locus_tag="KLTH0D08888r"
FT                   /old_locus_tag="Klth0D.tLeu.CAA.21"
FT                   /note="tRNA-Leu (CAA) cove"
FT   gene            <741531..>742505
FT                   /locus_tag="KLTH0D08910g"
FT                   /old_locus_tag="KLTH-ORF11600"
FT   CDS_pept        741531..742505
FT                   /locus_tag="KLTH0D08910g"
FT                   /old_locus_tag="KLTH-ORF11600"
FT                   /product="KLTH0D08910p"
FT                   /note="some similarities with uniprot|P50947 Saccharomyces
FT                   cerevisiae YNL097C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08910g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22660"
FT                   /db_xref="GOA:C5DGW8"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR024610"
FT                   /db_xref="InterPro:IPR028651"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGW8"
FT                   /protein_id="CAR22660.1"
FT                   /translation="MAAPANLYPGLNDISDVLEEMPLEVTRYLTLLREIDAKCVHTVPE
FT                   LNSTIGEFLGARGSKNDGVEPLARMNGLFQDLMPSLEEKMHVSALAYEALNRLTARLEL
FT                   AYEVAIKNNEIPPKLRLGNDNHPAMHLHHELMAKIDSKSGSKSSQALKSESRREAMAAR
FT                   RTAGAPPSVPAGHATGNGGGAGGAGAGGAGAGGFAAGAAASGSAAAATAAGAAQTTDGR
FT                   KRRTMAGPTGTASGAMGATAGSASADSKKRKRKTASREDYSQRPKTNEYGEALYCYCNQ
FT                   VAYGEMVGCDGDNCILEWFHLPCIGLETLPKGKWYCDDCKRAL"
FT   gene            <742772..>743762
FT                   /locus_tag="KLTH0D08932g"
FT                   /old_locus_tag="Klth0D.mRNA.459.p"
FT   CDS_pept        join(742772..742786,742899..743762)
FT                   /locus_tag="KLTH0D08932g"
FT                   /old_locus_tag="Klth0D.mRNA.459.p"
FT                   /product="KLTH0D08932p"
FT                   /note="similar to uniprot|P01120 Saccharomyces cerevisiae
FT                   YNL098C RAS2 GTP-binding protein that regulates the
FT                   nitrogen starvation response, sporulation, and filamentous
FT                   growth; farnesylation and palmitoylation required for
FT                   activity and localization to plasma membrane; homolog of
FT                   mammalian Ras proto-oncogenes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22661"
FT                   /db_xref="GOA:C5DGW9"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGW9"
FT                   /protein_id="CAR22661.1"
FT                   /translation="MSLNKNNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIED
FT                   SYRKQVVVDGKVSILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYY
FT                   QQILRVKDADYVPVFLVGNKSDLEDERQVAYEEGVSLAKQFNAPFLETSAKQAINVEES
FT                   FYGLVRLVRDEGAVYNPAHGEQLGQKFQQQQARNQSMGAGAGLGVGASDGLDNGGHASD
FT                   PNMLSADAQGGQAADARTSGVAASGKAGELKSGKAPGAAGKVKSPAGRVEQRADNTSGK
FT                   KQKSGGCCIVC"
FT   gene            complement(<743851..>744231)
FT                   /locus_tag="KLTH0D08954g"
FT                   /old_locus_tag="KLTH-ORF11591"
FT   CDS_pept        complement(743851..744231)
FT                   /locus_tag="KLTH0D08954g"
FT                   /old_locus_tag="KLTH-ORF11591"
FT                   /product="KLTH0D08954p"
FT                   /note="similar to uniprot|P46964 Saccharomyces cerevisiae
FT                   YOR103C OST2 Epsilon subunit of the
FT                   oligosaccharyltransferase complex of the ER lumen which
FT                   catalyzes asparagine-linked glycosylation of newly
FT                   synthesized proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22662"
FT                   /db_xref="GOA:C5DGX0"
FT                   /db_xref="InterPro:IPR003038"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGX0"
FT                   /protein_id="CAR22662.1"
FT                   /translation="MVPKTTPKKADVASSASKFSDTISASYKAYCKQVSGDRQLQLIDT
FT                   FCAFLVAVGVIQFLFVCAAKDSFPLNAFLAGFSACVGQFVLLVSLRMQVVNSFMGISPQ
FT                   RAFGEFVLASLVLHFLCLHFVN"
FT   gene            <744374..>744991
FT                   /locus_tag="KLTH0D08976g"
FT                   /old_locus_tag="KLTH-ORF11590"
FT   CDS_pept        744374..744991
FT                   /locus_tag="KLTH0D08976g"
FT                   /old_locus_tag="KLTH-ORF11590"
FT                   /product="KLTH0D08976p"
FT                   /note="highly similar to uniprot|P50946 Saccharomyces
FT                   cerevisiae YNL099C OCA1 Putative protein tyrosine
FT                   phosphatase required for cell cycle arrest in response to
FT                   oxidative damage of DNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22663"
FT                   /db_xref="GOA:C5DGX1"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGX1"
FT                   /protein_id="CAR22663.1"
FT                   /translation="MEPDYEEDDDHVYINEETELGRENVVISHAPRARIVPPLNFCPVE
FT                   RYLYRSGQPSTVNFPFLLDLKLKTIIWLANEEPQDALLEFCDAHAIQLQFATINPDGGE
FT                   DDNPWDGLTEHSIISALRTIVNVESYPLLVCCGMGRHRTGTVIGCLRRIMGWNLASVSE
FT                   EYRRFTGSRGGRILVELLIEAFDTQLVEIDRAKAPQWLLTAV"
FT   gene            <745108..>745761
FT                   /locus_tag="KLTH0D08998g"
FT                   /old_locus_tag="KLTH-ORF11589"
FT   CDS_pept        745108..745761
FT                   /locus_tag="KLTH0D08998g"
FT                   /old_locus_tag="KLTH-ORF11589"
FT                   /product="KLTH0D08998p"
FT                   /note="weakly similar to uniprot|Q12057 Saccharomyces
FT                   cerevisiae YOR104W PIN2 Protein that induces appearance of
FT                   [PIN ] prion when overproduced"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22664"
FT                   /db_xref="GOA:C5DGX2"
FT                   /db_xref="InterPro:IPR037504"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGX2"
FT                   /protein_id="CAR22664.1"
FT                   /translation="MSQICYKRLATRGFVSGAKDTAESFKSWDSCMDNRACKIIAIVGI
FT                   VIASIVAVWIVGSLLRCFKYGASGICEFCCWCCGAGRRRGVQRPIAQPHSQPGVGGGPP
FT                   MVVYQPVTAPQDAYYRGNSFYDERSSVKELEQDFDLEAQRPENKRRAAGAHRISGGREA
FT                   VPLVYDEDPREDHELSVYHPRLTTNVAPQGYTTQTPYPKDEQQSYSKTYRHGNY"
FT   gene            complement(<745849..>746571)
FT                   /locus_tag="KLTH0D09020g"
FT                   /old_locus_tag="KLTH-ORF11586"
FT   CDS_pept        complement(745849..746571)
FT                   /locus_tag="KLTH0D09020g"
FT                   /old_locus_tag="KLTH-ORF11586"
FT                   /product="KLTH0D09020p"
FT                   /note="similar to uniprot|P50945 Saccharomyces cerevisiae
FT                   YNL100W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22665"
FT                   /db_xref="GOA:C5DGX3"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGX3"
FT                   /protein_id="CAR22665.1"
FT                   /translation="MSRNFYADEGAFVGSSKGPLLPDILHTEDVSTKTLPTGNQIYDSK
FT                   ALDSWFSGIRKYVTHKYYIYKTELDTQKSAAANEWKSVQDYVSQHVLTDDYEKQELLVP
FT                   SSALALGAFFTGRVLSNRRNWGFDSPLNTTKAGILTRNPSALGRVLTSIPSRVLLPWVL
FT                   TGTVLSQLTPVTWNNSVKALEQDVLPADLVARYHEIWNQLLVDGVQKTSASVHRNVDAS
FT                   LQQGIGEVRRYLVKKLDL"
FT   gene            complement(<746802..>748958)
FT                   /locus_tag="KLTH0D09042g"
FT                   /old_locus_tag="KLTH-ORF11584"
FT   CDS_pept        complement(746802..748958)
FT                   /locus_tag="KLTH0D09042g"
FT                   /old_locus_tag="KLTH-ORF11584"
FT                   /product="KLTH0D09042p"
FT                   /note="similar to uniprot|P50944 Saccharomyces cerevisiae
FT                   YNL101W AVT4 Vacuolar transporter exports large neutral
FT                   amino acids from the vacuole member of a family of seven S.
FT                   cerevisiae genes (AVT1-7) related to vesicular GABA-
FT                   glycine transporters"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09042g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22666"
FT                   /db_xref="GOA:C5DGX4"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGX4"
FT                   /protein_id="CAR22666.1"
FT                   /translation="MKPKTKKSDGIDSLSSNISIPQQQDRRRHSILLLSESVASRRSSY
FT                   TRALRDSKWRKSGTFSKSPQLGRSVDSRIFIDRASPSFKTPKQQHQEEILNSVRTNYLN
FT                   DYMSRKASQTSLSLKGQNESSDTEQGPELLDRDPNLESQGGHITRELYRMTSPAAFGKA
FT                   VKKTRSADDLTLEEQHSASNASALNVPGGFRREFILQKHNKGKTIDTALSSESETLHSS
FT                   SVSGESVPDSSEKVPFLTRNFLEFLYVYGHFAGESFEDEFYTDQESEEQAVDETSPLLA
FT                   RAEAGTGKKILVPKSAKGTTSTTKAFLLMIKSFVGTGVLFLPGAFSNGGLFFSLAMLVF
FT                   FGIYSYWCYYILTKSKIATKVSSFGDIGLTLYGPWMKFIILFSLVMTQLGFSGAYVVFT
FT                   AKNLLAFVENVFYWPGVTIVHLLALQLVVFIPLSFIRNIAKLSFSSLVANFLVMGGIVI
FT                   VIGFTAKHLFFDLNCKPAEGIVTGFNSQSWTLFVGTAIFAFEGIGLIIPIQSSMKHPEK
FT                   FPLVMALVIITATVLFVSVATLGYLSYGAETQTVILLNLPQDSILVNLIQFFYSSAILL
FT                   STPLQLFPAIAIIENKVFPKFTKIYVKRSDHTKIQYKPNSGKLDWRIKWLKNFVRSLIV
FT                   SSVVIAAYFGANHLDAFVAIVGSLACIPLVYIYPPMLHLRSCSKPRFAGEKSVWRKWPI
FT                   LLDYVLVVFGAIGMVYTSYQSIFG"
FT   gene            complement(<749322..>753683)
FT                   /locus_tag="KLTH0D09064g"
FT                   /old_locus_tag="KLTH-ORF11582"
FT   CDS_pept        complement(749322..753683)
FT                   /locus_tag="KLTH0D09064g"
FT                   /old_locus_tag="KLTH-ORF11582"
FT                   /product="KLTH0D09064p"
FT                   /note="similar to uniprot|P13382 Saccharomyces cerevisiae
FT                   YNL102W POL1 Catalytic subunit of the DNA polymerase alpha-
FT                   primase complex required for the initiation of DNA
FT                   replication during mitotic DNA synthesis and premeiotic DNA
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09064g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22667"
FT                   /db_xref="GOA:C5DGX5"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015088"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR024647"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038256"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGX5"
FT                   /protein_id="CAR22667.1"
FT                   /translation="MSAKNRIELLKKLQHARQNKSSKSLYEEDETDDKVYDLIDEEEFR
FT                   SMKRQELLRDDFVVDDDGLGYVDRGVDEWDDRNRDQNYSSEEDDKPRERAAKGSKKIKN
FT                   DGKGVKSSSGASIGDIIAAQHTKNAKVLSKAPKKFSLDEFDDILQEFDGNEASTAVGGL
FT                   FGAKSHRVVPKLENNIKREANAAATPPTIKRMKIDEQSFSTPQGGANTSPLAGTKTKAN
FT                   LLDDRDLQAMIDDVQSSPTITKERSADIVKSGGQSSEEDSDEEITFRRRTIRSAAASQR
FT                   SNVDIRSSVQSSPFVTAPPTPSGSSKLKEENPKSLSFIGKRYSRSDVISDNASSFKFYW
FT                   LDFAEVDSTLLLFGKISTRENKLISAMIQILNLSRELFFLPREGKTASDVHGEIIPLLM
FT                   EKYGLENIRAKPEIKKYAFELPGIPHESEYLKVLLPYRTPKNRNVTIPSDLEGDTFHHV
FT                   FGGNTNIFESFVVQKKVMGPCWLEINNGDFSALSNASHCDIEVQVSQPSSIEPTSDKHV
FT                   PNLNCASLAVQTIMSSKENKQEIVSITLSQYKNLAQDLPIPEDLAPNDTITLVRPPVGS
FT                   SFPTGLTHLAKKNLTGNLRLFNNEKALLSCFCAMMKSSDPDVIIGHRLENVALDTILYR
FT                   CFELKIPTFSCLGRRARKSWPDKFGKNPSMNQFYNRDILSGRLLCDISNEMGQSLTPKC
FT                   QSWDLPEMYQVTCQKEQRALEINYQNPQYQNDVNSMIMALQENVSNALISAEIAFRIQI
FT                   LSLTKQLTVLAGNAWCQTLGGTRAGRNEYILLHEFERNNYIVPDKETKSMRNQRQQRAR
FT                   EEAGLDGGDEVQVSSKKAKYQGGLVFEPEKGLHKNYVLVMDFNSLYPSIIQEYNICFTT
FT                   VERDPSNIDELPNVPSSEMAQGVLPRLLASLVQKRREVKKLLKTEPDPHKRTQCDIRQQ
FT                   ALKLTANSMYGCLGYVNSRFYAKPLAMLVTNKGREILMNTRQLAESLALTVVYGDTDSV
FT                   MIDTGSDSYMEAIKIGENFKKLVNERYRLLEIDTDNVFRKLLLHAKKKYAALTVVFDKS
FT                   GAEKTLLEVKGLDMRRREYCPLSKEVSTHVLETILSDKEPETALQDVYEYLEDIREKVE
FT                   NNTIRVDKYKINTRLSKDPKAYPGGKNMPAVQAALRMREAGRVVKAGSVITFVITKQEG
FT                   VEDDSSLSPAERARVLNEVMVKNNNLRPDPQFYLEKQIFAPVERLLERIESFDIVRLSE
FT                   SLGLDSRRFINRAGANGELNGSSSGSLQPLESSISDEERFKDVAALTFQCSGCQQRFPF
FT                   GGIVASKRYQMSYSGLQCSSCQHTFAPLQMSAQLESAIRSHISMYYAGYLACDDPTCGN
FT                   NTRQVSVFGKRCLNENCMGVMRYRYTDKQLYNQLLYFESLFDVDKNKKDAVKPLYKPDH
FT                   PDAPEAKIPTSQLLALGEQNRELFQVMSSVVQKYLANCARRFVDMDAIFAV"
FT   gene            <753982..>754779
FT                   /locus_tag="KLTH0D09086g"
FT                   /old_locus_tag="KLTH-ORF11578"
FT   CDS_pept        753982..754779
FT                   /locus_tag="KLTH0D09086g"
FT                   /old_locus_tag="KLTH-ORF11578"
FT                   /product="KLTH0D09086p"
FT                   /note="similar to uniprot|Q12241 Saccharomyces cerevisiae
FT                   YOR106W VAM3 Syntaxin-related protein required for vacuolar
FT                   assembly PEP12 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22668"
FT                   /db_xref="GOA:C5DGX6"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGX6"
FT                   /protein_id="CAR22668.1"
FT                   /translation="MSFLDAISRPGTKAHRSNGTLDELLSELIHSINELQKKNGLLGTK
FT                   RDSQELRYSVEMELVPQCETLRDRIEQVVSGDYSNGKLATDFASLKGELIRSKRQFSEL
FT                   KSKFPLRKAQRPSSNSVVSQNSGYVSMPVAIAEETTPLLQDQGSRDRQQQLQQQEQPSV
FT                   SQDELNFHTLIQQERSEEISRIHTAVQEVNAIFHQLGSLVREQGEDVDNIDSNISGLAG
FT                   NLHRANEQLGKADQSQRKKNRCGIITLVIIVVIVLVVILAALS"
FT   gene            complement(<754873..>757002)
FT                   /locus_tag="KLTH0D09108g"
FT                   /old_locus_tag="KLTH-ORF11577"
FT   CDS_pept        complement(754873..757002)
FT                   /locus_tag="KLTH0D09108g"
FT                   /old_locus_tag="KLTH-ORF11577"
FT                   /product="KLTH0D09108p"
FT                   /note="some similarities with uniprot|P32389 Saccharomyces
FT                   cerevisiae YNL103W MET4 Lecine-zipper transcriptional
FT                   activator responsible for the regulation of the sulfur
FT                   amino acid pathway requires different combinations of the
FT                   auxiliary factors Cbf1p Met28p Met31p and Met32p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22669"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGX7"
FT                   /protein_id="CAR22669.1"
FT                   /translation="MQNGRSCGHCHVIQGHVSKCHTTTKIRDHVPTRCITGDGYSVSRD
FT                   GARARPFLASGPGNCGCAPAPVTCERLTRATSFFFTILISVWGLALQTLQSTSDRLHCS
FT                   SALCRCSPPTASLLCSRVLPMSFDKNDGLHNLFGEDSDAFKASDGPLNFHSNDANVTPN
FT                   ILLEQLAYVDNFMPDFENDMASFGAPAHGEAHAGGLGLDDRLAAELSAFADETFIFPDE
FT                   EKPDNPNGSQDSRQGSSADTLAPGLPGSASTAASPSASASATHPVANRSSRFLSQRRNN
FT                   FLASQHDNSRQRFSSRRAFDIANRSPSDDHGGFTNVDITDGPAQPFAQPGAPYSNSPLS
FT                   NLVSDSNSQTAELFTNSSATPLLTPQDPLRRQSQAPPFQNSYSEIHMPDYSSIPTRTLL
FT                   ALLPKVKVPSGAWNSLRAVGFDQDQIDAIAAIIAHHQMHKNSNPSISNSASQVVSQSVP
FT                   PVTDENAASFLLQFLSHDNQQPQQRQQRQQQQHQPQQQHQTQNHQQPLPRNEGILSSHQ
FT                   APMRNAEASITPRSIEHEKATESFFNTFFNADSVRPDVQSSASESRPRLSSSASRSDRS
FT                   VPSDKEASKSDYEKTTSRKPSVDRREMDFASSLHAADEKRPTGSKTQHPKRKMKEQEME
FT                   GSIQELSELALGLQHRIHTLEMENRLLKNLVMERGELKGVEQAESVRRELMKKIKDDKK
FT                   EENKMSDNFVEKSEF"
FT   gene            <758342..>759427
FT                   /locus_tag="KLTH0D09130g"
FT                   /old_locus_tag="KLTH-ORF11568"
FT   CDS_pept        758342..759427
FT                   /locus_tag="KLTH0D09130g"
FT                   /old_locus_tag="KLTH-ORF11568"
FT                   /product="KLTH0D09130p"
FT                   /note="some similarities with uniprot|Q99188 Saccharomyces
FT                   cerevisiae YOR107W RGS2 Negative regulator of glucose-
FT                   induced cAMP signaling directly activates the GTPase
FT                   activity of the heterotrimeric G protein alpha subunit
FT                   Gpa2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22670"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGX8"
FT                   /protein_id="CAR22670.1"
FT                   /translation="MNTSGAPTLEQALEMARAQPRNASRARSRDSPAQAFSFAAFRDFL
FT                   RKSHCDENLDFILATDAFVGADAALTEADFPLKPWTDNVYSQFIRRDSPRECNLPQGIR
FT                   ECFDRCHATQSAPDRAYIRSARQHVITLLRDAFTRFLDRQRRCSSSNCSRCGSRTAAVM
FT                   AASAAASAAASLAASASSSATATAPGTPSVLSPGLAAAKLSRNSYISDYAVDDDDEDED
FT                   GTDGADAGQSYNIRDLRDLRDLRDLDTEGSAAATITRTQNSASTAFSAFSAASAASAAS
FT                   ALSATVHPPLGSITTTTGTHLSDRPAYPPSSMPSTPSSSFSTTSSAGFNSLKLKHTGKK
FT                   LVNKFKFRRSSSGSSGSSFNP"
FT   gene            <760328..>762154
FT                   /locus_tag="KLTH0D09152g"
FT                   /old_locus_tag="KLTH-ORF11561"
FT   CDS_pept        760328..762154
FT                   /locus_tag="KLTH0D09152g"
FT                   /old_locus_tag="KLTH-ORF11561"
FT                   /product="KLTH0D09152p"
FT                   /note="highly similar to uniprot|P06208 Saccharomyces
FT                   cerevisiae YNL104C LEU4 Alpha-isopropylmalate synthase (2-
FT                   isopropylmalate synthase) the main isozyme responsible for
FT                   the first step in the leucine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22671"
FT                   /db_xref="GOA:C5DGX9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGX9"
FT                   /protein_id="CAR22671.1"
FT                   /translation="MFRRTAVNLAQSAGKAIPPVKLAYKYMLKDPSKKYKPFKAVTLPN
FT                   RKWPDNRITKAPRWLSTDLRDGNQSLPDPMSVEQKKEYFHKLVEIGFKEIEVSFPSASQ
FT                   TDFDFTRYAVENAPEDVSIQCLVQSREHLIKRTVESLSGAKRATVHCYLATSDMFRDIV
FT                   FNMSQEEAIKKAVEATKLVRKLTKDDPAQQATRWSYQFSPETFSDTPPEFALEICEAVK
FT                   AAWEPTEENPIIFNLPATVEVATPNNYADQIEYFSTHISEREKVCISTHAHNDRGCGVA
FT                   ASELGVMAGADRVEGCLFGNGERTGNVDLVTVALNMYTQGVSPELDLSDLNSVVEVVER
FT                   CNKIPISPRAPYGGDLVVCAFSGSHQDAIKKGFALQEKRRANGDEEWKIPYLPLDPKDI
FT                   GRDYEAVIRVNSQSGKGGAAWVILRSLGLDLPRNLQIEFSTTVQNRADSLGRELKSQEI
FT                   TELFKEVYNYSGNIGKVTLLEYDVTKIDAERRSLTGQVSINGGVYDIQGSGNGPISSLV
FT                   DAMSNLFNVKFGVANYTEHSLGSGSSTQAASFIHLVYRRDSDNERTFKWGVGVSEDVGE
FT                   ASTKAILSAINSIVQSGDVSLPDAPSKASASA"
FT   gene            <762443..>765796
FT                   /locus_tag="KLTH0D09174g"
FT                   /old_locus_tag="KLTH-ORF11557"
FT   CDS_pept        762443..765796
FT                   /locus_tag="KLTH0D09174g"
FT                   /old_locus_tag="KLTH-ORF11557"
FT                   /product="KLTH0D09174p"
FT                   /note="similar to uniprot|Q12271 YOR109w Saccharomyces
FT                   cerevisiae INP53 Phosphatidylinositol 4,5-bisphosphate 5-
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09174g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22672"
FT                   /db_xref="GOA:C5DGY0"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGY0"
FT                   /protein_id="CAR22672.1"
FT                   /translation="MQILVQRGAERKVALVSTAYALVFKAVNDGQNSTKPLCAIELTPK
FT                   SQIGSSYQKMSSHEVHGFIGLIELEGFIFICTITGKTKVAQPIPGETVNKIYAVDFFCL
FT                   NDSQWDFVELDSNGYPVTSEDDYRGEQSPSYPGHPCHELRKLLSNGSFYYSSNFDLTSI
FT                   LQKRGMGAHSLSFDNYQEEYMWNSFLMKEVITFRNRLDDLGRQVLDDEGFLTTVIRGFA
FT                   ETFVTYIKQLKVSLTVISKQSWKRAGTRYNARGVDDEGNVANFVETELLMFSKEYCYAF
FT                   TQIRGSIPIFWEQDTALINPKVQITRSVEATQPVFDDHFTRLIDKYGPVHVVNLLSTKS
FT                   SEVELSARYKQHVARSKLHTLNKDIFFTDFDFHKETSQEGFAAAARIKPLITQSLLESG
FT                   YFSYDVRERKVLSEQHGIFRTNCLDCLDRTNLIQQFISRYAFALFLNDFHLMSTARGTA
FT                   FTDSDLFIKHNTLWADHGDQISQIYTGTNALKSSFSRKGKMSFAGVLSDATKSVSRMYI
FT                   NNFMDKNKQANIDTLLGRLSHQQAVSLYDPINEYVTTQLTKSSDQFTSSSSINIFVGTY
FT                   NVNGLTRRVDISKWLFPIGDKFKPDVVVLGMQEIIELSAGSILNADYSKSPFWQNIVNE
FT                   CLNQYNDKYLLLRAEQMSSLLILFFVKSDKINNVKQVEGSSKKTGLGGMTGNKGAVSIR
FT                   FDYGSTSFCFVNAHLAAGVSNVDERRHDYESITKGICFTRSRQISHHDAIFWLGDLNYR
FT                   LSLPNEEVRREISDQKDNFPESLLMHDQLTQEINAGVVFKDFKEPTVKFPPTYKYDHGT
FT                   NNYDTSEKARTPSWTDRIVYKGNNLRPLAYSDSQLIASDHKPVYAAYRAQVNFVDETVK
FT                   MDLTKKLYMQYKESHPEEYNNTTVALVDIDYEKKNGHGAKSSSTQLFAESDISLVDLDE
FT                   NRADVGSITRSSSISSSSEMSSLNSGTLNPVRKEAPSRSTTSLGRARVPPPPPPAPRQN
FT                   SMASQFSSASNLQAKAEPVNAETTSTASVVAPPPPPARKTTFPPGYSSSILTPKNASAA
FT                   GSKLTSPEPSVSSAPVPDASSTQNSKTDEHAAVSEAPINKPSRIPPPRPAKKPTLDNLN
FT                   MDSWKPLTPK"
FT   gene            complement(<765986..>766552)
FT                   /locus_tag="KLTH0D09196g"
FT   CDS_pept        complement(765986..766552)
FT                   /locus_tag="KLTH0D09196g"
FT                   /product="KLTH0D09196p"
FT                   /note="similar to uniprot|P53930 YNL107W Saccharomyces
FT                   cerevisiae YAF9 Subunit of both the NuA4 histone H4
FT                   acetyltransferase complex and the SWR1 complex may function
FT                   to antagonize silencing near telomeres interacts directly
FT                   with Swc4p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22673"
FT                   /db_xref="GOA:C5DGY1"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR037989"
FT                   /db_xref="InterPro:IPR038704"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGY1"
FT                   /protein_id="CAR22673.1"
FT                   /translation="MGEVKPPNAPVEHSHMWTIFVRGPNGEDLSDIIKSVVFKLHETYP
FT                   NPTRAVEAPPFELTETGWGEFEINIKIHFIESANEKPISFYHHLRLHEYQNQNSNGVKL
FT                   ENGGNSPEVESVFYDEIVFNEPNEEFFKVLIAKPGYLLPSNKSEKAVFSKQLEQEEIDR
FT                   ISDGAKKVDEEIEKLKEELTQMIQT"
FT   gene            <766792..>768109
FT                   /locus_tag="KLTH0D09218g"
FT                   /old_locus_tag="KLTH.mRNA.262VL.p"
FT   CDS_pept        join(766792..766821,766859..768109)
FT                   /locus_tag="KLTH0D09218g"
FT                   /old_locus_tag="KLTH.mRNA.262VL.p"
FT                   /product="KLTH0D09218p"
FT                   /note="similar to uniprot|Q6B220 Saccharomyces cerevisiae
FT                   YOR110W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09218g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22674"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR014623"
FT                   /db_xref="InterPro:IPR019481"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGY2"
FT                   /protein_id="CAR22674.1"
FT                   /translation="MAIKTIYIARELLKLTHYFQHGYRSNWLPKGPYPPPPTGVNSDVP
FT                   LAEHGVKQAKELAHYIMSIENQPEMIFSSPFYRCLQTSEPIADLLDLPINMERGIGEWY
FT                   KPDRDVIPEPASFEVLNNFFPGKLNPDWESTVIPSGKGETEQDIFNRCKEFWPKFAAKL
FT                   EAAFPNVETILLVSHAATKIALGMNLLGFDNCRDPIDSDGAIIRSGSCSLDKFELVQSE
FT                   LEDLEDVPFPARRWRLTMNGNTEFLSKGEEMHWDFQYGFEAGSDADIKARQALAEKEAL
FT                   QAKASDAGVPLEKDARASNVDTEAFEHVYFSVDVPGDNFKKRGEIEPNATMQYSGLETE
FT                   APLVRVGEKLYEGKWKKLVGTELALPDAAVMKTRTSEDGDDAVSESETFDSTSTDKNQT
FT                   PEDAGDPNGERIYRITDRLVLENVRPM"
FT   gene            <768379..>769134
FT                   /locus_tag="KLTH0D09240g"
FT                   /old_locus_tag="KLTH-ORF11550"
FT   CDS_pept        768379..769134
FT                   /locus_tag="KLTH0D09240g"
FT                   /old_locus_tag="KLTH-ORF11550"
FT                   /product="KLTH0D09240p"
FT                   /note="similar to uniprot|Q99210 Saccharomyces cerevisiae
FT                   YOR111W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22675"
FT                   /db_xref="GOA:C5DGY3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGY3"
FT                   /protein_id="CAR22675.1"
FT                   /translation="MTLSMTFLSRFRSLRKIPLRCSLHQRCSMMSRVIKEISEKFEIVL
FT                   ASSSPRRYEIVTQVMGFADVKLMKPSFAEDHDKSLYAGNPTGYVHDTSKSKALGIIEDL
FT                   KHTEETHASKPKLVICADTVVIDSDENIHEKPQRPELQLGNLLRFRESDGPVKVITSVT
FT                   LIKWESPQDFTFTQFEEVSEVHFDSDFPLPILYDYVDSGDALDVAGGFKVQSFGGAMIK
FT                   KINGDFFNVVGLPLNKTFKELYKAAFPLE"
FT   gene            <769384..>770055
FT                   /locus_tag="KLTH0D09262g"
FT                   /old_locus_tag="KLTH-ORF11546"
FT   CDS_pept        769384..770055
FT                   /locus_tag="KLTH0D09262g"
FT                   /old_locus_tag="KLTH-ORF11546"
FT                   /product="KLTH0D09262p"
FT                   /note="similar to uniprot|P53927 Saccharomyces cerevisiae
FT                   YNL110C NOP15 Constituent of 66S pre-ribosomal particles
FT                   involved in 60S ribosomal subunit biogenesis localizes to
FT                   both nucleolus and cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09262g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22676"
FT                   /db_xref="GOA:C5DGY4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGY4"
FT                   /protein_id="CAR22676.1"
FT                   /translation="MAKSTTKQATPILEAEPVREEQLELGNSSSNESEIEGLSEDDEAG
FT                   SGEEQGSSGSRASSGVHTVKKLDAKKRESQQEGGKGSKKGRSKAEELSGIIYVSRLPKG
FT                   FHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDALVAQETMHNYLLMNH
FT                   LLQVVALPKGKKIEKLFHYKKRAFSETSVTKSSEELKQRAIDKHAQRAARLQDKGIEFK
FT                   W"
FT   gene            <770560..>770931
FT                   /locus_tag="KLTH0D09284g"
FT                   /old_locus_tag="KLTH-ORF11543"
FT   CDS_pept        770560..770931
FT                   /locus_tag="KLTH0D09284g"
FT                   /old_locus_tag="KLTH-ORF11543"
FT                   /product="KLTH0D09284p"
FT                   /note="similar to uniprot|P40312 Saccharomyces cerevisiae
FT                   YNL111C CYB5 Cytochrome b5 involved in the sterol and lipid
FT                   biosynthesis pathways required for sterol C5-6 and fatty
FT                   acid desaturation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22677"
FT                   /db_xref="GOA:C5DGY5"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGY5"
FT                   /protein_id="CAR22677.1"
FT                   /translation="MAKLYSYKEIAEHNTENDLWMIIDGKVYDCTKFMDEHPGGEEVLL
FT                   DLGGQDATGPFADIGHSDDAVKMLEDLYVGDVDKDSEPIAVVKGDPASTTTGGEGNGVM
FT                   ILAIAAVALAVVYFYLNQK"
FT   gene            <771018..>773357
FT                   /locus_tag="KLTH0D09306g"
FT                   /old_locus_tag="KLTH-ORF11541"
FT   CDS_pept        771018..773357
FT                   /locus_tag="KLTH0D09306g"
FT                   /old_locus_tag="KLTH-ORF11541"
FT                   /product="KLTH0D09306p"
FT                   /note="similar to uniprot|Q12453 Saccharomyces cerevisiae
FT                   YOR112W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22678"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGY6"
FT                   /protein_id="CAR22678.1"
FT                   /translation="MWKQEWRSEPPSWQVLSISRSGPCVFSQNTRKNTELHHTCKITTS
FT                   DPRALPMNFLFKSISGFQFPYSLESTPSVTTPIWEATNGHRKSDSLPVTVFSFQKQRNG
FT                   ALDAMIANAVHYAKVLKLPGILRVVDVLDTNQNTAYVVTERAHILDTKGLSQHALSLGT
FT                   LQVAETLELLHAQAKVVLGTLSRGTVFVNERGEWRLFGLELCSKISDLSHMKQNVSSYL
FT                   SFVAGSGLEVQISPSSAADAVLLSKFIQSIYSHPPSEWKPLLVGLEQGRLTLSQFLARS
FT                   KNTQPFQSPLIAMYQDLREFHIKDPQGKVVAMSDLQRNIMDDPTVLRGSTPGFVEGHLI
FT                   PEISQCIASILGAQKTQALTATSANVITFVASIMELTCSDDPVTDSASVFAHYVKPLIF
FT                   ESFKSPDRQLRFLLLVYFANYLEKLTNNEVSDRIFPHFVQGLADSDATMRIETLKKIPD
FT                   VTPLITERQLNNDLLRHLAKTQVDADVEIRTWTILTISGLSKKLSPSNNRSGILATAFT
FT                   KSLKDPHVKPKLAALYGLETSLELFDVTTIANKILTVIAPGLLDSNGQVRRKAKNLFRL
FT                   YLSKLEGETDQIPADDSEEVEVDFDASLRKENGQVIQQFMSNLKLSTPPIMSQPQTHDL
FT                   AENTGDDEWAQNNDEWAQNNDEWDDDEGWEGDLVDDIDAGLSKPTQETKGGHQAKVHIG
FT                   QVKIQKSWNKDIENDDWDSWDQPADLSTKAASKTSKPPTSKVTAKRTIIKASRQKKDQK
FT                   PNPIAEKAEVFEGFENDGDDGWGDDW"
FT   gene            complement(<773449..>775823)
FT                   /locus_tag="KLTH0D09328g"
FT                   /old_locus_tag="Klth0D.mRNA.2254.m"
FT   CDS_pept        complement(join(773449..773837,774557..775823))
FT                   /locus_tag="KLTH0D09328g"
FT                   /old_locus_tag="Klth0D.mRNA.2254.m"
FT                   /product="KLTH0D09328p"
FT                   /note="similar to uniprot|P24783 Saccharomyces cerevisiae
FT                   YNL112W DBP2 Essential ATP-dependent RNA helicase of the
FT                   DEAD-box protein family involved in nonsense-mediated mRNA
FT                   decay and rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22679"
FT                   /db_xref="GOA:C5DGY7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGY7"
FT                   /protein_id="CAR22679.1"
FT                   /translation="MTYGSRDNQFNRDNYGSRGGDFRGGRPSDRNSYGRDSYGGGRGGF
FT                   SRPPPSQPMELVAPDWDQELPNLPKFEKNFYVEHESVRNRSDAEVEEFRKANEMSILGK
FT                   DIPKPITTFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTL
FT                   SYCLPGIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQTECSKFGKSSRIRNTCVYGGV
FT                   PRGHQIRELTRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRK
FT                   IVDQIRPDRQTLMWSATWPKEVQQLARDYLHDPIQVNVGSLELAASHNIAQIVEVVSDM
FT                   EKRDRLLKHLETASEDKDSKILIFASTKRTCDEITRYLRQDGWPALAIHGDKAQNERDW
FT                   VLQEFRTGNSPIMVATDVAARGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTA
FT                   ISFFTEANKGMGAQLISIMREANQQIPPELMKYDRRQYGGHPRYGRGGYGGGRGGRGGY
FT                   GRGGRGGGRGYGGGRGGGFQKPRDSGWGNRNINY"
FT   gene            complement(<776115..>776555)
FT                   /locus_tag="KLTH0D09350g"
FT                   /old_locus_tag="KLTH-ORF11533"
FT   CDS_pept        complement(776115..776555)
FT                   /locus_tag="KLTH0D09350g"
FT                   /old_locus_tag="KLTH-ORF11533"
FT                   /product="KLTH0D09350p"
FT                   /note="some similarities with uniprot|P28000 Saccharomyces
FT                   cerevisiae YNL113W RPC19 RNA polymerase subunit common to
FT                   RNA polymerases I and III"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22680"
FT                   /db_xref="GOA:C5DGY8"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR033898"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGY8"
FT                   /protein_id="CAR22680.1"
FT                   /translation="MANGDVKEPDAQVNTEEIVHAGESVQNGAEDVDMVADEQEEAEED
FT                   ADKEKIRLLSSATSEDGTCASFQISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETL
FT                   LNLRIQTYGKFTAVEVLQKGLQDLMDLCDAVEDKFTQRIREM"
FT   gene            complement(<776870..>777832)
FT                   /locus_tag="KLTH0D09372g"
FT                   /old_locus_tag="KLTH-ORF11532"
FT   CDS_pept        complement(776870..777832)
FT                   /locus_tag="KLTH0D09372g"
FT                   /old_locus_tag="KLTH-ORF11532"
FT                   /product="KLTH0D09372p"
FT                   /note="similar to uniprot|P00812 Saccharomyces cerevisiae
FT                   YPL111W CAR1 Arginase responsible for arginine degradation
FT                   expression responds to both induction by arginine and
FT                   nitrogen catabolite repression disruption enhances freeze
FT                   tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22681"
FT                   /db_xref="GOA:C5DGY9"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGY9"
FT                   /protein_id="CAR22681.1"
FT                   /translation="MLTEPSFDLYPNKKAGLVLANFSGGQGKSGVEDGPKYMLRQGLRQ
FT                   DLQELGWTTSIEEPLASDDYEKRKETDTSDVWGIVKRPQLVGEATKQIYESAKKVLERG
FT                   EMPVTIGGDHSVAIGSIAAVFEKHPDACVLWIDAHADINTPSTTDSGNLHGCPVSFLMG
FT                   LDSENTPPSLQWVPKCVKPNKIAYIGLRDVDAGEKRILRENHIPAFSMYHVDRFGLNHV
FT                   IEMALQAINPDGDCPIHLSYDVDAMDPLFVPATGTPVRGGLTLREGLFVAERVAETGKL
FT                   VALDVVEVNPTLAVHDMHVLDTVSAGCAVARCALGETLL"
FT   gene            <779021..>779092
FT                   /locus_tag="KLTH0D09394r"
FT                   /old_locus_tag="Klth0D.tiMet.CAT.9"
FT   tRNA            779021..779092
FT                   /locus_tag="KLTH0D09394r"
FT                   /old_locus_tag="Klth0D.tiMet.CAT.9"
FT                   /note="tRNA-iMet (CAT) cove score=75.85"
FT   gene            <779251..>780438
FT                   /locus_tag="KLTH0D09416g"
FT                   /old_locus_tag="KLTH-ORF11527"
FT   CDS_pept        779251..780438
FT                   /locus_tag="KLTH0D09416g"
FT                   /old_locus_tag="KLTH-ORF11527"
FT                   /product="KLTH0D09416p"
FT                   /note="similar to uniprot|Q6B2A9 Saccharomyces cerevisiae
FT                   YPL112C PEX25 Peripheral peroxisomal membrane peroxin
FT                   required for the regulation of peroxisome size and
FT                   maintenance recruits GTPase Rho1p to peroxisomes induced by
FT                   oleate interacts with homologous protein Pex27p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09416g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22682"
FT                   /db_xref="GOA:C5DGZ0"
FT                   /db_xref="InterPro:IPR008733"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGZ0"
FT                   /protein_id="CAR22682.1"
FT                   /translation="MESQLYEGFHSSQRLVDEFNMLQDNQPISFTEKDSSDEESTAEES
FT                   QELQEVKHSHAVHHSAVVVRNIDVLNHIFGTLGGKDRLAKILKYVLDLVKLFVSRSRIG
FT                   ITRWDPQVLEHYSKVLAQLNLRLLLRHPATIAKIMVVAGLRNFEAKASLVSSNLSLFRQ
FT                   ILRFGGTPFRVAALWSKINLTTHQIAAARAKPASAADSHTLAVINKLWLNEASLGDFID
FT                   LYYGVMDELMLLHKFKVWHHPGLYTWVAKHESLSWYYDIMLGLKKNWCSLQQLNRAQLE
FT                   LSIQEQVKKRALELSSRLQGKTASPIKQQLLQDLQTGQEHNDQFSKRIRDIERQRRVVI
FT                   LDLVRLSFDFLADTTDVFNLKTPPGTYAVLSLASGLTGLVKLWGNAKRELSESVV"
FT   gene            <780671..>781825
FT                   /locus_tag="KLTH0D09438g"
FT                   /old_locus_tag="KLTH-ORF11525"
FT   CDS_pept        780671..781825
FT                   /locus_tag="KLTH0D09438g"
FT                   /old_locus_tag="KLTH-ORF11525"
FT                   /product="KLTH0D09438p"
FT                   /note="similar to uniprot|Q02961 Saccharomyces cerevisiae
FT                   YPL113C Putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09438g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22683"
FT                   /db_xref="GOA:C5DGZ1"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGZ1"
FT                   /protein_id="CAR22683.1"
FT                   /translation="MAKKPGVLIPFKNRVEVDDSLPEWKRLEEHVDFIKYKITTKEDFK
FT                   VALARSNVECLWITEDLFTYLGSPAEFYDDYSSSLKLIAVPWVGTDFLDGPKLKREKGI
FT                   VVCNIGPSAASNVGELALFLALSCFRMTSFFEHCFRFVHRGQPGQCAEYVGGKKHALTA
FT                   SSATGGEHHYPFPEKFTREQAQVVDLSKNYTIAGKTIASPNGKTALILGFGYIGQSIGK
FT                   KLCYGLDMKIQYFKRSGPVSKDILGYPAKYCSTLEDPETWVSADLIVLALPGHSSTQNV
FT                   INAKTLSMCKDQVRIVNVGRGSCIDEDALFQALESGKVASAGLDVFKNESTKVDERFFD
FT                   RWDVTLLPHIGSTVSDMVGRQTLVTLQNVEDVLVKNGRGLYPCN"
FT   gene            complement(<781892..>782566)
FT                   /locus_tag="KLTH0D09482g"
FT                   /old_locus_tag="KLTH-ORF11523"
FT   CDS_pept        complement(781892..782566)
FT                   /locus_tag="KLTH0D09482g"
FT                   /old_locus_tag="KLTH-ORF11523"
FT                   /product="KLTH0D09482p"
FT                   /note="weakly similar to uniprot|P32773 Saccharomyces
FT                   cerevisiae YOR194C TOA1 Transcription factor IIA large
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22684"
FT                   /db_xref="GOA:C5DGZ2"
FT                   /db_xref="InterPro:IPR004855"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGZ2"
FT                   /protein_id="CAR22684.1"
FT                   /translation="MSNQEGARAYETIVENVVNEVREDFESAGIDEQTLQDLKLVWQTK
FT                   LSESRVAKFMWDPEDEGALGTSLNNSNIAPSLLDSQGLAIPALSSGEDKAQQSQSQQQQ
FT                   AQQQPLMTQSKHEEQPKQEIELSMEDPDGEIAEQLKLQAKQAKKSALLDTDEINSDLDD
FT                   SEDDYLNSSGEDEGQDENIVLCLYEKVLRVKNKWKCNLKDGLATINHKDYAFQRAQGET
FT                   EW"
FT   gene            <783223..>785379
FT                   /locus_tag="KLTH0D09504g"
FT                   /old_locus_tag="KLTH-ORF11519"
FT   CDS_pept        783223..785379
FT                   /locus_tag="KLTH0D09504g"
FT                   /old_locus_tag="KLTH-ORF11519"
FT                   /product="KLTH0D09504p"
FT                   /note="weakly similar to uniprot|Q08581 Saccharomyces
FT                   cerevisiae YOR195W SLK19 Kinetochore-associated protein
FT                   required for normal segregation of chromosomes in meiosis
FT                   and mitosis component of the FEAR regulatory network which
FT                   promotes Cdc14p release from the nucleolus during anaphase
FT                   potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22685"
FT                   /db_xref="InterPro:IPR024312"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGZ3"
FT                   /protein_id="CAR22685.1"
FT                   /translation="MGDSNIGSFSTPLKNGISRSVELRVPNSERPYPKGVDSPGKPAND
FT                   DRALRIQKNNENASQLRSSPWKRAKLDKFSSRSHPVSSPAVIEMLDRNVSGPHGSLRDS
FT                   QALEIQDEISEAISSAVREVSGSDSSNHDNQHRTSLINDLLSPRRDGTPDHIPDADLAN
FT                   LGKLTPPKNYMHNTESSIIQNLQSCFRDELGKFEQYLKAKNEQADEYRRRTVDCFEKIK
FT                   QLEEALDEQKLTYSSLLGEYEMLRASQSVRDDQWQTQNREIEKLSTEKTSLEERVSRLK
FT                   LRLSEARNEMKMINQNSQILQEKFQTQIQQNERLQNQVSELEDSENQLRVHIENTTNSK
FT                   KRVEEEIERTRAELALLTEGKFKTQSENEDLKLSVSKAQTLLAEKTKFIEELQANLRAS
FT                   HDTKQKSTIELEQRINDLTLEKNELVRELEDMSTLRSKIEESENEIQSVKTELDRTQVA
FT                   LQHLKEEHSELREHCRSLEAELKTSHQKLETANDQLAIKSAEVVELGHDVKELRQGKSH
FT                   LEDSLKLRDASISEWNSKYEEKCAENNKLSIEIESFQFKNGNLETEHLVELEQLHQQMT
FT                   SLQETLKSNSERIKELTEENSSLKDQLEVRELPQPQQGPLVDPEQVEELHAKIQSLEQQ
FT                   LREKEAEAGKRLQLLAEDLYIQYSSKHEQKVKMLKKGYESKYQDKLERLGLENSGLKDE
FT                   LMQLNDTLKAEREEKHNLVKLLNK"
FT   gene            <785720..>788815
FT                   /locus_tag="KLTH0D09526g"
FT                   /old_locus_tag="KLTH-ORF11516"
FT   CDS_pept        785720..788815
FT                   /locus_tag="KLTH0D09526g"
FT                   /old_locus_tag="KLTH-ORF11516"
FT                   /product="KLTH0D09526p"
FT                   /note="similar to uniprot|P32873 Saccharomyces cerevisiae
FT                   YPL115C BEM3 Rho GTPase activating protein (RhoGAP)
FT                   involved in control of the cytoskeleton organization
FT                   targets the essential Rho-GTPase Cdc42p which controls
FT                   establishment and maintenance of cell polarity including
FT                   bud-site assembly"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09526g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22686"
FT                   /db_xref="GOA:C5DGZ4"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGZ4"
FT                   /protein_id="CAR22686.1"
FT                   /translation="MGSDDDSAGSITLQLLSKYNYHTSERDRSLENKEKNNEPSRKPSY
FT                   DALYKENTTLKLQLEEYESEIASLKRFIDVLKNNRNTFKESHQQLEVEDKLKEPILPPR
FT                   SAERRRNAKNLSLPVTKEAKSQAEKSPGLLSPAGIITSRSFNGTPTLTDNTLNHDRDQS
FT                   FSLNELDKIRRSSSSYSNVIAASPATSVAYTTSRISPSRSNKHSLKDEDSASSVPERSA
FT                   SLLNSSKAVISVSDHYHSPLRIGSGGNQEDNQESSSKKSYPKSPIPNLLASHEGKADIS
FT                   PASKKSLNNFAEMLDSSFGEDEEQTPHENPQEIEVASANQERESISRLLGSPVALKKPH
FT                   QSHENSPVLHSFEVVSSSAPEEKPSSSTIGSSASTQIVSAYDPQSPRSINAKSIPHLGK
FT                   SNSQPIVQSPRKKTTPTVTDSHSIISDIPLFVQPGELGTIRIDVVSTLHRDNEMFAGDH
FT                   HILFSVIDRTSGKEIFKFAKTIDRVYELDVYLKCHMDTIMLPPLPEKAMFETTTPLRVD
FT                   YRREKLNDYFSCLFAQQNLLPDIALKLAKFISTDTVMNPIIGDYIKEGILMMRKSKAIG
FT                   STNSWRLRYAVVDGVNLSLLDRGQVSEIIKLSQAAIELQANLPDDRYGTKNGFILNVHK
FT                   KGGLSSGTRYFFCCESPRERESWVSSLAEFVESSVVFSGSINSKSESSSMIDHSSTGNE
FT                   ASSDAPVSYIGPIANLQSPVSHSPTQAPDTTAQEDERESKRIRMRSFFPFKRATAAQTS
FT                   SEPELPLNGDSSQLPLLQPNETSISRSLQAMDLGPEIVSNTVFGSELRSCVSISSQLYQ
FT                   GKYVIPSVVYRCLEYLYRNHGVEEEGIFRISGSSLLIKSLQEQFDKDRDIDLCNYNKSV
FT                   TSDDPNKSNFGTGLVDVNTVTGLLKLFLRKMPHVIFGDSMLPVFKSALDAKWGSGYQVA
FT                   LEYRRLVNSDKISKESYSLMFVLFELLVKINQKNQINKMNLRNLCIVFSPTLNIPVSVL
FT                   QPFIVDFDCIFKNEEPINDSQREQVDIDAPSAVLKEINSYFA"
FT   gene            complement(<788915..>790030)
FT                   /locus_tag="KLTH0D09548g"
FT                   /old_locus_tag="KLTH-ORF11513"
FT   CDS_pept        complement(788915..790030)
FT                   /locus_tag="KLTH0D09548g"
FT                   /old_locus_tag="KLTH-ORF11513"
FT                   /product="KLTH0D09548p"
FT                   /note="highly similar to uniprot|P32875 Saccharomyces
FT                   cerevisiae YOR196C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22687"
FT                   /db_xref="GOA:C5DGZ5"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DGZ5"
FT                   /protein_id="CAR22687.1"
FT                   /translation="MLSRFKCSRLQLQKRAISVTKATTTTASQPKRRRTTTFSDALNKG
FT                   PSFEDFVSGKAAKFTLDPLQQARSNIEEAKRLPRWLKVPIPKGTNYHKLKKDVRELKLS
FT                   TVCEEAKCPNISECWGGGDSSKATATIMLLGDTCTRGCRFCSVKTNRAPSKPDPAEPEN
FT                   TAEAISRWGLGYVVLTTVDRDDLADGGAHHLAETVCRIKQKAPKTLVETLSGDFRGDLE
FT                   MVKVMAQSGLDVYAHNLETVKDLTPHVRDRRATYEQSLSVLNQAKKTVPTLITKTSLML
FT                   GLGETDEQVLQTLQDLRAIGCDVVTFGQYMRPTKRHMKVVEYVKPEKFDYWRDKALELG
FT                   FLYCASGPLVRSSYKAGEAFIENVLRKRANN"
FT   gene            complement(<790606..>790833)
FT                   /locus_tag="KLTH0D09570g"
FT                   /old_locus_tag="Klth0D.mRNA.at.286.m"
FT   CDS_pept        complement(790606..790833)
FT                   /locus_tag="KLTH0D09570g"
FT                   /old_locus_tag="Klth0D.mRNA.at.286.m"
FT                   /product="KLTH0D09570p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22688"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGZ6"
FT                   /protein_id="CAR22688.1"
FT                   /translation="MGKAASNTSHAIQAGNKAVIISPWQHKVIEILPLNKFGGQCSFNG
FT                   VMNGEVSLNDRYLHQVAVVENGEFVCLRDE"
FT   gene            complement(<792708..>794825)
FT                   /locus_tag="KLTH0D09592g"
FT                   /old_locus_tag="KLTH-ORF11500"
FT   CDS_pept        complement(792708..794825)
FT                   /locus_tag="KLTH0D09592g"
FT                   /old_locus_tag="KLTH-ORF11500"
FT                   /product="KLTH0D09592p"
FT                   /note="similar to uniprot|Q02959 Saccharomyces cerevisiae
FT                   YPL116W HOS3 Trichostatin A-insensitive homodimeric histone
FT                   deacetylase (HDAC)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22689"
FT                   /db_xref="GOA:C5DET4"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DET4"
FT                   /protein_id="CAR22689.1"
FT                   /translation="MSKEVDPLLKFEHQFQSFVRNNPNVASAAHSASQIPESAKAVVVL
FT                   SPLSLQHQFPRYWVSKSYKKTIVERPERLLACSMGIGAAITMYPALFTLKSSHKRKTSL
FT                   LSDHVLKVHGSDWPQELLKLCKNSQKALDQCQVEVPESWNVGDIYLSRQTISALEGSIG
FT                   ALETGVDSIFHGPSVEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTYG
FT                   VTHAVVLDFDLHHGDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHD
FT                   INSFPTELGYATKENVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAK
FT                   ADEYFRTAKQNMRALGKPFKGLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDAL
FT                   KLAQMHSHGKLLSVLEGGYSDGAISSGVFAHLIGLQNQNWINEWGSAQVVKEIVRGCKP
FT                   QWKPYKTKRARDVIRIWAEEVIKLGRAMIPEFEQVLFEPELVEPKAETSKRITRSRRAP
FT                   AAASIAVVKTPPTLPRSETPTPNDKRYIQKLETADVETVPFVEQDLPSDNEDEDDEDYV
FT                   YDEELNKTFNRTVEDITIDDISRHLETLEIEPEALDDAPPRTASSSGTRASSRNADSEA
FT                   AAAAAAGAPQERRPLSSSSGGYKIPSGSTTRHLRNTRASRLMNFDDSDISMISHVSPTK
FT                   GRSTRSGQTKW"
FT   gene            <795668..>796975
FT                   /locus_tag="KLTH0D09614g"
FT                   /old_locus_tag="KLTH-ORF11495"
FT   CDS_pept        795668..796975
FT                   /locus_tag="KLTH0D09614g"
FT                   /old_locus_tag="KLTH-ORF11495"
FT                   /product="KLTH0D09614p"
FT                   /note="highly similar to uniprot|Q08601 Saccharomyces
FT                   cerevisiae YOR197W MCA1 Putative cysteine protease similar
FT                   to mammalian caspases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22690"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:C5DET5"
FT                   /protein_id="CAR22690.1"
FT                   /translation="MFPGAGRQSYANQQQQNMQQGVYSRPQGPPPGQGQQFHPPPQQYS
FT                   RPGAPPPSFQGQQGYQDQQGHQGSQGFQRPPQPPPQGQYRNDIQANHAQPGFVNGPDMY
FT                   QQPQNLHAPPQQAQVAGSGSNNEFSYQYSQCTGKRKALLIGINYFGTQSELRGCINDVR
FT                   NIHDFLTTRYGYKSEDIVVLTDDQTQMAGVPLRQNILRAMQWLVSNAQPNDSLFFHYSG
FT                   HGGQTKDLDGDEEDGMDDVIYPVDHETQGHIIDDEIHDIMVKPLQPGVRLTALFDSCHS
FT                   GTVLDLPYTYSTKGVIKEPNLWKDVGQDGLQAAMAYATGNTSRMLTSLNSMFKSATRKA
FT                   TGSSASQQIKQTKFSPADIIMLSGSKDNQTSADAVENGQASGAMSHAFVKVMTTQPQQT
FT                   YLSLLQNMRAELSGKYSQKPQLSSSHPINVNLQFLL"
FT   gene            complement(<797064..>798479)
FT                   /locus_tag="KLTH0D09636g"
FT                   /old_locus_tag="KLTH-ORF11489"
FT   CDS_pept        complement(797064..798479)
FT                   /locus_tag="KLTH0D09636g"
FT                   /old_locus_tag="KLTH-ORF11489"
FT                   /product="KLTH0D09636p"
FT                   /note="similar to uniprot|P38934 Saccharomyces cerevisiae
FT                   YOR198C BFR1 Component of mRNP complexes associated with
FT                   polyribosomes implicated in secretion and nuclear
FT                   segregation multicopy suppressor of BFA (Brefeldin A)
FT                   sensitivity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09636g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22691"
FT                   /db_xref="InterPro:IPR039604"
FT                   /db_xref="UniProtKB/TrEMBL:C5DET6"
FT                   /protein_id="CAR22691.1"
FT                   /translation="MSSTTTVKKQGFVKRPDVGARDKKLDVLKSQLKKIDTEIASLRKQ
FT                   IDQQQVASGAQDQRSQLQNELRGIIKTQSDLKSRRQAIHDQVKALDAELKRKKTQIGAK
FT                   VGGKSQYQSVDDIEARKRAIDADISSGELSLVEEKLLVKELQSLNKLARDLQAIEPIRK
FT                   SMEDDKSRIAALKQELNELNPKEVSGKFETTQKKLNDLQSKNQTLYDKRQTLFNKRSAL
FT                   YKKRDEVYAQISQIRSDFDNEFKAFKHKLEKERLKREEEQKLSKLLEEKDAVVGKLQEK
FT                   LTHARQPAFTYEIGAIENVLCVLDPSYVKPAKHTLEVPADSNVAKAPVRKVEADDLVPI
FT                   VKEKEEFFAMGTKSKKNKKKQGSSSQSPASSGKFSLEPTMIATLAELDVTVPLNKEEVP
FT                   KTIEQLRAKHEDFTARQDEQTEKNIAEAEAKLKELDLEYAKKEENVRKELEEKRAKEQE
FT                   QEQEQGQTEQEEK"
FT   gene            <799938..>800768
FT                   /locus_tag="KLTH0D09658g"
FT                   /old_locus_tag="KLTH-ORF11483"
FT   CDS_pept        799938..800768
FT                   /locus_tag="KLTH0D09658g"
FT                   /old_locus_tag="KLTH-ORF11483"
FT                   /product="KLTH0D09658p"
FT                   /note="similar to uniprot|P15496 Saccharomyces cerevisiae
FT                   YPL117C IDI1 Isopentenyl diphosphate:dimethylallyl
FT                   diphosphate isomerase (IPP isomerase) catalyzes an
FT                   essential activation step in the isoprenoid biosynthetic
FT                   pathway required for viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22692"
FT                   /db_xref="GOA:C5DET7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C5DET7"
FT                   /protein_id="CAR22692.1"
FT                   /translation="MSSYSELVKGLDASHILSQFQDVIPLQKRPNTHSSSSSAEDNGDV
FT                   VFEGHDEEQIRLMCENCIVVDWSDRAVGAGTKKLCHLMTNIELGLLHRAFSVFLFNEQG
FT                   QLLLQQRATEKITFPDLWTNTCCSHPLCVDDELGLTGTLDDKVAGAQTAAVRKLEQELG
FT                   IPMTETVAKTDFHFLNRIHYKAPSNGPWGEHEIDYIFFCQLRAGQSLTVEPNPNEVRDY
FT                   KWVTAEQLKSMFQDPQFKFTPWFKLICESYLFQWWDQLSDLSQVENDSQIHRML"
FT   gene            complement(<800841..>802022)
FT                   /locus_tag="KLTH0D09680g"
FT                   /old_locus_tag="KLTH-ORF11481"
FT   CDS_pept        complement(800841..802022)
FT                   /locus_tag="KLTH0D09680g"
FT                   /old_locus_tag="KLTH-ORF11481"
FT                   /product="KLTH0D09680p"
FT                   /note="similar to uniprot|P25270 Saccharomyces cerevisiae
FT                   YOR201C MRM1 Ribose methyltransferase that modifies a
FT                   functionally critical conserved nucleotide in mitochondrial
FT                   21S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22693"
FT                   /db_xref="GOA:C5DET8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C5DET8"
FT                   /protein_id="CAR22693.1"
FT                   /translation="MFKPRPNTILRRSLAQAIRPAVKVPNASHQGSGPSNIDKNLPHER
FT                   RTKAWEKAGEDKDSWFRRKYAHVHAKAGNPNRQKGRAKQNVEEASVQHDQHKSKFRNRS
FT                   VTGSLRPNPLMEYVHGTNSVISVLQADKRDYYSRILYHASVTDEIRSLAKKRGAQLEMT
FT                   DKHRLNILTNYAVHNNVVLETKPLQLPEISQVGSCDPEGSTFAYDELFFDEASERRTSF
FT                   IQKENKKFPLGLYLDEVSDPHNMGAIIRSAYFLGVDFMIMSRRNCAPLSPTVSKTSSGA
FT                   TELLPIFTVDKPLDFFSKSQKEGWTFVSAGVSKQNKFAKNKKIEAQDLHGMLKELPVIL
FT                   VVGNEGEGVRTNLQMRSDFLVEIPQGRGAAGTRSVDSLNVSVATAILLNSILN"
FT   gene            <802180..>802863
FT                   /locus_tag="KLTH0D09702g"
FT                   /old_locus_tag="KLTH-ORF11479"
FT   CDS_pept        802180..802863
FT                   /locus_tag="KLTH0D09702g"
FT                   /old_locus_tag="KLTH-ORF11479"
FT                   /product="KLTH0D09702p"
FT                   /note="highly similar to uniprot|P06633 Saccharomyces
FT                   cerevisiae YOR202W HIS3 Imidazoleglycerol-phosphate
FT                   dehydratase catalyzes the sixth step in histidine
FT                   biosynthesis mutations cause histidine auxotrophy and
FT                   sensitivity to Cu Co and Ni salts transcription is
FT                   regulated by general amino acid control via Gcn4p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09702g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22694"
FT                   /db_xref="GOA:C5DET9"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:C5DET9"
FT                   /protein_id="CAR22694.1"
FT                   /translation="MNGTSNQGKTERRSFVSRNTNETKIQIALSINGGHVEIKDSILPK
FT                   KAADIASQATSSQIIDIHTGVGFLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDCG
FT                   IALGEAFKEAVGAVRGVKRFGHGYAPLDEALSRAVVDLSNRPYAVVDLGLKREKIGDLS
FT                   TEMIPHFLESFAEAARITLHVDCIRGFNDHHRSESAFKALAIALRESLSSNGTNDVPST
FT                   KGVLM"
FT   gene            complement(<802972..>804027)
FT                   /locus_tag="KLTH0D09724g"
FT                   /old_locus_tag="KLTH-ORF11478"
FT   CDS_pept        complement(802972..804027)
FT                   /locus_tag="KLTH0D09724g"
FT                   /old_locus_tag="KLTH-ORF11478"
FT                   /product="KLTH0D09724p"
FT                   /note="similar to uniprot|Q02950 Saccharomyces cerevisiae
FT                   YPL118W MRP51 Mitochondrial ribosomal protein of the large
FT                   subunit MRP51"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22695"
FT                   /db_xref="InterPro:IPR016712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEU0"
FT                   /protein_id="CAR22695.1"
FT                   /translation="MSSNLSHLLRNSRIAQVPKSKKPLTSAAPKYAPTHQIIETRPSTL
FT                   HRQEWGLKAAVPSKIKTKYIVFNDLDTLERLTTFEPNGGSQWNRIRFQELGVAPKYNPG
FT                   KANPLFEANASSKTQLVPLSALLNVNTSTPKPEVRRRLAEIKDLRSTFKKWLLEHDPEA
FT                   LLNKSFSAKDMTDSAVEFLAEKTDLNVNLASASLRKVVGTGGLTYNLHGRLRNSPNGVV
FT                   SRTVVPGRFLNVEGNDRLAAIGGFVANAGSSSVTTSQMDYRMGDFVRQLQFPFAVNHAT
FT                   VQDNGKVVLRANVISGMSSKARIQMNSRYYQQRPPRKVMRTASAEESTKHAEELLNILT
FT                   NFDSGKSKKLR"
FT   gene            <805863..>807728
FT                   /locus_tag="KLTH0D09746g"
FT                   /old_locus_tag="KLTH-ORF11475"
FT   CDS_pept        805863..807728
FT                   /locus_tag="KLTH0D09746g"
FT                   /old_locus_tag="KLTH-ORF11475"
FT                   /product="KLTH0D09746p"
FT                   /note="similar to uniprot|P06634 Saccharomyces cerevisiae
FT                   YOR204W DED1 ATP-dependent DEAD (Asp-Glu-Ala- Asp)-box RNA
FT                   helicase required for translation initiation of all yeast
FT                   mRNAs mutations in human DEAD-box DBY are a frequent cause
FT                   of male infertility"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09746g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22696"
FT                   /db_xref="GOA:C5DEU1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEU1"
FT                   /protein_id="CAR22696.1"
FT                   /translation="MSDLANKMENMNLGEDSKGASSYVPPHMRGKRGGNRAPSSFQSGG
FT                   DGDGASYFGGRGGSRDNRGSSFFSGGGRGGSRGFGGRSEGRGSIRGVGRWVNGKHVPSD
FT                   KDEQLELQLFGTPEDPGFQSSGINFDHYDDIPVEASGNDVPEPITEFTSPPLDQLLLDN
FT                   IIKARFTKPTPVQKYSVPIIAARRDLMACAQTGSGKTGGFLFPVLSESFANGPAPVPEQ
FT                   ASNFYIKKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRPCVVYGGADIGSQIKELNR
FT                   GCDLLVATPGRLSDLLERGRISLCNIKYLVLDEADRMLDMGFEPQIRHIVEGCDMPSVD
FT                   ERQTLMFSATFPMDIQHLARDFLKDYVFLSVGRVGSTSENITQHVLYVEDMDKKSALLD
FT                   LLAASDDGLTLIFVETKRMADALTDFLIMQNLRATAIHGDRSQSERERALAAFRSGKAS
FT                   LLVATAVAARGLDIPNVTHVINYDLPNDIDDYVHRIGRTGRAGNTGVATAFLNRGNKNV
FT                   VKEMVDLLTEAKQEVPEFLKQLARESSGSRGGARGGGFSSRGNSTRDYRRVGGGAPSYG
FT                   GSSRGGSSMGGGRGGSSWGSSWGNSGSSWGNTGSTGNSSASNSWW"
FT   gene            <808766..>808837
FT                   /locus_tag="KLTH0D09768r"
FT                   /old_locus_tag="Klth0D.tCys.GCA.10"
FT   tRNA            808766..808837
FT                   /locus_tag="KLTH0D09768r"
FT                   /old_locus_tag="Klth0D.tCys.GCA.10"
FT                   /note="tRNA-Cys (GCA) cove score=75.27"
FT   gene            complement(<808930..>810450)
FT                   /locus_tag="KLTH0D09790g"
FT                   /old_locus_tag="KLTH-ORF11469"
FT   CDS_pept        complement(808930..810450)
FT                   /locus_tag="KLTH0D09790g"
FT                   /old_locus_tag="KLTH-ORF11469"
FT                   /product="KLTH0D09790p"
FT                   /note="similar to uniprot|P87331 Saccharomyces cerevisiae
FT                   YPL122C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22697"
FT                   /db_xref="GOA:C5DEU2"
FT                   /db_xref="InterPro:IPR004598"
FT                   /db_xref="InterPro:IPR040662"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEU2"
FT                   /protein_id="CAR22697.1"
FT                   /translation="MSSTLFKATVTEYLQELPAQVHSRLYSSPATCLAIYRLLPKLAKF
FT                   FIMSLVFNETDASLRDLDRWVKSGGKYQFNEAIKSMKSLHLLIEGNSGQPFMINLNPIF
FT                   RSSFRNALTGGEVNNSFGNVVEDENETVHTSILDQYAANKWETILHFMVGTPLTQTPSR
FT                   NVLSLLQHSKLMEESSSGELQITNEGFQFLLQDANAQIWALLLQYLRLAETLQMDPVDV
FT                   LNFIFMLGALELGKAYSDTNLSDTQKIMLQDMRDYGLVFQKASNTHKFYPTRLTAMLTS
FT                   DTSSIRSASGAMNSVLSQGTSSSKEEAAAVAETDEETAQVGGTTQNIPDGAVILETNFK
FT                   LYSYSNSPLQIAVLSLFVHLKSRFSNMVTGQITRESIRRALHNGITADQIIAYMETHAH
FT                   PQMRRLAEQTLDKKMELDPNCNEGLQILPPTVVDQIKLWQLELDRIISYDGYLFTDFEN
FT                   FQEYNMLSSYAKDIGVLLWSDDKKKRFFVSQEGNSQVIDYAKRKLKKK"
FT   gene            <810820..>814254
FT                   /locus_tag="KLTH0D09812g"
FT                   /old_locus_tag="KLTH-ORF11468"
FT   CDS_pept        810820..814254
FT                   /locus_tag="KLTH0D09812g"
FT                   /old_locus_tag="KLTH-ORF11468"
FT                   /product="KLTH0D09812p"
FT                   /note="highly similar to uniprot|P22276 Saccharomyces
FT                   cerevisiae YOR207C RET1 Second-largest subunit of RNA
FT                   polymerase III which is responsible for the transcription
FT                   of tRNA and 5S RNA genes and other low molecular weight
FT                   RNAs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09812g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22698"
FT                   /db_xref="GOA:C5DEU3"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEU3"
FT                   /protein_id="CAR22698.1"
FT                   /translation="MSTAAVATPHDHFEKDSAFEQLLKPVYKGKKLTDEINTAEDKWNL
FT                   LPAFLKVKGLVKQHLDSFNYFVDVDLKKIIKANQLILSDVDPEFYLKYVDIRVGHRSTS
FT                   SSKDYIVPPHECRLRDMTYSAPVYVDIEYTRGRNIIMHRDVEIGRMPIMLRSNKCILNG
FT                   ASEKDMAKINECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKAIVQASVTSST
FT                   HERKSKTYVITKNDKIYLKHNSIAEEVPIVLVLKACGIVSDLEIMQLVCGNDSSYQDIF
FT                   AVNFEEVAKMKIYTQQQALEYIGSKVKTVRRQKLSTLQEGIEAIATTVIAHLTVEALDF
FT                   REKALYIAVMTRRVVMAMHNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKKFNNDFKA
FT                   NIDKVLKKPNRAMEYDALLSINVHSNNISSGLNRAISTGNWSLKRFKMERAGVTHVLSR
FT                   LSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPEGEACGLVKNLALMTH
FT                   ITTDDEEEPIKKLCFLLGVECINVVDSDSLHLNYCVYLNGTIVGVIRFPTKFVSHFRNL
FT                   RRSGKVSEFISIYTNSHQKAVHIATDGGRICRPLIIVNEGKSLVTAQHLRQLLDGHLQF
FT                   DDFLKLGLVEYLDVNEENDSFIALYERDLEPRITHLEIEPFTVLGAVAGLIPYPHHNQS
FT                   PRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKLPAGQNA
FT                   TVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRRKLTTVLKRYPNHTQDMVGGMRVDES
FT                   GEPIWQHKPLGPDGLGEVGMKVESGQIYVNKSVPTNASDSVLTQSQAQYRETPVVYRAP
FT                   EPSHIDQVMMSVSENDQALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVNHEDLPFND
FT                   QGVVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGSLEYGTCFGGSKLENMSQILVNH
FT                   GFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEG
FT                   RSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCNKCGLMGYSGWCTSCKG
FT                   AENVIKMTIPYAAKLLFQELLSMNIAPRLKLEDVFEQ"
FT   gene            complement(<814355..>815002)
FT                   /locus_tag="KLTH0D09834g"
FT                   /old_locus_tag="KLTH-ORF11464"
FT   CDS_pept        complement(814355..815002)
FT                   /locus_tag="KLTH0D09834g"
FT                   /old_locus_tag="KLTH-ORF11464"
FT                   /product="KLTH0D09834p"
FT                   /note="similar to uniprot|P32489 Saccharomyces cerevisiae
FT                   YPL121C MEI5 Meiosis specific protein involved in DMC1-
FT                   dependent meiotic recombination forms heterodimer with
FT                   Sae3p proposed to be an assembly factor for Dmc1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22699"
FT                   /db_xref="InterPro:IPR018468"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEU4"
FT                   /protein_id="CAR22699.1"
FT                   /translation="MAITNASLTIHRKPFKTPFVSSVKRGGSLGSKTLPSKEIIHPNRQ
FT                   ASKEERIVNEQLNKVRRENTTLQNSLKILRKYERELEVLELIDKWRSICQAGMAFLLNS
FT                   TLLKVNKMGGYEELIRKEVEAEKRKLEYQFAGRLQDEVDEVLESEEFKALPELEQQWLR
FT                   RDLQQKVDSNEQLQQEEIKKLDLKLTESSNKQMTMRELANRLKVDYALVFEE"
FT   gene            complement(<815253..>817409)
FT                   /locus_tag="KLTH0D09856g"
FT                   /old_locus_tag="KLTH-ORF11463"
FT   CDS_pept        complement(815253..817409)
FT                   /locus_tag="KLTH0D09856g"
FT                   /old_locus_tag="KLTH-ORF11463"
FT                   /product="KLTH0D09856p"
FT                   /note="similar to uniprot|P39744 Saccharomyces cerevisiae
FT                   YOR206W NOC2 Protein that forms a nucleolar complex with
FT                   Mak21p that binds to 90S and 66S pre- ribosomes as well as
FT                   a nuclear complex with Noc3p that binds to 66S pre-
FT                   ribosomes both complexes mediate intranuclear transport of
FT                   ribosomal precursors"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22700"
FT                   /db_xref="InterPro:IPR005343"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEU5"
FT                   /protein_id="CAR22700.1"
FT                   /translation="MGKVSKSTKKFQTKHLKHTLDHRRKQKHHNKKIQGRRGNKSEEEK
FT                   RNAALTKEEQKLRDSSKEEVFKDMSVEDFFAGGFDVPKNKGPKAVKAKAPKAENDSEDS
FT                   SSEDEDGMSENMANLADKDPEFYKYLQENDKDLLDFKPSNPLDNISDDEGEDDEDEEQT
FT                   TEAAPGKQDKSNDTVEVDLKLVRKWKKDLNSAFSVKLIRNIVSSFKAAVNANKEELVDE
FT                   YKYAVVDEKAFQELMFLALKDMPAAIQKAHPYHVSKGARTLSNNSNVNKIASALKSHAG
FT                   SMITLLHDITNTETAALVLHSLDQVFPYFLSHRRILKEIIKSVVEIGATTRDLDTQITA
FT                   FAFLNNSSREFRKSILDTVLRTTYSSFVKSCRKTNIRTMPLINFQKNSSAELFGIDEVL
FT                   GYQVGFEYIRQLAIHLRNSINASTKQTANSNPADAYKIVYNWQFCHSLDFWSRVLSSQC
FT                   HPDKEGGKESQLRQLIYPLVQVTIGVIRLIPTAQFFPLRFYLIKSLIRLSQNTGVFIPI
FT                   YPLLSEILTSTAFTKVPKKKSTLPTFDFEHNIKCNQGYLGTKVYQDGLGEKFVELLCEF
FT                   YVLYCKNVSFPELVTPAVIALRRYIKTSKNFKFNKQVSNVLEKLKQNSEFILNKRSEID
FT                   FGPTNRSEVARFLADLPWNKTPLGSYVQVHREVKEEKARILRESLAEEEENHVKSTSDD
FT                   EGANALEEDEEDEEDAEMSDASRE"
FT   gene            <817653..>819260
FT                   /locus_tag="KLTH0D09878g"
FT                   /old_locus_tag="KLTH-ORF11461"
FT   CDS_pept        817653..819260
FT                   /locus_tag="KLTH0D09878g"
FT                   /old_locus_tag="KLTH-ORF11461"
FT                   /product="KLTH0D09878p"
FT                   /note="similar to uniprot|Q08622 Saccharomyces cerevisiae
FT                   YOR205C FMP38 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09878g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22701"
FT                   /db_xref="GOA:C5DEU6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DEU6"
FT                   /protein_id="CAR22701.1"
FT                   /translation="MLPVSRLCVRSSLRKLVFVRFVSCTSCGVTLQNNNVRGTGFYTPP
FT                   KAQIERKRPVIEDLKYLLFSQDLQSLKSELSAEERPKKNKPLICKRCNDALHHNTFSKE
FT                   DFRRYSMQEVYRHVPAGADIYHVVPLTDFPLQLNSAVLKDSRYNSALLLSKGDQVTPDK
FT                   SLLQRKAPQFFKDMLRLKMNYNSNKSIAFSASKGWNIQSVYSVLRSNSFLIGCPNSGKS
FT                   TLVNALLKKFPSLKPSEGNNASEAEIVRGAGVSNIPNMTRDLQSYNIGSKVINDLPGYS
FT                   TNYGSPGPEDALDAKVLEKIQKTHLFKKTKLVKQRYTSLKGTDAGRCYTVSGIFYLVPP
FT                   PDTINQVVNYIPGNERQYRNIDKALSVVNSEHACPEKGPLRQYVGVQKAMESKDNYVRH
FT                   VLPPFQGSIEVVLKEIGYFQLKTTGKYKFLGLHEVWVPKGVDVCIREPIARLIDEGYEG
FT                   YLSSEGKKKAIPEKREVFSATYPMSFEETDTLQKMKEMFLERTKNDVLARKFISSNPLK
FT                   IIGTAQKEAPNLYWYYKW"
FT   gene            <819367..>820740
FT                   /locus_tag="KLTH0D09900g"
FT                   /old_locus_tag="KLTH-ORF11459"
FT   CDS_pept        819367..820740
FT                   /locus_tag="KLTH0D09900g"
FT                   /old_locus_tag="KLTH-ORF11459"
FT                   /product="KLTH0D09900p"
FT                   /note="similar to uniprot|Q02948 Saccharomyces cerevisiae
FT                   YPL120W VPS30 Protein required for sorting and delivery of
FT                   soluble hydrolases to the vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22702"
FT                   /db_xref="GOA:C5DEU7"
FT                   /db_xref="InterPro:IPR007243"
FT                   /db_xref="InterPro:IPR038274"
FT                   /db_xref="InterPro:IPR040455"
FT                   /db_xref="InterPro:IPR041691"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEU7"
FT                   /protein_id="CAR22702.1"
FT                   /translation="MGDDEVLKCQNCQVPLEIDSSLIDLSLAQRSLLMNTATEPSVPTG
FT                   IIPPDRLRRLGSVKKGGSLNLQPSVLNSLDSYVFLGGESSTLQQTRWDGESGDEADDSA
FT                   TTKTLSSRVGTLTNIFNVLSSKSNIDYPVCQDCCDLLIQKLKGEYEEALKERDTYSEFL
FT                   YRLKKQRELESYATSKPHMVSESGGVDTKKEQEELLNELIELEKTEAELDSTIEDLESE
FT                   LQAKNDQEIAELEVMNSRDLEKLEFMSELQSLKNQYESTLNNLDKLRKTNVYNETFRIS
FT                   HDGPFGTINGMRLGGLDDKPIPWQEINGALGQVILLLATICARLKFKLNGYVLRPMGSF
FT                   SKIEKLDPKDQEWHSYDAFSDGSFKLGRFFHKETSFDRAMVSILEVISQITSRLSMERS
FT                   SDSEEIELPYNMHGDKINGMAVKLCGNKPGLEWTTACKFVLTNCKWLLAFSSSMINDF"
FT   gene            <820901..>823504
FT                   /locus_tag="KLTH0D09922g"
FT                   /old_locus_tag="KLTH-ORF11458"
FT   CDS_pept        820901..823504
FT                   /locus_tag="KLTH0D09922g"
FT                   /old_locus_tag="KLTH-ORF11458"
FT                   /product="KLTH0D09922p"
FT                   /note="highly similar to uniprot|P21524 Saccharomyces
FT                   cerevisiae YER070W RNR1 Ribonucleotide-diphosphate
FT                   reductase (RNR) and to YIL066C uniprot|P21672 Saccharomyces
FT                   cerevisiae YIL066C RNR3 Ribonucleotide- diphosphate
FT                   reductase (RNR), large subunit; the RNR complex catalyzes
FT                   the rate-limiting step in dNTP synthesis and is regulated
FT                   by DNA replication and DNA damage checkpoint pathways via
FT                   localization of the small subunits"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09922g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22703"
FT                   /db_xref="GOA:C5DEU8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEU8"
FT                   /protein_id="CAR22703.1"
FT                   /translation="MTVKTVVSDRNGEANKLTSQALAQSLKQLAGGLQIEDADFDAVSR
FT                   RILDAVPPSATHSSVVQFGGEVLAAMSTTHPDFANLAARWEISELHKKLQGLSFTENLA
FT                   LLQKLRSSSKAPTVKRHKTSTSHNDKNLISAAFYEMALRYQTTLDAAIQPDRDFDFSYF
FT                   GWKTLSKSYLIKRKNEETHETPQFLFMRVALAIHGPRGDIDAVLETYDLMSRKFFIHAS
FT                   PTLFNAGTVNQYLSSCFLVAMIEDSIDGIYRTLHKTAMISKASGGVGVHVSNVRGTGAY
FT                   ISGSNGTSNGLVPMLRVFNNTARYVDQGGNKRPGAFCIYLEPWHSDVLDFLQLRKNQGK
FT                   EELRARDLFLALWIPDLFMERVEQNGSWCLFSPDEAPGLQECFGEEFKKLYETYEKTLA
FT                   PAKKMPAQKLWSEILQSQVETGGPFMLYKDSCNNKSNQKNLGTIKSSNLCCEIVQYSSP
FT                   SETAVCNLASVALPSFVKLQREQAIFDFESLHKIVKVLTKNLDSVIDICDYPVEDAKFS
FT                   NEKNRPIAIGVQGLADALMILRIPFHSESARVLNKQIFETIYHAAVETSIERSKKLGPY
FT                   PSFDNSPVSRGEFQFDLWGLNDDNYEFLFSDWKEMREKVKQHGIRNSLLVGPMPTASTS
FT                   QILGFTESFEPMTSNIYTRRVLSGEFTVINKYMVDDFCRLGIWNEKLKNRIIEQNGSIQ
FT                   GIEGIPSNLKELYRTVWEIPQRVMIDLSADRGPFIDQSQSLNLFLREPTMGKLTSMHFY
FT                   GWKKGLKTGMYYLRTQAASGAIKFTINQENTLRGAVSIRKGLEVKQLSVFGHYPSSCKP
FT                   HLHIKVAKDKRHEMSNSSDTSDKFRGDDDHFGIHNSQQLACSNDRTDANCESCSG"
FT   gene            <823988..>825292
FT                   /locus_tag="KLTH0D09944g"
FT                   /old_locus_tag="KLTH-ORF11455"
FT   CDS_pept        823988..825292
FT                   /locus_tag="KLTH0D09944g"
FT                   /old_locus_tag="KLTH-ORF11455"
FT                   /product="KLTH0D09944p"
FT                   /note="similar to uniprot|Q02933 Saccharomyces cerevisiae
FT                   YPL123C RNY1 RNAse member of the T(2) family of
FT                   endoribonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22704"
FT                   /db_xref="GOA:C5DEU9"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR033130"
FT                   /db_xref="InterPro:IPR033697"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEU9"
FT                   /protein_id="CAR22704.1"
FT                   /translation="MRIPIEALSLESLGLFSKLEHNNFKEKFPSCPSDLPLSCSNHTVI
FT                   NDSCCFEYPGGIMLQTQFWDYVPPRNMDSGRWNSDLEKHLGPNTSFTNHGLWPDNCDGR
FT                   YEQFCDSSRQIDDVYHLLTSEEFNKEGMEIQGKELLEQMGKLWKSNTGDDESLWIHEFN
FT                   KHATCIKTLQPSCYARWDGNEEAISEDHEKQAVFDYYRIAMKLYGELDTFQTLEKHGIV
FT                   PSVGKSYSRKQISEALNSDFKGKDVFFKCDRNKALNEIWYYHLLQGSLLGEQFEPIDSL
FT                   RPRSNCPEEGIKFYPKGHRPHNGGRPGGGNRGQRGIIRVSGYNGFIIRNGHWMTTGTPA
FT                   NFDLIKAPFGNYYLKSRTGYCGSDNKHEGVLVCNKGISSASQFDYDETKGFLGLSGSFA
FT                   WHANEYPRGRRQAQIYTGSPEDSKYPLKLKFVKLH"
FT   gene            complement(<825335..>825985)
FT                   /locus_tag="KLTH0D09966g"
FT                   /old_locus_tag="KLTH-ORF11453"
FT   CDS_pept        complement(825335..825985)
FT                   /locus_tag="KLTH0D09966g"
FT                   /old_locus_tag="KLTH-ORF11453"
FT                   /product="KLTH0D09966p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22705"
FT                   /db_xref="GOA:C5DEV0"
FT                   /db_xref="InterPro:IPR031392"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEV0"
FT                   /protein_id="CAR22705.1"
FT                   /translation="MSQPGLSAFLSNPETDDTLQNIRREYLASKKNLQNLLVTSPTRAR
FT                   TRPLQQIPTPPINGSKERADDDKLRQQLREGLQPDRFMNRPPQVPIPTAARSDIENLRS
FT                   MLYSQQRVIDELTRGLDAQVIRNSALENRVSMLERYITRLESQGNSRSPEPQLVDEGIS
FT                   RRLRQQYTPLYTDDENTRVLLNSGAVDRPDRQISNFDDSTTKLLQIARDTSRW"
FT   gene            <827667..>830237
FT                   /locus_tag="KLTH0D09988g"
FT                   /old_locus_tag="KLTH-ORF11447"
FT   CDS_pept        827667..830237
FT                   /locus_tag="KLTH0D09988g"
FT                   /old_locus_tag="KLTH-ORF11447"
FT                   /product="KLTH0D09988p"
FT                   /note="similar to uniprot|P29461 Saccharomyces cerevisiae
FT                   YOR208W PTP2 Phosphotyrosine-specific protein phosphatase
FT                   involved in the inactivation of mitogen- activated protein
FT                   kinase (MAPK) during osmolarity sensing dephosporylates
FT                   Hog1p MAPK and regulates its localization localized to the
FT                   nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D09988g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22706"
FT                   /db_xref="GOA:C5DEV1"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEV1"
FT                   /protein_id="CAR22706.1"
FT                   /translation="MSQAHLGMRHSGTAVHLGSPKNQAFMNTAATCVDLTKGQYYAAHV
FT                   QPCESLGDARQLENALFIDLSQCGTQLPLPNCKQVHLKFPSTLLRRPKFQFSQLVQTLD
FT                   HETQRVLEEEVPRRSTYVFYDEGSSLQSCSFNTSHILAKIVPYLYQQQRDIRLFFLQGG
FT                   AAQPQEKPAHQHPPFARPPHPTSTRSSSGIRKAAPSKHNMNLKITIPSRNLRTDNSNYM
FT                   FIQSFKKDSVHYSPDSLQKYFTFHMPSKIESDDQTLPAWLKSFSKDGNKNLLRILTSFE
FT                   HLEKLEVQRLERCLQSFKDEQGSQTGRDARPPVANDNSSRSQRPRVEKLYSFREMQKQF
FT                   QPNRHDYDSDNDSYHQSEEAKLKMDISEELNDGENKKMLLKLKKAKEDFNPYSSDTKDS
FT                   EECSDVAREAGTNEDDEEVAETPMDDYLLTRGIQSFTKNRYSNILPYEHSRVKLEPSPI
FT                   WAENKNDQFANTGAPGPKSPAGCTVRRRRNSYFSQDCSNDRDAEQACPPRQENSRSSLM
FT                   PPSMSLESRSSAASPHKSASESESFNDYFNANYLKIPQINPDYNYIATQAPLPSTLDDF
FT                   WKVVIANNVKVIISLNSDDELSLRKWDVYWNSSTLKKFDVRVNKTYENVAGVEGCILRV
FT                   FDVRRHISYEASSAEGPKNSGSANTVKSESNDSSAQGFEGNENSKNSSDSKFSPSYTVC
FT                   QLQYTKWLDSCGIVMSDVLKLHRIKTYLSSDAEGFIKSVQDGKVYEAIMKSDNEVPKNI
FT                   SAFDQKKNEVSAPVLVHCSAGCGRTGVFITLDYLLNVLEHPTDRSNRIDVWNMSQDLIY
FT                   IIVNELRKQRISMVQNLTQYITCYEGILEYFGLRKSAGRDATVY"
FT   gene            complement(<830376..>833480)
FT                   /locus_tag="KLTH0D10010g"
FT                   /old_locus_tag="KLTH-ORF11444"
FT   CDS_pept        complement(830376..833480)
FT                   /locus_tag="KLTH0D10010g"
FT                   /old_locus_tag="KLTH-ORF11444"
FT                   /product="KLTH0D10010p"
FT                   /note="similar to uniprot|Q02932 Saccharomyces cerevisiae
FT                   YPL125W KAP120 Karyopherin with a role in the assembly or
FT                   export of 60S ribosomal subunits"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10010g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22707"
FT                   /db_xref="GOA:C5DEV2"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEV2"
FT                   /protein_id="CAR22707.1"
FT                   /translation="MGDGSLALTELDLVQVLGQASDPRHAGSQAQRFAEQQLKLWETQK
FT                   GFHFLLQSVYLNLSCPLDVRWLAIIQFKNGVEKYWRSTRINAIGKDEKASIRARLFDLI
FT                   DENNNQLGIQNSQAAARIARLDFPGDWPTLFEDLEHLLGTEAIWQDNVRMFNLLLIMNQ
FT                   MIKTLATARIGRCRPAMQSKSPLVFPLLVRTYLKAFNEWTSAASVDEESLSQIQVSYLA
FT                   LKVLRRLVTEGCETPHRNVSIAEFLQISINHFELLMTHFDNYKGFDNFEKFVRCYGKLY
FT                   YSLICASPSNFILLPCSLQVLTAFTKLLIERAPDVYRENAEVDGNFWEQIAIRSFLILK
FT                   RLINFIHKKGAVTIKAKNDKYEVDVAVKRITSEFLNENLIKKWVDLLMDWYLKLRKSDL
FT                   EDWSLDPEEWINEQLATSYEYQIRPCAENFFQDLINSFPDLLVPYLLNKIQTEASSLNN
FT                   SVEDLLKKDAIFASFQLSATSISEAVDFDTLLVNVFLPEALNPQQLPEFSKIVKRRVAL
FT                   VINEWSTIKCSEESKQACYKFFYKILTEEEDKVVRLTAIQSLRTLVDDWNFDKNSFQPY
FT                   LDDFVVVLLKRTLPSVSLTETRLYVLNTLSDIIVQTKPLVSRNLLVEILQVVPELWELS
FT                   MNDSSESILANALLRLLRRAIDSLGKNSPATWQISLPITLAACDPSSPQYSLLYEDGFE
FT                   LWQSLLQNYSPSEQALDETFFKLVPFLKNAVQNQTEILPTLLEIVKSYALVLPESQFLN
FT                   NECFFFAFSHLSGYLLKLRDDSFDIVLSILDILTLARDPDNDRLLLEFLLETGMLPSIF
FT                   NALFREDQISLFQAGQLLQTIARIAYFDPGSIIQLLERYRSALPTSERNSLLPLEERKA
FT                   LSVETPLENVINKLVTIWILCFKDFFDPRVRKIHILGLSSMLRTQYPAVISEIASIVSL
FT                   WVEFLEETNETTNGDCEKYYINDPAYGESQDDSEEHILTCEHQRLQKLVSERDPAHNVS
FT                   LKEHITYTLQYLETEMGPQFQTLLSSVDEALIQDLRLFLSIPAQK"
FT   gene            complement(<833709..>834998)
FT                   /locus_tag="KLTH0D10032g"
FT                   /old_locus_tag="KLTH-ORF11441"
FT   CDS_pept        complement(833709..834998)
FT                   /locus_tag="KLTH0D10032g"
FT                   /old_locus_tag="KLTH-ORF11441"
FT                   /product="KLTH0D10032p"
FT                   /note="highly similar to uniprot|P39683 Saccharomyces
FT                   cerevisiae YOR209C NPT1 Nicotinate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10032g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22708"
FT                   /db_xref="GOA:C5DEV3"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEV3"
FT                   /protein_id="CAR22708.1"
FT                   /translation="MTGPVIKSLLDTDMYKLTMYAAVLQNMPDAEVIYKYTNRSSHMTF
FT                   NKEAIEWLEQEVRVLGDLKFGKDEIEYLKTAIPYLPDEFLKYISNGQPKICPSDQISLS
FT                   TEPADAPERYHIKIQVKGLWRDTILYEIPLLSLISEAYFKFVDTDWTYENQEERAYQKA
FT                   KKLIENDINFSEFGSRRRRSLEAQDLVLKGIIKAVEETGEKGRKCFAGTSNVLFAKKYG
FT                   VKPVGTVAHEWMMGVASVTKDYVNANKLAMDYWIKTFGPENAGLALTDTFGTDNFLKTF
FT                   IPPYSDYYAGVRQDSGDPVQYAKKIAHHYFDVLKYPRFSKLICFSDSLNPEKAIQYSQA
FT                   AHDCGLKATFGIGTNFTNDFHSSEDSVKVSEPLNIVIKLLEVNGNPAIKISDNMGKNMG
FT                   DPRTVRRVKEELGYIERTWAGDNEAHRWAS"
FT   gene            complement(<835206..>837818)
FT                   /locus_tag="KLTH0D10054g"
FT                   /old_locus_tag="KLTH-ORF11438"
FT   CDS_pept        complement(835206..837818)
FT                   /locus_tag="KLTH0D10054g"
FT                   /old_locus_tag="KLTH-ORF11438"
FT                   /product="KLTH0D10054p"
FT                   /note="similar to uniprot|Q02931 YPL126W Saccharomyces
FT                   cerevisiae NAN1 U3 snoRNP protein component of the small
FT                   (ribosomal) subunit (SSU) processosome containing U3"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10054g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22709"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEV4"
FT                   /protein_id="CAR22709.1"
FT                   /translation="MGQSVVHQKYKLSVVSGGKLVLPRASNRSCCNKSVTLLTRDETCV
FT                   VVPFNNQIKVYSLETSQCVKTLKFANNAVLSRLFLGADAASICDLALGDLTLAEGGTAD
FT                   GAHSDDTFDFSVITSVGDVVVLNYKGKLADEPKVIQLGTLQPNEQVVKLFRFGGRVSVL
FT                   TSEAETSATYTYRIYSYDNSERKLSERKRFEHVLLSAWSSNDKFLCLLAKGQNSKKVLY
FT                   LEDIHDQIDSKTLPLPSIASASASSNAHFATVMALDHQGSQLAVGYASGVINVINLTDQ
FT                   STRLLKWHIDSVLSLCFTSDGTYLLSGGWEKVLSFWQLSTNLQQFLPRLNGVVVDCNIL
FT                   HDKFYSLGLQFADNQSNSDYQLLLLNSTDLKSRIAISGPLCVFQTAVRDVVYPVSAVSS
FT                   KASASSADLQKANKKQQRKLLKRRRQDFSSVFEIQPSTKHLYFPHTSAVQIFDFYKNEQ
FT                   IHYQYLASGLNNSMGKVRSELNLKDPVIADVKFTKDGNWMISYEVEYPPEGLLSSNDFS
FT                   HVLKFWRMSASGEWELQTKVLSPHGLKTPITSILVAPRSVNNSLGCLTSDNNGGLKYWS
FT                   FDEVLNNWALSKVAVPSVNHFSNSVELAWSLDGSLIFHAFDDKVTVIEFAAFKKFYEDS
FT                   AKALNEFTMDSAIQSIMLVNDSNLIVATQTSLNSINLLLGVVESSFDLYPFVNGVYKNG
FT                   HASRLISCDEKNGRVALVVNHKTLDAEGRPTLNYASHVLVFNSDLSQKLGAFEHDEYIS
FT                   CIRWNFDTDFIFLDTKNRLGVVSTTTSPEMLDEVDKEGALDQLASNEFEIELQKLTRAQ
FT                   KAQGLEPETDEKEEALLDFINGDKSGKLINMNSFTSMFENIENVQMDTLFDRVMKVIT"
FT   gene            <838105..>838317
FT                   /locus_tag="KLTH0D10076g"
FT                   /old_locus_tag="KLTH-ORF11435"
FT   CDS_pept        838105..838317
FT                   /locus_tag="KLTH0D10076g"
FT                   /old_locus_tag="KLTH-ORF11435"
FT                   /product="KLTH0D10076p"
FT                   /note="highly similar to uniprot|P22139 Saccharomyces
FT                   cerevisiae YOR210W RPB10 RNA polymerase subunit ABC10-beta
FT                   common to RNA polymerases I II and III"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10076g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22710"
FT                   /db_xref="GOA:C5DEV5"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEV5"
FT                   /protein_id="CAR22710.1"
FT                   /translation="MIVPVRCFSCGKVVGDKWEAYLNMLQEDELDEGTALSRLGLKRYC
FT                   CRRMILTHVDLIEKFLRYNPLEKRD"
FT   gene            complement(<838429..>841023)
FT                   /locus_tag="KLTH0D10098g"
FT                   /old_locus_tag="KLTH-ORF11434"
FT   CDS_pept        complement(838429..841023)
FT                   /locus_tag="KLTH0D10098g"
FT                   /old_locus_tag="KLTH-ORF11434"
FT                   /product="KLTH0D10098p"
FT                   /note="similar to uniprot|P32266 YOR211C Saccharomyces
FT                   cerevisiae MGM1 Mitochondrial GTPase related to dynamin
FT                   present in a complex containing Ugo1p and Fzo1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10098g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22711"
FT                   /db_xref="GOA:C5DEV6"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEV6"
FT                   /protein_id="CAR22711.1"
FT                   /translation="MLQLTGRAVPITRQAIVRQAIFRRGYYSPLRRVHPTSYYHSFVRP
FT                   SRFLYVSHEAIHQLSHKRNASFFPKMIARVIRVPAYIGGGAAAVSSYLAYKLEEATHFS
FT                   HNKLAQLKELAQTMKERFGDTFGRQGPDGDNGGEGTEGEEALATGALLASLDNNDAEAK
FT                   RANEEDDDDDDEEEDNTESEILNLTKQMIEIRSILNKVDSSSANLTLPSIVVIGSQSSG
FT                   KSSVLESIVGKEFLPKGSNMVTRRPIELTLVNTASSNETTADFPSLRAYNIKDFNEVKR
FT                   ILMELNMAVPSTEAVSADPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPYELKSKIRQV
FT                   CETYLAEPNIILAISAADVDLANSSALRASKVADPKGTRTIGVITKLDLVEPARAREIL
FT                   NSKKYPLKMGYVGVITKSPGSQSRLFDSGSKSGLFKRNTNKEVELEQTRSFERNYFREN
FT                   KSVFTNCQVSTKRLREKLIKILEVSMSNALEPTSRVIQQELDDTSYLFKVEFNDRQLTP
FT                   KSYLLNNVDILKLAIKEFQEKFNRYELKSILKADLDQRVLDLLASRYWKDENLQELSSK
FT                   KSEKDESSALYWHKKLELSSSSLTKIGVGRVSTTLVTNAILRELENILDMTQLKNHDLI
FT                   KELVNNTAVNVLNTKYYATADQVENCIKPFKYEIDLEERDWSVAVDHSTKLMREELRQC
FT                   NERLQAIKNTVGSRKLQQVTTYLQQDSARQETLGFSALLLERGREAAFLEKRSQLLSFR
FT                   LKTLKNRCHSTADKDICPEVFLNAVSDKLTSTAVLFLNVELLSDFFYNFPIELDRKLTA
FT                   LSDEQVEMFAKEDPRIARHIELQKRKELLTLALERIDSILVFKKSYKNVSQP"
FT   gene            <841691..>842379
FT                   /locus_tag="KLTH0D10120g"
FT                   /old_locus_tag="Klth0D.mRNA.gf.310.p"
FT   CDS_pept        join(841691..841859,841922..842379)
FT                   /locus_tag="KLTH0D10120g"
FT                   /old_locus_tag="Klth0D.mRNA.gf.310.p"
FT                   /product="KLTH0D10120p"
FT                   /note="similar to uniprot|P53551 Saccharomyces cerevisiae
FT                   YPL127C HHO1 Histone H1, a linker histone required for
FT                   nucleosome packaging at sites"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10120g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22712"
FT                   /db_xref="GOA:C5DEV7"
FT                   /db_xref="InterPro:IPR005818"
FT                   /db_xref="InterPro:IPR005819"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEV7"
FT                   /protein_id="CAR22712.1"
FT                   /translation="MPSRVETKAKQTRLNSAVSAVKQKDTNKPSVKNAKPANKKVVKPS
FT                   VKPKSPLPTYKDMIIEGIATLGERNGSSRQALKKYISAKYPVGEGFENRFNLAIRRGID
FT                   SGDFSQPKGSSGPLKAVKKGPAKSEHVITPKPEVKDEIPKRRRSATKVKDNVTGVSPSK
FT                   EKRRGSATTVPKAKPQVSKNTKKAVSTKTPIAKPAKTAASRIKAA"
FT   gene            <843374..>844915
FT                   /locus_tag="KLTH0D10164g"
FT                   /old_locus_tag="KLTH-ORF11428"
FT   CDS_pept        843374..844915
FT                   /locus_tag="KLTH0D10164g"
FT                   /old_locus_tag="KLTH-ORF11428"
FT                   /product="KLTH0D10164p"
FT                   /note="some similarities with uniprot|Q02457 YPL128C
FT                   Saccharomyces cerevisiae TBF1 TTAGGG repeat binding factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22713"
FT                   /db_xref="GOA:C5DEV8"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013867"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEV8"
FT                   /protein_id="CAR22713.1"
FT                   /translation="MSEALPAKDTDPLKSDDIKTGKVIAELPPRTQLNINSIGLLDNVS
FT                   TQLLKLLMTSSIETLIGFTSAQSDGYQSEVFEMLFALFKQVKKVYTSAPLLVVQDIAPG
FT                   LWLEDEKCPYILKNQENLVLAAIRKANIVTYLLSIMGRLQYGFLFLDESFIEIFCPVAG
FT                   DLPFEAERALTTSLGRLLKPQAVLYLNLKTHAYISAIEPYRDNAEALSRVREEILDRIF
FT                   AKNMEQFILAKRRMRSSKLSPSEEDFVKRCVHRREKLQSQDSLDLLVAEYDWLEFFKEI
FT                   FFYLQRNISVLVWGKKGCDFASPGSDVSASDINADQPMSSLNNGSAESSRASSEPPVGK
FT                   PLSSSSSLRPSPAPLRDAASAKKLKQKRLWNKEEEGALIEALKVHGPAWSKILELHGAG
FT                   GSLSESLKNRTQVQLKDKARNWKMYFLKGGLPVPDYLAKVTGDLERDEKSKQRFKNKTK
FT                   KQAPTKTIGNVEKPHEPTQDLRKVANMSIVAQAGRSEFPIEEANASEMDPQLQAT"
FT   gene            <845352..>846617
FT                   /locus_tag="KLTH0D10186g"
FT                   /old_locus_tag="KLTH-ORF11425"
FT   CDS_pept        845352..846617
FT                   /locus_tag="KLTH0D10186g"
FT                   /old_locus_tag="KLTH-ORF11425"
FT                   /product="KLTH0D10186p"
FT                   /note="similar to uniprot|P18851 YOR212W Saccharomyces
FT                   cerevisiae STE4 G protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10186g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22714"
FT                   /db_xref="GOA:C5DEV9"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEV9"
FT                   /protein_id="CAR22714.1"
FT                   /translation="MIVKNGTSYEHSHHNQALPLAVDVENSVKDQIALARSDTRQLQDL
FT                   ITRVKAKVRDANLAQMSKNVPSLRGGSVNLASHLTLNGHNNKISDFAWSSDSQSILSAS
FT                   QDGFMIIWDAALGFKKNAIPLDSQWVLTCAINASGNLVASAGLTNNCTIYRISQENRIQ
FT                   QQIVSIFKGHTCYVSQVEFFGGNEVITASGDMTCALWDIPKAKRVAEFSDHLGDVLALA
FT                   LPPPKTQPEKTVFASGGSDGYVYIWDTRMRTAGQSFFVSESDVSTLKFFNNGNAILTGT
FT                   DDGIARMFDLRSDCVIAAYSLSQGLSQRTNSPGKQHSEFSLEYGLSPGKNSFTRATRSA
FT                   NSTYLDNQGIVSLDFSGSGRLIHACYTDYGCVIWDTLKAEIVGKLEGHSSRISGVKTSP
FT                   DGMAVCTGSWDATLKLWSPEYM"
FT   gene            complement(<846664..>847398)
FT                   /locus_tag="KLTH0D10208g"
FT                   /old_locus_tag="Klth0D.mRNA.2185.m"
FT   CDS_pept        complement(join(846664..847317,847390..847398))
FT                   /locus_tag="KLTH0D10208g"
FT                   /old_locus_tag="Klth0D.mRNA.2185.m"
FT                   /product="KLTH0D10208p"
FT                   /note="weakly similar to uniprot|Q99314 Saccharomyces
FT                   cerevisiae YOR213C SAS5 Subunit of the SAS complex (Sas2p,
FT                   Sas4p, Sas5p), which acetylates free histones and
FT                   nucleosomes and regulates transcriptional silencing;
FT                   stimulates Sas2p HAT activity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10208g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22715"
FT                   /db_xref="GOA:C5DEW0"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR016665"
FT                   /db_xref="InterPro:IPR038704"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEW0"
FT                   /protein_id="CAR22715.1"
FT                   /translation="MSILYVNRTVRIKTTQNIISEKSPVEGLPLRQWQVNVLILGPNGD
FT                   ESPAYIFEKCIYRLHPTFRNPIRTKIEAPFALEEKGWGEFTFSISCFFLRGAGEVEFLH
FT                   ELTFQDEVYYLDFNIKVPCHVPELRRVLELTGPVPEAVAPADLTYKTDMEKWIQKLLAS
FT                   DEELATNVVNKIMHHPAVAREVERKPLDECFVVDLRQLPESLLWDIGDYILNEPPVK"
FT   gene            complement(<847624..>848460)
FT                   /locus_tag="KLTH0D10230g"
FT                   /old_locus_tag="Klth0D.mRNA.2150.m"
FT   CDS_pept        complement(join(847624..848367,848452..848460))
FT                   /locus_tag="KLTH0D10230g"
FT                   /old_locus_tag="Klth0D.mRNA.2150.m"
FT                   /product="KLTH0D10230p"
FT                   /note="highly similar to uniprot|P35189 Saccharomyces
FT                   cerevisiae YPL129W TAF14 Subunit (30 kDa) of TFIID TFIIF
FT                   and SWI/SNF complexes involved in RNA polymerase II
FT                   transcription initiation and in chromatin modification
FT                   contains a YEATS domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22716"
FT                   /db_xref="GOA:C5DEW1"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR016665"
FT                   /db_xref="InterPro:IPR027353"
FT                   /db_xref="InterPro:IPR038704"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEW1"
FT                   /protein_id="CAR22716.1"
FT                   /translation="MVASVKRTVRIKTQQAILPDVPPPVENFPMRHWSIEIFVLDEQGN
FT                   EVPATIFDKVVYHLHPTFANPTRTFTEPPFKIEEQGWGGFELLISGHLLEKGGERKLTH
FT                   DLHFMKEVYEVDHVIQVPTNKPLLKAELQKTGPVEETVASTAGTPTASGVGEKRKAISN
FT                   GESKSKKAKTGTGSAVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNRTPDMNITNNIE
FT                   EGEFIIDLYSLPEGLLKSLWEYVKKNTD"
FT   gene            complement(<848849..>849412)
FT                   /locus_tag="KLTH0D10252g"
FT                   /old_locus_tag="KLTH-ORF11420"
FT   CDS_pept        complement(848849..849412)
FT                   /locus_tag="KLTH0D10252g"
FT                   /old_locus_tag="KLTH-ORF11420"
FT                   /product="KLTH0D10252p"
FT                   /note="similar to uniprot|Q12032 YOR215C Saccharomyces
FT                   cerevisiae Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22717"
FT                   /db_xref="GOA:C5DEW2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DEW2"
FT                   /protein_id="CAR22717.1"
FT                   /translation="MLTRRITLGISRNLSRGALINARFASSQSYLDSVANLKKDLKKAM
FT                   IAKDDLRKTTIRGLLSGIKNKEIDAQGKDLDEFALHDLYSKLITQRKDSIEEFLKNNRS
FT                   DLVEREESEIEIIKNYLGQLPVASEAEIDAKVSNLLTELKQSNPSLQLKDAFKKVDWKA
FT                   APSDWRASASMIKASIVRQFKTKS"
FT   gene            complement(<849747..>851162)
FT                   /locus_tag="KLTH0D10274g"
FT   CDS_pept        complement(849747..851162)
FT                   /locus_tag="KLTH0D10274g"
FT                   /product="KLTH0D10274p"
FT                   /note="similar to uniprot|Q12234 YOR216C Saccharomyces
FT                   cerevisiae RUD3 Golgi matrix protein that is involved in
FT                   the structural organization of the cis-Golgi"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22718"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="InterPro:IPR019459"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEW3"
FT                   /protein_id="CAR22718.1"
FT                   /translation="MAKNKKKASKPKPEKMEPAKTDCEAPESEPATSHQEPAPENAIEL
FT                   TDNDKTGDDEAGLRKEVERLQNEVSNLRQQLEKQTKHGSKDEKDEKDEKDEKDENSEKT
FT                   NKEVKDEEELTTKLAKIQEERDQFENQYNSLLSRLSSMKSVFNKMRESQEELESCQEQL
FT                   REYESQNLSLRNKLENSNREHEELQNTVVTLNQEVSGLNDECESLSQELSEAVEKSSKF
FT                   EEDLKTLSSHNANERHTWETKFKELELLLSNMKQDMESLKEEREDLKQRLEKSERLKET
FT                   SEANLAELERQLELQQQAGEETISEKAKRIQTLEAQIQEYRIKNEKIELERVNLLSQVE
FT                   GMREAVEQKEALQQECKERLLQIGKLRHEAIILNEHLTKALAMLKKSSDSETVDKELIS
FT                   NLLISFVAIPRADPKKFEVLELISSFLNWDDDKKQQAGLIYAANGQRSNTNGSRTQNFV
FT                   SLWTEFLEKESVN"
FT   gene            <851319..>853913
FT                   /locus_tag="KLTH0D10296g"
FT                   /old_locus_tag="KLTH-ORF11416"
FT   CDS_pept        851319..853913
FT                   /locus_tag="KLTH0D10296g"
FT                   /old_locus_tag="KLTH-ORF11416"
FT                   /product="KLTH0D10296p"
FT                   /note="similar to uniprot|P38630 Saccharomyces cerevisiae
FT                   YOR217W RFC1 Subunit of heteropentameric Replication factor
FT                   C (RF-C) which is a DNA binding protein and ATPase that
FT                   acts as a clamp loader of the proliferating cell nuclear
FT                   antigen (PCNA) processivity factor for DNA polymerases
FT                   delta and epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22719"
FT                   /db_xref="GOA:C5DEW4"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012178"
FT                   /db_xref="InterPro:IPR013725"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEW4"
FT                   /protein_id="CAR22719.1"
FT                   /translation="MVGIDEFFKGQHTGKQPSKARATGTSRKRKEQPVNSASNPINLED
FT                   SEDEHTLEAKKPSNQLKAGVSVEIVDEEPQPRKRQRATAPAPKAKASSPKKSPKSKIQS
FT                   AEAGTAEALLSQIPSVDLDAVHVKETAQFDFRSNGNAGDSSQAAAEEANFPEGAPNCLL
FT                   GLTIVFTGQLPTIERGVAEAIAKRYGARVTKSISSKTSVVVLGDEAGPKKLEKIKQLKI
FT                   KAIDEDGFKQLVAGMPEEGGDGSAAEKARQKLKQQEEKAQKDAAEMIKVEEEQREKARR
FT                   VQSKANTADKREPVREEDKLWTVKYAPTSLQHICGNKTSVNKLKTWLSNWRTYQKQGFK
FT                   NAGRDGFGVFRAAMVYGPPGIGKTTAAHLAAKELGYDILERNASDVRSKSLLNAGVKNA
FT                   LDNTSVVGFFKSKHDGDVNQKNFVIIMDEVDGMSGGDRGGVGQMAQFCRKSSMPMILIC
FT                   NERNSPKMRPFDRVCLDIQFRRPDPTSIKARLMTVAVREKFQLDPNIIDKLVEATRGDI
FT                   RQLINLLSTISTTTKKIGHENAQEIAKAWEKNIALKPFDIAHKLFDGRIYSDVGSKSFP
FT                   LYKKIELYFDDFDFAPLMIQENYLQTRPSVLKPGQSHLAAVADAAESISQGDLVERKIR
FT                   SSEQLWSLLPFHAIMSSVRPASKVAGQMAGRINFTSWLGQNSKMGKYYRLLQEIQYHTR
FT                   LSTSTDKLGLRMDYMPTMKKRLLDPLVERGNDAVPEVIQTMDDYYLSKEDWDSIMEFMI
FT                   GSDKTDLQIKKIPTAVKSGFTRKYNSMVHPVAIYKTGSTTAVGAKPAATPDFEDIVDAD
FT                   DNVPPADEDEESKEDTDFKKDKLIKQGKPKVASKRAGSTAKKSAAAKKRKTK"
FT   gene            complement(<853996..>856611)
FT                   /locus_tag="KLTH0D10318g"
FT                   /old_locus_tag="KLTH-ORF11412"
FT   CDS_pept        complement(853996..856611)
FT                   /locus_tag="KLTH0D10318g"
FT                   /old_locus_tag="KLTH-ORF11412"
FT                   /product="KLTH0D10318p"
FT                   /note="similar to uniprot|P33894 Saccharomyces cerevisiae
FT                   YOR219C STE13 Dipeptidyl aminopeptidase Golgi integral
FT                   membrane protein that cleaves on the carboxyl side of
FT                   repeating -X-Ala- sequences required for maturation of
FT                   alpha factor transcription is induced by a- factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10318g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22720"
FT                   /db_xref="GOA:C5DEW5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEW5"
FT                   /protein_id="CAR22720.1"
FT                   /translation="MEPSYKKRHPSLYLLKSNSSAQFMPAQEFELQPKGEAPGTAGKLP
FT                   RDEEAQVTDGADFLSRVPFRDFQNRIRVRKSAVIFLALIISWLTVGFSVLRFKDSNLSL
FT                   SKPASPSGRTFSIENVLNGEFSYYDTYFKFIRPGVLHQPQDNDPGLYLKIENKNGIPKY
FT                   VAKQLVDVEFYKELGRTSFTYGDVEYQVSDFDVSHRLDKAILATDLEKKFRHSSTAYYW
FT                   LKDIPTNTYRPISPFPEDGKLYKLSFARFSPHRNFVYFVYNNDLYVQSATNSQGFRRLT
FT                   ADGSEDVKNGRPDWVYEEEVLASDQAVWWAPDDSQIVFAKFNDSEVLTESVPTYINEQA
FT                   YDDVQQIKYPKPGTPNPRVQLFSYKMSEGVTYSIPFGGETGGRILYAAQWLDNNHFMFK
FT                   DTDRASQAMFVKIYESNARKVSTVRIINATAYSGWIEKVKDVQPIPPSEIHGRSELSYV
FT                   DVQVDESGYPHLFHFKSVFASTGTQLTFGDWEVTGKGIVGYDQDADSVFFLSNRLSRFS
FT                   QHLFMVPLREDSTKAAHGLQDPRDRDSFYEFELSVSCRFGVKRYLGPDEPMSDAGVLTS
FT                   LLLNDQSRAITQLTSNAGMLEALKKYDLPKSSFSSTQLDDDVQIDYKETVPYDFDPRKK
FT                   HPLLIHVYGGPGSQTVDHKFAISLEESLASSANAIVLSIEPRGTGGRGWPYRSWAKNKI
FT                   GYWEPRDIISVVKDYVNKHSDSIDPDHVAIWGWSYGGFVTLKTLELDQGQIFKYGVAVA
FT                   PVTNWKYYNSIYTERYLGLFENNEKAYEDTSLIKDVQNFSSVKRFLLIHGSADDNVHVK
FT                   NTMQLLDNFNLNNVKNYDLSIFPDSEHSIVFHNANRVVYERIFNWIKNAFEGKLDNLSW
FT                   "
FT   gene            complement(<856900..>857787)
FT                   /locus_tag="KLTH0D10340g"
FT   CDS_pept        complement(856900..857787)
FT                   /locus_tag="KLTH0D10340g"
FT                   /product="KLTH0D10340p"
FT                   /note="highly similar to uniprot|P26321 Saccharomyces
FT                   cerevisiae YPL131W RPL5 component of the large (60S)
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22721"
FT                   /db_xref="GOA:C5DEW6"
FT                   /db_xref="InterPro:IPR005485"
FT                   /db_xref="InterPro:IPR025607"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEW6"
FT                   /protein_id="CAR22721.1"
FT                   /translation="MAFQKEIKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYS
FT                   SPKYRLVVRFTNKDIICQIVSSTITGDVVLVAAYSHELPRYGITHGLTNWAAAYATGLL
FT                   VARRALQKLGLDETYPGVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGAL
FT                   KGASDGGLYVPHSESRFPGWDFEAEELDADMLRTYIFGGHVSQYMEELADDDEERFKEL
FT                   FKGYLADDIDADAVEDIYLEAHEKIREDPSFKPTEKKFTKEQYAAESKKYRQTKLSKEE
FT                   RRARVAAKIAALAQ"
FT   gene            complement(<858224..>858952)
FT                   /locus_tag="KLTH0D10362g"
FT                   /old_locus_tag="KLTH-ORF11399"
FT   CDS_pept        complement(858224..858952)
FT                   /locus_tag="KLTH0D10362g"
FT                   /old_locus_tag="KLTH-ORF11399"
FT                   /product="KLTH0D10362p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10362g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22722"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEW7"
FT                   /protein_id="CAR22722.1"
FT                   /translation="MCPCARSKPLDALCTNPAQRTPSTDTPLPQPPVAAARAPWPPEMR
FT                   LWRAACVPERPCCYATPLRTTHYGILGAALRCWERKRQRKRNERARRADGDSAGGNLPP
FT                   RKTACTARSAQRARQAQRRAVRCPAIVACVLGFVGENASLSCAATCCSFGATTAPGAEA
FT                   FPDDCPFGVWLPQRRTRYRLARGEKEEVIEAVGEERRLWAQRSVAMGETHRREAPARRV
FT                   RRERRMERAARQSGRGARGR"
FT   gene            <859289..>859933
FT                   /locus_tag="KLTH0D10384g"
FT                   /old_locus_tag="KLTH-ORF11395"
FT   CDS_pept        859289..859933
FT                   /locus_tag="KLTH0D10384g"
FT                   /old_locus_tag="KLTH-ORF11395"
FT                   /product="KLTH0D10384p"
FT                   /note="weakly similar to uniprot|Q12044 Saccharomyces
FT                   cerevisiae YOR220W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10384g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22723"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEW8"
FT                   /protein_id="CAR22723.1"
FT                   /translation="MLHTTPKTQILITDVPAQDFACGWPQQLQSQLFDREFPQLKHSCL
FT                   YYTPLAFLHRVVLIFDQEPATLQVHEFLTRALAGKPVKIFLTESLLAKPRAKSFDAAPD
FT                   HVPDFDVEPRAKPQLSLDTHSSPANSPSLSPDRSDPHSPTALKSLEDGKVHLYQEPLPA
FT                   ADAPGDDASPRGETKLLYKPRLSLDTRSSGASHSSFSVPMSPSITLNEFPQ"
FT   gene            complement(<860078..>860842)
FT                   /locus_tag="KLTH0D10406g"
FT                   /old_locus_tag="KLTH-ORF11391"
FT   CDS_pept        complement(860078..860842)
FT                   /locus_tag="KLTH0D10406g"
FT                   /old_locus_tag="KLTH-ORF11391"
FT                   /product="KLTH0D10406p"
FT                   /note="similar to uniprot|P19516 YPL132W Saccharomyces
FT                   cerevisiae COX11 Mitochondrial membrane protein required
FT                   for assembly of active cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10406g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22724"
FT                   /db_xref="GOA:C5DEW9"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEW9"
FT                   /protein_id="CAR22724.1"
FT                   /translation="MLHKLLFRAASRSIPARRLFSAGPMCLKNQSQIDISKLTQKEIQQ
FT                   LRSLKFQRDRQFKDRTAAYYFTSIAVLFLGLAYAAVPLYRAICARTGFGGIPITDKRKF
FT                   TDDKLIPVESGKRIRVSFTSEVSQILPWKFVPEQREVHVLPGETALAFYKARNTSDKDI
FT                   IGMATYSITPGDAAPYFNKIQCFCFEEQRLAAGEEIDMPVFFFIDPDFATDPRMRNIDD
FT                   IVLHYTFFRAHYANGGAVSESANPQVMDSGSS"
FT   gene            <861135..>862196
FT                   /locus_tag="KLTH0D10428g"
FT                   /old_locus_tag="KLTH-ORF11389"
FT   CDS_pept        861135..862196
FT                   /locus_tag="KLTH0D10428g"
FT                   /old_locus_tag="KLTH-ORF11389"
FT                   /product="KLTH0D10428p"
FT                   /note="similar to uniprot|P19541 Saccharomyces cerevisiae
FT                   YPL133C RDS2 Regulator of drug sensitivity Transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22725"
FT                   /db_xref="GOA:C5DEX0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEX0"
FT                   /protein_id="CAR22725.1"
FT                   /translation="MNESSQKKRKKVSKACLYCRRSHMICDEQRPCSRCLRRDIGHLCR
FT                   DEDSRLPMDVEVDPERIQPTLASLDKQHPALQQPPKNVAYSGLLSQQPTFVSEHVGSEF
FT                   LSLNEFMNMLEEPIILEPPAVTHSAPRNPEDQPTLKENFFLTAADPSAEMTPEDRLKSV
FT                   INAKLEAGLLRPYNYAQGYARLQTYMDKHMDFLSKQRILKPLSIIRPEFRAIARSLKDV
FT                   DLILVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLVDCKVDDLRDGKL
FT                   AIYELMTEESAVNFWEKYGSIAFDKAQKAVLTSCNLRARDGGRQRSCCFSFTIRRDRYN
FT                   IPICIVGNFIPTS"
FT   gene            complement(<862180..>863160)
FT                   /locus_tag="KLTH0D10450g"
FT                   /old_locus_tag="KLTH-ORF11387"
FT   CDS_pept        complement(862180..863160)
FT                   /locus_tag="KLTH0D10450g"
FT                   /old_locus_tag="KLTH-ORF11387"
FT                   /product="KLTH0D10450p"
FT                   /note="weakly similar to uniprot|Q12283 Saccharomyces
FT                   cerevisiae YOR221C MCT1 Predicted malonyl-CoA:ACP
FT                   transferase putative component of a type-II mitochondrial
FT                   fatty acid synthase that produces intermediates for
FT                   phospholipid remodeling"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10450g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22726"
FT                   /db_xref="GOA:C5DEX1"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEX1"
FT                   /protein_id="CAR22726.1"
FT                   /translation="MKVITFPGQGTPVALNVFRSYLAEGSSAFRAVFRDSGRIGVTRTI
FT                   EQRPADPVSIAACSFLLFDLYRRSRKNNAEELLFLGHSLGELGCLGAGNRLFGLSETMK
FT                   IASLRNKLMINAAGGNKYELWAISAPRSQNLECELQPLLRVTDVNLANVNSRMQCVVTV
FT                   PQGYTTDSKGTPQWAAELALQVPRCRIQRLENPYHIPFHNKNILQGIEEPLLDHMWQKL
FT                   KSQGLHTKRELEHPIISNLNGKRITDVDKALESFAKSSCNVVNFVACCDTLNSLGVSKA
FT                   VHIGPGEVIGKLMHRNCKLEKSQEWNTVEDITKELGDVQDSNSLE"
FT   gene            <863427..>864317
FT                   /locus_tag="KLTH0D10472g"
FT                   /old_locus_tag="KLTH-ORF11385"
FT   CDS_pept        863427..864317
FT                   /locus_tag="KLTH0D10472g"
FT                   /old_locus_tag="KLTH-ORF11385"
FT                   /product="KLTH0D10472p"
FT                   /note="similar to uniprot|Q99297 Saccharomyces cerevisiae
FT                   YOR222W ODC2 Mitochondrial inner membrane transporter
FT                   exports 2-oxoadipate and 2-oxoglutarate from the
FT                   mitochondrial matrix to the cytosol for use in lysine and
FT                   glutamate biosynthesis and in lysine catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22727"
FT                   /db_xref="GOA:C5DEX2"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEX2"
FT                   /protein_id="CAR22727.1"
FT                   /translation="MTDARPLPFIYQFAAGAVAGISEILVMYPLDVVKTRMQLQVAGGV
FT                   GPQYNGVVNCLKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE
FT                   KLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSKYNGPVDVVKRIIAQEGVLAMY
FT                   NGLESTLWRHGVWNAGYFGIIFQVRSLLPQAQSKSQQTGNDLIAGTIGGTIGSLMSTPF
FT                   DVVKSRVQNTAVVAGQARKYNWSWPSIFTIYREEGFSALYKGFVPKVLRLGPGGGILLV
FT                   VFTGMMDFFRTVHYK"
FT   gene            <864837..>865595
FT                   /locus_tag="KLTH0D10494g"
FT                   /old_locus_tag="KLTH-ORF11383"
FT   CDS_pept        864837..865595
FT                   /locus_tag="KLTH0D10494g"
FT                   /old_locus_tag="KLTH-ORF11383"
FT                   /product="KLTH0D10494p"
FT                   /note="similar to uniprot|Q12015 Saccharomyces cerevisiae
FT                   YOR223W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22728"
FT                   /db_xref="GOA:C5DEX3"
FT                   /db_xref="InterPro:IPR019413"
FT                   /db_xref="InterPro:IPR025390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEX3"
FT                   /protein_id="CAR22728.1"
FT                   /translation="MSGSELDGSPSQDRVVVVRFSDEQMEDLPLNVNNVSLSDVNTSWL
FT                   RRMCRQLRGRSLSNRKLRFIRSGRFLNASTDLQLQRYFESTNDKFYVHCIVGQELTPQE
FT                   LANEDSVDETQQNTEGTTTQAIGFDRLRAVGFSDEEIELLRQRFRSTYGDLEELSRDNG
FT                   EGQDIRQLEEHWMETGANDENDQLGAVGIANYKHNKDLLIGLVVGCVLGVFSFLLMKQE
FT                   GLFNKRQKLAMVGGLLINMGFGAMLGFSRD"
FT   gene            complement(<865650..>866273)
FT                   /locus_tag="KLTH0D10516g"
FT                   /old_locus_tag="KLTH-ORF11382"
FT   CDS_pept        complement(865650..866273)
FT                   /locus_tag="KLTH0D10516g"
FT                   /old_locus_tag="KLTH-ORF11382"
FT                   /product="KLTH0D10516p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10516g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22729"
FT                   /db_xref="InterPro:IPR019560"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEX4"
FT                   /protein_id="CAR22729.1"
FT                   /translation="MSAPTKSPSSEYAETHLPDSTDSSVRYAAYASRLRTIALASHRYV
FT                   AYTSDIGESFRPVFSPLLVKLGYGVSWAYILGDVSYTAWVAKLQKEGRYREGLKPWDPV
FT                   PPVDPNMVEKGTLEKLPDWKMVGLERMIFQSVASMGLPAFTIHSTVKYSGKWFNKAFPK
FT                   NAALRTWGPIGLGLSVVPALPYIFDKPIERLLEQVFHPEHDKQE"
FT   gene            complement(<866502..>866936)
FT                   /locus_tag="KLTH0D10538g"
FT   CDS_pept        complement(866502..866936)
FT                   /locus_tag="KLTH0D10538g"
FT                   /product="KLTH0D10538p"
FT                   /note="highly similar to uniprot|P20436 Saccharomyces
FT                   cerevisiae YOR224C RPB8 RNA polymerase subunit ABC14.5,
FT                   common to RNA polymerases I, II, and III"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10538g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22730"
FT                   /db_xref="GOA:C5DEX5"
FT                   /db_xref="InterPro:IPR005570"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEX5"
FT                   /protein_id="CAR22730.1"
FT                   /translation="MSTTLFDDIFQVTEVDLGRYNKVSRIEAHSTSQEFLLTVDINTEL
FT                   FPVRVNDTLTVMLSSTLSIDGSETVQGGSWRAPQPGERSLADDYDYVMYGTAYRFEEVA
FT                   GKKDLIAVYYSFGGLLMRLEGNYRGLSNLKQENAYLLVRR"
FT   gene            complement(<867215..>867742)
FT                   /locus_tag="KLTH0D10560g"
FT   CDS_pept        complement(867215..867742)
FT                   /locus_tag="KLTH0D10560g"
FT                   /product="KLTH0D10560p"
FT                   /note="highly similar to uniprot|Q12056 Saccharomyces
FT                   cerevisiae YOR226C ISU2 Conserved protein of the
FT                   mitochondrial matrix required for synthesis of
FT                   mitochondrial and cytosolic iron-sulfur proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10560g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22731"
FT                   /db_xref="GOA:C5DEX6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEX6"
FT                   /protein_id="CAR22731.1"
FT                   /translation="MFRTLLARNSLGASARSVLRAPVPVTGAAVPRFVGNPVAQPARRA
FT                   YHPKVIDHYTNPRNVGSLDKNLENVGTGLVGAPACGDVMKLQIQVNDDTGVIENVKFKT
FT                   FGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIK
FT                   DYRSKRKSTVLK"
FT   gene            <869369..>872800
FT                   /locus_tag="KLTH0D10582g"
FT                   /old_locus_tag="KLTH-ORF11374"
FT   CDS_pept        869369..872800
FT                   /locus_tag="KLTH0D10582g"
FT                   /old_locus_tag="KLTH-ORF11374"
FT                   /product="KLTH0D10582p"
FT                   /note="similar to uniprot|Q12276 Saccharomyces cerevisiae
FT                   YOR227W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10582g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22732"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEX7"
FT                   /protein_id="CAR22732.1"
FT                   /translation="MCRVGQVNSARNRSTIICVSPCTCYTPIIENWPNLLITNQCPFFN
FT                   VETPSLTSSKLLKYCKQRMSKSLDVDVDVDWLYKGKRKAKQARRERSNSVSNGSLSHVA
FT                   ANQAPLQDAAPESPKPKPATSETKSPPSTPKRSSSVSDKSKKSLFGTLFRRNSHGSGDR
FT                   PSIPIPLPKSRSNSNASSHAPEKPSGHSNGTGAMNAAVSQYLNEPSSPEVKDPAPIHED
FT                   RLVLNRNPHRKSLPIESLAKTRLRRVTFAVDKFGMDPPQQIPSRKPKRGNVLVPQDLTC
FT                   PTPSISVGITNTQGSIEQSASPLNEESKEYKLAVEEHRRALKESEKHQQEAHYAAQRIA
FT                   HEVLKFKAKPQSGPSVLPSTSSSLTATESHPSSATNTVIDDRARNLEIDKPIHMHETHF
FT                   QDETTDPNDEEDKLTLDKIYTRCCHLREILPIPSTLKQVKGKSSPLQTLKFLNPRPTLI
FT                   DILSFCDFISIVPVHNVIFDNVSLNPEMLKNVISSLVSSKVVEKIGFRNVVFTSEGWKL
FT                   LCKFLMRNNSLLKLDISQTKIKPDLDKSLYRAKMDWNLFIDVLQRREGRPLEELLINGV
FT                   KFEDFDTFVNLLTTFASERSQTRKRLGIAQSDLSAEQLKFVMSWVSDYKIQGVDMAFND
FT                   LSDLVKPLVGKLSSLPFSHLNYFTLNNTNIMTAYDAALLLRALSKLPNLYFLDLSNLPQ
FT                   IFPEVFPYLNKYLPRMTNLKRLHLDSNEFTSREVAMVTNVLPKCSELLHLSLLNIPQES
FT                   FTTATCATVYDCVRQCSKLTNLDIAYNCIPEEISSRIAICFMRRMQRDFELDDLTNQDD
FT                   LLFDGTLLSETAENVFEKLNNFEDLETDATRRYLLKKYWEKFNRVHDRVQSTIDEMFEK
FT                   RSAGELNLQSKENLLRLLFLENNLSNILDVLKSYPQVADVAGIERNTRSANSENLLSGL
FT                   SSEAENQSHVKPHLMATDSGRTIDVTTGTPILVKTPSHVALVGKKQEEEEGEFHKWGFF
FT                   VQQQNSIYPDHHLRNAAYESAEKRPGSAASSAESPKSSQPSAASQATTHAIISKIPSGT
FT                   ELRDAVMRAKGINSIEELIGNVNRNRVTLDNIYGVPLHPMSPALSDTAARTTPISQVLR
FT                   SSSSVSEASSEDEDEEKVDETYDKLLNSLSKVRSNK"
FT   gene            complement(<873026..>873877)
FT                   /locus_tag="KLTH0D10604g"
FT                   /old_locus_tag="KLTH-ORF11370"
FT   CDS_pept        complement(873026..873877)
FT                   /locus_tag="KLTH0D10604g"
FT                   /old_locus_tag="KLTH-ORF11370"
FT                   /product="KLTH0D10604p"
FT                   /note="weakly similar to uniprot|Q12106 Saccharomyces
FT                   cerevisiae YOR228C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10604g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22733"
FT                   /db_xref="GOA:C5DEX8"
FT                   /db_xref="InterPro:IPR012472"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039960"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEX8"
FT                   /protein_id="CAR22733.1"
FT                   /translation="MGLKEVTPEPIRNLRPVEGIEKPSGILNFLNARFVRLSLRKIQKH
FT                   SIWPLMVYFPLHAVNTLVVPAISPESAPNDVLMMVRAILPGFTSALLKWSITAHVLSGL
FT                   ALRIWGSFSRWKTHRRRGKSIPQDQKERESQRAIGLIGGLSGYCIGVSKQLAYNPQVVT
FT                   GYILTPLLWYHGRIMKEVPLEQDFGAIDIDFPKWILQNDNAFIKWFGGILPLSVLIWAA
FT                   SYHVVAGFCNFAKIRRMDVRKSLSTLILFLTTSGIISLWRLSKSSPVFQASSFPQILRR
FT                   VF"
FT   gene            <874019..>875023
FT                   /locus_tag="KLTH0D10626g"
FT                   /old_locus_tag="KLTH-ORF11368"
FT   CDS_pept        874019..875023
FT                   /locus_tag="KLTH0D10626g"
FT                   /old_locus_tag="KLTH-ORF11368"
FT                   /product="KLTH0D10626p"
FT                   /note="similar to uniprot|Q03012 Saccharomyces cerevisiae
FT                   YPL138C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10626g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22734"
FT                   /db_xref="GOA:C5DEX9"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR037869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEX9"
FT                   /protein_id="CAR22734.1"
FT                   /translation="MGVLPEWCPTYSSRKKDPVTGEEVFCICKKPDSGELMVGCDGCDD
FT                   WFHFSCLKIPQKFNELVFSFFCPYCQCGITGPGASSGNLPKTLWRRKCRLPECYKPCAE
FT                   NSKYCSEDHAVSYMCNLIGRVESKGFDAQDVLRQMLQNSDLEKFQKMGHEGVPTPPEGL
FT                   APGLFEGDARLRDLESQADKIRTLTRPEIEQQLKKLEAYVAWVKRVNHLLFTSASEDQD
FT                   GGSSSKNSRALKRKKKSTKPKSICGYHPELRIVCSAEEFAPQYNESEIELYSVCCKLRC
FT                   PRHLDWAGIQETSLRFQLETLESSLERLALLQKIREDQLKMQVYKELSKSKQA"
FT   gene            <875331..>876751
FT                   /locus_tag="KLTH0D10648g"
FT                   /old_locus_tag="Klth0D.mRNA.519.p"
FT   CDS_pept        join(875331..875337,875409..876751)
FT                   /locus_tag="KLTH0D10648g"
FT                   /old_locus_tag="Klth0D.mRNA.519.p"
FT                   /product="KLTH0D10648p"
FT                   /note="weakly similar to uniprot|Q12206 YOR229W
FT                   Saccharomyces cerevisiae WTM2 WD repeat containing
FT                   transcriptional modulator 2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10648g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22735"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEY0"
FT                   /protein_id="CAR22735.1"
FT                   /translation="MSEAKGNKIKNEEFKIWKKSVPSLYQHITTIKPSYTRLFEGAERI
FT                   PKVVAFTHKIVPDREKGTFTTSLLCSQGSDIYEVDFQLPLGLHSNSEALPDPQYSSAFA
FT                   EIVHSEKHEPKWTYQGNTIIKLEYVGGAEADAVAMTSTGSLAWFKDGCKVPVYVMEELV
FT                   GPATSFSRIHNQGSTNNWIAADFAVSENTETVVKSQQSMATGPGEEHSLLKIVDNSQSP
FT                   GNLIRTISIPGVSVTQSIKFHDNNMFSTCSDDNGIRFYDIRGDGKPLWTVFEPHDGKLT
FT                   CYDVSPTLETLFITGSDTGVLKLWDLRSVIACEIEQKEPTEIAKLYHSGADPVADVRFG
FT                   ISSPTEVLSVGDSGNVYHWNLEPIFLREGDEDDEMAESEELQQQCLEFMHTGGGRRSLG
FT                   QSRKRETVAWHPIVQGVVGCVDPDGLLTVYRGHYGATDKARAQDEREDNE"
FT   gene            <877472..>878806
FT                   /locus_tag="KLTH0D10670g"
FT                   /old_locus_tag="KLTH-ORF11361"
FT   CDS_pept        877472..878806
FT                   /locus_tag="KLTH0D10670g"
FT                   /old_locus_tag="KLTH-ORF11361"
FT                   /product="KLTH0D10670p"
FT                   /note="some similarities with uniprot|P32490 Saccharomyces
FT                   cerevisiae YOR231W MKK1 Mitogen-activated kinase kinase
FT                   involved in protein kinase C signaling pathway that
FT                   controls cell integrity upon activation by Bck1p
FT                   phosphorylates downstream target Slt2p functionally
FT                   redundant with Mkk2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10670g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22736"
FT                   /db_xref="GOA:C5DEY1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEY1"
FT                   /protein_id="CAR22736.1"
FT                   /translation="MASMFRPPDSARGNSRSPKLSLPPSLKYNSSEAPSQSGSGLTPAI
FT                   NTPCSSSSSQTLVFPPPEKLSSSSSSSITTLKKRPVPPPIPSLVIPKSAGAGTPDRSPF
FT                   ADSFEKLRIDNSEISGSASASPSAVSPAPPNPIADVHELGEETWQSGIVKDHVVTMGIL
FT                   GEGAGGSVTKCRLKYGTKVFALKTITTVNSDAETQKQVLRELQFNRTCKSEYIVRYYGM
FT                   FADGSSSSIYIAMEYMGGKSLHAIYKHLLDRGGRISEKVLGKVAESVLKGLSYLQERKI
FT                   IHRDIKPQNILLNEVGQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTSD
FT                   VWSLGLTLLEVAQGQFPFGSDKMAANMPPIELLMLILTFTPELNDIPESNVTWSKSFKS
FT                   FIQYCLNKEPRERPSPRQMLRHPWIQGHMKKPCNMHKFITKCWEE"
FT   gene            <879032..>879748
FT                   /locus_tag="KLTH0D10692g"
FT                   /old_locus_tag="KLTH-ORF11359"
FT   CDS_pept        879032..879748
FT                   /locus_tag="KLTH0D10692g"
FT                   /old_locus_tag="KLTH-ORF11359"
FT                   /product="KLTH0D10692p"
FT                   /note="similar to uniprot|P38523 YOR232W Saccharomyces
FT                   cerevisiae MGE1 Protein of the mitochondrial matrix
FT                   involved in protein import into mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10692g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22737"
FT                   /db_xref="GOA:C5DEY2"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEY2"
FT                   /protein_id="CAR22737.1"
FT                   /translation="MRLLTSNIPKMVVRPTMGARLCTRMTARPATMTKFQTPTLGMRFY
FT                   SDAAKQSEAAENAEGAQEESPKGPASEEQKKVQELEEKLAVKDKEAAEYKDRLLRSVAD
FT                   FRNLQEVTKKDIQKAKDYALQKFAKDLLDSVDNFGHALNAFKPESTQQSTELSELYTGV
FT                   KMTKDIFEKTLKKHGIEKIDPMGETFDPNRHEATFELPNPEKQPGTVFHVQQVGFTLNN
FT                   RVIRPAKVGIVKDPAN"
FT   gene            <880389..>883007
FT                   /locus_tag="KLTH0D10714g"
FT                   /old_locus_tag="KLTH-ORF11356"
FT   CDS_pept        880389..883007
FT                   /locus_tag="KLTH0D10714g"
FT                   /old_locus_tag="KLTH-ORF11356"
FT                   /product="KLTH0D10714p"
FT                   /note="similar to uniprot|Q03002 Saccharomyces cerevisiae
FT                   YPL141C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10714g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22738"
FT                   /db_xref="GOA:C5DEY3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEY3"
FT                   /protein_id="CAR22738.1"
FT                   /translation="MTSVPQRHTYYGAPTSSYTQSRQSASYSSQKRKHVTFGPYIVGST
FT                   LGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIPKNSEKEVKIYREINALKHLNH
FT                   PNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKESAACRLFAQLISGVYYMHS
FT                   KGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSCGSPCYAAPELVVTARP
FT                   YEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDYIAPVP
FT                   RDLLRAILVADPKKRITIAQTLHHQWLQPHLPFLSVMPEEWDHVSKNQELLRQPPQKGE
FT                   AVNSARPRSNCSVSSTNSKGEKRNSLIMDSSLYSQPVPPQQSQSHAVAMPSSPSPRLRQ
FT                   SPVKSNNRHSRSNSAASIALQAVVDAEREYHATHPPFTSSASTSALQFEVSPHSTSPRL
FT                   YTFSPTKANQNTVTSLRDSVIIETSPQKGSGAFLIASSLKESPNGTGLPEASSVPTTSG
FT                   FKAPLAVKAQVPHHGTHNLALHRRPRPTSYHPASCSTFGDTSQAPTSQPAVSGEATTGH
FT                   TQANIGKSTSQGIMHRDSFSMNKPFVDMQIVAGDLIKSGGDGDTVAKKIHDQVEDADHR
FT                   VDLSRQRRQSQRYSVVYDKLFGVAQQSEDNAVEDAGPGGSTVERGASGTSVKRDKKRFS
FT                   IMSIYSPSRSSVDSGSPKNEDKHKRTGSENNPSGSSKRTPSRQESLVNDQADTSRKSSA
FT                   AKKPEPTKQASTLKEVKADASRKTSNPISKQESLGQSSVHGDGKAEARAEPEANKKNPT
FT                   VQRSASLKKAAKPTQTRKKVNRSSVMVSSVAAGSTENARPREQSTAKRVIDFFKRRSMR
FT                   L"
FT   gene            complement(<883254..>883954)
FT                   /locus_tag="KLTH0D10736g"
FT                   /old_locus_tag="Klth0D.mRNA.2116.m"
FT   CDS_pept        complement(join(883254..883558,883936..883954))
FT                   /locus_tag="KLTH0D10736g"
FT                   /old_locus_tag="Klth0D.mRNA.2116.m"
FT                   /product="KLTH0D10736p"
FT                   /note="highly similar to uniprot|P05744 Saccharomyces
FT                   cerevisiae YPL143W, RPL33A Ribosomal Protein of the Large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10736g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22739"
FT                   /db_xref="GOA:C5DEY4"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="InterPro:IPR038661"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEY4"
FT                   /protein_id="CAR22739.1"
FT                   /translation="MAESHRLYVKGKHLSYQRSKKTNNPNVSLVKIEGVATPEDAKFYL
FT                   GKRVAYVYRASKEIRGSKIRVIWGKINRTHGNSGVVRATFRSNLPAKTFGASVRIFLYP
FT                   SNI"
FT   gene            <884714..>885123
FT                   /gene="SNR17"
FT                   /locus_tag="KLTH0D10758r"
FT                   /old_locus_tag="Klth0D_snoRNA_207"
FT   ncRNA           884714..885123
FT                   /gene="SNR17"
FT                   /locus_tag="KLTH0D10758r"
FT                   /old_locus_tag="Klth0D_snoRNA_207"
FT                   /product="U3 RNA"
FT                   /note="C/D snoRNA SNR17 (U3 RNA)"
FT                   /ncRNA_class="snoRNA"
FT   gene            complement(<885342..>885728)
FT                   /locus_tag="KLTH0D10780g"
FT                   /old_locus_tag="KLTH-ORF11345"
FT   CDS_pept        complement(885342..885728)
FT                   /locus_tag="KLTH0D10780g"
FT                   /old_locus_tag="KLTH-ORF11345"
FT                   /product="KLTH0D10780p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10780g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22740"
FT                   /db_xref="InterPro:IPR018854"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEY5"
FT                   /protein_id="CAR22740.1"
FT                   /translation="MVKTTQHTIENPLGSPFHVLVSAPEPEIDTPKSPISMVVSTGANP
FT                   AAQSLMAYVYAIGTARDVYSTVLVDTVDDTVRETATRIAKLCAKKSSRPCYLGVAGDGG
FT                   AGTLALDQLLLCRECVKLVERAAQ"
FT   gene            <885955..>886668
FT                   /locus_tag="KLTH0D10802g"
FT                   /old_locus_tag="KLTH-ORF11344"
FT   CDS_pept        885955..886668
FT                   /locus_tag="KLTH0D10802g"
FT                   /old_locus_tag="KLTH-ORF11344"
FT                   /product="KLTH0D10802p"
FT                   /note="similar to uniprot|P07807 Saccharomyces cerevisiae
FT                   YOR236W DFR1 Dihydrofolate reductase part of the dTTP
FT                   biosynthetic pathway involved in folate metabolism possibly
FT                   required for mitochondrial function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10802g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22741"
FT                   /db_xref="GOA:C5DEY6"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEY6"
FT                   /protein_id="CAR22741.1"
FT                   /translation="MALNRPPIVTIVACLMPEMGIGYNGKLPWRLKQEMAYFRQVTSAT
FT                   FADGKRNAVIMGRKTWESIPPKFRPLPDRVNVVVSRQFAEDLAPAQSSAPGSKLSSHAG
FT                   AAAPASPALWLSNSLTRCLDLLPQRVPDLERIYVIGGAEIYAQSNSLCDYMLITKIEPE
FT                   SATERPPMDAFLDTQSIHALFQHDQSLPSFLPPAVSLPADPYISENGYRYNFALYRRRS
FT                   EPKTDLKTKECAPQK"
FT   gene            <887004..>888257
FT                   /locus_tag="KLTH0D10824g"
FT                   /old_locus_tag="KLTH-ORF11342"
FT   CDS_pept        887004..888257
FT                   /locus_tag="KLTH0D10824g"
FT                   /old_locus_tag="KLTH-ORF11342"
FT                   /product="KLTH0D10824p"
FT                   /note="similar to uniprot|P35844 Saccharomyces cerevisiae
FT                   YPL145C KES1 Member of the oxysterol binding protein family
FT                   which includes seven yeast homologs involved in negative
FT                   regulation of Sec14p-dependent Golgi complex secretory
FT                   functions peripheral membrane protein that localizes to the
FT                   Golgi complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10824g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22742"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEY7"
FT                   /protein_id="CAR22742.1"
FT                   /translation="MSGYAASSTWTSFLKSVASFNGDLSTLTAPPFILSPTSLSEYSQY
FT                   WGEHPDLFLGPNFITEPDAEGTSAEQLRMLAVTKWFISTLKSQYCSRNESMGTEKKPLN
FT                   PFLGELFVGKWENKEHPDFGETVLLSEQVSHHPPVTAYTIINDKNKTSLQGYNQVKASI
FT                   STASLSVKQFGHALLEYGKFNEQYLITLPPLHIEGMLVASPFVELEGKAYIQSSSGLLC
FT                   VVEFSGRGYFSGKKNSFKARIFQKPSDASDKEKALYTITGQWSGTSTISKGKSKKGEEL
FT                   FYDASKLRVEHLHVKPIEEQHSLESRKAWKKVADAVKGGDFSQIHQEKSALENAQRDLR
FT                   KQEEAEGTKWKRRWFVLEDYTAGINDKFTSLASNLKLSTKNVPSGTLVGDKEDKKEHSA
FT                   AHWRFKRELWDSEKEIKA"
FT   gene            <888656..>890002
FT                   /locus_tag="KLTH0D10846g"
FT                   /old_locus_tag="KLTH-ORF11340"
FT   CDS_pept        888656..890002
FT                   /locus_tag="KLTH0D10846g"
FT                   /old_locus_tag="KLTH-ORF11340"
FT                   /product="KLTH0D10846p"
FT                   /note="similar to uniprot|Q12080 Saccharomyces cerevisiae
FT                   YPL146C NOP53 Nucleolar protein involved in biogenesis of
FT                   the 60S subunit of the ribosome interacts with rRNA
FT                   processing factors Cbf5p and Nop2p null mutant is viable
FT                   but growth is severely impaired"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10846g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22743"
FT                   /db_xref="GOA:C5DEY8"
FT                   /db_xref="InterPro:IPR011687"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEY8"
FT                   /protein_id="CAR22743.1"
FT                   /translation="MAAEKERPSQYRQSSRKGKKAWRKNIDISDIEKSIRQQQDEEITH
FT                   GAKDLSSLRNEDLFQVDTVGDEVWKQKLIKRKQIKKNLKSSEILDSIKTNSKVAPLKHP
FT                   KSQAAQDDEKKKIQGVSKKELRKLMALAGRIEGESKLKNAVSKKGLVRAGTNDLWGAEE
FT                   EVKVPSGIKLATKDSTAIPEELKKLSTTGWSIATVAPDTLKRAPMKVKDVEEIPHAGKS
FT                   YNPSSKEWTELVNSEYQSEKAREEARLQMQAYRERIKHLMETLDNNEEEDSEDDEDEAD
FT                   ENQEPQENAEASSEIKLSLNKPSANKKKTKYQRNKQRRHQEKLSLQKELKQLKGQLREL
FT                   ERFEEIEKDVLEKQAAREAEKQTRVGKEKPNKKHKLGTKHSVIEGNLELKFSDELSDSL
FT                   RKLRPEGNLLYDAAKKLQSSGKIETRIPVKKGRRYAPRITEKWTYKDLK"
FT   gene            <890134..>891021
FT                   /locus_tag="KLTH0D10868g"
FT                   /old_locus_tag="KLTH-ORF11337"
FT   CDS_pept        890134..891021
FT                   /locus_tag="KLTH0D10868g"
FT                   /old_locus_tag="KLTH-ORF11337"
FT                   /product="KLTH0D10868p"
FT                   /note="similar to uniprot|Q08634 Saccharomyces cerevisiae
FT                   YOR238W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10868g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22744"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEY9"
FT                   /protein_id="CAR22744.1"
FT                   /translation="MNKTNLIIVPCHSIWKIDDRLDSENYGQYPEHWFLAPFQYEGHDH
FT                   LAFIMHSLLAVEKLLDDVSGSLLLFSGSCTKADAGQVSEAQSYLSLTRKLLTAVIYEVE
FT                   LPVSLLNSTDVHKACAHIAERIKAQGLTVTGLFTEHISTEEFALDSFDNLLYSLTRFHE
FT                   LTSNYASSVTIAGFGFKTKRFLQCHACAIDYPLSKIEYLSYEPQPQYSETEKIEAYFND
FT                   LNYQESKNALELFKIDWYGTKEPLLSKKIKRNPFTLSPNYRLPFELEKPILDDNAFFET
FT                   MIQGKMPWSNSSQI"
FT   gene            complement(<891012..>893504)
FT                   /locus_tag="KLTH0D10890g"
FT                   /old_locus_tag="KLTH-ORF11336"
FT   CDS_pept        complement(891012..893504)
FT                   /locus_tag="KLTH0D10890g"
FT                   /old_locus_tag="KLTH-ORF11336"
FT                   /product="KLTH0D10890p"
FT                   /note="similar to uniprot|P41909 Saccharomyces cerevisiae
FT                   YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
FT                   peroxisomal ATP-binding cassette transporter necessary for
FT                   transport of long-chain fatty acids into peroxisomes ABC
FT                   family long-chain fatty acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22745"
FT                   /db_xref="GOA:C5DEZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEZ0"
FT                   /protein_id="CAR22745.1"
FT                   /translation="MAETTITAQRLKELLVRLPHECIGIDLRGVARGKYAKVILKHLWW
FT                   LVRNPDTSLNHRKRAQIIFITLAFSAASAASGVGYAIYTLISRLRARTFGRTPVMRRTR
FT                   SQVMLENGARVMYVPYEENATNKKRILISPKSDDMYEHDKFLFKYFGKNKISQVFYSKF
FT                   ISQLNIISRILVPKVTDQNSILLIFQIFFLVMRTWLSLFVARLDGQIVKDIISGNSRKF
FT                   LVDLLCWFLIAFPASYTNSAIKYLQRKLSLNFRINLTRYIHDMYLDKRLAFYKLTFDNQ
FT                   ASSSVIANIDNSITNDVTKFCDAICSVFANIAKPVIDLVFFSVYLRDNLGTVGIVGIFV
FT                   NYFITGYTLKRWTPPLGRLVSQRSTAEGDYYNYHLNLINNNEEIAFYHGTKVERTKVNA
FT                   LYDHLMDQMLLVDRVKVNYNILEDYVLKYTWSALGYAFASIPIVIATFSSGVNNEDVNM
FT                   REFIVNKRLMLSLADAGGRLMHSIKDIAQLTGYTNRIFILLSVLHRVHSNVYNYGATVE
FT                   EGEDSSGHNSLTSSDIVRGTLQRNFNGIRLENIDVVIPSKYGKDGTRLINKLSFQVPPV
FT                   ITLGNGNSDSNLNINKKLAFQGPGSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSI
FT                   PPASDLFCVPQKPYFIQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKLDYLLKR
FT                   DKGWRYLDAVAEWKDVLSGGERQRINFARIMFHKPRFVVLDEATNAISADMEDYLFGLL
FT                   KRYRFNFITISQRPSLIKYHDLALDISTDGTWRLQNLGTDEVITSIEKEIEMLENKLKN
FT                   VNVWEGERAALMRKLAHI"
FT   gene            <894176..>895039
FT                   /locus_tag="KLTH0D10912g"
FT                   /old_locus_tag="KLTH-ORF11333"
FT   CDS_pept        894176..895039
FT                   /locus_tag="KLTH0D10912g"
FT                   /old_locus_tag="KLTH-ORF11333"
FT                   /product="KLTH0D10912p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22746"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEZ1"
FT                   /protein_id="CAR22746.1"
FT                   /translation="MSFSGVLHKYASRRVAFEFNSTPSKKVVVFIGGLGDGLLTVPYVP
FT                   KLAQELGSLGWSVIQIQFTSSFKGWGLTSLDQDVSEIKELVDYLKSTEGGSRERIVLFG
FT                   HSTGSQDTMHYLLKFGDTIDAGVLQASVSDREFFGQAVDKETWNRLNSKAKELVDKGQK
FT                   DEILPLEYAKVMSETPVTAYRWCSLALPGGDDDYFSSDIPDETLKTTFGRVKKPFLVAY
FT                   SEQDQIVPAYVDKKKLLDRWQACSNTDFWSKNSGLVNGANHQIEQVQSQDQLLSMVREF
FT                   LTEFQL"
FT   gene            <895142..>895927
FT                   /locus_tag="KLTH0D10934g"
FT                   /old_locus_tag="KLTH-ORF11332"
FT   CDS_pept        895142..895927
FT                   /locus_tag="KLTH0D10934g"
FT                   /old_locus_tag="KLTH-ORF11332"
FT                   /product="KLTH0D10934p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10934g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22747"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEZ2"
FT                   /protein_id="CAR22747.1"
FT                   /translation="MTSISINFSGLGYLRSNSKGVDARGPLSRSTIRRNSHNTMARTLR
FT                   NGPAFSDPSVTVEPIQFKLFNSGDVATAFPVFSAEDLPDSLVDYMHQEFNKNVDAGQTY
FT                   PHMQLMNREEFIDYWLHSFCAVALKTDKLVIGPEWNDWEDRFLGTFFVKPNYLPRCSHN
FT                   CNGGFLVNSLQRGQGIGYRLGQVYLSWAPLLGYTYSVFNLVFVTNVGSWKIWDKLAFDR
FT                   IGYLPKAAILKGFEQPVDAIMFGKDLTNVEPRLLADLHV"
FT   gene            <896070..>896660
FT                   /locus_tag="KLTH0D10956g"
FT                   /old_locus_tag="KLTH-ORF11330"
FT   CDS_pept        896070..896660
FT                   /locus_tag="KLTH0D10956g"
FT                   /old_locus_tag="KLTH-ORF11330"
FT                   /product="KLTH0D10956p"
FT                   /note="similar to uniprot|Q12036 Saccharomyces cerevisiae
FT                   YPL148C PPT2 Phosphopantetheine:protein transferase
FT                   (PPTase) activates mitochondrial acyl carrier protein
FT                   (Acp1p) by phosphopantetheinylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D10956g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22748"
FT                   /db_xref="GOA:C5DEZ3"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEZ3"
FT                   /protein_id="CAR22748.1"
FT                   /translation="MPMKRISSRLLNKRMLLLPATLAIPPHAAMLGIGTDIVYLPRFAK
FT                   IVEKHAPVGQSTTFRKIATKFMHPEEVRHLYQMLQLGYNSPSVVRYLAGVWATKEAIFK
FT                   SLAAQRLEIPLLPAQKIYTQVFYKTNEQDGAPRVEFDSSIERLHPEFARAYIANTRFVL
FT                   SIAHDEDYLVSFVCHIRGQAAENVVQKTPRPFS"
FT   gene            <896959..>898669
FT                   /pseudo
FT                   /locus_tag="KLTH0D10978g"
FT                   /old_locus_tag="pseudo-Klth0D-896959-898669"
FT   gene            complement(<898726..>899616)
FT                   /locus_tag="KLTH0D11000g"
FT                   /old_locus_tag="KLTH-ORF11323"
FT   CDS_pept        complement(898726..899616)
FT                   /locus_tag="KLTH0D11000g"
FT                   /old_locus_tag="KLTH-ORF11323"
FT                   /product="KLTH0D11000p"
FT                   /note="similar to uniprot|Q12380 Saccharomyces cerevisiae
FT                   YPL149W ATG5 Conserved autophagy-related protein that
FT                   undergoes conjugation with Atg12p and then associates with
FT                   Atg16p to form a cytosolic complex essential for
FT                   autophagosome formation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11000g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22749"
FT                   /db_xref="GOA:C5DEZ4"
FT                   /db_xref="InterPro:IPR007239"
FT                   /db_xref="InterPro:IPR042526"
FT                   /db_xref="InterPro:IPR042527"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEZ4"
FT                   /protein_id="CAR22749.1"
FT                   /translation="MDNVRRRAWAGSLNLRVTVHPDLTLNSSNEPEHIISFRVPREIYL
FT                   VLYFPYILERVAPELRTNVTDFYNGWWLEMEGVPLSWNFPAGVLFDSLTGLDPALRSSR
FT                   HRHNSLNVWELTLRHEDQCPTNVIPIVRGRDQVREFWMHQWKQACFILNGASKQVMSLS
FT                   KPDTMKFWDSILRRDQNSFDTIKEKILPTFDNTRYVPLRVHLALPQIRFLEPQAKVQHN
FT                   NGHIRLGDVLSSEFPEWFPNDSSTPNLAKAVIQGIEVPLQLSVWYLYQELSSFDGFLHV
FT                   SLCLMTEDASLTSRS"
FT   gene            <899665..>901266
FT                   /locus_tag="KLTH0D11022g"
FT                   /old_locus_tag="KLTH-ORF11322"
FT   CDS_pept        899665..901266
FT                   /locus_tag="KLTH0D11022g"
FT                   /old_locus_tag="KLTH-ORF11322"
FT                   /product="KLTH0D11022p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11022g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22750"
FT                   /db_xref="InterPro:IPR010770"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEZ5"
FT                   /protein_id="CAR22750.1"
FT                   /translation="MIFFKLISSPYQLINKAEKMHESESEHLGKAALLWSDLSETHDGL
FT                   DETPEETYIYFGIFHLDIIHGQSAEHLNRALKQFQDLIRPWNEFYPWTNYNGVKTEVVE
FT                   DSASAPYILGSLCITDNLEEESLVVSLLQRFSSLQGPEIFVKVTGSDGEVLLIESHDVL
FT                   PSEYEYPKGNNRLWIHEGKFKLIPSNVTPGRGMERSEALNFLLNTYYKLIEVPEVSSIL
FT                   HQRFVLDTPEKYLRNLYQLPLELNNKQHFELLKKKPRLIGYIIKCLYQENLSHEPEKII
FT                   EECENQPLTLLLPVSQCKLLSFYLQYSGIDLQSERLPSITGAIISRALEQVIRYDKHFQ
FT                   RENFTSCSEALDSFQVQLVSQGYLKKEVPHQKANMGALLIEAEAEVAEEDTMERMQSLF
FT                   TGIKSSLEEEDNNKQANESSDDSDTAADHEAQKFFSAQNIDIDEDDFFEFFLTEALKVK
FT                   KEDLKNYQSGSAPPSERYHEKEDEAEAVNEFEGHLSTDSRGHSNDTEALEELIEAMRLD
FT                   PSAFENIQNILDLDSE"
FT   gene            complement(<901388..>903937)
FT                   /locus_tag="KLTH0D11044g"
FT                   /old_locus_tag="KLTH-ORF11321"
FT   CDS_pept        complement(901388..903937)
FT                   /locus_tag="KLTH0D11044g"
FT                   /old_locus_tag="KLTH-ORF11321"
FT                   /product="KLTH0D11044p"
FT                   /note="similar to uniprot|Q12152 Saccharomyces cerevisiae
FT                   YPL150W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11044g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22751"
FT                   /db_xref="GOA:C5DEZ6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEZ6"
FT                   /protein_id="CAR22751.1"
FT                   /translation="MFPSRLEQNQLKANISASYNKLYGQFSLTELRDVGNYRILKIVGE
FT                   GSFGKVYLASHRLTHQKVVLKMGSKNDPNVVREVFYHRQFDYVYITKLYEVIVTENSVW
FT                   MALEYCPGKELYEYLLIKKRIPLDECSHLFSQIVGAVFYAHSMKCVHRDLKLENILLDK
FT                   KGQAKLTDFGFTRECATKGILETVCGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMI
FT                   HGAMPFDEEDDIKTKYRIVNNEPFYDDNFIDANGKDLIMQLLQKDPSQRPSLTQVLQHP
FT                   FMFPHGSSILEKTDKTIKRQSQGCKHFHSKLERRLLKKLKQSGFDTQAIKQSVNKKKCD
FT                   ALAGTWQLLLEKEKRSEILRHPKRSRSVLSVKKVFEPSLPSRKGSEDLKNPEQGGKAAS
FT                   LKRIMSRKSDTVSIRQPINATQLKMSPQQSPAEQTEGSGNTRSNKKHNFFNKMTNFFKT
FT                   KKQNGIHYQNGSPSLSSKNADKRKRNTNSFESNKNSPHRSPTRNGNGLMPGIDVEKKPH
FT                   EKLKIEEPMLKKFKSNTSSEGSRQTSMGNYDSELDHRPANNEHEVPEGNKLLEQRGRPM
FT                   SILSQQSEMSNDTYNSEYSTDGNISNSKANSSISSNNRNISSVILSPTGDLTDNQTTQS
FT                   RVTTRRSMSIMSSASSASERSSRTDSFYDISTASSPKTMDLRAMGNYSNADTMVPRMTV
FT                   GSQWLSKRGRSPVGRRGRPPKRNISRKLMNHSSSAAQSVIQEESSFDNEDDNSGALIEE
FT                   TEGQGIPDAPLLHDLETPSSISGTPSKPSTPICAEIQPTDTRPVLFAMGRSFSGGSRWS
FT                   RNLSEERILTSDFPSLQNAGVHSDIGSADDEDNSLDD"
FT   gene            <904878..>906359
FT                   /locus_tag="KLTH0D11066g"
FT                   /old_locus_tag="KLTH-ORF11315"
FT   CDS_pept        904878..906359
FT                   /locus_tag="KLTH0D11066g"
FT                   /old_locus_tag="KLTH-ORF11315"
FT                   /product="KLTH0D11066p"
FT                   /note="similar to uniprot|Q08645 Saccharomyces cerevisiae
FT                   YOR241W MET7 Folylpolyglutamate synthetase catalyzes
FT                   extension of the glutamate chains of the folate coenzymes
FT                   required for methionine synthesis and for maintenance of
FT                   mitochondrial DNA present in both the cytoplasm and
FT                   mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11066g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22752"
FT                   /db_xref="GOA:C5DEZ7"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR023600"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEZ7"
FT                   /protein_id="CAR22752.1"
FT                   /translation="MRLSVPLRMSTRPARSYSDAIAALNSLQSNYANIMAIRASGDRKN
FT                   KMNIWEMQEWSRRIGYSTSDFNKLNIVHITGTKGKGSTAAFTQSVLQQYGDQIRKIGLY
FT                   TSPHLKSVRERIRINGQPICEEKFSSYFFDVWDKLEATSSPLDNFPHMTPGSKPGYFKY
FT                   LTLLSFHVFMQEGCDSCIYEVGVGGEFDSTNIIESPTACGVSLLGIDHTFMLGETIEEI
FT                   AWNKGGIFKKGSPAFTIAAQPTKGLEVLKERAQERETSLTEVPIFDSLKKIKLGIAGDF
FT                   QISNASLAVALASQHLVRLGVLDQNLQLAPDTELPQRFVDGLTSAKWNGRCQTVQDGAI
FT                   TWLIDGAHTKDSIEAASGWFKSEVIKTPRKKVLLFNQQTRDAEALITNLHKCLLPEVAF
FT                   DRVIFTTNVTWKSGSYSADLVSMNTSKEQVENLEVQNALRDTWLRLEPHAKVDVVANIE
FT                   SAIELVKAYNEPVEVVVTGSLHLVGGLLVALDGKD"
FT   gene            complement(<906439..>907707)
FT                   /locus_tag="KLTH0D11088g"
FT                   /old_locus_tag="KLTH-ORF11312"
FT   CDS_pept        complement(906439..907707)
FT                   /locus_tag="KLTH0D11088g"
FT                   /old_locus_tag="KLTH-ORF11312"
FT                   /product="KLTH0D11088p"
FT                   /note="some similarities with uniprot|Q96US5 Saccharomyces
FT                   cerevisiae YOR242C SSP2 Sporulation SPecific involved in
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11088g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22753"
FT                   /db_xref="GOA:C5DEZ8"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034250"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEZ8"
FT                   /protein_id="CAR22753.1"
FT                   /translation="MAPRESLPDCWTTKIQGADIDNGSMRVRPSRLVSVSSMLGSGVGA
FT                   SSRSSSRWKQEAHDLFGLKRLARAYFRGEEHYTKEDVPDYGVMRFPPKGTRLRKNQTSS
FT                   ATLIKPNCHAPQTTDGSMKPLLPQKKHCYSVSMGSLIEGRDVNVKPLKTPVAVESGENV
FT                   SQFGDIKGLKKSTLNSSALLNKHHVNAAFLQNSHQDSENGEERVVEILELPQDVGIQSL
FT                   LSQVYGGPLEKVNVSKDQRGAPARGARLHFLFNEDAKSFISYGLSNNFRINGHIVKPQW
FT                   APKSTCSLSNMNFDEVKDMVSANACAGRQEGTRARRCIVVKKTGCTKSPRSRQLHSNRQ
FT                   NLCSFDYKDLRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALESFGEPDSFMHK
FT                   KYNRDWTMAYGRDTTDRACYHMF"
FT   gene            complement(<907970..>910036)
FT                   /locus_tag="KLTH0D11110g"
FT                   /old_locus_tag="KLTH-ORF11311"
FT   CDS_pept        complement(907970..910036)
FT                   /locus_tag="KLTH0D11110g"
FT                   /old_locus_tag="KLTH-ORF11311"
FT                   /product="KLTH0D11110p"
FT                   /note="similar to uniprot|Q08647 Saccharomyces cerevisiae
FT                   YOR243C PUS7 pseudouridylates U2 snRNA at position 35"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22754"
FT                   /db_xref="GOA:C5DEZ9"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:C5DEZ9"
FT                   /protein_id="CAR22754.1"
FT                   /translation="MSEIEDKKRGNEAIAADAGPESTLDSHLDKKPKVMGPEGISETDV
FT                   GITKFLTDNVPGFLGQIKQRYTDFMVNEIDKQGNVVYLTDKGFKMPKAPKKSKEEETEE
FT                   ELAEAERRKQFKVDEDLRAQLVELLGEEDVEKIEDSYKNVTKMETSRKFDGKAERTKIH
FT                   QLLRAAFNNQLESVTSPENTFLIALANRRSRVNKKDLVERNKDANGVENWGYGPSKSFI
FT                   HFTMYKENKDTMDVANVLSKFLKTPTRLIRFAGTKDRRAITCQRMSISKINIDRLNALN
FT                   RALKGVVLGGFKFEDESLSLGDLRGNEFTIAIRDVKVPEVSTVSLEQILADGCAFIKEN
FT                   GFINYFGMQRFGTFSVSTHEVGKCLLLEQWEKAANLILAEQENVLPISKEARKIWSETK
FT                   DPAAALKRMPRQCVAENAILHSLADQARNGDSAGNYLHCINKIPRNLRTMYGHAYQSYV
FT                   WNTVTSKRIELYGLKVVAGDLVIDESAQQGSKAGNASGDADADEEDDFAEDLREAQFVR
FT                   ARPVTQEEVDAGKFSIEDVVLPSPGFDVVYPANESLRQIYVDVMNKDGLDPFNMRRKIR
FT                   DFSLAGSYRNIIHKPQDLSFKILHYSSPTQQLINTDLEILNNKKGKENGQKYMKDKLSR
FT                   FPEDKGGESTAVILSFKLGVSAYATMLLRELMKLETSRRGDMCDVKTHSEQAN"
FT   gene            <910259..>911572
FT                   /locus_tag="KLTH0D11132g"
FT                   /old_locus_tag="KLTH-ORF11309"
FT   CDS_pept        910259..911572
FT                   /locus_tag="KLTH0D11132g"
FT                   /old_locus_tag="KLTH-ORF11309"
FT                   /product="KLTH0D11132p"
FT                   /note="similar to uniprot|Q12417 Saccharomyces cerevisiae
FT                   YPL151C PRP46 Splicing factor that is found in the Cef1p
FT                   subcomplex of the spliceosome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22755"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF00"
FT                   /protein_id="CAR22755.1"
FT                   /translation="MSIDRIHGPEHAREVYLKHLWEKRFKNLAQVSPDLQKKIEDRKNV
FT                   LERYEEFRSASSAPSEPSTGALVHYEKPLPDTAQTASLVRKVYREDDSFNLLMERQSRQ
FT                   LALEPSWHAPWKLMRVINGHNGWVRCVCVDPVDNEWFATGSNDTTIKVWDLASGKLKLT
FT                   LAGHVMTVRSIAISQRHPLMFSASEDKLVKCWDLEKNTVVRDYHGHFSGVHTVDVHPTL
FT                   DLIASAGRDAVVRLWDIRTRVPVMTLAGHKGPINQVKCFPVDPQIMSGSADSTVRLWDI
FT                   RAGKAMKILTHHSKSVRAIAGNPSESSVATASTSDIRSWRLQDGQLLTNFRSEDTGIIN
FT                   CLSVNPDGVLFAGGDDGHLSFYDYKTGHKFQDLPTIKVPGSLESERGILSASFDQTGLR
FT                   LITGESDKSIKVWKQIPGATQETHPNLPWNPRLESQRF"
FT   gene            <911708..>913045
FT                   /locus_tag="KLTH0D11154g"
FT                   /old_locus_tag="KLTH-ORF11307"
FT   CDS_pept        911708..913045
FT                   /locus_tag="KLTH0D11154g"
FT                   /old_locus_tag="KLTH-ORF11307"
FT                   /product="KLTH0D11154p"
FT                   /note="highly similar to uniprot|Q08649 Saccharomyces
FT                   cerevisiae YOR244W ESA1 Histone acetyltransferase catalytic
FT                   subunit of the native multisubunit complex (NuA4) that
FT                   acetylates four conserved internal lysines of histone H4
FT                   N-terminal tail required for cell cycle progression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22756"
FT                   /db_xref="GOA:C5DF01"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR025995"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037995"
FT                   /db_xref="InterPro:IPR040706"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF01"
FT                   /protein_id="CAR22756.1"
FT                   /translation="MSHDEEKKPVVPKEISDIGELNIGCKCWVDKDGEERLAEILSINK
FT                   RKSPPKFYVHYEDFNKRLDEWVLTPRINLGREVFFPQDEKDAKEAEKDKSSSKKQKQKK
FT                   NTPASRSSSHSDAVDGEDVMDLDNLNVQGIKDEDISRDDEIKKLRTSGSMVQNSHEVAR
FT                   VRNLNKIIMGKYEIEPWYFSPYPIELTDEDVVYIDAFTLQYFGSKKQYERYRSKCTLRH
FT                   PPGNEIYRDDYVSFFEIDGRKQRTWCRNLSLLSKLFLDHKTLYYDVDPFLFYCMTRRDE
FT                   LGHHLVGYFSKEKESAEGYNVACILTLPQYQRMGYGRLLIEFSYELSKKEGKAGSPEKP
FT                   LSDLGLLSYRAYWADTLIKLLMNHGTEITIDEISSMTSMTTTDILHTLKALNILQYYKG
FT                   QHIIYMNEDVVQRYEKIKQKKGRNIDPAKLIWKPPVFTASQLRFAW"
FT   gene            complement(<913077..>914138)
FT                   /locus_tag="KLTH0D11176g"
FT                   /old_locus_tag="KLTH-ORF11304"
FT   CDS_pept        complement(913077..914138)
FT                   /locus_tag="KLTH0D11176g"
FT                   /old_locus_tag="KLTH-ORF11304"
FT                   /product="KLTH0D11176p"
FT                   /note="similar to uniprot|Q12461 Saccharomyces cerevisiae
FT                   YPL152W RRD2 Resistant to Rapamycin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22757"
FT                   /db_xref="GOA:C5DF02"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="InterPro:IPR037218"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF02"
FT                   /protein_id="CAR22757.1"
FT                   /translation="MKPQKRLLTQDDMDIWSHSETFNNLISFLSGLAESVKGLENNEYQ
FT                   KPTGSSIESCCQLLEEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAF
FT                   DALDGTQCEELSVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVL
FT                   KLFIKYLGVMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPKSIHNS
FT                   EVVEMFGKRYLYFGCIDFINKVKTTASLRWHSPMLDDISGVKTWAKVAEGMIKMYKAEV
FT                   LNKLPIMQHFFFGSFLQCPEGISPPGTHAESHQHCSHSPLENTWGDCCGIRVPSAVAAT
FT                   ESQKAGPKRIPFD"
FT   gene            complement(<914281..>915780)
FT                   /locus_tag="KLTH0D11198g"
FT                   /old_locus_tag="KLTH-ORF11302"
FT   CDS_pept        complement(914281..915780)
FT                   /locus_tag="KLTH0D11198g"
FT                   /old_locus_tag="KLTH-ORF11302"
FT                   /product="KLTH0D11198p"
FT                   /note="similar to uniprot|Q08650 Saccharomyces cerevisiae
FT                   YOR245C DGA1 Diacylglycerol acyltransferase catalyzes the
FT                   terminal step of triacylglycerol (TAG) formation acylates
FT                   diacylglycerol using acyl-CoA as an acyl donor localized to
FT                   lipid particles"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22758"
FT                   /db_xref="GOA:C5DF03"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF03"
FT                   /protein_id="CAR22758.1"
FT                   /translation="MCKTLNRTKQLAERLLRGHLSWAEVDNTADGLKRSDGRTATMDNS
FT                   KGLKQRGREGGRENGGEHGAEHRDENAASERSSKASGFLHHELDHVRLYDRNHQEGKKL
FT                   SEFVEEINHFQEPRPKLAFCSVKTPWRRRLQTLAVAWHVASFVYILAFAILALANPIMW
FT                   IIMFPYMAYYAFDRSPANGNVTKRYSKWMRGLTFWRYYCDYFPIQLHKTADLKPTFTHK
FT                   KHSSGCPSEDKYLVSFQLRLWPLRYSLKVNILKLGGAPPREVTGPRYIFGYHPHGVAAL
FT                   GAFGAFATEGANWSKLFPGIPMCLMTLVNQFQIPFYRDYLLSLGVTTVSKKNALKVLER
FT                   NHSICIVVGGAQEALMSKLGSADLVLKRRKGFIKLALETGNVCLVPCFAFGETDCYNIL
FT                   ETDEKSYLHKFQLWFKKTYGFTIPLFFARGLFNYDFGLIPFRKPINVVTGNPIYIKRKH
FT                   DNPTVEEIDHYQKLYIDELQRTFDDYKRQFGYKDLELNLAE"
FT   gene            <916020..>918002
FT                   /locus_tag="KLTH0D11220g"
FT                   /old_locus_tag="KLTH-ORF11301"
FT   CDS_pept        916020..918002
FT                   /locus_tag="KLTH0D11220g"
FT                   /old_locus_tag="KLTH-ORF11301"
FT                   /product="KLTH0D11220p"
FT                   /note="weakly similar to uniprot|P36044 Saccharomyces
FT                   cerevisiae YKL201C MNN4 Putative positive regulator of
FT                   mannosylphosphate transferase (Mnn6p), involved in
FT                   mannosylphosphorylation of N-linked oligosaccharides;
FT                   expression increases in late-logarithmic and stationary
FT                   growth phases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22759"
FT                   /db_xref="GOA:C5DF04"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="InterPro:IPR009644"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF04"
FT                   /protein_id="CAR22759.1"
FT                   /translation="MKLTRRPQRPIKALKRAPYYLASIALLYIVFGIAIKHGSNEPRAP
FT                   SAQESSSFSKKDYYENFLQRLPVSRMGQDSISQINFETRAGSRRFTQKDELGKTLVPAR
FT                   SGHEVEPGREVLLPVASSFRQWERSLSTEERWSHSLAATMAFVSKLVRMGFKHPVVPFS
FT                   WRDWHDTSEITKTKVSGLSSEYFEVAESEAIKAARGARFLYLDGVAINKMVVLYNESCI
FT                   ELNARNLDSRKSAIFDPESGMLSDIRELESQRGPAFFNMSSVKQDISLNSQDHQSASRE
FT                   PLPSNHEDSAKLHPTKPISLPKIETRRNFKYHGKEEGVIELIEEDFDLDLSNRIEEMSQ
FT                   ISICDEYNGKNITVAESAFLQHLAFRHTEMLRETSRSLNEKHQTKFFNEVKLDSKDREI
FT                   WGQGCHHDWRFFRSITPQQQRLQVLHRMTRAWQSFASHQKIIYWLAHGNLLSWFWQGTN
FT                   FEWDYDIDIQVPMRHMEFLSANFNNSIIISDDEGYVGRYYLEVNPLYADKNRGSGMNVI
FT                   DARFIDVDTGLYIDLTSISNVVDSAGSHFGDKNYHSYQSFSYLNPLRETMYEGSKTYIP
FT                   AAVQNILSDEYPSGLSKMEYKDYVYNKTISGWISNSKNPNMIPEPLKIMWKRHQLEIAA
FT                   LCPLEGFKDTKSCKDRTTSESGKKN"
FT   gene            <918232..>920619
FT                   /locus_tag="KLTH0D11242g"
FT                   /old_locus_tag="KLTH-ORF11296"
FT   CDS_pept        918232..920619
FT                   /locus_tag="KLTH0D11242g"
FT                   /old_locus_tag="KLTH-ORF11296"
FT                   /product="KLTH0D11242p"
FT                   /note="similar to uniprot|P22216 Saccharomyces cerevisiae
FT                   YPL153C RAD53 Protein kinase required for cell-cycle arrest
FT                   in response to DNA damage activated by trans
FT                   autophosphorylation when interacting with
FT                   hyperphosphorylated Rad9p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22760"
FT                   /db_xref="GOA:C5DF05"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016256"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF05"
FT                   /protein_id="CAR22760.1"
FT                   /translation="MDYVTQPTQQATQATQKYIIEKFSQEQIDDDIVCRMICTTGQIPI
FT                   RDLRAELRDVVGKKESIKKLWTFGRNPQCDYHLGNTSRFSNRHFQIMLGEDGNLLLRDT
FT                   STNGTWLNGERLVKERNQILSQGDEITVGWGVSQDVLSLVVFINDKFKQRLEAAKAHGS
FT                   KSAKSRSSRGASSSAQLTGILRDYSIKDEVVGQGAFATVKKAIERRTGKTHAVKIINKR
FT                   KVMGNMDGVTRELEVLRRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSV
FT                   GEDAGREITRQVLEAVKYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGT
FT                   FMKTFCGTLAYVAPEVISGKNSEEKEGNKYSSLVDMWSIGCLVYVILTGHLPFSGSTQQ
FT                   ELYKQISAGSYHEGPLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIRTADSQS
FT                   FIDSQVSLSQSMSQQKASDNVSDAQQQFINMRATKPKDEQPQSSPQEPQTQQPVFKIPG
FT                   HRPVRYTQSCVPENSQPSSLKQVRTANFDFNYASQASDESQQPVQIPRGRVPPRLADPD
FT                   NEDDVRLNADSMTAAGGRFITLRSTAESSVKGVIEIKQGVNPFFIGRSQDCSCKIEDNR
FT                   LSRIHCFVLKKRHPIGDSIHESPAQGLEDLWYCHSGTNLSYLNDVKLTQGTKALLYEGD
FT                   EIKIISDRANNFVISFVVEINDSTGLFNHGKPFPGHERLVEQQTPDELGLTRKLTDLKK
FT                   AFASQNSSKRVRSISLSQDPNKKAKRARLDKADKGGANLQFI"
FT   gene            <920981..>922234
FT                   /locus_tag="KLTH0D11264g"
FT                   /old_locus_tag="KLTH-ORF11292"
FT   CDS_pept        920981..922234
FT                   /locus_tag="KLTH0D11264g"
FT                   /old_locus_tag="KLTH-ORF11292"
FT                   /product="KLTH0D11264p"
FT                   /note="highly similar to uniprot|P07267 Saccharomyces
FT                   cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
FT                   (proteinase A) required for the posttranslational precursor
FT                   maturation of vacuolar proteinases synthesized as a zymogen
FT                   self-activates"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22761"
FT                   /db_xref="GOA:C5DF06"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033819"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF06"
FT                   /protein_id="CAR22761.1"
FT                   /translation="MHLPSLLSLATLLVASFNSAEAKVHKSKVYKSKQHNDGSELGVMM
FT                   SVANLHQKYLSQFSKAYPEVDFASHAGSGIGLGAVEQDVLSAMGGHDVPLSNYLNAQYF
FT                   TEITLGTPPQSFKVILDTGSSNLWVPSDECGSLACFLHSKYSHDASSSYKANGTNFAIQ
FT                   YGSGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLGYDTIAVDKV
FT                   VPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGIDSSKYKGNITWLPVRRKAY
FT                   WEVKFDGIGLGDEYAELEGTGAAIDTGTSLIALPSGLAEVLNAEIGAKKGWSGQYTVDC
FT                   ESRDQLPDLTFTFNGKNFTISAYDYTLEVSGSCISAFTPMDFPEPVGPLAIIGDAFLRK
FT                   FYSVYDLGNNAVGLAQAV"
FT   gene            <922942..>924978
FT                   /locus_tag="KLTH0D11286g"
FT                   /old_locus_tag="KLTH-ORF11289"
FT   CDS_pept        922942..924978
FT                   /locus_tag="KLTH0D11286g"
FT                   /old_locus_tag="KLTH-ORF11289"
FT                   /product="KLTH0D11286p"
FT                   /note="similar to uniprot|P28743 Saccharomyces cerevisiae
FT                   YPL155C KIP2 Kinesin-related motor protein involved in
FT                   mitotic spindle positioning"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22762"
FT                   /db_xref="GOA:C5DF07"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF07"
FT                   /protein_id="CAR22762.1"
FT                   /translation="MIHKSPTRKHMSRFCNYPVPQTPVFQTGGGTFSSRRRKSSVTPLT
FT                   TPLSTTSVRRRSRQSSPSRSSMISSPTRTSSGSSSRGRSAEGLVNLDNVLEGGTTQQCR
FT                   GTISVSIRLKPSDTNTRSPWYASDDHTIVHNDLGEFWFDKVFSPQTNNYGVYEEIGKPM
FT                   IDKLFQGYNATIFAYGMTGSGKTFTMSGTRDEAGLILLSVEQIFSQIMKESVNNKSYEV
FT                   RVSYLEIYNEKIYDLLNYPSAKSPGGTYGSFQSKNVPGAGAELPVRDDARHGVRVVGLT
FT                   EQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKVTCTELLSGTDTTSTLS
FT                   LCDLAGSERAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGGAATPPPTFGNSH
FT                   VPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRAKNVSMTVKRNE
FT                   AEATHDKDELLHSLRRQLDEQQDLICELRRAQPPADQSSCEATPLGPSATVLMLRRENE
FT                   TLKKKLQHCERLLDKDDAAVEDEQFVEIVEMLPPAVGALLESKIQGLESQLREHRAYTA
FT                   QLEQRLSEAEAEARLVTQQARAQAQTLSGDDGTLQRVVREQEEELEELQRSLARKNKML
FT                   DALQSAKRLREGALRPLNRGLGAGAGAGLGDGRVAHKSGGVGT"
FT   gene            <925622..>926437
FT                   /locus_tag="KLTH0D11308g"
FT                   /old_locus_tag="KLTH-ORF11281"
FT   CDS_pept        925622..926437
FT                   /locus_tag="KLTH0D11308g"
FT                   /old_locus_tag="KLTH-ORF11281"
FT                   /product="KLTH0D11308p"
FT                   /note="some similarities with uniprot|Q12498 Saccharomyces
FT                   cerevisiae YPL156C PRM4 Pheromone-regulated protein
FT                   predicted to have 1 transmembrane segment transcriptionally
FT                   regulated by Ste12p during mating and by Cat8p during the
FT                   diauxic shift"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22763"
FT                   /db_xref="GOA:C5DF08"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF08"
FT                   /protein_id="CAR22763.1"
FT                   /translation="MGFRVASGRVSSRSSHAVSCAVALLLILGFVALTSSDTVRLYGSL
FT                   ANARDAEPAASATASAAASGASKHAGSHGRSHSRAEAAAKPSASAEAGPRAVEQIFSDI
FT                   RLEISDNSGVATRVATRAEIVRSEVVHGPRNYRPPSADFDPAANFQEILSASPVVLFVD
FT                   SAQDSERLRALLQRDYEVSPAPAVVDLEKHSRGAQLETYIRYYRTKPASATAVPRQPPY
FT                   LFVNGNSVINSDFQSDIQDLHAQNELLAKLKTVAEGNVMFARNNAPSNS"
FT   gene            complement(<926504..>927412)
FT                   /locus_tag="KLTH0D11330g"
FT                   /old_locus_tag="KLTH-ORF11276"
FT   CDS_pept        complement(926504..927412)
FT                   /locus_tag="KLTH0D11330g"
FT                   /old_locus_tag="KLTH-ORF11276"
FT                   /product="KLTH0D11330p"
FT                   /note="similar to uniprot|Q12052 Saccharomyces cerevisiae
FT                   YPL157W TGS1 TrimethylGuanosine Synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22764"
FT                   /db_xref="GOA:C5DF09"
FT                   /db_xref="InterPro:IPR019012"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF09"
FT                   /protein_id="CAR22764.1"
FT                   /translation="MGRLNSSELEHFVHLGKRKYRRERRALKKLFRTNEHRVEPDVKVV
FT                   DRTIFKYWKNRLTLFSRMRNRDIYMTRELWFSVTPESVAKFVARFIKSCLPEAKVVLDV
FT                   YCGGGGNTIQLAQYFPKVYGVDNSLDHLYCAYRNAQAYGVEDRVWLKFGDWRVLSRKRR
FT                   FEKVAVDCVFSSPPWGGPEYLRSEVYDLEAALQPQGLRETLAGLLRISENVVLFLPRNA
FT                   DLSQLSRVTRELLGEQALCKVLYVKQNGYMKGILCFWGARFYNYAGSTAEPSGAAQESS
FT                   GVAEPCEVAPGADTLDYSVDG"
FT   gene            <927949..>929754
FT                   /locus_tag="KLTH0D11352g"
FT                   /old_locus_tag="KLTH-ORF11270"
FT   CDS_pept        927949..929754
FT                   /locus_tag="KLTH0D11352g"
FT                   /old_locus_tag="KLTH-ORF11270"
FT                   /product="KLTH0D11352p"
FT                   /note="weakly similar to uniprot|Q99299 Saccharomyces
FT                   cerevisiae YPL158C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22765"
FT                   /db_xref="GOA:C5DF10"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DF10"
FT                   /protein_id="CAR22765.1"
FT                   /translation="MIRTPTRTKTLSFAGPQVDFHFPSPESAPNGSLDNYHMSNHHLLN
FT                   DAVARSPSQNSSGTSNGVDSAHYSFANISDNTTGVRNAGNGKRSSQAPSWSSGSGSCRR
FT                   YPVTLAPITNASALARPGDSGAADVRKNDTAAFLRRKRSPEDCALHSISTSAYTIPTAD
FT                   NISFQITFGSSDKSHSLGSLRRSPSFGRRLPSRRTAGSSNNAPVSASLPARAASVKSTQ
FT                   STLKRSQAVRCKGGLLQFFMQVGVRAKNRIRRWRLAVRKKLFTYKAKRLAKKNKKQTTS
FT                   HLKRGNGYVSNIQRSISSASLRNSQRKNSDSASKETPATVARSGTLPNPLETPPKTTRK
FT                   SLRRSPSSIKRAASILTRANSSGTITQGTAEKNNAGENIPRTKLVRSGPSLSLSSIARQ
FT                   PSIVVNNKVIPLTSLNEDTKDFTIEEEDEDEYVIDTDCMKKSVRGYSQSSSGSSNSGKS
FT                   SDETYHDSLENPTPDESLLPDEKVSRALDAWNHYLRAVVAQRVLMRLQIRRFQESGGDP
FT                   ECQELIDAIISDYEENSSSHCDSDLRSDSTSLTSVSDCEGRVSSSVASDVSVGITGSIF
FT                   SARPFQQTMKNSVKRSLTLPVGFRV"
FT   gene            complement(<929788..>931119)
FT                   /locus_tag="KLTH0D11374g"
FT                   /old_locus_tag="KLTH-ORF11266"
FT   CDS_pept        complement(929788..931119)
FT                   /locus_tag="KLTH0D11374g"
FT                   /old_locus_tag="KLTH-ORF11266"
FT                   /product="KLTH0D11374p"
FT                   /note="similar to uniprot|Q03649 Saccharomyces cerevisiae
FT                   YMR210W Hypothetical ORF and weakly similar to YPL095c
FT                   uniprot|Q02891 Saccharomyces cerevisiae YPL095C
FT                   Hypothetical ORF and weakly similar to YBR177c
FT                   uniprot|P38295 Saccharomyces cerevisiae YBR177C EHT1
FT                   Possible serine hydrolase, may be involved in lipid
FT                   metabolism, null mutant slightly temperature sensitive at
FT                   37C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22766"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF11"
FT                   /protein_id="CAR22766.1"
FT                   /translation="MESILHHLPIYSHVRQTRPFEPLKFVGEQSGTSTDLPTLVDKCSP
FT                   EFSNGAMALFHPLYFNGHLQTLYAAVRTFDKENMVYYKRLVVPCRDGGEATADFRVPPF
FT                   EKASDYTPPNQTKPLMPRYSFFTPEEERNLGSNDEKPLLIVLHGLTGGSHEAYVRSLVD
FT                   RITTNYGFEACVLNSRGCSESCITTPQLYNGVWTNDIRDFVVKLRALFPKRKFYLVGFS
FT                   LGASIATNYLGQEGSNSQIECAAILANPWDLCNASYYMYRTFLGRNLYGNHFSKSLVKM
FT                   LKDNLSVLKQDPYMAKLYAEKIDSVKTVEEFDNWFTSRMFGFNCSFEYYRYGTSSNRIP
FT                   LIRTPMLAISASDDPIVGSESLPIREIESNPYTLLIESSKGGHVAWFDAHGERWYEEPL
FT                   CRFFSGFHSDVALEGLKPDLASVTLPHANKFKGDRLVDATVRDY"
FT   gene            <931339..>932016
FT                   /locus_tag="KLTH0D11396g"
FT                   /old_locus_tag="KLTH-ORF11264"
FT   CDS_pept        931339..932016
FT                   /locus_tag="KLTH0D11396g"
FT                   /old_locus_tag="KLTH-ORF11264"
FT                   /product="KLTH0D11396p"
FT                   /note="similar to uniprot|Q99373 Saccharomyces cerevisiae
FT                   YPL159C PET20 Protein required for respiratory growth and
FT                   stability of the mitochondrial genome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22767"
FT                   /db_xref="GOA:C5DF12"
FT                   /db_xref="InterPro:IPR014804"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF12"
FT                   /protein_id="CAR22767.1"
FT                   /translation="MIVFRGLRPGVRAGRSAIPKLQRCQSSFTFSTNKLLMQKEQLKDE
FT                   KRKNRRGEAKGEELAAEKDGKKRMASELRGKQRKTDFSWLPKAPSTDHLKHRDVSTTLL
FT                   YSGYRPFVLNSSEQKQTDSTLYEFAMKLEALGDPLPWISSATGTEFYGEWDNIPADVIK
FT                   KLRPFQPPTDDPAAKDKEALKLLQKEIVQKEKDKLINRAKGRKKPILKLLQLSKKIGSE
FT                   NGN"
FT   gene            complement(<932256..>932531)
FT                   /locus_tag="KLTH0D11418g"
FT                   /old_locus_tag="KLTH-ORF11262"
FT   CDS_pept        complement(932256..932531)
FT                   /locus_tag="KLTH0D11418g"
FT                   /old_locus_tag="KLTH-ORF11262"
FT                   /product="KLTH0D11418p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22768"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF13"
FT                   /protein_id="CAR22768.1"
FT                   /translation="MQDAVSVEMMGTDLDQTLSEHFTEEEQFWLYARDQDYDLDTCLEL
FT                   CDHVQLLNEDILTNNVEQRPEIVRAELDFAKFESREKSGSVDYQTA"
FT   gene            complement(<932979..>936275)
FT                   /locus_tag="KLTH0D11440g"
FT                   /old_locus_tag="KLTH-ORF11261"
FT   CDS_pept        complement(932979..936275)
FT                   /locus_tag="KLTH0D11440g"
FT                   /old_locus_tag="KLTH-ORF11261"
FT                   /product="KLTH0D11440p"
FT                   /note="highly similar to uniprot|P26637 Saccharomyces
FT                   cerevisiae YPL160W CDC60 Cytosolic leucyl tRNA synthetase
FT                   ligates leucine to the appropriate tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22769"
FT                   /db_xref="GOA:C5DF14"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF14"
FT                   /protein_id="CAR22769.1"
FT                   /translation="MSSDTGSKGLVLENTARRDALIAIEKKYQKLWAEEHVFEIDAPSI
FT                   EEESVSIDSEELQRKYPKFMSSMAYPYMNGVMHAGHCFTLSKVEFSVGFERMNGKRALF
FT                   PLGFHCTGMPILACADKLKREAELFGSDFSKAPAEEEEDEAAAAKEEVKTESEDVTKFK
FT                   AKKSKAAAKKGRGKFQFEIMLQLGIPHEEVVKFADPQFWLTYFPPLCQSDCSAFGSRID
FT                   WRRSFITTDMNPYYDAFIRWQMNKLKELGKIKFGERYTIYSEKDGQACMDHDRQSGEGV
FT                   TPQEYVGIKIETLEFAEAAKKVVESSDALDKSKRFYFVAATLRPETMYGQTCCFVSPKI
FT                   NYGIFDAGDAYYITTERAFKNMSYQKLTPKRGYYKPLVTISGKDFIGSKIRAPLSAYDE
FT                   LRILPMETVIATKGTGVVTCVPSNSPDDYMTTRDLQNKSQFYGIDPEWVKHEPVPIIRS
FT                   ERYGDLTAQKICEELKIRSPKDTVPLAEAKKIAYKEDFYNGTMIYGKFKGEKVEVAKGK
FT                   LKAELIANNEAFVYNEPESLVVSRSGDDCIVSLEDQWYVDYGEQTWKEQAIECLNQMNT
FT                   FAPEVKNAFEGCLEWLKNWAVCRTYGLGTKLPWDEKYLVESLSDSTIYQAFYTIAHLLF
FT                   KDYYGNEIGPLGIEANQMTPAVFDYIFQHTDNVETDIPIESLQKLRREFEYFYPLDVSI
FT                   SGKDLITNHLTFFIYTHVALFPKKFWPRGIRANGHLMLNNAKMSKSTGNFMTLKQIVEK
FT                   FGADASRIALADAGDTIEDANLDETNANAAILRLYNLKEWADEVVKNLDGLRSGPITEF
FT                   FDVSFENELNALVEETYKQYELTNYKSALKTGLFDLQTARDYYRESCEVMHRDLVLRYI
FT                   EFQVLVLAPIAPHFAEYIWREVLGNTKSVQITRFPRATKPVDAGALSALEYLRNLQRSI
FT                   RESEGQALKKKKGKGSDVDITKPAKMTLLISESFPEWQSEYIELVRKLFESQELDDNKK
FT                   IKQMVNPKDMKRAMPFISMLKQRLVAEPVETVFNRELPFDEVATIKATVENVKKCCQVI
FT                   KCQEFQFISFPYGAKVGKDIFTGEQVDIPNAAKVVENAIPGNPGIIIANI"
FT   gene            complement(<938262..>939236)
FT                   /locus_tag="KLTH0D11462g"
FT                   /old_locus_tag="KLTH-ORF11250"
FT   CDS_pept        complement(938262..939236)
FT                   /locus_tag="KLTH0D11462g"
FT                   /old_locus_tag="KLTH-ORF11250"
FT                   /product="KLTH0D11462p"
FT                   /note="similar to uniprot|Q08651 Saccharomyces cerevisiae
FT                   YOR246C Protein with similarity to oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22770"
FT                   /db_xref="GOA:C5DF15"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF15"
FT                   /protein_id="CAR22770.1"
FT                   /translation="MPARNLDQLPYYDLRKQRKVALVTGGNSGIGWYTVLHLYMHGFVV
FT                   YVAGRNSSRVNRAMKDIKKEARTRIKTLATDQRHPVGELHFLSLDLTALKVVEKAAKRF
FT                   RSLESSLDVLINNAGVMALPYSVTEDGFEIQLQTNYVAHFLLTMRLLPSVKRCRGRIIT
FT                   VSSIGHNLEFSYFSLSQSFNYKPNMLFTWMRYAMAKTASIQFAKMLAIKHPDVLCISVH
FT                   PGLVMKTNLFSYWTRLPIVGIFFWFFFQLVGYFFGVSNEEGSVATLKGALSTELEREWD
FT                   NGKYYTTGGIESKPSYVANNLDNAASTWLWTIHELRDRGYEPT"
FT   gene            <941011..>942834
FT                   /locus_tag="KLTH0D11484g"
FT                   /old_locus_tag="KLTH-ORF11247"
FT   CDS_pept        941011..942834
FT                   /locus_tag="KLTH0D11484g"
FT                   /old_locus_tag="KLTH-ORF11247"
FT                   /product="KLTH0D11484p"
FT                   /note="similar to uniprot|P39011 Saccharomyces cerevisiae
FT                   YPL161C BEM4 Protein involved in establishment of cell
FT                   polarity and bud emergence interacts with the Rho1p small
FT                   GTP-binding protein and with the Rho-type GTPase Cdc42p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22771"
FT                   /db_xref="GOA:C5DF16"
FT                   /db_xref="InterPro:IPR040144"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF16"
FT                   /protein_id="CAR22771.1"
FT                   /translation="MDFENVLFRLKPILDSGSSSQIAKDQDLCNRCVAVLDELAVQLRS
FT                   PTNRDFIRESGVLSKLLKLFNDGLRELSGDKSPTVNWLIFSAELTRCIANCVADNDDNR
FT                   AEFCTLALESAEAFEANFPKIFELTDTATEHVLDLQFKSLALVKNLCLNNEVYTRECSH
FT                   ILTIPLVNLLHSRNLTEFDEHALDIVVMTTDLLSEFVKFSSNSIALKELLIMARLMALI
FT                   SPKIAEQPTEDQITNGDANCEESSEDTEDADPFLELHQCLALCIECVVSKNEALDLSLS
FT                   DSTHKLQQLLLQSLSLAELKNTFENKLIMMRRLLFIIGMVSANVTNTNVQDRAMCYATL
FT                   LQPNGVYNKAAALIVLSNSISSRETADQVSSNIGLGQIVQACSAFKDPMQFQGLLDILK
FT                   KLLNLANVYDLTDEDLKLLFAELRICHEQCQVYQDVSPLLDALLGKFAAVCPGSLLLKQ
FT                   ISDPNFKTLIIQRGGIPACLLIDKFVVGDRNLANGLLADLWASAFRFQELSKISTPHLF
FT                   QLLKSLGIYFRSVGDNDANIVFKQHSSQLVTLLEAIVPMSTNTDSASKSIFNNARFVAG
FT                   MILNLLNGKELTSNEFQLRNLAKQLLAPIES"
FT   gene            <942952..>943761
FT                   /locus_tag="KLTH0D11506g"
FT                   /old_locus_tag="KLTH-ORF11245"
FT   CDS_pept        942952..943761
FT                   /locus_tag="KLTH0D11506g"
FT                   /old_locus_tag="KLTH-ORF11245"
FT                   /product="KLTH0D11506p"
FT                   /note="similar to uniprot|Q12042 Saccharomyces cerevisiae
FT                   YPL162C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22772"
FT                   /db_xref="GOA:C5DF17"
FT                   /db_xref="InterPro:IPR022127"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF17"
FT                   /protein_id="CAR22772.1"
FT                   /translation="MNSGTGDDSCQLLGPISLLIQTLMGVAAISGLLLKRRYEVPKRRW
FT                   RVWFFDISKQVFGSLIIHFLNLGISILKQRKAHFLMVLDDDPGGDQCDWYFLNLLMDTT
FT                   VGTLVLWFVLGLLEEGLRRLGVQNIESGNYYPSRDSSRETEEGPPIRNEPLFSAFGKQL
FT                   LIFVCGLSIMKFCVFLILTYFEVVATWFAELVLGWSDNWPNFQVFLVMFVFPILLNFFQ
FT                   CFCIDNIIKLHPRNLSTSELENFEEGPILYSPGLQNASHTKAMYGST"
FT   gene            <944475..>945056
FT                   /locus_tag="KLTH0D11528g"
FT                   /old_locus_tag="KLTH-ORF11239"
FT   CDS_pept        944475..945056
FT                   /locus_tag="KLTH0D11528g"
FT                   /old_locus_tag="KLTH-ORF11239"
FT                   /product="KLTH0D11528p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22773"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF18"
FT                   /protein_id="CAR22773.1"
FT                   /translation="MRFTTVVASLIAASGFASASEYLNQTTTLRPSGSSSLLNAVTTEL
FT                   TTQTFDSTSTVTLMTTITMSGGQSTGSTTTSAASASSAALTAGQNNKGAFVGSASSASS
FT                   STSEIWSTITSTLYTTQSVTLSNSQVSASVSAYEKQIVIGTSIPSCTPQTVTVTAEKTK
FT                   YITVTAGQTSSAAPVYTPSAGPYSNSTMSI"
FT   gene            <945401..>947494
FT                   /locus_tag="KLTH0D11550g"
FT                   /old_locus_tag="KLTH-ORF11236"
FT   CDS_pept        945401..947494
FT                   /locus_tag="KLTH0D11550g"
FT                   /old_locus_tag="KLTH-ORF11236"
FT                   /product="KLTH0D11550p"
FT                   /note="similar to uniprot|Q12083 Saccharomyces cerevisiae
FT                   YPL164C MLH3 Protein involved in DNA mismatch repair forms
FT                   a complex with Mlh1p to promote meiotic crossing-over
FT                   mammalian homolog is implicated mammalian microsatellite
FT                   instability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22774"
FT                   /db_xref="GOA:C5DF19"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR028830"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF19"
FT                   /protein_id="CAR22774.1"
FT                   /translation="MSQGIRKLTDDVAKSLKSSASIDCITTALRLLLQNSIDAGASHIT
FT                   VFLDLPNRVFTVADNGLGMTRRDLTCFGQQNYTSKLTDVQDVDHLKTYGFKGCSIFEIS
FT                   NVAKIRVISKHESASSGWMKELGGRSEDINNPITEIEKLEKGTVVTVDDFFHNLPVRLE
FT                   SLERPTSGELLDRVRFDIFEILVVHPEVEICINTEGACAGHSKFLETRGIKRSLPETEK
FT                   LLLCLQDVFGLEGENSTLKPVHAQFTDYVVDGLISEVPTFHIKIQLLYVNGLKCEDSAL
FT                   LRPISRAFRNARNCWNQTHGRSGYEMHVLKISMPRCKAKILGGERSLGLGTKQYQIIHA
FT                   LIFKIIESVFNVKLNQYTAIAHRPSKFNTSCTAWKSSNYSLRSASGFEEGKIPALKKPK
FT                   PEPPEHSRNLKSTSTDIDFKKLIQNAGCRGSSEASQEPIMSPFSTLQEHFVDRSLFKRF
FT                   RVVNQVDKKFVLLKSYGSNPDILSLVLLDQHAADERIKYESLLNGFIWGMLTSPHLHIR
FT                   KAHIEVDLSPKEYHIFQQCKNELHQWGILFEGKPVAKPRHLVKLTALPDPLQHRSIEAL
FT                   KNGIIQHACDLRHLRKNHFRSQSTQKLESGAAQNFAWWNYLNSIPTMITDSLKSKACRS
FT                   AIMFGDYLSPQETTLLVEMLGKCRNPFYCAHGRPSLVPIFTHNGCSHTNFTEVPAFTDY
FT                   RLT"
FT   gene            complement(<947503..>949554)
FT                   /locus_tag="KLTH0D11572g"
FT                   /old_locus_tag="KLTH-ORF11234"
FT   CDS_pept        complement(947503..949554)
FT                   /locus_tag="KLTH0D11572g"
FT                   /old_locus_tag="KLTH-ORF11234"
FT                   /product="KLTH0D11572p"
FT                   /note="weakly similar to uniprot|Q08683 Saccharomyces
FT                   cerevisiae YOR249C APC5 Subunit of the Anaphase-Promoting
FT                   Complex/Cyclosome (APC/C) which is a ubiquitin-protein
FT                   ligase required for degradation of anaphase inhibitors
FT                   including mitotic cyclins during the metaphase/anaphase
FT                   transition"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22775"
FT                   /db_xref="GOA:C5DF20"
FT                   /db_xref="InterPro:IPR026000"
FT                   /db_xref="InterPro:IPR037679"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF20"
FT                   /protein_id="CAR22775.1"
FT                   /translation="MTLEQSIIITDTLTPHDISILILIGFFCSGIERFDQRIMIKLLPP
FT                   LSPHEELPVLFGSQQRENTKTIVLPYLLDLILFLIENEQKSAASRLISTLKAVSTVDGI
FT                   SKLIRALETHCLRSSYRELLKSSERKTVKRELTRSSLLGSFVERCSIKYKIQDFNESEM
FT                   LWRNLRIYVRRFEKTSLFKTIESQLPELDHFMSFTLRGEGGSETIESLEELQRMGLPER
FT                   YNDLLLNEEDIIVMISSDHLKTLLNEEVCLLLDGHANIRNSTEKIINCMSLEDCSKFPS
FT                   VHILKGLEQLNDQRYDSFLTLLYRYFDYMLGQHSEPNFHMSLLSLASFYAHFNDNEAAV
FT                   KTFEEAIAVARENKDTKTLNFILMWVFEFIVKFPSLAVKFHVSAEQIINYLKSCPSDQS
FT                   ASVFEMAYKFETLWTMLNSESVVGILEALFKASLITLQNATNKPKLSLLANHNAQVWEY
FT                   LGSQSLQQTYKNVAKTYLKKSSDFSHKARKLLSSKDSGIIRHELHTSRSPLLTYHERKS
FT                   LEIMGISHLGSIGECDEAIRLANAKLRECKSEFLDVNNEQRFALAKCQIMIKCGMEMRC
FT                   LPIFTKVMEDVIIAGNAHLAALCILLLSRVLLSLRKFSELEELLNSTMHTVLKFTEPGI
FT                   NRAFFDIYYLNKCEKENAGEDLTRASSYLGALKGLRDQLQNNNVVLFN"
FT   gene            complement(<949719..>951041)
FT                   /locus_tag="KLTH0D11594g"
FT                   /old_locus_tag="KLTH-ORF11232"
FT   CDS_pept        complement(949719..951041)
FT                   /locus_tag="KLTH0D11594g"
FT                   /old_locus_tag="KLTH-ORF11232"
FT                   /product="KLTH0D11594p"
FT                   /note="similar to uniprot|Q08685 Saccharomyces cerevisiae
FT                   YOR250C CLP1 cleavage/polyadenylation factor IA subunit
FT                   interacts with Pcf11p in the 2-hybrid system
FT                   cleavage/polyadenylation factor IA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22776"
FT                   /db_xref="GOA:C5DF21"
FT                   /db_xref="InterPro:IPR010655"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028606"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="InterPro:IPR032324"
FT                   /db_xref="InterPro:IPR038238"
FT                   /db_xref="InterPro:IPR038239"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF21"
FT                   /protein_id="CAR22776.1"
FT                   /translation="MASLPGLNDSLHPADLGVDLNEPKHVSITAGSEWRVDVPQESKLT
FT                   IKVHSGVAEIFGTELASDVPYVFQGTKFAVYAVEDAEFEWTSPELTSHSISSDTNMKFI
FT                   YNVHFALEKLRVSSFEGPRVLIVGESCTGKTSLAKTLCAYAIKFKAHQPMMVNLNPQEC
FT                   IYSPPGCLTATPISDVIDVSSSTWGQSMTSGATKLHNKQPIVKSFGLEQISENKERYVS
FT                   TFQQLANAVRGRVQNDSTVRRSGLIIDTPPLGQLSDDFSELKEIIYQFKVNAVVVCAKD
FT                   DTLALKLNEHLPVETLAIVRLPTSSGVVQTDDVYKRALQRNAIREYFYGDFNTVLSPYT
FT                   IGVDSDMITVWQPKSVLVQSDSQDDLLPVEINASNLQHALVAISYASRRSSSEEVSASP
FT                   ILGFALIMDVNDTKRKLRVLLPVPGLLPDKAMILTAYRYLE"
FT   gene            complement(<951182..>952090)
FT                   /locus_tag="KLTH0D11616g"
FT                   /old_locus_tag="KLTH-ORF11231"
FT   CDS_pept        complement(951182..952090)
FT                   /locus_tag="KLTH0D11616g"
FT                   /old_locus_tag="KLTH-ORF11231"
FT                   /product="KLTH0D11616p"
FT                   /note="similar to uniprot|Q08686 Saccharomyces cerevisiae
FT                   YOR251C catalyzes transfer of the sulfane atom of
FT                   thiosulfate to cyanide to form sulfite and thiocyanate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22777"
FT                   /db_xref="GOA:C5DF22"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF22"
FT                   /protein_id="CAR22777.1"
FT                   /translation="MSLFKIISPKALAEKLQQEATRRIVAVDSTWYLPYLQKNAKKEFM
FT                   ELERLPNAVFFDIDGVKDANSPYPHMLPDAATFNASMSELGIRKNDILVVYDRVGNFSA
FT                   PRCAWTLAVFGHELVYLLNNFPAYKAEGFPLDTTPRTSFSELEPSDYKSDADFTKQEVV
FT                   SYEEIHKLVEDGKLAEVYNVFDARALPRFTGESSEPRPEIPSGHIPGAQPMPFTDVVKN
FT                   GIFEMDSRLAAENLEKYLESSGCKYDPSKPTVAMCGTGVSGVIIKTALESAGIKHVKLY
FT                   DGSWTEWALRSEPKYVAKGRS"
FT   gene            <952307..>953368
FT                   /locus_tag="KLTH0D11638g"
FT                   /old_locus_tag="KLTH-ORF11229"
FT   CDS_pept        952307..953368
FT                   /locus_tag="KLTH0D11638g"
FT                   /old_locus_tag="KLTH-ORF11229"
FT                   /product="KLTH0D11638p"
FT                   /note="similar to uniprot|Q12529 Saccharomyces cerevisiae
FT                   YPL165C SET6"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22778"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF23"
FT                   /protein_id="CAR22778.1"
FT                   /translation="MMPIEEAVYISELFDIRTTDNSGRACFASKDLKKGTDVLCLTKCL
FT                   GASTCYEFRKEVCSQCFQYDGGQRMKVRLNNKFLKGAGLWFCTENCRDQFLRQEHVDHL
FT                   IDALETLLVSWEIQAKKRIGSIDRASNSSISTEKIESLWQDIRDNWITRIDRMKPTKRV
FT                   LQLPIINEDEYVCARFVIHCLFTLKTTDTSSLHMAAFRNLQSNESSKISRFPVLLDLQK
FT                   RVFQTLYILLPPFLKSGFDIPTFRHILGSEYGNSFGIWQNEEASDSREYLGYWVLPEAS
FT                   FFNHSCAPNLIKHRFGNKMIFTLNSDVTKDQELCIDYKDILDLKVDERRHILKENWFFS
FT                   CECPRCKIEMQIN"
FT   gene            complement(<953365..>953880)
FT                   /locus_tag="KLTH0D11660g"
FT                   /old_locus_tag="KLTH-ORF11228"
FT   CDS_pept        complement(953365..953880)
FT                   /locus_tag="KLTH0D11660g"
FT                   /old_locus_tag="KLTH-ORF11228"
FT                   /product="KLTH0D11660p"
FT                   /note="some similarities with uniprot|Q12092 Saccharomyces
FT                   cerevisiae YPL166W Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cytoplasm in a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22779"
FT                   /db_xref="GOA:C5DF24"
FT                   /db_xref="InterPro:IPR039113"
FT                   /db_xref="InterPro:IPR039362"
FT                   /db_xref="InterPro:IPR040666"
FT                   /db_xref="PDB:4HPQ"
FT                   /db_xref="PDB:4P1W"
FT                   /db_xref="PDB:5JHF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF24"
FT                   /protein_id="CAR22779.1"
FT                   /translation="MNSENTIVYVRVAGRARNGFVDPLKFYWDLERDRSLWSSVSKLDN
FT                   TKKTIDWKRLSREFKAPEHFIRKRSYALFAKHLKLLERQIEAKTRSLAVTEDELNYTDE
FT                   DDERNSISHGEDDFEAAEGLKNLRTSKVLKQRVPGEGRNGESSLSELSNLSVSKSALEE
FT                   ALLDRLQL"
FT   gene            <953995..>958497
FT                   /locus_tag="KLTH0D11682g"
FT                   /old_locus_tag="KLTH-ORF11227"
FT   CDS_pept        953995..958497
FT                   /locus_tag="KLTH0D11682g"
FT                   /old_locus_tag="KLTH-ORF11227"
FT                   /product="KLTH0D11682p"
FT                   /note="similar to uniprot|P14284 Saccharomyces cerevisiae
FT                   YPL167C REV3 Subunit of DNA polymerase zeta which is
FT                   involved in DNA repair required for mutagenesis induced by
FT                   DNA damage"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22780"
FT                   /db_xref="GOA:C5DF25"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR025687"
FT                   /db_xref="InterPro:IPR030559"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF25"
FT                   /protein_id="CAR22780.1"
FT                   /translation="MSSGAPESGSFSTLAEDLIHIQINSYDSYQEVPGAFDRLSGNSLP
FT                   NRQFNHVPVIRVYGSLPSGHNVLCHIHGAFPYIYVPYDGEKGDSAQTIQSRCTQLHSCL
FT                   ETKLKESYNRKGSAEEEEGKEKEKKDGFPENLKFVADVSPIRAVPFYGYHVGYSVFYKI
FT                   SLLSSATTTKTAEFLREGKATGKRSQVFEAHIPFLLQFSADYNLFGCSWLKLSKCFFRS
FT                   PLLNPAHSQDLLQRNESLDEFLGRFYRKGENESGDDCERIGNSLLEIDAVPQFINNRNE
FT                   IDFRDIHGTLFESSQIGPDETLFIPSTKNLWTQTTHLRKQFGLDPYQPIPEQHRFSRLP
FT                   EWQSHKELLSFLQKAKDRTIPKSKSFSESVSKSMFSAARHLDLPHESLCQLWPDSHPRV
FT                   GLDLSHRVQNQNTNRESFNSDSTSNDIVYSSDSETASEREMEMEQFHNTENTKEGKKTE
FT                   TEARLQSSAPLNPQKDTGAVDSFNDQILTQSMAHKRPSKGEGLLNQRPKKLIRPVYAQS
FT                   ISAPSSGFRYKKLSLEFYNILQDLEDRGIPKIDYMDPYFRSPEDLKKKDYIYSGRKFSL
FT                   NSTHVTCRRPIEFANRTVRLESTSDERQPKNSWKYAIAPPTYSTVHDYILHTCKVNYRS
FT                   QIDFKTMSNERGYKFKSNNSLKGLNSGDHNPLSHLTLEIFATSKANRLPDPNFDPVQLI
FT                   FWKIDPDSFPIDIGISTEGIMAYHEKDDAEFISHLNSASWSTPVAFFQSEEEMINGVAD
FT                   LVLLLDPDIISGFELHSSSWGYLIERLESAYERDLCEEIARVKYKTFNKRKDVWGFSHD
FT                   SGIHIAGRHTLNIWRLLRSGLNLLKYTLENITFHVLHERLPHFSPSALTSLWESRSNIT
FT                   ALTTLISYWKKRVNINMKLLHSQQTINQTIEQARLIGIDFYSVISRGSQYKVESVLMRL
FT                   CKCEHFLVLSPSKTQVRDQKALECIPLVMEPESAFYKSPLVVLDFQSLYPSIMIGYNYC
FT                   YSTIVGTVHEYNSKKTAIGASKVKFARGLLHELEDHLTISPNGVMYLKESVRKSMLAKM
FT                   LTDILHTRLMIKATMSDLKSKNETVAKLLNNKQVALKLLANVTYGYTSASFSGRMPCSD
FT                   VADSIVQTGRETLEKAISLIESHSQWGAKVVYGDTDSLFVYFPGKSREEAFKFGKEMAK
FT                   AITTCNPFPITLKFEKVYHPCLLVSKKRYVGYSFEKEDQNEPKFDAKGIETVRRDGHPA
FT                   QQKIVEKSLRILFDSKDLSAVKSYVQDQFRKIMKGQVSVQDFCFAREVKLGSYKSEKTA
FT                   PPGAVVAAKKKAADHRAGPQYRERIPYVVVKGRPGQILRERCVPPEMFLSNDSLELDAT
FT                   YYITKTLLPPLQRFFNLIGVDVSQWYVEMPRFQDIGNYQDGNLPEFMRTTSCFNCKKEI
FT                   REKTKDLCAECFENKSQTITNLLQEDVSIRKHFKSILTVCRACCQPFTKNSLDNLNKIV
FT                   TQCDAQDCPVYYSRVKYKGYMSTARSAQLRDILKGLDHW"
FT   gene            <958658..>959227
FT                   /locus_tag="KLTH0D11704g"
FT                   /old_locus_tag="KLTH-ORF11225"
FT   CDS_pept        958658..959227
FT                   /locus_tag="KLTH0D11704g"
FT                   /old_locus_tag="KLTH-ORF11225"
FT                   /product="KLTH0D11704p"
FT                   /note="highly similar to uniprot|Q08687 Saccharomyces
FT                   cerevisiae YOR252W RBF17 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22781"
FT                   /db_xref="InterPro:IPR021346"
FT                   /db_xref="InterPro:IPR038356"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF26"
FT                   /protein_id="CAR22781.1"
FT                   /translation="MPLSKSLSKIQKNNKSQGKNLTVHPKGRKFQKLTAATLREDKIAA
FT                   KKKAHNERKSNELSRVKFIQDVISSESFKDQKVFSLGETVVFIQEFISRDDGELEELKK
FT                   KRRTNRPPSTRQVVLQQRRDYETKELASGFLVPDLGDAENVDFLRKWNQTFGSLNTMKL
FT                   IRVNAKAEQVVGGSKGTKPPTDVEMQ"
FT   gene            complement(<959234..>960448)
FT                   /locus_tag="KLTH0D11726g"
FT                   /old_locus_tag="KLTH-ORF11223"
FT   CDS_pept        complement(959234..960448)
FT                   /locus_tag="KLTH0D11726g"
FT                   /old_locus_tag="KLTH-ORF11223"
FT                   /product="KLTH0D11726p"
FT                   /note="some similarities with uniprot|Q12467 Saccharomyces
FT                   cerevisiae YPL168W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22782"
FT                   /db_xref="GOA:C5DF27"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF27"
FT                   /protein_id="CAR22782.1"
FT                   /translation="MICVNSLRAYLRHNLPRELRFYVARGPTHPFSSLSSISDTGNIDD
FT                   IAAVAFTKKLKNVVRHSKIPEQNSQLSREIIALCESSGLKCDFLTSSKIKRLYNMLLQG
FT                   KISTLQIMNALKSARNQKMVNVMDPKKSIDNQKDKKADISQYEFLQINPASSEKFGKIL
FT                   DEMGCSETRKPFKQKVGTRRENEVPPLKGSDEIDLGVLHSFLQSAEKQKKEQKQFAWNQ
FT                   ARAYEWNEKNSPAAFSPGMMLFDSTYTPLRSKLMRNFRGSNVRGQGTGTVKTAFTYTTE
FT                   MLFYNLKDSTTHVMLWKNQGNNVHIEYRDLFTVINGSQRPPEQLLKVITNFEGKDWELT
FT                   GEATIDGVRQIVFKRDTTKHSSNRVSSKIFNMTLLSVFLGFAAYGAIQKYRSTRYTVTT
FT                   SAEPS"
FT   gene            <960571..>961059
FT                   /locus_tag="KLTH0D11748g"
FT                   /old_locus_tag="KLTH-ORF11222"
FT   CDS_pept        960571..961059
FT                   /locus_tag="KLTH0D11748g"
FT                   /old_locus_tag="KLTH-ORF11222"
FT                   /product="KLTH0D11748p"
FT                   /note="similar to uniprot|Q08689 Saccharomyces cerevisiae
FT                   YOR253W NAT5 Subunit of the N-terminal acetyltransferase
FT                   NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
FT                   proteins which influences multiple processes such as the
FT                   cell cycle heat-shock resistance mating sporulation and
FT                   telomeric silencing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22783"
FT                   /db_xref="GOA:C5DF28"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF28"
FT                   /protein_id="CAR22783.1"
FT                   /translation="MSRNLVNLDNVYSNNVGTFQKIANTVLNVTYPDKFFQEQFDGGKE
FT                   TLFAQLGYYGEVAVGAVRAQLISNKNGGVKASGVYIQIFAVLENYRGKGVGSQLLKFVE
FT                   EQCKAHFQHNIYVHVAVDNEKGIQWYQRKGFEQEGEVLKNYYKDTTGAPDALILKKSL"
FT   gene            complement(<961180..>963138)
FT                   /locus_tag="KLTH0D11770g"
FT                   /old_locus_tag="KLTH-ORF11221"
FT   CDS_pept        complement(961180..963138)
FT                   /locus_tag="KLTH0D11770g"
FT                   /old_locus_tag="KLTH-ORF11221"
FT                   /product="KLTH0D11770p"
FT                   /note="similar to uniprot|P14906 Saccharomyces cerevisiae
FT                   YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
FT                   Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP and
FT                   Lhs1p forms a channel competent for SRP-dependent and post-
FT                   translational SRP-independent protein targeting and import
FT                   into the ER"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22784"
FT                   /db_xref="GOA:C5DF29"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR027137"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF29"
FT                   /protein_id="CAR22784.1"
FT                   /translation="MTQSYDYDEGSETWPFFVLAVLCVVLVPLTLMQAYEIIAAKDEDS
FT                   SSQSSPLEKLSEKYTGDQVKRFRAKFAPKKSKLLARRNLVIIAGWCMVAFLINKIGSNG
FT                   AIKDAATLLFDPYALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQY
FT                   VMITKAYKALTDEITRENYLRYGHPDGPQATSHGIALPKFLVDSSASTLMVLGYIALLG
FT                   FILPFFVSRWWSKTQSFTKKGIHARSASYFADRLFNFKPSQVVTTGLILNWLSHAAEFK
FT                   LLYPDLTQETFESLLYDHINRRHSGELETAKLRIVAKTHALLFGLLDIATTFRNLEIST
FT                   VAIDTFKSIVQATPLTSHSQILQLPNVDAKRFEEGSVDDIRTLGKLFTFEDEKIGKILG
FT                   IEDETKLRETLSVAANIPHLKLLRAEFTVPGESVVTPLSTPHISVKVLVRSAKHKFFTP
FT                   NKIPDELYKEEQDFDSLRDPFASLSNQPALPRTFAPHFPAKRSGCWCALVVLQKDGKVI
FT                   QTPMLVDRLSFANLNKDFDKRTVKDLEKEFNPEEWEIGTIKIPFSQPAPDQKGDYYFRV
FT                   IVKSTEYFGADLDFTLPMMVRELSEVEGAEKIADDSASDEDDSDLEDDEEDSNDELEDD
FT                   EDSDYTDIDTDTEVEEN"
FT   gene            <963412..>965235
FT                   /locus_tag="KLTH0D11792g"
FT                   /old_locus_tag="KLTH-ORF11218"
FT   CDS_pept        963412..965235
FT                   /locus_tag="KLTH0D11792g"
FT                   /old_locus_tag="KLTH-ORF11218"
FT                   /product="KLTH0D11792p"
FT                   /note="similar to uniprot|Q99257 Saccharomyces cerevisiae
FT                   YPL169C MEX67 Poly(A)RNA binding protein involved in
FT                   nuclear mRNA export component of the nuclear pore ortholog
FT                   of human TAP"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22785"
FT                   /db_xref="GOA:C5DF30"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR005637"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR030217"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR040736"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF30"
FT                   /protein_id="CAR22785.1"
FT                   /translation="MNNLFQNSNNVGVAAQQAVLQNRVKVGVKGWQNATKQDLVSFVSR
FT                   KTRIGIQDSYVEGNLVIGFVNSRNEASSLLNWNGVRFAGNALKFEILGDNVGLGGAPGT
FT                   NNTIALLKAFLYKRYNPQAKMLDLGNLRNDPDLTANGLFSTTSTQSKMFPAMMKLASKE
FT                   DQMVVESVNLSNNNLKDLNMISSLAQTYPNLKNLCLANNQISRFRALEVWKNKFKDLRE
FT                   LLMMNNPITTEPLYRSEIMRLFPKLIILDSVLLRDENKLQQIYSLPMKLQQFFFETNEL
FT                   GQSSIDFVSNFLNLWDTNRTQLMALYTPQSQFSVCIDSSVPSSSVPNSDQNPTFSYYLP
FT                   LSRNLTKISSDKTKQQRLALGQEAIDKLFRSLPKTKHALQEQPLNYSLEAFSYPQVNGF
FT                   IITLHGFFDESGAPEIDANKSTPNTSGNRNRRFNHGHGSSTNKLTKKSFDRTWVIVPNP
FT                   GGVVVASDMLTIRPYADGSWLQAQAQPQAVSQPPIQSQQHPQSQPQVPLPNNPQSQLPN
FT                   VIQPQIPGVAQTPVPNMPLQGSVGVPLLLPPEVQSKLSPVQLELLNRLHQQTRLNAEYT
FT                   YMLADQSGWNFDVALKGFQDSVNNIPREAFI"
FT   gene            <965505..>966515
FT                   /locus_tag="KLTH0D11814g"
FT                   /old_locus_tag="KLTH-ORF11216"
FT   CDS_pept        965505..966515
FT                   /locus_tag="KLTH0D11814g"
FT                   /old_locus_tag="KLTH-ORF11216"
FT                   /product="KLTH0D11814p"
FT                   /note="weakly similar to uniprot|Q08692 Saccharomyces
FT                   cerevisiae YOR255W OSW1 Protein of unknown function
FT                   required for the construction of the outer spore wall
FT                   layers"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22786"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF31"
FT                   /protein_id="CAR22786.1"
FT                   /translation="MRAPPAPRKSRARFVRRKAGQVYQVISLRRLKKKYNLHRLHKIHR
FT                   NNIRNGNPRGVPPYRCDALSFSNELLHVTSNSVSPAAKHKPLLIASFPNGCSRSPRVKI
FT                   LQKNMLSRFWMSKRRFKLRRFNPGLEKAFIDEEDALSNDCFRSCRLIKKQTSKFADVKF
FT                   DFEKKNVFKTVCMSTDHLEDRTPRFLEFNAGQSIRLEEFPSLNLARGEIRNFERPGPFA
FT                   LECEASVLQQLRQKAKHRLEWLRWNVSELAPRLSTLAAPDVFIVSGIVRPYDASSDLLD
FT                   ADLRTMQTKISALVEASRHAGSAFNSYNQMLRKLETISPRASKTIRRATTRQLVR"
FT   gene            complement(<966612..>967064)
FT                   /locus_tag="KLTH0D11836g"
FT                   /old_locus_tag="KLTH-ORF11215"
FT   CDS_pept        complement(966612..967064)
FT                   /locus_tag="KLTH0D11836g"
FT                   /old_locus_tag="KLTH-ORF11215"
FT                   /product="KLTH0D11836p"
FT                   /note="highly similar to uniprot|Q12091 Saccharomyces
FT                   cerevisiae YPL170W DAP1 Heme-binding protein involved in
FT                   regulation of cytochrome P450 protein Erg11p damage
FT                   response protein related to mammalian membrane progesterone
FT                   receptors mutations lead to defects in telomeres
FT                   mitochondria and sterol synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22787"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF32"
FT                   /protein_id="CAR22787.1"
FT                   /translation="MSFVKNFLFGGVKTSEDPTGLTGEVADNQTAKTEEPIVEGKFFPR
FT                   TLYKYNGHDDEKIFIAIKGKVFDCSQGRQFYGPSGPYSNFAGHDASRGLATNSFELDTL
FT                   RHWDQPMDDLSDLTGQDMESLNGWLEHFQNKYPCIGELVPEPGVNI"
FT   gene            complement(<967344..>969698)
FT                   /locus_tag="KLTH0D11858g"
FT                   /old_locus_tag="KLTH-ORF11214"
FT   CDS_pept        complement(967344..969698)
FT                   /locus_tag="KLTH0D11858g"
FT                   /old_locus_tag="KLTH-ORF11214"
FT                   /product="KLTH0D11858p"
FT                   /note="similar to uniprot|Q08919 Saccharomyces cerevisiae
FT                   YPL176C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22788"
FT                   /db_xref="GOA:C5DF33"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR036757"
FT                   /db_xref="InterPro:IPR039373"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF33"
FT                   /protein_id="CAR22788.1"
FT                   /translation="MVSSSNRYRPVGQDDIGDSPESNDSSASLAAEELPPNPPGYVEEM
FT                   REGQEPQFEIMDFDEDPLASTQSRVARLRQKFKNCVVTPVRNRIADPLAVLMSMASHKV
FT                   DYYLSKIGNPLILRRFVYVFFASLFIYYVSSSGLLPSERTTGTRGMFSDKTQLMSYAKR
FT                   ALDLSKMENDLEYISSMPHMAGTKGDFAVSQYIREAFANNGLRVAGDAAFKTYLNYPGN
FT                   VSLTAYAKSGGKLSLELSEQNFNPLSVKGEVREANLLYAHYGSGEDYRKLKEENLIDDN
FT                   TVALIHYSKNAGEQVVEAQEAGIKAIFFISDGYGEDQIDSIQQKSVQNFRYDMGDPLSP
FT                   GWTSSLRNRIELSESLMVPKIPTIPLSRRQAEQLRKEMTKEGGIKFEDGWYSGTANDLK
FT                   IDFSLDPVVRQEHFSWSIAGRIEGREQSDKAIIISSARDSACTGCTYPNYGTAALLSLA
FT                   QLFQQVKYKYGWKPLRTIYFISYDASQFGHAGATELLESELIKIKNEVYTVLDISQLGV
FT                   TSDSLNLDIQAHPLLFDFLKDEDLKTGVDTEIRTVQQFGDWSAFLAHGIPVAAISAPHV
FT                   LERKYPIESCDDTFERLKQSINEDYWEKSSEVLLYVFKMALKLADEPMIPLGIAQYSET
FT                   LQQLLQDLQESAEGLDVDFEQLGEGITAWKRIDEQSTNWVRAWNNIVMVENEGIEPSFV
FT                   AVDRWNWNKKLTHIGIRHCALQGLPHRPFYKNVLFGPTLKDQSPHSSWSFPGIKDAIFD
FT                   RDATRAQDQANLAAEILLKSAESFIEYAGST"
FT   gene            <969889..>971202
FT                   /locus_tag="KLTH0D11880g"
FT                   /old_locus_tag="KLTH-ORF11212"
FT   CDS_pept        969889..971202
FT                   /locus_tag="KLTH0D11880g"
FT                   /old_locus_tag="KLTH-ORF11212"
FT                   /product="KLTH0D11880p"
FT                   /note="similar to uniprot|P32363 Saccharomyces cerevisiae
FT                   YPL175W SPT14 UDP-GlcNAc-binding and catalytic subunit of
FT                   the enzyme that mediates the first step in
FT                   glycosylphosphatidylinositol (GPI) biosynthesis mutations
FT                   cause defects in transcription and in biogenesis of cell
FT                   wall proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22789"
FT                   /db_xref="GOA:C5DF34"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR013234"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF34"
FT                   /protein_id="CAR22789.1"
FT                   /translation="MVCDFFYPQLGGVEFHIYHLSQKLISLGHLVVIITHAYGDRTGVR
FT                   YLTNGLKVYHIPYFVAYRETAFPTIFGSFLIVRNILIREQIQIVHTHVSVSPLTHETLL
FT                   HANVMGLQTLLTDHSLYGFDTLSEILNNKMLKFALTNTGAVICVSNTCKENMIIRSKLN
FT                   PSSISVIPNAVVSHDFTPATKGSKAPGEITIVVISRLYPNKGADLLTHIIPRICEIEDK
FT                   VKFIIGGDGPKFVDFQQMIESYRLQDKVQLVGAVQHENVRDVLCRGDIYLHASLTEAFG
FT                   TALVEAASCGLLIVTTTAGGIPEVLPKHMTVFAQETSVSCLVAATRKAIQSLREGTVDT
FT                   TSFHEEISSMYDWVDVAKRTVAVYDSLAQSPMPRNKSWYKMLKNFHERNDGPWAMPLYV
FT                   LCYLVENMLYLFLEWWYPRSEIDLAPKWPINQNHAASP"
FT   gene            complement(<971208..>973667)
FT                   /locus_tag="KLTH0D11902g"
FT                   /old_locus_tag="KLTH-ORF11211"
FT   CDS_pept        complement(971208..973667)
FT                   /locus_tag="KLTH0D11902g"
FT                   /old_locus_tag="KLTH-ORF11211"
FT                   /product="KLTH0D11902p"
FT                   /note="weakly similar to uniprot|P33420 Saccharomyces
FT                   cerevisiae YPL174C NIP100 Large subunit of the dynactin
FT                   complex which is involved in partitioning the mitotic
FT                   spindle between mother and daughter cells putative ortholog
FT                   of mammalian p150(glued)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22790"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF35"
FT                   /protein_id="CAR22790.1"
FT                   /translation="MAELGKRVALNGLQGTVRFIGETEFAPGTWCGVELDEKCGKNDGS
FT                   VQGVRYFNQTLKDGLYGLFGRIETVRPISTSGSVASSPNESRNLHGVILKLQDKLYGLH
FT                   HRYADLELQLENCAIDKEALKEENEELMSVIIGLQQELATLRQDLSALQQEVDLRRSIE
FT                   EHEWETDAGKLSHEALWKRNQLVEVALSKLQESLDESNEECISLAAENDQIKMELSVTA
FT                   AELDECKHVVESLASKSADNQIIDKLTEENTDLNARVESFKATVEELKSEHVVAKDLQQ
FT                   IYSDLEEELSEQLRILRENADRDKHTITLLESERAELLHELERVKSHANTRDFCQQIEQ
FT                   LSSQLSKTQMIAKRSVLNEKFSNIGLGDQGSRAPLTLSKQVQFLSNHLLQEQFPADLQV
FT                   KLQGSFFLQLMAQELMAWHRQREIYTDTLHSFKPTAFQINEWKELIFDNKIPQECSADS
FT                   IAHHLKNQGGPLNKDASFLLSFISATAETFLPLIFDILSKDFDLKKVSLIHSKAKQLAT
FT                   TCKKQQEQIPIGSAGVTHDPKISELLSTYFQDVVFILTSGKSDNDSIDRAIESLEALNF
FT                   VLENMKFDKISSASKVSVEQPKLQSNLLVEDRVHNSNGSTPKARLRDNRIEELELKLKV
FT                   YENKVERHKHQEETIVKLQQELHGLKCNKNTLEASVSALQARSSELTEKLESERIRQNF
FT                   LFPKPQMIDLVKEMEATDKIDLISQISDLRRVIVKHEEAKYTLEEDKWLRKPIEARGNI
FT                   VNSEFFTKLNDAHKSIDCLVKSLDVVPLDVNYSGKERSTNISSYYCKSLKERSIGIESL
FT                   LSGLCKQ"
FT   gene            <973790..>974320
FT                   /locus_tag="KLTH0D11924g"
FT                   /old_locus_tag="KLTH-ORF11210"
FT   CDS_pept        973790..974320
FT                   /locus_tag="KLTH0D11924g"
FT                   /old_locus_tag="KLTH-ORF11210"
FT                   /product="KLTH0D11924p"
FT                   /note="highly similar to uniprot|P06704 Saccharomyces
FT                   cerevisiae YOR257W CDC31 Component of the spindle pole body
FT                   (SPB) half-bridge required for SPB duplication in mitosis
FT                   and meiosis II homolog of mammalian centrin interacts with
FT                   Kar1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22791"
FT                   /db_xref="GOA:C5DF36"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF36"
FT                   /protein_id="CAR22791.1"
FT                   /translation="MSHRRTTPRGSLNGAGSYKPSNSENSVLQRELLEENKQEIFEAFS
FT                   LFDMNNDGFLDYHEFKVAARALGFEMSKTELLELLEKYDRDGRRLIHYDDFFLVMGERI
FT                   LERDPLDEIRRAFKLFDDDNTGKISLKNLRRVAKELGENLTDDELRAMIDEFDLDNDGE
FT                   ISEREFIAICTDM"
FT   gene            <974554..>975435
FT                   /locus_tag="KLTH0D11946g"
FT                   /old_locus_tag="KLTH-ORF11208"
FT   CDS_pept        974554..975435
FT                   /locus_tag="KLTH0D11946g"
FT                   /old_locus_tag="KLTH-ORF11208"
FT                   /product="KLTH0D11946p"
FT                   /note="similar to uniprot|P36534 Saccharomyces cerevisiae
FT                   YPL173W MRPL40 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22792"
FT                   /db_xref="GOA:C5DF37"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF37"
FT                   /protein_id="CAR22792.1"
FT                   /translation="MSGYQHLSKAGSRFLKQVERRPKHLVDHFKKFEEKSMPSFLVPSI
FT                   PRVENDQKFQSVREWVFMPGDRVVITRGRWKGQISVIQQHDKETNGFILDENGPTKTVP
FT                   VPKQFWSEGQNSHMVTFPIAVEKKDLKLVADIDDPAAPGQTKTVAVRDIVFKGSYFDEN
FT                   YKQRMPFRCVSGQEDLVIPWPRPEPKADAELATPAEVAREQTFWVESIAKNPIPEGALL
FT                   TVRNPHSKWRRGTLSARDIAKLVAPKMPLTKTKKAYIAEQKELAAAPRRKLTSEDKELI
FT                   GSKIFQHLKQHL"
FT   gene            <975613..>976254
FT                   /locus_tag="KLTH0D11968g"
FT                   /old_locus_tag="KLTH-ORF11206"
FT   CDS_pept        975613..976254
FT                   /locus_tag="KLTH0D11968g"
FT                   /old_locus_tag="KLTH-ORF11206"
FT                   /product="KLTH0D11968p"
FT                   /note="similar to uniprot|Q08702 Saccharomyces cerevisiae
FT                   YOR258W HNT3 Member of the third branch of the histidine
FT                   triad (HIT) superfamily of nucleotide-binding proteins
FT                   similar to Aprataxin a Hint related protein that is mutated
FT                   in individuals with ataxia with oculomotor apraxia"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22793"
FT                   /db_xref="InterPro:IPR032566"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF38"
FT                   /protein_id="CAR22793.1"
FT                   /translation="MSFRYVLKNYIVEPQLYPDEVLFFDSHAVIIKDAFPKSQFHFLIL
FT                   PRDLKITWTDPTSLSAEQKSKLQGYVDWALTRAFEDFTKSYTFSKEGMIPFEKKYQFED
FT                   KQFFIDKFTQVGIHSVPSLKNLHIHVMTKDFYSDRMKNKKHYNSFNTTFFVNWRRLPLE
FT                   ESPDATYLENEVIKKTDLKCCYCKKNFKNRFSELKLHLDREFKVRFTNQS"
FT   gene            complement(<976271..>977572)
FT                   /locus_tag="KLTH0D11990g"
FT                   /old_locus_tag="KLTH-ORF11204"
FT   CDS_pept        complement(976271..977572)
FT                   /locus_tag="KLTH0D11990g"
FT                   /old_locus_tag="KLTH-ORF11204"
FT                   /product="KLTH0D11990p"
FT                   /note="highly similar to uniprot|P53549 Saccharomyces
FT                   cerevisiae YOR259C RPT4 One of six ATPases of the 19S
FT                   regulatory particle of the 26S proteasome involved in the
FT                   degradation of ubiquitinated substrates required for
FT                   spindle pole body duplication localized mainly to the
FT                   nucleus throughout the cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D11990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22794"
FT                   /db_xref="GOA:C5DF39"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR035263"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF39"
FT                   /protein_id="CAR22794.1"
FT                   /translation="MSEEQDPLMAAFQNAEGADGNATSENRASGRENDTEPARVEVDPA
FT                   QEARNKALTAFKKKLTEHRRYEDQLKQRRQGIRDMEKEYEKTENDIKALQSIGQLIGEV
FT                   MKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRVLPRETDPLV
FT                   YNMTSFEQGDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGT
FT                   GKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDA
FT                   IGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLD
FT                   RKIEINLPNETGRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAI
FT                   RDDRDHIIQDDLMKAVRKVAEVKKLEGKIEYQKL"
FT   gene            <977828..>979327
FT                   /locus_tag="KLTH0D12012g"
FT                   /old_locus_tag="KLTH-ORF11202"
FT   CDS_pept        977828..979327
FT                   /locus_tag="KLTH0D12012g"
FT                   /old_locus_tag="KLTH-ORF11202"
FT                   /product="KLTH0D12012p"
FT                   /note="similar to uniprot|P09032 Saccharomyces cerevisiae
FT                   YOR260W GCD1 Gamma subunit of the translation initiation
FT                   factor eIF2B the guanine-nucleotide exchange factor for
FT                   eIF2 activity subsequently regulated by phosphorylated eIF2
FT                   first identified as a negative regulator of GCN4
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22795"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF40"
FT                   /protein_id="CAR22795.1"
FT                   /translation="MDFQAFIFCGKGYNLAPFTQTKGDTGVSKALLPVANRHMIEYVLD
FT                   WCEQANFKEINIVADNEEIDVIHEALSSYMKIRESQYEILAKTLAPHHSQHLRKPVPIQ
FT                   FIATKGETTGAILQRELLSKITGDFVLLPCDFITDIPPQIFIDQYRNKDPDNLAMSVSY
FT                   RNTFENIDKKQLDFSYTVYSENEDSVKQPVLLDVYSKKDVENSKYLQIRTHLLWRYPNA
FT                   SVSKKLLNSFVYFCSYELVELLTEESKLSFTSETESEEFEDDTVTSESHRQVIKPTPFR
FT                   KRNKLVKDPINCCKSLAKVFRDLGRRSWQHSAPRETIGVFILPSLGCFIRSNVLSAYME
FT                   ANRYMLRMKASMLAAQGAPAIGNSAVGADSVVGAECSISEKTSVKLSVLGKNCKIGKRC
FT                   RIVGCVILDGVEIDDECILENAVIGNFTKIGKKCKLTNSYVEGSYIVNSRTVLKGETLT
FT                   HIFIEESEDTSDSLESSEEEDTSEYSDDYDDEFEDDGLFER"
FT   gene            complement(<979433..>980761)
FT                   /locus_tag="KLTH0D12034g"
FT                   /old_locus_tag="KLTH-ORF11201"
FT   CDS_pept        complement(979433..980761)
FT                   /locus_tag="KLTH0D12034g"
FT                   /old_locus_tag="KLTH-ORF11201"
FT                   /product="KLTH0D12034p"
FT                   /note="similar to uniprot|P21592 Saccharomyces cerevisiae
FT                   YPL172C COX10 Heme A:farnesyltransferase catalyzes the
FT                   first step in the conversion of protoheme to the heme A
FT                   prosthetic group required for cytochrome c oxidase activity
FT                   human ortholog is associated with mitochondrial disorders"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22796"
FT                   /db_xref="GOA:C5DF41"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR016315"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF41"
FT                   /protein_id="CAR22796.1"
FT                   /translation="MTPVNVANVLLLKTVFARSVSSSYLSTSGVRRFSLYYRHYSTDNR
FT                   RKRTSVPLNTSPIEFSPNISADKVKDSGVTIADSARKALSCTDDTSAPAHAPFNVKSVD
FT                   PEERKRLRAHTKVGNKIATEKLIKTYIQLSKPRLTVLVMLSCICSYALSPFPATVLELL
FT                   SLTAGTALCSSSANAINMGREPDFDRRMVRTQARPVVRGLLTPGQAYKFAAVAGTLGVS
FT                   ILYCGVNTTVAVLGATNIALYAWIYTSLKRKHIINTWVGALVGAIPPLMGWCAASPLSH
FT                   PGGWCLAGFLYAWQFPHFNTLSHNIRSEYKDAGYVMTCWKNPKLNARVAFRYSLLMFPL
FT                   CFGLSYFDVTDWYYQLDSAVVNAWLSFWACKFWWQQRINYSAKVLKDRVKFNKGIALAN
FT                   VYARKTFWVSVLHLPAVLILAILHKKGRWDWLFEKENDKKLRV"
FT   gene            complement(<980947..>982059)
FT                   /locus_tag="KLTH0D12056g"
FT                   /old_locus_tag="KLTH-ORF11198"
FT   CDS_pept        complement(980947..982059)
FT                   /locus_tag="KLTH0D12056g"
FT                   /old_locus_tag="KLTH-ORF11198"
FT                   /product="KLTH0D12056p"
FT                   /note="highly similar to uniprot|Q6Q5I7 Saccharomyces
FT                   cerevisiae YOR261C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22797"
FT                   /db_xref="GOA:C5DF42"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR024969"
FT                   /db_xref="InterPro:IPR033858"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF42"
FT                   /protein_id="CAR22797.1"
FT                   /translation="MSMKGSQIKGGKLTIKLGTFEYNSPGGSQAHNRASGIMSLNHDSV
FT                   TVAPLVLLSVLDHYRRINTPQGKRCVGVILGDSSSSTVRVTNSFALPFEEDEKNPDVWF
FT                   LDHNYIESMNEMCKKINAKEKLVGWYHSGPKLKSADLKINDVFKKYTSSNPLLLIVDVK
FT                   QESVGLPTTAYMAVEQVKDDGTSTEKTFLHLPSSIEAEEAEEIGVEHLLRDVRDQAAGG
FT                   LSIKLTNQLKSLQGLQTKLSGIASYLTKVSEGQLPVNHVILGKLQDVFNLLPNLGVPDE
FT                   DEMAELDPQMLTNASSTLQKALAVKTNDELMVIYVSNLVRAIIAFDNLIENKIQNAKTQ
FT                   LKNKPDTESEKPEVDGKDEKTTADDIASAP"
FT   gene            <982337..>983380
FT                   /locus_tag="KLTH0D12078g"
FT                   /old_locus_tag="KLTH-ORF11195"
FT   CDS_pept        982337..983380
FT                   /locus_tag="KLTH0D12078g"
FT                   /old_locus_tag="KLTH-ORF11195"
FT                   /product="KLTH0D12078p"
FT                   /note="highly similar to uniprot|Q08726 Saccharomyces
FT                   cerevisiae YOR262W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22798"
FT                   /db_xref="GOA:C5DF43"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030231"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF43"
FT                   /protein_id="CAR22798.1"
FT                   /translation="MPFGQIVIGPPGSGKSTYCHGCLQFFNAIGRHAQVVNMDPANDML
FT                   PYPCAVDIRDFITLEEIMAEQQLGPNGGLMYALESVDKSVDLFVLQVKSLVQDERAYVI
FT                   FDCPGQVELFTHHSALFRIFKRLEKELDLRLCVVNLIDCIYVTSPSQYVSILLLALRSM
FT                   LMMDLPHINVLSKIDMLKSYGPLPMRLDYYTEAQELEYLQPFVEQESSSVLGKKYSRLT
FT                   ETIGEMVSDFNLVSFEVLCVDDKQSMISLQSVVDKANGYIFGASEVGGDTVWAESTRQG
FT                   ASMVTYDAQERWIDNKEAYDKQEREAREQLLREQKLQEKEVDVDADGEWEQALKDWEEQ
FT                   RGLNYVK"
FT   gene            <983742..>984959
FT                   /locus_tag="KLTH0D12100g"
FT                   /old_locus_tag="KLTH-ORF11193"
FT   CDS_pept        983742..984959
FT                   /locus_tag="KLTH0D12100g"
FT                   /old_locus_tag="KLTH-ORF11193"
FT                   /product="KLTH0D12100p"
FT                   /note="weakly similar to uniprot|Q08729 Saccharomyces
FT                   cerevisiae YOR264W DSE3 Daughter cell-specific protein may
FT                   help establish daughter fate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22799"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF44"
FT                   /protein_id="CAR22799.1"
FT                   /translation="MPRKFLGQRLSAGTDFVRPASLNLTELDLDEIPDVPQGTSLDNRE
FT                   LGSYPAEDVRCRRLSRPFGGTLRLKKRLSSVPELLLRDLGRLEQKTGVKLAQNSNTTSE
FT                   RPARRSAPPCSAPRWTKDQRGKNLVTAAKRRPTSSTSNHQSYVPSPLAGPPSMGRGQTL
FT                   ETFPVTAVQIQFTPERPSHNRQKSDGELLFEEIIKAYANAPEREGPEPLALKAEMQSSL
FT                   GKHFVHDSASRTFGQVKKQPLGFFGTVVKEEELSGIEGPKHTRRLSPPSLPVALDATLP
FT                   GVEYSGSSSSDPSSSGEEFSDLGSILESLKASPRGARSSDEEENYFSADDLLSSPTKVN
FT                   LPTARSARCSLRQVRTSQVTPVVLDFDELVSASEDEGEGSDAISQLQEELDDLGIMDTS
FT                   SSIYDS"
FT   gene            <985213..>985536
FT                   /locus_tag="KLTH0D12122g"
FT                   /old_locus_tag="KLTH-ORF11191"
FT   CDS_pept        985213..985536
FT                   /locus_tag="KLTH0D12122g"
FT                   /old_locus_tag="KLTH-ORF11191"
FT                   /product="KLTH0D12122p"
FT                   /note="similar to uniprot|P48606 Saccharomyces cerevisiae
FT                   YOR265W RBL2 Protein involved in microtubule morphogenesis
FT                   required for protection from excess free beta-tubulin
FT                   proposed to be involved the folding of beta- tubulin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22800"
FT                   /db_xref="GOA:C5DF45"
FT                   /db_xref="InterPro:IPR004226"
FT                   /db_xref="InterPro:IPR036126"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF45"
FT                   /protein_id="CAR22800.1"
FT                   /translation="MAPSQLEIKVRSLQRLVKEEKYYQQELSDQKAHVENLKANSEVDP
FT                   YDLKKQVEVLQDTQRLLPALYEKIGQFKEDLVQFTKTYSGSEDLGSSKQVLKEAADLLE
FT                   QKR"
FT   gene            <985993..>987219
FT                   /locus_tag="KLTH0D12144g"
FT                   /old_locus_tag="KLTH-ORF11190"
FT   CDS_pept        985993..987219
FT                   /locus_tag="KLTH0D12144g"
FT                   /old_locus_tag="KLTH-ORF11190"
FT                   /product="KLTH0D12144p"
FT                   /note="weakly similar to uniprot|P38969 Saccharomyces
FT                   cerevisiae YOR266W PNT1 Involved in targeting of proteins
FT                   to the mitochondrial inner membrane Pentamidine resistance
FT                   protein involved in pentamidine resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22801"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF46"
FT                   /protein_id="CAR22801.1"
FT                   /translation="MMHCPIWARACSSARTPGVPALISLRDARLFQESLSANSTLATFK
FT                   DAYQTGKFRVVEDEDKASAGLNSNRSLPMLQFPKYRIFEEVAKDAKIGEWRKPVTKWAR
FT                   LAKAVLKMYMVGLKNNWYIRKSAKKVTTKFGTTPEQFAAELYKDMTFQEIEHRIKGLRP
FT                   APLRINRSEFQELHRQKEFWKIPAFFALYVVFEEFLPLICYLLPSIVPWNCLTPGGFKK
FT                   LSDLRVSSKSLLPFKSQDKLVPAYASPYSVPLDNVIGLLRSHRMISRWKAAVYRVSGNR
FT                   TQLCELLTQLSQNLTLDDWFLVSQVVNADGIVAITDRELVNAVLERQLYFKGEDLNALA
FT                   STEIGRRLLVWRLLIYWSFRFHGTTVTGGPKTFSETWGVNNVGIMNFPGSTQLLDFNTL
FT                   KNVVDQCCT"
FT   gene            complement(<987310..>989061)
FT                   /locus_tag="KLTH0D12166g"
FT                   /old_locus_tag="KLTH-ORF11187"
FT   CDS_pept        complement(987310..989061)
FT                   /locus_tag="KLTH0D12166g"
FT                   /old_locus_tag="KLTH-ORF11187"
FT                   /product="KLTH0D12166p"
FT                   /note="similar to uniprot|Q07224 Saccharomyces cerevisiae
FT                   YOR267C HRK1 Protein kinase implicated in activation of the
FT                   plasma membrane H( )-ATPase Pma1p in response to glucose
FT                   metabolism plays a role in ion homeostasis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22802"
FT                   /db_xref="GOA:C5DF47"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF47"
FT                   /protein_id="CAR22802.1"
FT                   /translation="MPTLLGRNPFHHPKGQHPPPSLGSQADNVRSSRSFLGFMNHTSSR
FT                   ESTGSETFREPSDIPKRSGGSMNELKRFFRPAILHRKHSQSSLRNGSPEHHSHTQSAIP
FT                   PSSDSSLSLSNRVNIYHDDAILAQKYGKLGKVLGSGAGGSVRVIVRPSDGATFAVKEFR
FT                   PRRPTELVKDYAKKCTAEFCIGSTLHHPNVIETLDIFSDAKQNKYYEVMEYCPIDFFAV
FT                   VMSGNMSRGEINCCLRQLTEGVKYLHSMGLAHRDLKLDNCVMTCDGILKLIDFGSAVVF
FT                   KYPFDANVSMAHGIVGSDPYLAPEVMTSTKRYDPQFVDIWSIGIIYCCMMLKRFPWKTP
FT                   KETDDNFRLFCLPDDVEHDYVKSAHEHETLMRQRRQEKHRARKLKEERVLAEKSEPSPV
FT                   PNHGHGSEAAETQAAKGASAAPDNASQGASASAQKDTSPEAAPEKKNTKNEVVAETNEK
FT                   PQSPQQHASDPQAPNEKDASNTEAPQEKPACDHKSGSRHHGKGRKVMHGPYRLLRLLPH
FT                   ASRPIMSRILTVDPKERATMEDMYNDEWFANIPFCTRDAKKGTIRAPGHTHTIVCEEDA
FT                   HLESYKV"
FT   gene            <990209..>991582
FT                   /locus_tag="KLTH0D12188g"
FT                   /old_locus_tag="KLTH-ORF11180"
FT   CDS_pept        990209..991582
FT                   /locus_tag="KLTH0D12188g"
FT                   /old_locus_tag="KLTH-ORF11180"
FT                   /product="KLTH0D12188p"
FT                   /note="similar to uniprot|P39946 Saccharomyces cerevisiae
FT                   YOR269W PAC1 Protein involved in nuclear migration part of
FT                   the dynein/dynactin pathway targets dynein to microtubule
FT                   tips which is necessary for sliding of microtubules along
FT                   bud cortex synthetic lethal with bni1 homolog of human
FT                   LIS1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22803"
FT                   /db_xref="GOA:C5DF48"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017252"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037190"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DF48"
FT                   /protein_id="CAR22803.1"
FT                   /translation="MSLLPPEQRQLLHRCILNYIRSQVPGDGAEGETGGQTEERHVMNS
FT                   LAKWLRVDPDGLDGEKAADGSLLPRKWSSIVRLQRRIIELEKEIQELTDENENLRENGP
FT                   SSPANGALKSWLPRERPSFSISAGASVTSVKLHPELPLVFIATDAGKLQCYDLMNYTMP
FT                   VASVQAHMRGITAIDAYVGEDSQCLVATASKDLHCKVFRFVDSELQLIRTLSGHEHIVS
FT                   HIKIWNNSTNTLVASCSRDLTCKVWDIANGWCLKSFQPHTEWVRCLDVMGDFVVTGSND
FT                   CTVRLSHWPTGRSLSFGTGHEFPVEKIRIIPLQPPESAEHSHRFNTHDEDYLPLGFSHV
FT                   ISTSRDGTLRIWQVPLPRFVAHRAPQPNPARPYFNLVATLKGHSSWVRDVRVRGKHAFS
FT                   CSDDRSIKVWDLSTCEVVRSINNLHSGFINCIDIDCGGLNRQLLVSGGADGKLVILMK"
FT   gene            complement(<991654..>994116)
FT                   /locus_tag="KLTH0D12210g"
FT                   /old_locus_tag="KLTH-ORF11179"
FT   CDS_pept        complement(991654..994116)
FT                   /locus_tag="KLTH0D12210g"
FT                   /old_locus_tag="KLTH-ORF11179"
FT                   /product="KLTH0D12210p"
FT                   /note="similar to uniprot|P32563 Saccharomyces cerevisiae
FT                   YOR270C VPH1 Subunit of vacuolar-ATPase V0 domain one of
FT                   two isoforms (Vph1p and Stv1p) Vph1p is located in V-
FT                   ATPase complexes of the vacuole while Stv1p is located in
FT                   V-ATPase complexes of the Golgi and endosomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22804"
FT                   /db_xref="GOA:C5DF49"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="InterPro:IPR026028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF49"
FT                   /protein_id="CAR22804.1"
FT                   /translation="MSEKYEAMFRSAEMSLVQLYVPQEIARDTVYSLGNRGLVQFRDLN
FT                   RKVRAFQRTFVPEVRRLDELQRQYRYFYSLLCKYDIKLYEDFEDEEDEEVLAASPVASA
FT                   HKLAPRTSKIDDHIENGTLIEKRMQQLVEASEQLELQKSDLEQFRHVLKAGDEFFAQSA
FT                   GLTSQDSGEENFPRSVSFVTGTIPRAKAGTLEQILWRVLRGNLFFRTVPITEPLYDAKA
FT                   QKKIYKDAFIVFSYGDIILQRVKKVAESLDASLYEISDDQSNRSKQLSEVNSRLADVYT
FT                   VLDTTNTTLETELFAVSKELHAWNTEIAREKAVYETLNLFDFDSNRKTLVGEGWVPQDE
FT                   LGSLQVQLANLTETLGVDVPSIVQVLETNRTPPTFHRTNKFTAAFQNICDCYGTATYRE
FT                   VNPGLPTIVTFPFMFAVMFGDMGHGMLMSMVAGLLVFNEKALGKMKRDEIFDMAFSGRY
FT                   ILLLMGLFSIYTGFLYNDMFSKSLTLFKSGWEWPSHWHLGEAIEAKSVGTYVFGLDWAW
FT                   HGTENALLFSNSYKMKLSVLLGFIHMTYSYMFSLVNYVYFQKWIDIIGNFIPGLLFMQG
FT                   IFGYLTVCIIYKWTIDWVAIGKPAPGLLNTLINMFLSPGTVEEELYPHQAKVQVFLLIM
FT                   ALICIPCLLLIKPLHFKFTQDKHQHIALPDNEAGLVHHETNTGAGAVEDDDDDEEGGHG
FT                   EEFGDVMIHQVIHTIEFCLNTVSHTASYLRLWALSLAHAQLSTVLWTMTIQIAFSMRGF
FT                   VGVVMTVILFGMWFVLTCVILVLMEGTSAMLHSLRLHWVESMSKFFEGEGYPYEPFKFM
FT                   PVEFENEQ"
FT   gene            <994890..>996137
FT                   /locus_tag="KLTH0D12232g"
FT                   /old_locus_tag="KLTH-ORF11174"
FT   CDS_pept        994890..996137
FT                   /locus_tag="KLTH0D12232g"
FT                   /old_locus_tag="KLTH-ORF11174"
FT                   /product="KLTH0D12232p"
FT                   /note="similar to uniprot|P07277 Saccharomyces cerevisiae
FT                   YMR208W ERG12 Mevalonate kinase acts in the biosynthesis of
FT                   isoprenoids and sterols including ergosterol from
FT                   mevalonate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22805"
FT                   /db_xref="GOA:C5DF50"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF50"
FT                   /protein_id="CAR22805.1"
FT                   /translation="MSLPLLTSAPGKVIIFGEHSAVFNEPAVAASVSALRTYLLVSAAQ
FT                   DPKVVELDFPDIKFDKQWSGEALATIAAGVQPEAVTDSRELNADLSNALESLLQPLSGS
FT                   LHYQAAYCFLYMYFSLCGTRTGVKFTVKSSLPIGAGLGSSASLAVCLALALGKLGGHLK
FT                   HGTESLTKEELAFVNKWSFIGEKCIHGTPSGIDNMVATYGSAVLFQRLPSGETKSEQIL
FT                   SFPQIPMVLTNTRIPRSTKVLVAGVKDLIVRQPEVMKPILESMGVVASSGAQILSQLTD
FT                   ANYESLCELVRVNHGLLVALGVSHPGLELIKSVGDSMNIGHTKLTGAGGGGCALTLLSR
FT                   GARPEEVEKFKRTLESEHNYKTYTTGLGGPGCGYIAPELVQQNFSSIEPLFRKDSTASD
FT                   LNKVLLPSSGSFQWIH"
FT   gene            complement(<996251..>997234)
FT                   /locus_tag="KLTH0D12254g"
FT                   /old_locus_tag="KLTH-ORF11171"
FT   CDS_pept        complement(996251..997234)
FT                   /locus_tag="KLTH0D12254g"
FT                   /old_locus_tag="KLTH-ORF11171"
FT                   /product="KLTH0D12254p"
FT                   /note="highly similar to uniprot|Q12029 Saccharomyces
FT                   cerevisiae YOR271C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0D12254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR22806"
FT                   /db_xref="GOA:C5DF51"
FT                   /db_xref="InterPro:IPR004686"
FT                   /db_xref="UniProtKB/TrEMBL:C5DF51"
FT                   /prot