(data stored in SCRATCH zone)

EMBL: CU928169

ID   CU928169; SV 1; linear; genomic DNA; STD; FUN; 1521774 BP.
XX
AC   CU928169;
XX
PR   Project:PRJNA12499;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Lachancea thermotolerans CBS 6340 chromosome E complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans CBS 6340
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-1521774
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1521774
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   MD5; 22ee74461fd411d6731ab3a0f246998e.
DR   BioSample; SAMEA3138300.
DR   CABRI; CBS 6340.
DR   EnsemblGenomes-Gn; ENSRNA049516024.
DR   EnsemblGenomes-Gn; ENSRNA049516064.
DR   EnsemblGenomes-Gn; ENSRNA049575548.
DR   EnsemblGenomes-Gn; ENSRNA049575632.
DR   EnsemblGenomes-Gn; ENSRNA049575722.
DR   EnsemblGenomes-Gn; ENSRNA049575848.
DR   EnsemblGenomes-Gn; ENSRNA049575950.
DR   EnsemblGenomes-Gn; ENSRNA049576048.
DR   EnsemblGenomes-Gn; ENSRNA049576111.
DR   EnsemblGenomes-Gn; ENSRNA049576190.
DR   EnsemblGenomes-Gn; ENSRNA049576259.
DR   EnsemblGenomes-Gn; ENSRNA049576328.
DR   EnsemblGenomes-Gn; ENSRNA049576412.
DR   EnsemblGenomes-Gn; ENSRNA049576486.
DR   EnsemblGenomes-Gn; ENSRNA049576545.
DR   EnsemblGenomes-Gn; ENSRNA049576635.
DR   EnsemblGenomes-Gn; ENSRNA049576705.
DR   EnsemblGenomes-Gn; ENSRNA049576766.
DR   EnsemblGenomes-Gn; ENSRNA049576862.
DR   EnsemblGenomes-Gn; ENSRNA049576914.
DR   EnsemblGenomes-Gn; ENSRNA049577014.
DR   EnsemblGenomes-Gn; ENSRNA049577070.
DR   EnsemblGenomes-Gn; ENSRNA049577129.
DR   EnsemblGenomes-Gn; ENSRNA049577201.
DR   EnsemblGenomes-Gn; ENSRNA049577269.
DR   EnsemblGenomes-Gn; ENSRNA049577355.
DR   EnsemblGenomes-Gn; ENSRNA049577425.
DR   EnsemblGenomes-Gn; ENSRNA049577519.
DR   EnsemblGenomes-Gn; ENSRNA049577583.
DR   EnsemblGenomes-Gn; ENSRNA049577623.
DR   EnsemblGenomes-Gn; ENSRNA049577670.
DR   EnsemblGenomes-Gn; ENSRNA049577774.
DR   EnsemblGenomes-Gn; KLTH0E00506r.
DR   EnsemblGenomes-Gn; KLTH0E01672r.
DR   EnsemblGenomes-Gn; KLTH0E02266r.
DR   EnsemblGenomes-Gn; KLTH0E02288r.
DR   EnsemblGenomes-Gn; KLTH0E02332r.
DR   EnsemblGenomes-Gn; KLTH0E02574r.
DR   EnsemblGenomes-Gn; KLTH0E02706r.
DR   EnsemblGenomes-Gn; KLTH0E02838r.
DR   EnsemblGenomes-Gn; KLTH0E03498r.
DR   EnsemblGenomes-Gn; KLTH0E05060r.
DR   EnsemblGenomes-Gn; KLTH0E05126r.
DR   EnsemblGenomes-Gn; KLTH0E05214r.
DR   EnsemblGenomes-Gn; KLTH0E05258r.
DR   EnsemblGenomes-Gn; KLTH0E06270r.
DR   EnsemblGenomes-Gn; KLTH0E06336r.
DR   EnsemblGenomes-Gn; KLTH0E06402r.
DR   EnsemblGenomes-Gn; KLTH0E06490r.
DR   EnsemblGenomes-Gn; KLTH0E07238r.
DR   EnsemblGenomes-Gn; KLTH0E07436r.
DR   EnsemblGenomes-Gn; KLTH0E07986r.
DR   EnsemblGenomes-Gn; KLTH0E08008r.
DR   EnsemblGenomes-Gn; KLTH0E08250r.
DR   EnsemblGenomes-Gn; KLTH0E08404r.
DR   EnsemblGenomes-Gn; KLTH0E08932r.
DR   EnsemblGenomes-Gn; KLTH0E09328r.
DR   EnsemblGenomes-Gn; KLTH0E10252r.
DR   EnsemblGenomes-Gn; KLTH0E10846r.
DR   EnsemblGenomes-Gn; KLTH0E11286r.
DR   EnsemblGenomes-Gn; KLTH0E12056r.
DR   EnsemblGenomes-Gn; KLTH0E12958r.
DR   EnsemblGenomes-Gn; KLTH0E14278r.
DR   EnsemblGenomes-Gn; KLTH0E16170r.
DR   EnsemblGenomes-Gn; KLTH0E16698r.
DR   EnsemblGenomes-Tr; EFT00001979238.
DR   EnsemblGenomes-Tr; EFT00001979239.
DR   EnsemblGenomes-Tr; EFT00001979240.
DR   EnsemblGenomes-Tr; EFT00001979242.
DR   EnsemblGenomes-Tr; EFT00001979244.
DR   EnsemblGenomes-Tr; EFT00001979246.
DR   EnsemblGenomes-Tr; EFT00001979247.
DR   EnsemblGenomes-Tr; EFT00001979248.
DR   EnsemblGenomes-Tr; EFT00001979250.
DR   EnsemblGenomes-Tr; EFT00001979253.
DR   EnsemblGenomes-Tr; EFT00001979255.
DR   EnsemblGenomes-Tr; EFT00001979258.
DR   EnsemblGenomes-Tr; EFT00001979261.
DR   EnsemblGenomes-Tr; EFT00001979264.
DR   EnsemblGenomes-Tr; EFT00001979266.
DR   EnsemblGenomes-Tr; EFT00001979268.
DR   EnsemblGenomes-Tr; EFT00001979270.
DR   EnsemblGenomes-Tr; EFT00001979272.
DR   EnsemblGenomes-Tr; EFT00001979274.
DR   EnsemblGenomes-Tr; EFT00001979275.
DR   EnsemblGenomes-Tr; EFT00001979276.
DR   EnsemblGenomes-Tr; EFT00001979278.
DR   EnsemblGenomes-Tr; EFT00001979279.
DR   EnsemblGenomes-Tr; EFT00001979280.
DR   EnsemblGenomes-Tr; EFT00001979282.
DR   EnsemblGenomes-Tr; EFT00001979283.
DR   EnsemblGenomes-Tr; EFT00001979284.
DR   EnsemblGenomes-Tr; EFT00001979285.
DR   EnsemblGenomes-Tr; EFT00001979288.
DR   EnsemblGenomes-Tr; EFT00001979290.
DR   EnsemblGenomes-Tr; EFT00001979292.
DR   EnsemblGenomes-Tr; KLTH0E00506r-1.
DR   EnsemblGenomes-Tr; KLTH0E01672r-1.
DR   EnsemblGenomes-Tr; KLTH0E02266r-1.
DR   EnsemblGenomes-Tr; KLTH0E02288r-1.
DR   EnsemblGenomes-Tr; KLTH0E02332r-1.
DR   EnsemblGenomes-Tr; KLTH0E02574r-1.
DR   EnsemblGenomes-Tr; KLTH0E02706r-1.
DR   EnsemblGenomes-Tr; KLTH0E02838r-1.
DR   EnsemblGenomes-Tr; KLTH0E03498r-1.
DR   EnsemblGenomes-Tr; KLTH0E05060r-1.
DR   EnsemblGenomes-Tr; KLTH0E05126r-1.
DR   EnsemblGenomes-Tr; KLTH0E05214r-1.
DR   EnsemblGenomes-Tr; KLTH0E05258r-1.
DR   EnsemblGenomes-Tr; KLTH0E06270r-1.
DR   EnsemblGenomes-Tr; KLTH0E06336r-1.
DR   EnsemblGenomes-Tr; KLTH0E06402r-1.
DR   EnsemblGenomes-Tr; KLTH0E06490r-1.
DR   EnsemblGenomes-Tr; KLTH0E07238r-1.
DR   EnsemblGenomes-Tr; KLTH0E07436r-1.
DR   EnsemblGenomes-Tr; KLTH0E07986r-1.
DR   EnsemblGenomes-Tr; KLTH0E08008r-1.
DR   EnsemblGenomes-Tr; KLTH0E08250r-1.
DR   EnsemblGenomes-Tr; KLTH0E08404r-1.
DR   EnsemblGenomes-Tr; KLTH0E08932r-1.
DR   EnsemblGenomes-Tr; KLTH0E09328r-1.
DR   EnsemblGenomes-Tr; KLTH0E10252r-1.
DR   EnsemblGenomes-Tr; KLTH0E10846r-1.
DR   EnsemblGenomes-Tr; KLTH0E11286r-1.
DR   EnsemblGenomes-Tr; KLTH0E12056r-1.
DR   EnsemblGenomes-Tr; KLTH0E12958r-1.
DR   EnsemblGenomes-Tr; KLTH0E14278r-1.
DR   EnsemblGenomes-Tr; KLTH0E16170r-1.
DR   EnsemblGenomes-Tr; KLTH0E16698r-1.
DR   EuropePMC; PMC2765284; 19525356.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00093; SNORD18.
DR   RFAM; RF01195; snR52.
DR   RFAM; RF01244; snR4.
DR   StrainInfo; 318472; 0.
XX
CC   The Lachancea thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1521774
FT                   /organism="Lachancea thermotolerans CBS 6340"
FT                   /chromosome="E"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0E"
FT                   /db_xref="taxon:559295"
FT   gene            <844..>1952
FT                   /pseudo
FT                   /locus_tag="KLTH0E00110g"
FT                   /old_locus_tag="pseudo-Klth0E-844-1952"
FT   gene            <3262..>5010
FT                   /locus_tag="KLTH0E00132g"
FT                   /old_locus_tag="KLTH-ORF10338"
FT   CDS_pept        3262..5010
FT                   /locus_tag="KLTH0E00132g"
FT                   /old_locus_tag="KLTH-ORF10338"
FT                   /product="KLTH0E00132p"
FT                   /note="weakly similar to uniprot|P53389 Saccharomyces
FT                   cerevisiae YNR055C HOL1 Putative ion transporter similar to
FT                   the major facilitator superfamily of transporters;
FT                   mutations in membrane-spanning domains permit nonselective
FT                   cation uptake"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23058"
FT                   /db_xref="GOA:C5DB82"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB82"
FT                   /protein_id="CAR23058.1"
FT                   /translation="MTTVIDYNVIPGDSHLVDFDETRKSGEREGKIVLNPTPSDDPDDP
FT                   LNWTPRRKWTAVACVLIYTLGACIPTAAIYSVLPNIEANTNITLSELNNGTGYMFLFLG
FT                   LGCLIFQPLALQFGKRPIYLFSMLATALICVWPPYTKSNGEWVASKILQGFVGSSMESL
FT                   PEISMSDLFFEHERSFALSLYGLTLLSASFLAPFVAGFISEGQGWEWVMWWCAIFGAVC
FT                   FVLLFFLMEETNYDRKLKVDAATGEVITLASRKQQLGAVFTNIDEVIASNSEGNNAGEK
FT                   NETKTNDIGASLQTEEYPENINIVNQVSNVEVVDSNSYAPNYEGTKTYLQKLSLFGGRR
FT                   KKFLLQHYIFAPFLMARFPVVLWAGFLYGSSLVWFNVLNATAALILGGSPYDFSSSTIG
FT                   VAYLSPTIFSVILFFISGLCSDWLKVRVALWRGTGLSKPEDRLWILVIYCVLGCAASIL
FT                   WGVGAYYEIHWFGLVFGMGLLGGCGIFGIASSATYVVDTYKELDTEAMVVVIIIRNCMS
FT                   FGVSYGITDWVTDLGYKKCFISVAFLCFAANFTFLAMVYFGPRLRNRQKHMYWSMVDKY
FT                   RKLGMH"
FT   gene            <6352..>7461
FT                   /locus_tag="KLTH0E00154g"
FT                   /old_locus_tag="KLTH-ORF10335"
FT   CDS_pept        6352..7461
FT                   /locus_tag="KLTH0E00154g"
FT                   /old_locus_tag="KLTH-ORF10335"
FT                   /product="KLTH0E00154p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23059"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGZ8"
FT                   /protein_id="CAR23059.1"
FT                   /translation="MKCLQTVLASAICLISKAAAEVFIVDNDTPTALQVLLPLAAGKQV
FT                   LGITTNLGDYDTDAATYEAAMALSTGNLTSCVPVYKGAEQPLLLDYNTYHLWQDLYGDI
FT                   VWQGAWDKDYESPVPVNASYEYNKTVGAPQWIMDTVKNSKDNVTIVAAGTMTNLALALA
FT                   QWPAMAEKVKLVIMGGYVDGQIAQTTGGDFVNDMYTDFNLMVDPEAAQTALSAPWKELV
FT                   IVGNISSEIFPTQDLYNELIAVSGGLAEIKSNKSLGYVSETVGNGTLPSFNLPYWDEVA
FT                   SAIAADPEIVTGSYDAYVSVDTSFSSPFYGSLRIYPANLRAKKGVRTGKAKMITSIDEG
FT                   KLNAMIVDALVRDWTNYCKTGSAPSVAIM"
FT   gene            <8605..>10311
FT                   /locus_tag="KLTH0E00176g"
FT                   /old_locus_tag="KLTH-ORF10330"
FT   CDS_pept        8605..10311
FT                   /locus_tag="KLTH0E00176g"
FT                   /old_locus_tag="KLTH-ORF10330"
FT                   /product="KLTH0E00176p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23060"
FT                   /db_xref="GOA:C5DGZ9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGZ9"
FT                   /protein_id="CAR23060.1"
FT                   /translation="MPHRSKTACALCKAEKKCCDKKRPKCSHCTDENVACSYPLTLRWG
FT                   GRPYKDKTKQIKIPKNTVLVDGVLMVRDKSHLSPNRYERRSRLVLINEGPVFTKDITKG
FT                   KVRKAVEGASEESSVQISNPCYFTPQGSMPSLKLLNCSLEHSTFFEFYVYKTSYHFVAL
FT                   NKGCKSNPFHTIVPQMAMFNPSLMKLVMAFGGEHRERFRRLENPQLCYSLDEDFVGKKP
FT                   LTMTGQELLKQGVMELVDQLASPKTVIDDTVLASVLVLASFCIYFGTIENKWHAHLYGA
FT                   EGIILRELKEKSKIEKGLLRYTCEQGPYFFLRRWFAYMRIWGCISSASFRQKTVERPLL
FT                   EIDFEEAQDPRRHKNGDVDYALYTSGMESLVLSYLAQVANLILKSETRPPGSDREYIFR
FT                   DAVELEYKIMNYLGSRKQEGEASLKRFLPLTERAPCDSTKQYSILIATNMLFGLTGVLQ
FT                   LRRRVLGLTHESLLVQNLVLKITDLIEKKLSTGTFVQPCLLFCFFSCGCELLDESLVPK
FT                   RTLFLNLLDSLIRDGVESARQARSAMQECWRTSKPWWEVLKERGLDICFAI"
FT   gene            complement(<10634..>11638)
FT                   /locus_tag="KLTH0E00198g"
FT                   /old_locus_tag="KLTH-ORF10327"
FT   CDS_pept        complement(10634..11638)
FT                   /locus_tag="KLTH0E00198g"
FT                   /old_locus_tag="KLTH-ORF10327"
FT                   /product="KLTH0E00198p"
FT                   /note="similar to uniprot|Q07589 Saccharomyces cerevisiae
FT                   YDL144C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23061"
FT                   /db_xref="GOA:C5DH00"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH00"
FT                   /protein_id="CAR23061.1"
FT                   /translation="MPNKPNVLLVGAGGVGAMASFALEYSGESSVTSVLRSDYAHVVEN
FT                   GFKINSCDYGRGIRYRPSNVVNSIEASKQYGPFDYVVLATKCIPGVSSMIDIIAPAVSK
FT                   DTAIVLIQNGIGIEDEALFKCPGNVILSGVSMIASSNVKGHIEHSDRDFLSVGYFENVN
FT                   LTNEHQEKVCKRFVSMYKNDKNQCVFDENVKYSRWRKLVYNAGLNPVCALTEADVGRLE
FT                   IFGGTDSIIRKAMKEVIAIAKSDGVELSEALMDFMIRSKDPVYYRPSMLVDIDKGNPLE
FT                   VEVICGNPVRIAKKNGVEAPYLTLIYDLLKVVQGRIMEKRGMLIVPKERQVPK"
FT   gene            complement(<12415..>13335)
FT                   /locus_tag="KLTH0E00220g"
FT                   /old_locus_tag="KLTH-ORF10326"
FT   CDS_pept        complement(12415..13335)
FT                   /locus_tag="KLTH0E00220g"
FT                   /old_locus_tag="KLTH-ORF10326"
FT                   /product="KLTH0E00220p"
FT                   /note="similar to uniprot|P14065 Saccharomyces cerevisiae
FT                   YOR120W GCY1 Putative NADP( ) coupled glycerol
FT                   dehydrogenase proposed to be involved in an alternative
FT                   pathway for glycerol catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23062"
FT                   /db_xref="GOA:C5DB86"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB86"
FT                   /protein_id="CAR23062.1"
FT                   /translation="MATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHID
FT                   TAAIYRNEAAVGRAIRDSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYL
FT                   MHFPVALKTDLIKDGNVLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVS
FT                   NFSIKNIEEILKPELGLSVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESS
FT                   MLTDPDLIKLAEKHQVEPAQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQ
FT                   ISKILEKLGSKRYVSPSWAPFPMYE"
FT   gene            complement(<15734..>19045)
FT                   /locus_tag="KLTH0E00242g"
FT                   /old_locus_tag="KLTH-ORF10319"
FT   CDS_pept        complement(15734..19045)
FT                   /locus_tag="KLTH0E00242g"
FT                   /old_locus_tag="KLTH-ORF10319"
FT                   /product="KLTH0E00242p"
FT                   /note="some similarities with uniprot|P32768 Saccharomyces
FT                   cerevisiae YAR050W FLO1 Lectin-like protein involved in
FT                   flocculation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23063"
FT                   /db_xref="GOA:C5DH02"
FT                   /db_xref="InterPro:IPR001389"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH02"
FT                   /protein_id="CAR23063.1"
FT                   /translation="MWYLAIRLASFAFIALASSSENEENIGNHVCLPQGLSFPGFRANI
FT                   YSYKYLDRESAYSFDYLQSGYQYNSKLLKQAFGITDPSFRLVHEENGVAGGQLYGEDIT
FT                   TTNFTLELVGYFQPSQSGVYTITANEIDDGFSLMMGESAFKCCTSNSFTEQESSDGTVQ
FT                   LTKRDDQSENGEPTTDLHGFYHMGATSVQVELREGMFYPLRLVFANMERTAIMDLSLIL
FT                   PDGTIKNTFEEVTFFPEDDGSNGQCDALVVTEGYTGTVTSTSTADDTTPTIYILTPTAV
FT                   LTTTLYTPWTGSETVTYSTETTTFTGSGGVPTTETIYYVETPTAATESTTYTPWTGSET
FT                   STFSTETTTFTGSDGVPTTETIYYVETPTAATESTTYTPWTGSETVTFSTETTTFTGSD
FT                   GVPTTETIYYVETPNVGTESTIYTPWTGSETVTYSTETTTFTGSDGVPTTETIYYVETP
FT                   TVGTESTIYTPWTGSETSTFSTETTTFTGPDGIPTTETIYYVETPNVGTESTTYTPWTG
FT                   SETVTYSTETTTFTGSDGVPTTETIYYVETPTAATESTTYTPWTGSETVTFSTGTTTFT
FT                   GSDGVPTTGTIYYVETPTAPVNTPTSGKPLYPSSSAPVSETYFSVVSSAPSPSSPVSET
FT                   SSTPVSSVPSSSAPVSETSSTPVSSVPSSSALVSEYSSTPVSSVPSSSAPVSETSSTPV
FT                   SSVPSSSAPVSETSSTPVSSVPSSSAPVSETSSTPVSSAPSSSAPISSVPHSYPYYHNT
FT                   TSAAGIGSTSYPVSLSSTPATSGSAPATSETTPATSGTPATSGSVPATSGSIPTTSTCQ
FT                   TIVKSAVSGTTTIFTTTCPESTLPTTTGPAQTESVVTVTESGTVTSYTTTCPITEVEPT
FT                   TTGPDNAKTVLVSSVSGTVTSYTTTLPASESQPATTAPASSESVVVSSASGTVTSYTTT
FT                   LPASESQPATTAPASSESVVVSSASGTPVTESIVTDTVSGTTTIYTTTCPVSSAVETTS
FT                   PGPANSEIVTTSTISGTETVYTTTAPLSSAQKTEAASPSGSQTKSVESSPAYSGSYTTP
FT                   GASGSYVTQTPSSSLEVQSSSSVAAVSTTAGVSTFEGAANKLRAGLLLAIPLALL"
FT   gene            complement(<21896..>23587)
FT                   /locus_tag="KLTH0E00264g"
FT                   /old_locus_tag="KLTH-ORF10306"
FT   CDS_pept        complement(21896..23587)
FT                   /locus_tag="KLTH0E00264g"
FT                   /old_locus_tag="KLTH-ORF10306"
FT                   /product="KLTH0E00264p"
FT                   /note="highly similar to uniprot|P38361 Saccharomyces
FT                   cerevisiae YBR296C PHO89 Na+/Pi cotransporter active in
FT                   early growth phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23064"
FT                   /db_xref="GOA:C5DH03"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH03"
FT                   /protein_id="CAR23064.1"
FT                   /translation="MLFAFLDAFNIGANDVANSFASAISSRSLEYWQAMILAGLCEFLG
FT                   AALTGSRVSKTIKNDIIDASTFNNDPAVLMLTMTCALVGSSCWLTIATSIGLPVSTTHS
FT                   IVGGIFGAGIAASGAGGVVWGWDGVAQIIASWFIAPVLAGLIAAIIFTISRICVLEVKT
FT                   LEKSIKNALLIVGLLVFATFSILTMLIVWKGSPNLHLDNLSETETALSIVLTGAIASVV
FT                   YFIFFYPFYRRKLLHQDWTLKLADILRGPVFYFKPLDEIPPMPENHQLTIDYYEGKRFP
FT                   QEALVGVSDEENKMPNVSTKSINDNDDNLQRTGSVETKTEPENKMTTRQYWWSLLKQGP
FT                   KQWPKLLWLVASHGWTQDVVNAQVNDKDMLSDNLVDMFKRSKYYDNRVEYIYSVLQAIT
FT                   AATMSFAHGANDVANATGPLAVVYEIWKTNATAAKSDVPVWVLAYGGAALVLGCWTYGY
FT                   KIIKNLGNKIILQSPSRGFSIELAAAITTVMATQLAIPTSTTQIAVGGIVAVGLCNKDV
FT                   KSVNWKMVAWCYSDWFFTLPIAGLIAGILNGIILNAPHFGGVYEMT"
FT   gene            <26588..>27502
FT                   /locus_tag="KLTH0E00286g"
FT                   /old_locus_tag="KLTH-ORF10301"
FT   CDS_pept        26588..27502
FT                   /locus_tag="KLTH0E00286g"
FT                   /old_locus_tag="KLTH-ORF10301"
FT                   /product="KLTH0E00286p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23065"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH04"
FT                   /protein_id="CAR23065.1"
FT                   /translation="MYSFFVFGFFFLAIAASFPLYKRANLDVDILQFALTLERLENKFY
FT                   KEALSMWSVDDFVDANFTEDFYTQLKYIVHDEEAHLVFLEQTIRATGAEPVQACTYKLP
FT                   LDGPAGFVKNLATFEGVGVSAYLGAASLISSKKYLTVAGSILSAEAIHQAAARNAIGEI
FT                   PMANPFATPLSANAIYSIASQFIESCPVNNTKLPFKAYPELFVTQGLPTAMNSSITFAS
FT                   NGTLPNSTQIYVTFVSGLDVIPVAGSRNGSSIRATVPEMVSGQSYVFLTTGNSSNLTDS
FT                   NILYGPAIIEVTPSSPTFNVSIF"
FT   gene            complement(<28103..>29218)
FT                   /locus_tag="KLTH0E00308g"
FT                   /old_locus_tag="KLTH-ORF10298"
FT   CDS_pept        complement(28103..29218)
FT                   /locus_tag="KLTH0E00308g"
FT                   /old_locus_tag="KLTH-ORF10298"
FT                   /product="KLTH0E00308p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23066"
FT                   /db_xref="GOA:C5DH05"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH05"
FT                   /protein_id="CAR23066.1"
FT                   /translation="MSFNKIPVLSLADAYSADKKPRFLECLREALINVGFLLITDFEEH
FT                   GPSHQNFERIKTQAVKFFSLPDHVKTECEMINSPHFLGYTRLANEITGGKADWREQIDL
FT                   ATELPEPKEGEPLYKQIEGPNLWPRDEFAPEFRPVVTAYIEQMTKLSKSFRGLICEAIG
FT                   LPPDGFDSYFKENQQCKMKLIAYPEKKDTPQSSIEGSTLEQDQGQGVGAHRDSDFFTFI
FT                   YQASDHKGSLQVQNFQGDWIPIDNVQGSLVVAVGQTLEAITKGVCKATIHKVTSPQGGS
FT                   GTRLSIPFFQTIDLDAHKSAILDIPQEILKLKDKRDKLITNWGSNIGFQFTPGSNDHPI
FT                   GYAVFRNRIKSHQDVAAKWYPEILEQVLRGD"
FT   gene            complement(<30414..>31385)
FT                   /locus_tag="KLTH0E00330g"
FT                   /old_locus_tag="KLTH-ORF10297"
FT   CDS_pept        complement(30414..31385)
FT                   /locus_tag="KLTH0E00330g"
FT                   /old_locus_tag="KLTH-ORF10297"
FT                   /product="KLTH0E00330p"
FT                   /note="highly similar to uniprot|P40447 Saccharomyces
FT                   cerevisiae YIL164C NIT1 Nitrilase member of the widely
FT                   found nitrilase branch (EC:3.5.5.1) of the nitrilase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23067"
FT                   /db_xref="GOA:C5DH06"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH06"
FT                   /protein_id="CAR23067.1"
FT                   /translation="MMAKKVVAALQVGTSPGGTQETLEKILSYEKEIIEAGAKLIVIPE
FT                   ATLGGYPKGSIFGTYLGYRLQSGREEFRRYHEQAIEIGKGDAYPEIAQLSMLAKRTDAT
FT                   VVCGCIERDGATLYCTMVYIDPVQGLVGKHRKLMPTAGERLIWGRGDGSTLPVVDSAVG
FT                   KLGGAICWENMMPLLRYAMYEKGVEVWCAPTVDERDIWRTAVQNIGYEGRVFVVSAVQF
FT                   MPDAKTMGLGEEFGEEGMRRMPGKGTDGSENLINGGSVIINPYGEIIAGPLLGREGLLA
FT                   AEIDTSLIVESRFEFDPTGHYSRGDVFQLTVNEKSHDTVFIK"
FT   gene            <33232..>34779
FT                   /locus_tag="KLTH0E00352g"
FT                   /old_locus_tag="KLTH-ORF10294"
FT   CDS_pept        33232..34779
FT                   /locus_tag="KLTH0E00352g"
FT                   /old_locus_tag="KLTH-ORF10294"
FT                   /product="KLTH0E00352p"
FT                   /note="similar to uniprot|P43634 Saccharomyces cerevisiae
FT                   YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6] fungal-
FT                   type binuclear cluster domain DNA-binding transcriptional
FT                   activator or CHA1 and to YOR337W uniprot|P47988
FT                   Saccharomyces cerevisiae YOR337W TEA1 Mutants are defective
FT                   in Ty1 Enhancer-mediated Activation Ty1 enhancer activator"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23068"
FT                   /db_xref="GOA:C5DH07"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH07"
FT                   /protein_id="CAR23068.1"
FT                   /translation="MKAAKDIREIKKILQSLPINDVNQDIPEGAICSNSGNSTGLVAPK
FT                   LGNMVYSSIYPSDSLNISKEITTSNAEEALPGFLSAKARNLSKDPYILSAMSNFFRWLY
FT                   PGHYMFIHRETLLKALFEKPTTKSYYCSEELVLAVASLGSQIAESQDELLQKADEFYAT
FT                   SKSLVLGKIFQANQHTSGYSKNSSKLAIIQTLLCLAFYDIGRGENPMAWYFSGLAFRIA
FT                   HEVGLHLNPKTWNNVYASDLSRIDVEVRSRIYWGCYIADHLICTLFGRSKSLRLSNSTT
FT                   PETEDLPDIEAGIEMFQYDPAASLSVVKPLKSLIALSKVAELFVRKIFGPCSSLTQRDE
FT                   SLNKLNMSFHEWRCNLPSSLKWSKTCLKTFDFDPTKAFVWIHFYVVSLSYNKPFINDVE
FT                   SCRMVVKECIEDLYYLFSSFKRKNETLCKSSLYLCYSAILAVQCIKFGTIQQEYLEYFM
FT                   NFLKSPSQPYDLGRKILELELDTESFDVFGFFASGDDYSSEFDFEFVLSNCGIQSPS"
FT   gene            complement(<36763..>38091)
FT                   /locus_tag="KLTH0E00374g"
FT                   /old_locus_tag="KLTH-ORF10292"
FT   CDS_pept        complement(36763..38091)
FT                   /locus_tag="KLTH0E00374g"
FT                   /old_locus_tag="KLTH-ORF10292"
FT                   /product="KLTH0E00374p"
FT                   /note="weakly similar to uniprot|P07991 Saccharomyces
FT                   cerevisiae YLR438W CAR2 L-ornithine transaminase (OTAse),
FT                   catalyzes the second step of arginine degradation,
FT                   expression is dually-regulated by allophanate induction and
FT                   a specific arginine induction process; not nitrogen
FT                   catabolite repression sensitive"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23069"
FT                   /db_xref="GOA:C5DH08"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH08"
FT                   /protein_id="CAR23069.1"
FT                   /translation="MESMTLEKNQYSYFDQSTFQKASQRLLNYGARFTPQVVTYAKGSY
FT                   VYINDKKVLDFTSGQMSTLLGHGHPEIAETITKHASGLDHLYSGMVSPPVLELAEKLTS
FT                   ILPKGLDRAMFLSTGSEANEAAIKLAKNITGRFEVVGFSLSWHGMTSGSNGTTYQDGRK
FT                   NQGPLMPGNLCLPAPNAYRSIFRKPDGSHDWETELDYGFSLIDAASVGSLAACIIEPVM
FT                   SCGGMLVLPDGYLKALKKHCEKRRMLLIVDEAQTAIGRCGDMFAFESHGIVPDILTLSK
FT                   TLGNGIPLSAVVTSDEISKKSAENGYLFYTTHINDPLPAAVGVKVLEIVQRDNLVPHSR
FT                   QMGELFRKRLRELQKVYRQIGDIRGRGLMTGVELVDPDTLEADGQLAEKLASTMMKFGL
FT                   SANLIAVPAFGGVFRIAPPISVSEEEILLGVEIIQKAFSEVIS"
FT   gene            <40060..>40920
FT                   /pseudo
FT                   /locus_tag="KLTH0E00396g"
FT                   /old_locus_tag="pseudo-Klth0E-40060-40920"
FT   gene            <41913..>42527
FT                   /locus_tag="KLTH0E00418g"
FT                   /old_locus_tag="KLTH-ORF10285"
FT   CDS_pept        41913..42527
FT                   /locus_tag="KLTH0E00418g"
FT                   /old_locus_tag="KLTH-ORF10285"
FT                   /product="KLTH0E00418p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23070"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH09"
FT                   /protein_id="CAR23070.1"
FT                   /translation="MSNPESFRELCRKEIHTGPTSGVLPGYIQANLLILPKCVAESFED
FT                   LCTRNPVACPILSKTEGRPQFLRNHASLIKQGTFDIRTDFPRYNVYSRGKLVQQKNNCV
FT                   NEWSSDHVGFLIGCSFTFEHALEKAGLVPKNVLYNKNVSMFRTTKFLDSAGIFHQCPYV
FT                   VSMRPYKLTEVEIVREITRKFKKTHGEPLDWGYDGAKRLGI"
FT   gene            complement(<42945..>45011)
FT                   /locus_tag="KLTH0E00440g"
FT                   /old_locus_tag="KLTH-ORF10284"
FT   CDS_pept        complement(42945..45011)
FT                   /locus_tag="KLTH0E00440g"
FT                   /old_locus_tag="KLTH-ORF10284"
FT                   /product="KLTH0E00440p"
FT                   /note="some similarities with uniprot|P25502 Saccharomyces
FT                   cerevisiae YKL015W PUT3 Positive regulator of PUT (proline
FT                   utilization) genes zinc-finger transcription factor of the
FT                   Zn(2)-Cys(6) binuclear cluster domain type"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23071"
FT                   /db_xref="GOA:C5DDC4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC4"
FT                   /protein_id="CAR23071.1"
FT                   /translation="MPRKKMMKACIKCKQRKKKCSGQLPCDYCVKIEQPGGCEYRTRTK
FT                   SKVVKVTERYISSLKNKIRALEAELAKASEGPDSEGCLEDGATSAEVNPLIEPEFRLTP
FT                   DLDSPKQESLTIGSVEHCVQASQHSKQFLGMSSCVQYLAKLKQSLVNSCGSSTEHFVAT
FT                   DGGWPPNDLDINRSFVENVATKELPDLRKAKELIEIAHEIIGADYMFLETGYFEDTAQH
FT                   LICKNPPPLQSEAIIEYTTELLRLVAHLALGSLFDKENAESRSLGLKYHRTTLLLYSEL
FT                   VKTYDCAASTSLILSLLYMAYFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTKTIVENR
FT                   VFWLCFIYDRLLAVRFGFPLMIDERNINIPLLTEVDDNLTAVSLDIYHFVSQVRLAKIT
FT                   TQIITKIYTRNPYSFLHNCHAVLKQLKNWFESLPAELKFDYNDIKTATTRSTFNLHINY
FT                   NYSIIIATRPVLLYVFNSILTENRTKEKIYEARQLELISVLLESCVQAAEIQSRILAKL
FT                   YYDGKLANRSFLDCHYIFSATTVLILTGYCSMLSGESIAFSGDIEGLFDFIQHNLKILQ
FT                   GLSEYNLAAKNFNKQLTELIDMMSSDEVVKALATGRSQNDPTSVDFQQAVASPRPMSRI
FT                   LRKRGNNPPKDFEEIGYVDLSQLVNNMDAEFRSGSTTDLFLDEDFMNYASGSL"
FT   gene            <45358..>46869
FT                   /locus_tag="KLTH0E00462g"
FT                   /old_locus_tag="KLTH-ORF10283"
FT   CDS_pept        45358..46869
FT                   /locus_tag="KLTH0E00462g"
FT                   /old_locus_tag="KLTH-ORF10283"
FT                   /product="KLTH0E00462p"
FT                   /note="weakly similar to uniprot|P53322 Saccharomyces
FT                   cerevisiae YGR260W TNA1 High affinity nicotinic acid plasma
FT                   membrane permease"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23072"
FT                   /db_xref="GOA:C5DDC3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC3"
FT                   /protein_id="CAR23072.1"
FT                   /translation="MAIGLVKTVQMETTHSVATKDPIKVSIHDDAELSEELAEHVIEEE
FT                   YYIDPQDESALTRKLDTRLLPMLAFMYFLSALDRSNIGNAYTSGMKEDLRLTSHQYSNA
FT                   VSVFYSTYLAAELPAVWLLKIAKPRYYMSILVFCWSVITLSSGFVKSYHSLLATRILLG
FT                   TFEGGFFPAMTLLITMMYKPKEQAKRIAFFFGSSALSGAFGGLIATGLASVNNAGGLEG
FT                   WRWLYIIEGLISVCASFWLFFGLPDNLDKMKFLNERELSLMQIREKQRIQYMGADPAFS
FT                   WGQVWLAFKDFKTYFAFVIQFCQDIILYGFSTFLTAILKLGLGYSSREAQYMSVPVYIL
FT                   AAIVFMVSAYVSDRLQVRGPVFFCYNILGATGYIILLAVDNNAVKYFACYLITFSLYTG
FT                   TGLNITWLTNNVAPHYKRATALGLNQTLGNLSGAIVGQVYTKSPYVFGNSFSLGCIVLS
FT                   NILTAVQIAWLVKLNKDKAAILAGTKKDTKKERIGDEALDFKYCL"
FT   gene            complement(<47160..>50996)
FT                   /locus_tag="KLTH0E00484g"
FT                   /old_locus_tag="KLTH-ORF10282"
FT   CDS_pept        complement(47160..50996)
FT                   /locus_tag="KLTH0E00484g"
FT                   /old_locus_tag="KLTH-ORF10282"
FT                   /product="KLTH0E00484p"
FT                   /note="highly similar to uniprot|P28273 YKL215C
FT                   Saccharomyces cerevisiae Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23073"
FT                   /db_xref="GOA:C5DH12"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH12"
FT                   /protein_id="CAR23073.1"
FT                   /translation="MSKIRIAIDRGGTFTDCIGNPGTGKPQDDVVIKLLSVDPKNYPDA
FT                   PLEGIRRLLEIFQKKKISRGVPLDLSDVESLRMGTTLATNCALERNGERCVFVTTKGFK
FT                   DCLLIGDQTRPRIFELAIKRPDPLYDVVIEVDERVTLEDFSEDPENVKSQPSANEGVIV
FT                   GKSGEIVRVLRKPDISTLRTALEAAFAQGIRSVGIALLHSYTFPEHEELVAALASEIGF
FT                   THVSLSSQVSPMIKYLPRANSAIADAYLTPVIQKYLSGMQAGLINTDNTNIQFMQSDGG
FT                   LVEGSKFSGLKSILSGPAGGVVGYSATCYDPVTKIPLVGFDMGGTSTDVSRYGDGKLDH
FT                   VFETTTAGIVIQSPQLDINTVAAGGSSRLFWENGLFRVGPESATADPGPAAYRKGGPLT
FT                   ITDANLLLGRLVPEFFPKIFGPNEDESLDMDITKKKFEELAETINRDLGTRFSTDQVAY
FT                   GFIKVANESMARPIRSLTEAKGHVISSHQMVTFGGAGGQHAVAVAESLGIDTVIAHRYS
FT                   SILSAYGMFLADVVEETQEPCSLVLENTSTCIKVEERFEAMTGKATDSLLKQGFSEKDL
FT                   SFEKYLNLRYEGTETSLMVLKDKSSWKFSQDFAKAHKREFGFIFSDRNIIVDDIRIRAV
FT                   AKSPVRSQTSIEEELARSLISEIDVEREVAFYKDVFFDDRRMKTPVFQIDNMPVGSRIK
FT                   GPCILADGTQTNIIPCNATATILSSHIVIKITSRSQESDTKLENRVDPVLLSIFSHRFM
FT                   DIAEQMGNQLRKTSVSTNVKERLDFSCALFDPEGNLVANAPHVPVHLGSMSTCISAQAK
FT                   LWKNKLKPGDVLVTNHPEMGGTHLPDITVITPAFSETSGKIIFYVASRAHHADIGGILP
FT                   GSVPPNSKELYEEGAAIYSELLVKEGRFDEELLIKLLVDDPAQYPGCSGSRKISDNMSD
FT                   LKAQIAANNKGVQLIAKLMTDFGFDVIVKYMLAIQENASFTVKQVLKRMTEHFGATEFA
FT                   GEDYMDDGTVIKLRVTLDTKKEEYVFDFEGTSPQVYGNLNAPEAITNSAILYCLRCLVN
FT                   EEIPLNQGCLKPITVKIPKGSILSPTKGVAVVGGNVLTSQRVTDVVLKTFKVMADSQGD
FT                   CNNFTFGTGGKDSNGKVSSGFGYYETICGGHGAGGDSWRGPGWNGAHAVHTNMTNTRMT
FT                   DVEIFERRYPVILREFSIRAGSGGKGKFAGGNGVVRDILFRKAVQASILSERRVVPPHG
FT                   FDGGEDGERGLNLWIRGSSGAVINIGAKNTISAQPGDRVIIMTPGGGGWGLPE"
FT   gene            <51804..>51904
FT                   /locus_tag="KLTH0E00506r"
FT                   /old_locus_tag="Klth0E.tLeu.CAG.1"
FT   tRNA            join(51804..51840,51861..51904)
FT                   /locus_tag="KLTH0E00506r"
FT                   /old_locus_tag="Klth0E.tLeu.CAG.1"
FT                   /note="tRNA-Leu (CAG) cove"
FT   gene            complement(<54185..>55843)
FT                   /locus_tag="KLTH0E00528g"
FT                   /old_locus_tag="KLTH-ORF10276"
FT   CDS_pept        complement(54185..55843)
FT                   /locus_tag="KLTH0E00528g"
FT                   /old_locus_tag="KLTH-ORF10276"
FT                   /product="KLTH0E00528p"
FT                   /note="similar to uniprot|P38124 Saccharomyces cerevisiae
FT                   YBR008C FLR1 Plasma membrane multidrug transporter member
FT                   of the major facilitator superfamily involved in efflux of
FT                   fluconazole diazaborine benomyl methotrexate and other
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23074"
FT                   /db_xref="GOA:C5DH13"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH13"
FT                   /protein_id="CAR23074.1"
FT                   /translation="MKAFCFLASKQSKEHIVKMYKKSFKNIFLLDVLERFHLVALDSNF
FT                   AQQATNTSLWDVPKPSCDLERSIYESSSHSSGPNIQEKDTFLVDWNGPKDCENPLNWSR
FT                   LKKGFVVFQVMLLTCATYMGASIYTPGQEYIQHEFGVGHVVGTLNLSLYVLGYGLGPIV
FT                   FSPLSEVASVGRQQIYIVTLFFFMLFQVGAATVKNIGGLLVIRFISGVLCSPSLATGGG
FT                   TMGDIIKPEIVSVFIGLWAIGAVAAPVVAPLLGAAMVQAKGWRYDFWLLMWISAATLIL
FT                   LVVFFPETQHQNILHRHAVRVRKETGDLRYYTRQERVDAEIKATSFMKELFVRPFLIMA
FT                   LEPAVLAFDIYIAVCYGAFYLFFEAFPLVFIGIYNFTLVEMGLAFLGFCIGCLLAYAAL
FT                   LVYLAKYIGPKFKNNTFTPEDFLPLSMAVCWALPLSLFMFGWTARVHWILPIIAEVFFV
FT                   INVFNLFQSAFAYLAFCYPRYLASVFASNGFCRSVFACAFPLFGRAMYEKLGSEEYPVA
FT                   WGSSLIGFCSIGLAVIPFFFYKFGPRMRGKSRYAN"
FT   gene            <57109..>58680
FT                   /locus_tag="KLTH0E00550g"
FT                   /old_locus_tag="KLTH-ORF10274"
FT   CDS_pept        57109..58680
FT                   /locus_tag="KLTH0E00550g"
FT                   /old_locus_tag="KLTH-ORF10274"
FT                   /product="KLTH0E00550p"
FT                   /note="similar to uniprot|P43548 Saccharomyces cerevisiae
FT                   YFL055W AGP3 Low-affinity amino acid permease may act to
FT                   supply the cell with amino acids as nitrogen source in
FT                   nitrogen-poor conditions transcription is induced under
FT                   conditions of sulfur limitation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23075"
FT                   /db_xref="GOA:C5DH14"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH14"
FT                   /protein_id="CAR23075.1"
FT                   /translation="MPKENDKTHGSASIVSAESVDSTGYVVNAKGEVLLSNGLKPGLKN
FT                   RMINLMAICGIIGPGVFVGMGSMLKSSGGAGLLAGFAIVGVLCMYMMLSVGELNSTFDF
FT                   NFCKHGTRFVSPGFGAALALAYVVLWITNLISEYTSLTSICETYTDKVPTYGWFLIFWA
FT                   FFTLFQLLDVTAYGESEYILGFLKLGFITAFYVFAIVYASGGVPNNKPDNPFGKHPLVD
FT                   GFKGIANSFVFAGVFLSGIESVSIFASESRNPAKAIPVAVRSTVIRIFYVYFGISIAYG
FT                   ITVSPTDAALSDPHKSMKAPMTIALTNAGWVNGKYLITTIILVTCISSINSAIFLASRS
FT                   LFTWSEMGMGPKIFTKTNKKGVPYVAVHFCHLFGFLSILSYSAGSSVAYNYVVNVAGVC
FT                   AFIVWTSISFIHLRFRRGWVKQSKPLSDLGFVAPLFPWINIVGITLGTILVLVQGWSSF
FT                   CPWDKKAFIDGYIMLPVFFLVWGLYDLVLLKTKIIKSSEMDFESDRKLDLDALKKETSV
FT                   VIVEGE"
FT   gene            <59682..>61417
FT                   /pseudo
FT                   /locus_tag="KLTH0E00572g"
FT                   /old_locus_tag="pseudo-Klth0E-59682-61417"
FT   gene            complement(<61565..>62230)
FT                   /locus_tag="KLTH0E00594g"
FT                   /old_locus_tag="KLTH-ORF10270"
FT   CDS_pept        complement(61565..62230)
FT                   /locus_tag="KLTH0E00594g"
FT                   /old_locus_tag="KLTH-ORF10270"
FT                   /product="KLTH0E00594p"
FT                   /note="similar to uniprot|P53630 Saccharomyces cerevisiae
FT                   YNR057C BIO4 Dethiobiotin synthetase catalyzes the third
FT                   step in the biotin biosynthesis pathway BIO4 is in a
FT                   cluster of 3 genes (BIO3 BIO4 and BIO5) that mediate biotin
FT                   synthesis expression appears to be repressed at low iron
FT                   levels"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23076"
FT                   /db_xref="GOA:C5DH15"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH15"
FT                   /protein_id="CAR23076.1"
FT                   /translation="MSSPIIFVTGTDTDVGKTFVSALLVQKWEANYWKPVQTGLESDVG
FT                   DTATIEQLCAGQRHEPHIFEPRYALQKPLSPLAAMEYEPTVDIQLSDFHIPGQNTDCPL
FT                   VIEGAGGVYVPLTKELHITTDLIKHLIGSTNRPVKIVVVGRSGLGTLNHMLLTLEHLCA
FT                   ANLENHILGCILNGKRNPGNVKVLQRYGRRIIAEVDHCSTDEDFVTALDGIPNLATFS"
FT   gene            <62596..>64074
FT                   /locus_tag="KLTH0E00616g"
FT                   /old_locus_tag="KLTH-ORF10269"
FT   CDS_pept        62596..64074
FT                   /locus_tag="KLTH0E00616g"
FT                   /old_locus_tag="KLTH-ORF10269"
FT                   /product="KLTH0E00616p"
FT                   /note="similar to uniprot|P50277 Saccharomyces cerevisiae
FT                   YNR058W BIO3 7 8-diamino-pelargonic acid aminotransferase
FT                   (DAPA) catalyzes the second step in the biotin biosynthesis
FT                   pathway BIO3 is in a cluster of 3 genes (BIO3 BIO4 and
FT                   BIO5) that mediate biotin synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23077"
FT                   /db_xref="GOA:C5DH16"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH16"
FT                   /protein_id="CAR23077.1"
FT                   /translation="MSDLSFTPEVEKILDFDRKHLWHPYTSMSNPLKVYPVKSAAGATI
FT                   TLDTKGPGEATLVEAMSSWWCMIHGYNNPEINGAIIEQIGRMSHVMFGGLTHKPAVGTA
FT                   EKLLRLIDHEKLNYCFLADSGSVAVEVAMKMALQYEFTKNGDKTRKSKFLTIRNGYHGD
FT                   TFGAMSVCDPVNSMHSLYSGYLPQNIFVTAPSVIDTLPTSNFLRSNPEVFEGKVDWNER
FT                   DIIEFEEIVRARHAEICAVILEPILQGAGGMRLYHPQYLIEVRKLCTKYKVPLIMDEIA
FT                   TGFCRTGEMFAFHHCRKYQKMLNIQPENHIDVYPDILCVGKALTGGYLTLSAVVTTAEI
FT                   KDVISRRDSVTGGCFMHGPTFMGNPLACSAAEKSLEILLRGECYNQVASIEAQLMKQMY
FT                   LPLLNDLTLMSTVIKHMRVIGAVGVIELRQVVDSAWFHEKFISKRVYVRPFGKLLYIMP
FT                   PYVISEAELSKVIEAINQILREWKFHLENKKLLL"
FT   gene            <64787..>66730
FT                   /locus_tag="KLTH0E00638g"
FT                   /old_locus_tag="KLTH-ORF10267"
FT   CDS_pept        64787..66730
FT                   /locus_tag="KLTH0E00638g"
FT                   /old_locus_tag="KLTH-ORF10267"
FT                   /product="KLTH0E00638p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23078"
FT                   /db_xref="GOA:C5DH17"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041805"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH17"
FT                   /protein_id="CAR23078.1"
FT                   /translation="MSFRAFLLALNLLSALVFGSPVISGKDDLVEILNAHENFNDGSIV
FT                   AAFVDELKSLSSSNKTKCEQCVTRLAIGKSLSLLKPNLVPKVFTKWCTETGYMSNKTCI
FT                   ATFSRNTVESSNTGTNFADMLSLMDPFGYDGQLYCNYKESGACPKPLTPNVSLSHMWPE
FT                   KQPKHSIAPEPSNETFNVLHVSDFHIELDYTVGAEANCSASMCCTPHSKNSVSNNNTDQ
FT                   HKWNSYYNSSYTDDSFSKGSLIDVFQNSSVWAPATTFGNYKCDAPEILINSSLDSIAQF
FT                   SKDNDINFDFAIFTGDLVDHDEISLTSYEMTVQSEEIVFRDIKKKLADVPVYSVMGNHD
FT                   TFPYGELAQENHGFANLFSWNAELMADLWEDYGWLGPSESQYARKHYTGFSVVTKKGLK
FT                   VIALNSNVWYKKNHYAYWNASEPDTFGQFQFLIDELVESESKDQRVWILAHIPFSSDVL
FT                   PLPSKLFAEVVQRFSPYTVANIFFGHTHLDQFEILYSTSGEDAKTIENVVASSWISQAV
FT                   TPWVNNNPSWRYYTVDEKTFSIMNAYNFYTKLNETFTNDGAEPVWEFEYSSREGYNITW
FT                   PETSPLNATYWHKVASAINNSVEANQLYRNYAMRFSPYVPDCAKSTGCADDYCYLTSFT
FT                   VDEYDACVGSSS"
FT   gene            <67093..>67770
FT                   /locus_tag="KLTH0E00660g"
FT                   /old_locus_tag="KLTH-ORF10264"
FT   CDS_pept        67093..67770
FT                   /locus_tag="KLTH0E00660g"
FT                   /old_locus_tag="KLTH-ORF10264"
FT                   /product="KLTH0E00660p"
FT                   /note="weakly similar to uniprot|P40449 Saccharomyces
FT                   cerevisiae YIL161W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23079"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH18"
FT                   /protein_id="CAR23079.1"
FT                   /translation="MENPSAASGSQLKDGKRRRDRNMRKPKNSPKSGQVNEKSSKKDSQ
FT                   QDTKNGDVKKRSSQKRSRPERKITEDSKHSGTPLVNVPKTTRLSKQCKEQIQQFQHIIG
FT                   KENFKVFKKSKNSTSYGLSVSSVMDQENFTFVVNIPFSYPSQPLKLEPPSASRTAETCT
FT                   EGGRKLANILNNFNSKSREMTSDGAPLTAQLNYLITQWSKLSDSNYKRTDKLYKEFLAD
FT                   ITP"
FT   gene            complement(<67775..>68998)
FT                   /locus_tag="KLTH0E00682g"
FT                   /old_locus_tag="KLTH-ORF10263"
FT   CDS_pept        complement(67775..68998)
FT                   /locus_tag="KLTH0E00682g"
FT                   /old_locus_tag="KLTH-ORF10263"
FT                   /product="KLTH0E00682p"
FT                   /note="highly similar to uniprot|P27796 Saccharomyces
FT                   cerevisiae YIL160C POT1 3-ketoacyl-CoA thiolase with broad
FT                   chain length specificity cleaves 3-ketoacyl-CoA into acyl-
FT                   CoA and acetyl-CoA during beta-oxidation of fatty acids"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23080"
FT                   /db_xref="GOA:C5DH19"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH19"
FT                   /protein_id="CAR23080.1"
FT                   /translation="MSERLTQIKDHLISAVSPSVQDQRADDVVIIAAHRSPIARGFKGG
FT                   FKDVNSDYLVHQFLQEFFKKVPSSLSENKQLIEEVACGNVLNPGAGATEHRAACLAAGI
FT                   PFSTPFVALNRQCSSGLVAVNDIANKIKVGQIGIGLALGAESMSKNYGPKALGNVSAEM
FT                   KQNKDAKKCMVPMGITNENVSHKFHVSRQSQDTFAAESHRKAERAISEGLFEDEILPIN
FT                   LPDGTTISTDEGPRKGVTADNLAQLKPAFIPEKGTTTAGNASQISDGVAAVLLARRSIA
FT                   ESMELPILGKYVACQVIGVPPEIMGVGPAYAIPKVLKDCGLAIEKVDVFEINEAFAGQA
FT                   LYCINKLQIPLAKVNPRGGAIALGHPLGCTGARQVATLLRELERGQVGIVSMCVGTGMG
FT                   AAAVFVRE"
FT   gene            <70073..>74242
FT                   /locus_tag="KLTH0E00704g"
FT                   /old_locus_tag="KLTH-ORF10260"
FT   CDS_pept        70073..74242
FT                   /locus_tag="KLTH0E00704g"
FT                   /old_locus_tag="KLTH-ORF10260"
FT                   /product="KLTH0E00704p"
FT                   /note="some similarities with uniprot|P40450 Saccharomyces
FT                   cerevisiae YIL159W BNR1 Formin nucleates the formation of
FT                   linear actin filaments involved in cell processes such as
FT                   budding and mitotic spindle orientation which require the
FT                   formation of polarized actin cables functionally redundant
FT                   with BNI1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23081"
FT                   /db_xref="GOA:C5DH20"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR042201"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH20"
FT                   /protein_id="CAR23081.1"
FT                   /translation="MDYRRGDPWIEPHGYAYRFFSLDEGIGRPGRDIQQSEISDPVSLG
FT                   LRLVGSGLVKKTKKAYASPYVSKARNFSTNDIEGPSNRACSASLEKLSQSDSSDAFSWP
FT                   STSDSSSIFDPHTTPPEEVVDQHFRELLESRAFFWGSARSGLKNLSSKRKWQLVCKERL
FT                   MRDEKDNTVRQQPVAVFDEAVLENLMTRLRSGENAAASLYQLEKLLRRNDFSRGFLRSD
FT                   GVARLADVLASFKREDMYVCLRCFKTLANTEEGRLSVVSEDRVVSYFCTGLIIEQVHLR
FT                   VHLLSAELLLLCTYIESPGGSNTVLHHLVPLFPEWISSISQLLESSSDDITNPDFIATP
FT                   NFHQTQKDYCLTSLFLINSMMQIISSFREKLEVVKKLRELGIHQLFRTMHGLEYKELEE
FT                   EIEKYEFLEKEVVEKTNPELPHFLNISYGNFLSTIIQEAHHNPLEHCIFQIFEDLAHLL
FT                   ISRTMSDSLKALTLFRTVLNYLKEYNYGEENTKVESVISVSLNQLVDNLQSDEIAERAM
FT                   SELKTAQNSIDQLNSEIQILQKERSVSKGSILSELEKIKKELFAKESLIGKLEKELHLS
FT                   NQQRKNDRKKLEQAAVHKVPRLPARASSLSVFEHLKTQTLKHSHQKSPRQASLSKSSRF
FT                   LSLKSVIDQQLEGENSSWQTHNKLSTPLNNSVDEVDIESTSSGSPSTEDLSCHSVADQS
FT                   ISNGHPDGYKLRHLGFEGHKIETLNSLVKKTPNYFPETPILSQETCPVLSNYQPNGADC
FT                   KPSKHIGKSSSELEADINGNQSPSKFLPPLPSSLPAPPPPPPPLPSNLESASINSIATP
FT                   QAVTQPIAVNSKTPPTAPPLPENLLASKVLVLDSNEELKNLAAPPPPPPPPPLPLALST
FT                   KKVDTTSNGFVSGATQKSAPRAPPPPSNLIGSKEVHSIVEAVTENSNLKLKQIHWDKLE
FT                   DVSETIWSQEGERQDAARHLESSGFLDEIAELFRVNQSLPIKAKSETSSGKDKVSILPR
FT                   DLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLSIIPRSIASKLE
FT                   PYATDHQPNEAPLLDREKLERADRIFLELCYNLRSYWRPRSLCLLTLSTYEKDYFDLIY
FT                   KLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMNRKQAGGIRLSSLQKLTFVKSSKDKNM
FT                   SLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFHEYTQRISGVKQSLEQG
FT                   RLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALENLMKLYGEDPSNIDS
FT                   KNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELLQNRSKEHSSSSQGSASEGED
FT                   NTVDILIKRLREVNNEKSTQRRSANHNSEDHLFTRTQHLLDSIQKI"
FT   gene            <74503..>75447
FT                   /locus_tag="KLTH0E00726g"
FT                   /old_locus_tag="KLTH-ORF10257"
FT   CDS_pept        74503..75447
FT                   /locus_tag="KLTH0E00726g"
FT                   /old_locus_tag="KLTH-ORF10257"
FT                   /product="KLTH0E00726p"
FT                   /note="weakly similar to uniprot|P36169 Saccharomyces
FT                   cerevisiae YKR100C SKG1 and weakly similar to
FT                   uniprot|P40451 Saccharomyces cerevisiae YIL158w AIM20"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23082"
FT                   /db_xref="GOA:C5DH21"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DH21"
FT                   /protein_id="CAR23082.1"
FT                   /translation="MTDGLGVSVGCAVGIPCGVAVLVAVIFWYYMQRKFKKEIEDDEES
FT                   MSGDGTISFTNLHSMRVPDNPEKDLPVSHVVGGSTSSDNTTTAQNVATAGQMEAQQSQP
FT                   SKKPKNTYMPAYRKRLNSSLSTLQHQDEQRSPTDSSSTSLDTKNQNGRAHSTVLDQMIP
FT                   VLAQDDNAAAASSEFSLTHERTSSNDNLIKNLHNHDFGSYPKRRSSGNLTGMISGNVSS
FT                   ASVHTRTSSVHSGKKNNENVFDTPNSQKFHEAVAPSEEDAESKGMRSYYMLKNNYDVEN
FT                   ASQIAEEDQYENEFTNYSESKREFINSLRPKKN"
FT   gene            complement(<75584..>76132)
FT                   /locus_tag="KLTH0E00748g"
FT                   /old_locus_tag="KLTH-ORF10255"
FT   CDS_pept        complement(75584..76132)
FT                   /locus_tag="KLTH0E00748g"
FT                   /old_locus_tag="KLTH-ORF10255"
FT                   /product="KLTH0E00748p"
FT                   /note="similar to uniprot|P40452 Saccharomyces cerevisiae
FT                   YIL157C FMP35 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23083"
FT                   /db_xref="GOA:C5DH22"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="InterPro:IPR042432"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH22"
FT                   /protein_id="CAR23083.1"
FT                   /translation="MLKLLTGSAGRQFRVLGARRLFLRQLATKPELVLKDKARPLRIER
FT                   ELPDPTKDKVKNRVQLGLFTVAICVALASIFNYEKTQSPIISNSLYHLRRSQSIRDLMG
FT                   DNIDFDGLVPWVYGDLNQVAGRVNISFYIKGTKDVQGMVKLVANRENKNQEFLIHEWSI
FT                   KVGDKKIDLLAEEGGAKTL"
FT   gene            <76244..>76536
FT                   /locus_tag="KLTH0E00770g"
FT                   /old_locus_tag="Klth0E.mRNA.ibl.320.p"
FT   CDS_pept        join(76244..76252,76324..76536)
FT                   /locus_tag="KLTH0E00770g"
FT                   /old_locus_tag="Klth0E.mRNA.ibl.320.p"
FT                   /product="KLTH0E00770p"
FT                   /note="similar to uniprot|Q2V2P4 Saccharomyces cerevisiae
FT                   YIL156W-B hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23084"
FT                   /db_xref="InterPro:IPR013726"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH23"
FT                   /protein_id="CAR23084.1"
FT                   /translation="MTILGKAFHISFDLVLVSACLAGIKRNTGLTPKVDVIGDPHVKGY
FT                   VSKYLNVGESCYDYTVATLGSSNYFVRK"
FT   gene            complement(<76585..>78828)
FT                   /locus_tag="KLTH0E00792g"
FT                   /old_locus_tag="KLTH-ORF10253"
FT   CDS_pept        complement(76585..78828)
FT                   /locus_tag="KLTH0E00792g"
FT                   /old_locus_tag="KLTH-ORF10253"
FT                   /product="KLTH0E00792p"
FT                   /note="similar to uniprot|P22035 Saccharomyces cerevisiae
FT                   YKR099W BAS1 Myb-related transcription factor involved in
FT                   regulating basal and induced expression of genes of the
FT                   purine and histidine biosynthesis pathways"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23085"
FT                   /db_xref="GOA:C5DH24"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH24"
FT                   /protein_id="CAR23085.1"
FT                   /translation="MSKEPAPGKTKKIRIDPLDVTRSLGYQTHKLKARKPWSKEEDDLL
FT                   RSCVITHLLNMGFENGIESVKTIQQSNEACKNMPWDEIATKFDRKVRKPKDIRKRWVSS
FT                   LDPNLRKGKWTPEEDELLMKSFEKWGPHWLKVSTEIPGRTEDQCAKRYIEVLDPSTKDR
FT                   LRDWSLQEDLALISKVKAYGTSWRRISLEMESRPSLTCRNRWRKIITMIMRGKASEEIT
FT                   KAVQETSQAQEVQSLDQLRESLRMKLEEMRDESPRLDEGQPCIEDQLEPRGGFKSGSSV
FT                   CGTSSGTQRSPSDNNSLEKGQSLFEDFSGNQSRGFEEREFRETTQQRHQSPQEQQQSLQ
FT                   LHQQQHQQLQPQFQKQQQQQQQPQQQPQQQQQQQQQQQQHQQQQQQKQQSLNNRLNEKR
FT                   KPQSSVLDWRFALNDNFGNIVSEGMVSNSDLVRELIDQARKNSLSVSVHQHIHNHYGTV
FT                   PSSLSTQSQSLSGEILSQLSPFAFSGDRTDKLSNDRGFDTDFLGKSPNYASLPLDPQNE
FT                   PVAQNRAPSQNFPVLPMYTQRSGPTSSVGSRSTPGAELEDIPPHRQYHFNYLPATVRPQ
FT                   LGSSEAGRSPQVGKVSNRSPAAQPKRKKRRKGKDGSSEGNTPNENYGSTGTTPRESEVS
FT                   PSNERHSKQGSLLTPGGASAAGEEDGLDFWESLRSLASVPSNARNNMNEGPLDEYDYLY
FT                   NFYEEQAEVSGENEIVNKKPAPSQHQMSSNQSMMGYTPQDPDLIHKGLPYNPS"
FT   gene            <80059..>82983
FT                   /locus_tag="KLTH0E00814g"
FT                   /old_locus_tag="KLTH-ORF10250"
FT   CDS_pept        80059..82983
FT                   /locus_tag="KLTH0E00814g"
FT                   /old_locus_tag="KLTH-ORF10250"
FT                   /product="KLTH0E00814p"
FT                   /note="similar to uniprot|P40453 Saccharomyces cerevisiae
FT                   YIL156W UBP7 Ubiquitin-specific protease that cleaves
FT                   ubiquitin-protein fusions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23086"
FT                   /db_xref="GOA:C5DH25"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH25"
FT                   /protein_id="CAR23086.1"
FT                   /translation="MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAE
FT                   YLFESYRHALAANQAEDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDE
FT                   ANMTNVLLMVTEVIESMSKDEVETARIMRKRAYSVPYGKSPVTIQALSKANSATVEPDA
FT                   PTETEFENGTTMWTAPELEPNDHLKVSLGSHHSSTSSASSNEQFPKIHNESHSFPFEEP
FT                   ELHALSLGGSRTRRSSVPARASRKLGTTQASNSSDFNDQKINRYATHRKDSYHSVHMSN
FT                   DDYDAFTFNLARLQKQSVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLN
FT                   VDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVF
FT                   FQLIYTSNKNLKCTPKVLLGGYEQWKKFLSKSSQAYCDKDAFLYSSTNNGRNAPVTSHS
FT                   LPEHYPVAPPSIPPPPPPIAKTEEMTKTPYNRAPFPTPLVQAQRADHFPASSQNHTRDK
FT                   NEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFA
FT                   TKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALR
FT                   PDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGLLLHDDKKLDVDQKEYDTWF
FT                   EKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKV
FT                   RLEDCINLFTSDEQLTNENAWDCPKCGTSASGTGPEEEKKKKRFLLNPDTRASGNRSRF
FT                   FKLRSKSRSRSVSPFRKQSSQQQNLEKLKSKKLTTIKTLNFISLPTVLTIHLSRFFYDL
FT                   TKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGK
FT                   QKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKIDESQ"
FT   gene            complement(<83201..>85126)
FT                   /locus_tag="KLTH0E00836g"
FT                   /old_locus_tag="KLTH-ORF10249"
FT   CDS_pept        complement(83201..85126)
FT                   /locus_tag="KLTH0E00836g"
FT                   /old_locus_tag="KLTH-ORF10249"
FT                   /product="KLTH0E00836p"
FT                   /note="similar to uniprot|P32191 Saccharomyces cerevisiae
FT                   YIL155C GUT2 Mitochondrial glycerol-3-phosphate
FT                   dehydrogenase expression is repressed by both glucose and
FT                   cAMP and derepressed by non-fermentable carbon sources in a
FT                   Snf1p Rsf1p Hap2/3/4/5 complex dependent manner"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23087"
FT                   /db_xref="GOA:C5DH26"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH26"
FT                   /protein_id="CAR23087.1"
FT                   /translation="MFARTVSRRVLAGATLAAGGYAAFALQRDRSAHNEVHVSIPLKAE
FT                   APAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSS
FT                   KSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYW
FT                   QVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSR
FT                   MNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNST
FT                   GPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFY
FT                   CPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQH
FT                   YIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGG
FT                   KWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMA
FT                   EHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYS
FT                   VKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDF
FT                   IKTFGV"
FT   gene            complement(<86253..>87227)
FT                   /locus_tag="KLTH0E00858g"
FT                   /old_locus_tag="KLTH-ORF10242"
FT   CDS_pept        complement(86253..87227)
FT                   /locus_tag="KLTH0E00858g"
FT                   /old_locus_tag="KLTH-ORF10242"
FT                   /product="KLTH0E00858p"
FT                   /note="some similarities with uniprot|P32351 Saccharomyces
FT                   cerevisiae YIL154C IMP2' Transcriptional activator involved
FT                   in maintenance of ion homeostasis and protection against
FT                   DNA damage"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23088"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH27"
FT                   /protein_id="CAR23088.1"
FT                   /translation="MEGGEPKRSILLPSKAETAGRDNIRILESEVPSRSERGRSREKKG
FT                   SSANTAVQHRSRTSSRLRGDVGSYLKWTVLQHDPSERLLLGTKEGAEASDDDEDVSDEE
FT                   QVSDVENEIDIDAALGYDLGARVLPNFTSSLWDVVQNQKPWVAKFNKSVEGKDSGVKLE
FT                   DLQGGYARAIKIVHGKPQQGAEAREGRSYIIYLDLTPESFYALLYVFGAVLASNDTLYV
FT                   VHISQRVPNEQLRANVERLEAEAAYLLDASSAALNAVNVVLLSVSHPYPKHLLNELVIA
FT                   LKPMALCVPLSLVLSSLQNYVCPIPTVVIRRKLKRSKKKGFEE"
FT   gene            <87353..>88468
FT                   /locus_tag="KLTH0E00880g"
FT                   /old_locus_tag="KLTH-ORF10237"
FT   CDS_pept        87353..88468
FT                   /locus_tag="KLTH0E00880g"
FT                   /old_locus_tag="KLTH-ORF10237"
FT                   /product="KLTH0E00880p"
FT                   /note="similar to uniprot|P40454 Saccharomyces cerevisiae
FT                   YIL153W RRD1 Resistant to Rapamycin Deletion"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23089"
FT                   /db_xref="GOA:C5DH28"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="InterPro:IPR037218"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH28"
FT                   /protein_id="CAR23089.1"
FT                   /translation="MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKY
FT                   VSSMSGVKIPETSTNHEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDES
FT                   LEALLHKFLPEPCHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGA
FT                   DFQASDVLFLFDKYYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCA
FT                   PIAPREVQDKLIVDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQR
FT                   GLLKMYFAEVLNKFPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPA
FT                   PTNLNSARRQMNPPNLRGINRLTSQDRFRRE"
FT   gene            complement(<88552..>90186)
FT                   /locus_tag="KLTH0E00902g"
FT                   /old_locus_tag="KLTH-ORF10234"
FT   CDS_pept        complement(88552..90186)
FT                   /locus_tag="KLTH0E00902g"
FT                   /old_locus_tag="KLTH-ORF10234"
FT                   /product="KLTH0E00902p"
FT                   /note="highly similar to uniprot|P10963 Saccharomyces
FT                   cerevisiae YKR097W PCK1 Phosphoenolpyruvate carboxykinase
FT                   key enzyme in gluconeogenesis catalyzes early reaction in
FT                   carbohydrate biosynthesis glucose represses transcription
FT                   and accelerates mRNA degradation regulated by Mcm1p and
FT                   Cat8p located in the cytosol"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23090"
FT                   /db_xref="GOA:C5DH29"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH29"
FT                   /protein_id="CAR23090.1"
FT                   /translation="MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKE
FT                   NKTTIASSGALIAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERA
FT                   ADYLRTRDHLYIVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPD
FT                   FTVWNAGQFPANTHTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVN
FT                   HNVLTLHSSANQGIRDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEG
FT                   GCYAKCIGLTEAKEPEIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYI
FT                   PSAKIPCLANSHPKNIVLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTE
FT                   PEATFSSCFGQPFLALHPLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKY
FT                   TRAILDAVHDGSLAQEDFETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGA
FT                   LAKLFTENFKKYQDRASADVISAGPVL"
FT   gene            <90490..>90864
FT                   /locus_tag="KLTH0E00924g"
FT                   /old_locus_tag="KLTH-ORF10229"
FT   CDS_pept        90490..90864
FT                   /locus_tag="KLTH0E00924g"
FT                   /old_locus_tag="KLTH-ORF10229"
FT                   /product="KLTH0E00924p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23091"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH30"
FT                   /protein_id="CAR23091.1"
FT                   /translation="MELIKGRQGLRQVLCHSHGVVAPATDTRTSPRAPQSSVGSDKGFE
FT                   IGSDADFLCQCLLLFSAGGLQAQRDALVAQALKTVPFDVTSEEAVVAYASSCAFGAIGP
FT                   FGPGGRRLGLRAQPDRSAQR"
FT   gene            <91205..>91852
FT                   /locus_tag="KLTH0E00946g"
FT                   /old_locus_tag="KLTH-ORF10226"
FT   CDS_pept        91205..91852
FT                   /locus_tag="KLTH0E00946g"
FT                   /old_locus_tag="KLTH-ORF10226"
FT                   /product="KLTH0E00946p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23092"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH31"
FT                   /protein_id="CAR23092.1"
FT                   /translation="MTRETRAQDRASNVFRNLSTLASKERKPLQPRPVNISQLVASQKL
FT                   RSPPNTPASAKSPASLLSNAISRSRPKSHDGSLRSVAQVIGSDYHLTPTKPHYRARAKK
FT                   RYDLAFPAGKALVNRLLKCVSAFETNRRLQRHGLSTHEYDRKLHVQYTKLLSPTELLAV
FT                   AAGPLGREVLILHMLPSTKDAEPKSGSQLLLSSNASALLYPGLRWYFEWRVI"
FT   gene            complement(<92019..>95465)
FT                   /locus_tag="KLTH0E00968g"
FT                   /old_locus_tag="KLTH-ORF10223"
FT   CDS_pept        complement(92019..95465)
FT                   /locus_tag="KLTH0E00968g"
FT                   /old_locus_tag="KLTH-ORF10223"
FT                   /product="KLTH0E00968p"
FT                   /note="similar to uniprot|P36168 Saccharomyces cerevisiae
FT                   YKR096W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23093"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH32"
FT                   /protein_id="CAR23093.1"
FT                   /translation="MEFMRDIPTGISGVNVEASPAQQKRQHSRSCDYMGSGVNKRRLGS
FT                   GISGAAAAAAALFLDSGGSPVRRKDAQSPSYMPTTSSSNLEAAAVENENSSVRLSDICI
FT                   DPRMDSSADHNCKMRGCDLASKNQHQTFSNCIQTASAVPGAPAGNAPAYSEHSVPNNAA
FT                   QTESGEARAPVNSGGLTGRNDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQDIY
FT                   RNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTALLPSQPEQDL
FT                   LIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISISNMLGDMP
FT                   QKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYHMSTVQQ
FT                   NTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEYLKHSE
FT                   VMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYFFRHAPAFA
FT                   ESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSMEAPSPTSPIEY
FT                   LESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAY
FT                   FLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLC
FT                   EQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYNSVQDHMFGD
FT                   MPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLAAGHPL
FT                   QNFCFKFEDPPVDSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQ
FT                   LHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKELD
FT                   KMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLAT
FT                   NGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATH
FT                   LEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIA
FT                   LVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN"
FT   gene            complement(<95824..>96157)
FT                   /locus_tag="KLTH0E00990g"
FT                   /old_locus_tag="Klth0E.mRNA.3762.m"
FT   CDS_pept        complement(join(95824..96055,96120..96157))
FT                   /locus_tag="KLTH0E00990g"
FT                   /old_locus_tag="Klth0E.mRNA.3762.m"
FT                   /product="KLTH0E00990p"
FT                   /note="similar to uniprot|Q3E833 Saccharomyces cerevisiae
FT                   YKR095W-A PCC1 Protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23094"
FT                   /db_xref="InterPro:IPR015419"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH33"
FT                   /protein_id="CAR23094.1"
FT                   /translation="MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHV
FT                   EYSSKAHNLCVSFEGVDDRVLRVGVSSVIESIKTIIETIDEFSH"
FT   gene            <96295..>97455
FT                   /locus_tag="KLTH0E01012g"
FT                   /old_locus_tag="KLTH-ORF10216"
FT   CDS_pept        96295..97455
FT                   /locus_tag="KLTH0E01012g"
FT                   /old_locus_tag="KLTH-ORF10216"
FT                   /product="KLTH0E01012p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23095"
FT                   /db_xref="GOA:C5DH34"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH34"
FT                   /protein_id="CAR23095.1"
FT                   /translation="MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASL
FT                   DPQLTRGQKDILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQL
FT                   GHTFQPSTENTILIFLSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLG
FT                   LRCPAASLSCFLQGQLTPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQS
FT                   LGVERFKIASLEILQKYPLEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHF
FT                   QLHVLGYSSKLQQASLVSKIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSN
FT                   TYFEICCDGHLLNMLSLQPQDQKFDGRIRIQFLKNFSSFELNVMVP"
FT   gene            complement(<97462..>99281)
FT                   /locus_tag="KLTH0E01034g"
FT                   /old_locus_tag="Klth0E.mRNA.at.343.m"
FT   CDS_pept        complement(join(97462..99128,99197..99281))
FT                   /locus_tag="KLTH0E01034g"
FT                   /old_locus_tag="Klth0E.mRNA.at.343.m"
FT                   /product="KLTH0E01034p"
FT                   /note="similar to uniprot|P32354 Saccharomyces cerevisiae
FT                   YIL150C MCM10 Essential chromatin-associated protein
FT                   involved in the initiation of DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23096"
FT                   /db_xref="GOA:C5DH35"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015408"
FT                   /db_xref="InterPro:IPR040184"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH35"
FT                   /protein_id="CAR23096.1"
FT                   /translation="MGQETDPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRD
FT                   RLEQKASRKKAQRQSLERVEVPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPW
FT                   KNGPSNTTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKEL
FT                   YSGFNISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSE
FT                   VKLTSSSKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPS
FT                   QVNNDEFSGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATD
FT                   RCEYHQDVRFRHVNAQRVELNGSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQA
FT                   QDGESQNTLFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIG
FT                   KTGYQSFNNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNS
FT                   KSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESS
FT                   DSDLEIV"
FT   gene            complement(<99471..>104786)
FT                   /locus_tag="KLTH0E01056g"
FT                   /old_locus_tag="KLTH-ORF10213"
FT   CDS_pept        complement(99471..104786)
FT                   /locus_tag="KLTH0E01056g"
FT                   /old_locus_tag="KLTH-ORF10213"
FT                   /product="KLTH0E01056p"
FT                   /note="similar to uniprot|Q02455 Saccharomyces cerevisiae
FT                   YKR095W MLP1 Myosin-like protein associated with the
FT                   nuclear envelope, connects the nuclear pore complex with
FT                   the nuclear interior; involved in the Tel1p pathway that
FT                   controls telomere length; involved in the retention of
FT                   unspliced mRNAs in the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23097"
FT                   /db_xref="GOA:C5DH36"
FT                   /db_xref="InterPro:IPR012929"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH36"
FT                   /protein_id="CAR23097.1"
FT                   /translation="MANTDELPRLESAEAAETAASFLGIESNELLAVDGGVVVNIAAKA
FT                   REFQQLQAENLRTSVTVDELRSSSERKLGACKDQVHLLLQELESLRGESAQFEKMKLEL
FT                   TSEKQRALNDSETLRVRKEALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQE
FT                   NRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNA
FT                   YRHTTQSQLAALTQKLETLEQELQASTRTNKSLREHNARITNDLETQLRNVKKLTDNLN
FT                   SEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQK
FT                   TQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEK
FT                   RQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDL
FT                   RRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQ
FT                   GDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVE
FT                   NDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKAIQPSTNNGNKITEHALANSKGK
FT                   MSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLK
FT                   VSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSV
FT                   AKIESLSSCQKKNTESIEQLTAERNNLTILVTQLQTLQGERDKLLAETEKSYKEKVDAL
FT                   EVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRD
FT                   LESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEH
FT                   RSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNELGH
FT                   QKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYE
FT                   QELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQL
FT                   RSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKVRELITSLRRERDILQTKL
FT                   EVSKRSETVSLRKLEAIEQELSFAKEELSSLQALSSQNSIMADEHNKLLEQLNQLNLLR
FT                   ESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKRSVRAKDSQISLISEET
FT                   NRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELEDRFQRLKKQARE
FT                   RLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVESEAKADSTTQP
FT                   ELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHAEELERRLDEARREVESLE
FT                   EVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATYEKELEENGK
FT                   HTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEF
FT                   EAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGK
FT                   QQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEKPVRILEASPLEDALSRN
FT                   DPNKESLPIKKISLPSLTPEPQQSQPEEAPNGQQQATKTQLTEGNATQDGLTPTKRAIE
FT                   VGNESPSKRTKPDQD"
FT   gene            <105372..>106121
FT                   /locus_tag="KLTH0E01078g"
FT                   /old_locus_tag="KLTH.mRNA.155AT.p"
FT   CDS_pept        join(105372..105379,105743..106121)
FT                   /locus_tag="KLTH0E01078g"
FT                   /old_locus_tag="KLTH.mRNA.155AT.p"
FT                   /product="KLTH0E01078p"
FT                   /note="highly similar to uniprot|P61864 Saccharomyces
FT                   cerevisiae YKR094c RPL40B and highly similar to
FT                   uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23098"
FT                   /db_xref="GOA:C5DH37"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH37"
FT                   /protein_id="CAR23098.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLP
FT                   PKATNCRKRKCGHTNQLRPKKKLK"
FT   gene            complement(<106377..>109910)
FT                   /locus_tag="KLTH0E01100g"
FT                   /old_locus_tag="KLTH-ORF10207"
FT   CDS_pept        complement(106377..109910)
FT                   /locus_tag="KLTH0E01100g"
FT                   /old_locus_tag="KLTH-ORF10207"
FT                   /product="KLTH0E01100p"
FT                   /note="similar to uniprot|P39928 Saccharomyces cerevisiae
FT                   YIL147C SLN1 Histidine kinase osmosensor that regulates a
FT                   MAP kinase cascade; transmembrane protein with an
FT                   intracellular kinase domain that signals to Ypd1p and
FT                   Ssk1p, thereby forming a phosphorelay system similar to
FT                   bacterial two-component regulators"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23099"
FT                   /db_xref="GOA:C5DH38"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH38"
FT                   /protein_id="CAR23099.1"
FT                   /translation="MARLKKFDLGAYAKRKLKPPFLISIRTQLTALVCLVALLSLIILA
FT                   VITGVYFTSSFKSMRAERLYVASQLKASQIDQNLYYLYYQCYYLSTRDVLQNALTQYLA
FT                   GNTTTENWADAVTTLDKFLGSSNLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLF
FT                   PLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSLPIFANPSIILSTSKVYGYITVVISA
FT                   EGLKTVFNDTTALEDSSVILVSTVYDNRELAGYHLVFPPYGMPSDIIDKRYTIGNDSFL
FT                   MDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLARII
FT                   VGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSSTA
FT                   ESFSSALHPASIRRSGSVARSSKHKYIPESAKGTLNKNDFEEIQPDGIENNEDAALQKV
FT                   HSPTPGSLFSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRH
FT                   YALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEND
FT                   MQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKL
FT                   AKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGE
FT                   YDESKASNGCFDRAAVVPIQESEKESSTLGPTEKGGIKDVTESASSSNATWPPSPSTSE
FT                   TSNGSKAETTSGKLTESSEEDEKEEKLDHDDKDEGDEESEEEEYRGEAEVSGKDDTNNE
FT                   TQREDSNENQNEDARSIESENASSYDDAIFHSRLRKGNSGENEDGRPLEHPRRLAIAME
FT                   VQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVG
FT                   VGSKFTFTVPLTQTKELCFEEDENPFEDEFNPDSKKNRKVKFKVSKNNKRKKSHSSSSG
FT                   QNSSVGTPTVSESEVSVGSVRVDRPFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVN
FT                   QEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRM
FT                   IRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKAD
FT                   GEKKGKTEGQA"
FT   gene            complement(<110889..>112307)
FT                   /locus_tag="KLTH0E01122g"
FT                   /old_locus_tag="KLTH-ORF10203"
FT   CDS_pept        complement(110889..112307)
FT                   /locus_tag="KLTH0E01122g"
FT                   /old_locus_tag="KLTH-ORF10203"
FT                   /product="KLTH0E01122p"
FT                   /note="weakly similar to uniprot|P40458 Saccharomyces
FT                   cerevisiae YIL146C ECM37 Non-essential protein of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23100"
FT                   /db_xref="GOA:C5DH39"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DH39"
FT                   /protein_id="CAR23100.1"
FT                   /translation="MSQYITNPRQQSRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHL
FT                   SVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTDCSMVNTQ
FT                   GDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEASSLREYQN
FT                   SEIANPREENDNETVTMSLMNSSNSFVMPKLSLIQQSQKFCILIVGKPAQRFYRDIPRA
FT                   YHKMFEVRDVGHLSPREMNKYSAVMVIFGEPKEGKELLEKVAAHNSNIIAVCQRGQQQQ
FT                   ISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLNTLSTEVDSGYETEVGSRKIRKR
FT                   RKSSKKRSPQITVNRWVIWSISLTVGVGLGYCISCLLSSTSSTLSVTLRSGDEVTIMED
FT                   IHNSPHESPFDNYLRHLLLAVKRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEWLSEASD
FT                   PTLPGVTALDLVLV"
FT   gene            complement(<113309..>115027)
FT                   /locus_tag="KLTH0E01144g"
FT                   /old_locus_tag="KLTH-ORF10201"
FT   CDS_pept        complement(113309..115027)
FT                   /locus_tag="KLTH0E01144g"
FT                   /old_locus_tag="KLTH-ORF10201"
FT                   /product="KLTH0E01144p"
FT                   /note="similar to uniprot|P32837 Saccharomyces cerevisiae
FT                   YDL210W Permease that serves as a gamma- aminobutyrate
FT                   (GABA) transport protein involved in the utilization of
FT                   GABA as a nitrogen source; catalyzes the transport of
FT                   putrescine and delta-aminolevulinic acid (ALA); localized
FT                   to the vacuolar membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23101"
FT                   /db_xref="GOA:C5DH40"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH40"
FT                   /protein_id="CAR23101.1"
FT                   /translation="MSASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDAR
FT                   SATSDQQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWG
FT                   WFIAGGLILTIGIALGELSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSAS
FT                   VCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTIS
FT                   IISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPA
FT                   IWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLD
FT                   SQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSN
FT                   FFKKVDGLTGVPVRAVWGSSALSLALGCLCLVGETASGALFSLSVAGMYMALIFPITLR
FT                   LTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGP
FT                   GFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGDDVIDAIMSNNEADYKPGDA"
FT   gene            complement(<115445..>116380)
FT                   /locus_tag="KLTH0E01166g"
FT                   /old_locus_tag="KLTH-ORF10197"
FT   CDS_pept        complement(115445..116380)
FT                   /locus_tag="KLTH0E01166g"
FT                   /old_locus_tag="KLTH-ORF10197"
FT                   /product="KLTH0E01166p"
FT                   /note="similar to uniprot|P40459 Saccharomyces cerevisiae
FT                   YIL145C PAN6 Pantothenate synthase, also known as pantoate-
FT                   beta-alanine ligase, required for pantothenic acid
FT                   biosynthesis, deletion causes pantothenic acid auxotrophy,
FT                   homologous to E. coli panC"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23102"
FT                   /db_xref="GOA:C5DH41"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH41"
FT                   /protein_id="CAR23102.1"
FT                   /translation="MKVLHTVREVVEWRTKNIDPRTHKSGFVPTMGCLHEGHLTLMRAA
FT                   KRENDFAIASIFVNPSQFAPTEDLDKYPRTLDDDIKLLEAEGVDVCFAPNAREMYPQGI
FT                   PLQVEEQRGPFVTVLGVSEQLEGRTRPNFFRGVATVVTKLLNIVAPTRAYFGQKDFQQF
FT                   TVLQVMARELFMNTELRMMPIVRDDAGLALSSRNRYLCGETLGRARSIYKGLSAAAALL
FT                   EQADASGAERTALLERVHAHWAPYENSGEFKVDYVSIADAATLQELEPRVSRDRDVVIS
FT                   CAVYVTDAEHPATVVRLIDNILVHAVRSSN"
FT   gene            <116753..>118783
FT                   /locus_tag="KLTH0E01188g"
FT                   /old_locus_tag="KLTH-ORF10193"
FT   CDS_pept        116753..118783
FT                   /locus_tag="KLTH0E01188g"
FT                   /old_locus_tag="KLTH-ORF10193"
FT                   /product="KLTH0E01188p"
FT                   /note="similar to uniprot|P40460 Saccharomyces cerevisiae
FT                   YIL144W TID3 Component of the evolutionarily conserved
FT                   kinetochore-associated Ndc80 complex (Ndc80p- Nuf2p-Spc24p-
FT                   Spc25p) conserved coiled-coil protein involved in
FT                   chromosome segregation spindle checkpoint activity
FT                   kinetochore assembly and clustering"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23103"
FT                   /db_xref="GOA:C5DH42"
FT                   /db_xref="InterPro:IPR005550"
FT                   /db_xref="InterPro:IPR038273"
FT                   /db_xref="InterPro:IPR040967"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH42"
FT                   /protein_id="CAR23103.1"
FT                   /translation="MEESRKRLSNESHAVLGHLDPQRFTSQIPMAVNGRRRNSTASAIG
FT                   GAGLSELINRSMAKNKPEVPKRSYTDSRRSLIADRKSLRSSQRTSLLPNHGLNSANTTN
FT                   TNNKDPRPLRDKNFQVAIQQEIYDYLHSQKFDVQTNHPISLKSLRQPTQKDFVFIFRWL
FT                   YQRMDPGYKFSKSIEHEVYTILRAIQYPYLETINKSQISAVGGSSWPKFLGMLHWLVNI
FT                   NKRLDSYLQKVDLTLISQNTQDITVLQQPIGTIDEQEDKQEKYELIVERLFIDYIVQSY
FT                   KSFLRLDDDYDQYMKELELGFEKFAQVIRSDIANIGMQNSDLSVKYQELVGKGQDVKVA
FT                   KDKFNALRSDLTKFQNYVNAMQHKSQEWPKKLEKMETERENKMSQLKATENQITEFRDL
FT                   IKGKNIEIAEVDRLNAERERLTRSLDSVSTDMDQAVSLLKAQKMEAESAYKTLLDVGKQ
FT                   YESAVESLVVARLNLGHQLNTDNRKISLPDTFYSRGYEPGQSGLDNDIPPEMDVRGTIK
FT                   PKLLELNEEVRSRVQKLQQENASFEAHLENLKQEISEKTRYLESLENELSIAKSQYDEQ
FT                   QQESQSHLLSQRIEIEKMERKLQNVRYSSHQKIAEAEQKVQSTKLKYEELKLAVNRERN
FT                   ILHGKVIQLIDYVSDFKINVQSAVEDLDYLAIEELNKIKFE"
FT   gene            complement(<118884..>121403)
FT                   /locus_tag="KLTH0E01210g"
FT                   /old_locus_tag="KLTH-ORF10191"
FT   CDS_pept        complement(118884..121403)
FT                   /locus_tag="KLTH0E01210g"
FT                   /old_locus_tag="KLTH-ORF10191"
FT                   /product="KLTH0E01210p"
FT                   /note="similar to uniprot|Q00578 Saccharomyces cerevisiae
FT                   YIL143C SSL2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23104"
FT                   /db_xref="GOA:C5DH43"
FT                   /db_xref="InterPro:IPR001161"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH43"
FT                   /protein_id="CAR23104.1"
FT                   /translation="MAEHQYQTRSKGGLYSNTDLNYFSDDSVATDNSDYDDGFIDGDDD
FT                   MGMTNASSRPKPKKQVRKTNQKNKKNNSSTNETLNKLAAKDQTFLHDVQTDAPPDFVPD
FT                   VVSGLFRRNDFSYLKLKPDHASRPLWISPGDGRVILESFSPLAEQAQDFLVTIAEPVSR
FT                   PSHIHEYKITAYSLYAAVSVGLETDDIIAVLDRLSKVPVAPSIINFIKSATVSYGKVKL
FT                   VIKHNRYFVETSQADILQMLLKDPVIGSLRIDSDATPAPNKAGSQQASRPNESAPSEKV
FT                   DPNDVEAVFSSVVGEIRLDDDNDDIDAVHAFEIANESVEIVKKRCQEIDYPVLEEYDFR
FT                   NDHRNPDLDIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAACTI
FT                   KKSVIVLCTSSVSVMQWRQQFLQWCTLQPENVAVFTSDNKEMFQTESGLVVSTYSMVAN
FT                   TRNRSHDSQKVMDFLTGREWGFIILDEVHVVPAAMFRRVVTTIAAHAKLGLTATLVRED
FT                   DKISDLNFLIGPKLYEANWMELSQKGHIANVQCAEVWCPMTAEFYQEYLRENARKRMLL
FT                   YIMNPTKFQACQFLIQYHEKRGDKIIVFSDNVYALQEYALKLGKPFIYGSTPQQERMNI
FT                   LQNFQFNDQINTIFLSKVGDTSIDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRND
FT                   EGFNAFFYSLVSKDTQEMYYSTKRQAFLVDQGYAFKVITHLHGMESLPNLTYSTARERR
FT                   ELLQEVLLKNEEAAGIEVGDDAENSVGRGAHANKKAKSKAVRGEGSLSGLAGGEDMAYV
FT                   EYSSNRNKDLKEHHPMIRKLYYRNAKK"
FT   gene            <121683..>122966
FT                   /locus_tag="KLTH0E01232g"
FT                   /old_locus_tag="KLTH-ORF10189"
FT   CDS_pept        121683..122966
FT                   /locus_tag="KLTH0E01232g"
FT                   /old_locus_tag="KLTH-ORF10189"
FT                   /product="KLTH0E01232p"
FT                   /note="some similarities with uniprot|P32583 Saccharomyces
FT                   cerevisiae YKR092c SRP40 suppressor of mutant AC40 of RNA
FT                   polymerase I and III singleton"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23105"
FT                   /db_xref="GOA:C5DH44"
FT                   /db_xref="InterPro:IPR007718"
FT                   /db_xref="InterPro:IPR039191"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH44"
FT                   /protein_id="CAR23105.1"
FT                   /translation="MASKKSGKVAKSEAPKLSEKMKKEELSTSGSSSSSSSSSSSDSSS
FT                   SRSSSSDESSSSSSSSSSSSSSSSSSSSSSSSSSDSELSTSSGESSNEEKSKPGNKRKK
FT                   SPKTAKAAKKQKLSKKSSSSESSSSSSSSGSSSSSSDSESSSSSSASSDESSSSSSSDS
FT                   ESSSSGSSSSSSGSSSSSSGSSSSSSDSDSSSSDSDSSSSGSDSSSSSSDSSSSDSDSS
FT                   SSDSDSSSSGSDSSSSGSDSSSSGSSSSSSDSDSSSSSSGSSSSDSDSSESDASSSSSS
FT                   DDEAEKSQLKSHSSPAGSSSSTKKNSKHDGETQETSQGSSSSSKTASPDAPSPAAPKDG
FT                   IPAAVDELKPGQRKHFSRIDKNAIKFEDRVLTDNTYKGAAGTWGEKANEKLGRVRGKDF
FT                   TKNKNKMKRGSYRGGSITLSSGSYKFTD"
FT   gene            complement(<123483..>124442)
FT                   /locus_tag="KLTH0E01254g"
FT                   /old_locus_tag="KLTH-ORF10186"
FT   CDS_pept        complement(123483..124442)
FT                   /locus_tag="KLTH0E01254g"
FT                   /old_locus_tag="KLTH-ORF10186"
FT                   /product="KLTH0E01254p"
FT                   /note="some similarities with uniprot|Q12416 Saccharomyces
FT                   cerevisiae YOR083W WHI5 Protein that regulates the critical
FT                   cell size required for passage through Start and commitment
FT                   to cell division; may act upstream of SCB binding factor
FT                   (SBF) and MCB binding factor (MBF); periodically expressed
FT                   in G1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23106"
FT                   /db_xref="GOA:C5DH45"
FT                   /db_xref="InterPro:IPR013734"
FT                   /db_xref="InterPro:IPR039198"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH45"
FT                   /protein_id="CAR23106.1"
FT                   /translation="MENTPRREKTKDRHSLEGKREEFDAPSPKSPLTPSPPNNKGRRSS
FT                   VLHGFLPSPLPVAGSKRHSGIDFANPESPSVKTRLLPPTTPKTRNSELFLSPSPKLKSP
FT                   GVYKENEKPIREISNSLKTRLNYAFVKLQNGWVDKTLPELENNDGPAEPSSTSSSKHRV
FT                   SYSNRFLDDDESDSNSARAAFLNALTSPKKKQRQNSMTSPARSGSPGKIRPPPISTKPK
FT                   EPPSEVEAIETLMSLSSPKSQSRKKSAEFTLPPPPPLSQRQASQTEQPATSHSSRSSSS
FT                   DSSAPNTLAKPFLLKSEAGESSQIVLDVETDVEETNDD"
FT   gene            complement(<124975..>127488)
FT                   /locus_tag="KLTH0E01276g"
FT                   /old_locus_tag="KLTH-ORF10181"
FT   CDS_pept        complement(124975..127488)
FT                   /locus_tag="KLTH0E01276g"
FT                   /old_locus_tag="KLTH-ORF10181"
FT                   /product="KLTH0E01276p"
FT                   /note="weakly similar to uniprot|P36166 Saccharomyces
FT                   cerevisiae YKR090W PXL1 LIM domain-containing protein that
FT                   localizes to sites of polarized growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23107"
FT                   /db_xref="GOA:C5DH46"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR034962"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH46"
FT                   /protein_id="CAR23107.1"
FT                   /translation="MQGWIYSSPFPALNPKVRYKTALERAGFDVNFHDKNKPREAHGSV
FT                   LPAGRHVSEGGRDVFGTRSAPNLAQTAQRAVSERDPRGYQNASALRSPPHSPFVKERSA
FT                   PALQEHYKVRRSDESKGAFSPRVGQPQEGRNFASAGSHKASPQPAAFPQLRKDSQSRGA
FT                   LDSRFQRHGSRTSPDRASLKSARTRGSSISQGRSAGEGSFQVSSAPQDRFSASETARRG
FT                   PVARQSPASAAGAAGKESPVSQARLSTEDLGNRQSSVFDFENQRNSPAERNFRSPDIDP
FT                   VERSFKQLTQNDNDSFSSQQEREFTPYARDSFTSVNQSDEVFEDAADIDDFNEKGDNAS
FT                   KWNSIMRLSKAPEDSVQEAAPLDRDSTNEYVDATPRTRPTSTSSISFTPVAELHVNLSP
FT                   NRPTEQTESINSATDAPISQAEPIGLERESSASVSGVYDIDLASGHTDLSQGVPQFSIQ
FT                   PTYHFSEENVGREQELREEQEVDTEEGTAQDPTATVKSSLQVERLLAQLDNVSLNRNLS
FT                   VGNRRHSPGSSRFKKSSAYLSGFVSNPAATGIDAKLQTGIASGDDQQFTPQVLSVAEDR
FT                   AHALSGEISPGSDDSPQFYHIRRQDEPRQADHRESDMTDFMRPSQQLTESLKVPVIQPL
FT                   QLYQLENTAEARAETAKPETKQEPHRLSSSSSLVEGSQPAEPPVPVFKYPPGEGPCRAC
FT                   GLEVTSRRIYSKKANELSGQWHRPCFKCIKCELTFSKKVVCYILDDEPYCQRHFHETNN
FT                   SICRICQGFIEGKCLENDRDERFHVDCLKCFRCGEFICEDYFLFNNELPLCANHDIEAL
FT                   KLESFGNMGQNNTVSKRRTRIINFT"
FT   gene            complement(<128187..>129554)
FT                   /locus_tag="KLTH0E01298g"
FT                   /old_locus_tag="KLTH-ORF10176"
FT   CDS_pept        complement(128187..129554)
FT                   /locus_tag="KLTH0E01298g"
FT                   /old_locus_tag="KLTH-ORF10176"
FT                   /product="KLTH0E01298p"
FT                   /note="highly similar to uniprot|P47154 Saccharomyces
FT                   cerevisiae YJR117W STE24 Highly conserved zinc
FT                   metalloprotease that functions in two steps of a-factor
FT                   maturation C-terminal CAAX proteolysis and the first step
FT                   of N-terminal proteolytic processing contains multiple
FT                   transmembrane spans"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23108"
FT                   /db_xref="GOA:C5DH47"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH47"
FT                   /protein_id="CAR23108.1"
FT                   /translation="MSLVESIQRTFDRPNMPWKSIVTAFTLGQFCFETYVTFRQYRTLS
FT                   KKQLPKVLEGEIEEETMQKAEKYSRAKAKFSIFSDVLGLLQNLCILKFDLLPRFWHMGQ
FT                   ALAQKLPLKVAAGSTIGQSLLFLTVLTNISSLLDLPLSYYQHFVLEEKFGFNKLTLKLW
FT                   ITDKIKGTILSAAIGLPLLYAFLKIFDAFPTNFLWYICSFILAVQVLAMVLVPVYIMPL
FT                   FNKFTPLEDGELKSSIEALAKRVGFPLDQIFVVDGSKRSSHSNAYFTGLPFTSKRIVLY
FT                   DTLVKDASVDEITAVLAHEIGHWQKNHILRMLAFSEVHIFFIFSLFSAAYQNKSLYSAF
FT                   GFYVGNIASTKPSIVVTPQLPILIGFMLFNDLLQPLDCVLNFGINLFSRLHEYQADAYA
FT                   KKLGYTKDLCHALINLQVKNLSTMNVDPLYSSYHYSHPTLPERLEALDYATEKKEK"
FT   gene            complement(<129926..>130735)
FT                   /locus_tag="KLTH0E01320g"
FT                   /old_locus_tag="KLTH-ORF10171"
FT   CDS_pept        complement(129926..130735)
FT                   /locus_tag="KLTH0E01320g"
FT                   /old_locus_tag="KLTH-ORF10171"
FT                   /product="KLTH0E01320p"
FT                   /note="similar to uniprot|P47153 Saccharomyces cerevisiae
FT                   YJR116W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23109"
FT                   /db_xref="GOA:C5DH48"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH48"
FT                   /protein_id="CAR23109.1"
FT                   /translation="MEDPFLKFSPFAGSDNLLVRHSLEIIGSFLVYQVVLSRWLVPRVN
FT                   ALVFGRHYTELKDKDARLNFDIHTVSMFQCVVSLGLTWPILFQPLSLSIVSYQDSYTSM
FT                   ISAITCGYFLWDLYVCLKHFSLFGIGFLGHAMASLYVFVLALRPFCQSWVGKFLIFEAS
FT                   TPFVNINWFISQLSRTSSRPVVPMWFNALNGLLLIGTFFVVRVLWGFTAIAILCAKLWE
FT                   ARKVLPTWIPTTVITLNLSLDALNLFWLSKMIKIAKKMASGSKQKGH"
FT   gene            <131090..>132115
FT                   /locus_tag="KLTH0E01342g"
FT                   /old_locus_tag="KLTH-ORF10169"
FT   CDS_pept        131090..132115
FT                   /locus_tag="KLTH0E01342g"
FT                   /old_locus_tag="KLTH-ORF10169"
FT                   /product="KLTH0E01342p"
FT                   /note="similar to uniprot|P47143 Saccharomyces cerevisiae
FT                   YJR105W ADO1 adenosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23110"
FT                   /db_xref="GOA:C5DH49"
FT                   /db_xref="InterPro:IPR001805"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH49"
FT                   /protein_id="CAR23110.1"
FT                   /translation="MSASPKLVCLGNPLLDIQATVDEAYLAKYSLKENDAILVDASSNE
FT                   PKMAIFDELLQFPDVKFIAGGAAQNTARGAAYVLGAGKVGYFGSVGQDKFSSKLLAENE
FT                   AAGVVSYYQEQSKVGTGKCAALITGHNRSLVTDLGAANHFTPDHLDKHWDVVEKAELFY
FT                   IGGFHLTVSPGAIVKLGKHAQATGKPFVLNLSAPFIPQFFKSALEQVLPYTTYVIGNES
FT                   EAAAYAEAFGLDCKQDDLASIAKHVLGGSTTRTVIFTHGLEPTVIVSANDVATRPVKAL
FT                   PKDSIVDTNGAGDAFAAGFMAGLTQGKNLDQSVDIGQWLAALSIQEVGASYPAEKLQYQ
FT                   G"
FT   gene            <132301..>134319
FT                   /locus_tag="KLTH0E01364g"
FT                   /old_locus_tag="KLTH-ORF10167"
FT   CDS_pept        132301..134319
FT                   /locus_tag="KLTH0E01364g"
FT                   /old_locus_tag="KLTH-ORF10167"
FT                   /product="KLTH0E01364p"
FT                   /note="weakly similar to uniprot|P47144 Saccharomyces
FT                   cerevisiae YJR106W ECM27 Non-essential protein of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23111"
FT                   /db_xref="GOA:C5DH50"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH50"
FT                   /protein_id="CAR23111.1"
FT                   /translation="MHEKAENWLFRLVHPSLLYLDSKLNVQFVISSLLYLSLCFVLLGI
FT                   CASDYLCPAVSNISNGRKGSAQKGLLAAILLSWCNSSPDLFTNFMSWTSSNAAALSVGE
FT                   VLGSCGFIMCVVQGAVFIVMSKARVGLEPEQRQHVTRDLGFILVAMLMMLYVCLQNEVT
FT                   LLNCVFMMGVYAAYIASKAGVRYSKPTSDDANHTDWNSPEEAFPEMTAGAFSSGADSGH
FT                   KFNILSAMDYSALYEMMERSTSSPDDAITLQTLRSDIPGTTFVSPRPITEPSASRLPFL
FT                   DNVASPVQSSPSTFQPFHDSDDISEAGQALLAEPIKYSKIAIKRLQRLRKGAFFLLAPQ
FT                   LLGFGCKSLSAKALALATTPFTVLLRFSCPQYYEILQFDRTPSNLIELERAQLMLLLVQ
FT                   ALLAPSSSLVLLWVLAGILLRWYYLLAAGITAIALLVSVAFLQLAAKKYNRFSLNEDHS
FT                   SDDRKLKRLLNAEKAIIILFNSFGILNSILWISTLANALVEVMEVYQRFTSVSEAVLGL
FT                   TIFSWGNSISDLMSNVAMCQLYRKNEVEDTEETSRHASRSFFISLSACFGGILLNSLIG
FT                   IGLSGFVAMLINTEGTNEKNSWILRSVSLDSSGVDFKFMVSVSFIIIQNLFLLSSFCGV
FT                   RTFDSLLEDKRKLVGILMCSWWGAATLVNVLIESFVD"
FT   gene            <134534..>135754
FT                   /locus_tag="KLTH0E01386g"
FT                   /old_locus_tag="KLTH-ORF10165"
FT   CDS_pept        134534..135754
FT                   /locus_tag="KLTH0E01386g"
FT                   /old_locus_tag="KLTH-ORF10165"
FT                   /product="KLTH0E01386p"
FT                   /note="similar to uniprot|P47145 Saccharomyces cerevisiae
FT                   YJR107W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23112"
FT                   /db_xref="GOA:C5DH51"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH51"
FT                   /protein_id="CAR23112.1"
FT                   /translation="MNIYPKAIVIVIFLFLQAYTLVNASNVSYGVALHNTIFIESSHIV
FT                   ASENNSNVPNQWKMNDTVLIRPHEAGHFEDVTITKELYERLVYFSKMCALTYCITSNEL
FT                   NTGLSFKGGGCPSKLEFCSNKDHNPTLERTIVELVILAESGELGTGYLAVDHEKRVVVL
FT                   SFRGSTTNQDWLSDFAVYPVPYMPCSKDFYDEWIESGRIRECEGCFVHRGFNVFLNTLS
FT                   SQFFDRIEGIFKAFPHYSLVVTGHSLGAAVASLAGIELKLRGYEPLLLTYASPNIFNGA
FT                   LRAWVDDLFETKRIHDLSVEEGEVMFQKGYFRVVHDQDYITMVPPFYEPAGLEIFINNP
FT                   CLPHKHEDLEYRGPSLDLTSLQIAGENSAVSQGRGQGHWYLGPLERLLHMYEHRSYFIL
FT                   INTCEGF"
FT   gene            complement(<136108..>137460)
FT                   /locus_tag="KLTH0E01408g"
FT                   /old_locus_tag="KLTH-ORF10163"
FT   CDS_pept        complement(136108..137460)
FT                   /locus_tag="KLTH0E01408g"
FT                   /old_locus_tag="KLTH-ORF10163"
FT                   /product="KLTH0E01408p"
FT                   /note="similar to uniprot|P10823 Saccharomyces cerevisiae
FT                   YER020W GPA2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23113"
FT                   /db_xref="GOA:C5DH52"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR002975"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH52"
FT                   /protein_id="CAR23113.1"
FT                   /translation="MGACMSKSTDGPPAKGGGTAAAKRSRSQKIAKGARAAEEKEAAAG
FT                   AGSGDRSQTGHTTDSSSGAEEKAATSAKGAAPDRPRLGGAVPDNSKRQQSVVSSNSGGS
FT                   TGPSMGSLSKSGGGSTDSNRALKVLLLGSGESGKSTVLQQLKILHQNGFSNEELLEFKP
FT                   FIFDNIIETGKDIINARLKFHATLEPESGLSEEDLQGVLNFNTPGAQLQQFPADLQKTL
FT                   SNLWSLPSTQELITGEHRSSFYLMDSARYFMDNLPRVAAENYKPTVRDVLLSRKKTSGI
FT                   FDTLVEMDSNLKLHIYDVGGQRSERKKWIHCFDNVTLIIFCVSLSEFDQTLLEDKSQNR
FT                   LEESLILFDSVVNSRWFARASIVLFLNKIDVFAEKIQHVPLERFFPDYTGGQDINKAAK
FT                   YILWRFVQLNRAHLNIYPHVTQATDTSNIKLVFAAIKETILENSLKDSGVL"
FT   gene            complement(<138025..>138309)
FT                   /locus_tag="KLTH0E01430g"
FT                   /old_locus_tag="KLTH-ORF10156"
FT   CDS_pept        complement(138025..138309)
FT                   /locus_tag="KLTH0E01430g"
FT                   /old_locus_tag="KLTH-ORF10156"
FT                   /product="KLTH0E01430p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23114"
FT                   /db_xref="InterPro:IPR033775"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH53"
FT                   /protein_id="CAR23114.1"
FT                   /translation="MKENSTMHNIDPYEWQLDQALLANASQAAPAGAGAWSDRAMLERS
FT                   TSAEPLPKLAPLAAPASDGSKRALEYDGRQEAPSVTPGKRTRRGSQGDT"
FT   gene            complement(<138573..>141938)
FT                   /locus_tag="KLTH0E01452g"
FT                   /old_locus_tag="KLTH-ORF10152"
FT   CDS_pept        complement(138573..141938)
FT                   /locus_tag="KLTH0E01452g"
FT                   /old_locus_tag="KLTH-ORF10152"
FT                   /product="KLTH0E01452p"
FT                   /note="highly similar to uniprot|P03965 Saccharomyces
FT                   cerevisiae YJR109C CPA2 Large subunit of carbamoyl
FT                   phosphate synthetase, which catalyzes a step in the
FT                   synthesis of citrulline, an arginine precursor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23115"
FT                   /db_xref="GOA:C5DH54"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH54"
FT                   /protein_id="CAR23115.1"
FT                   /translation="MSSVPSIYESTQPTTSAFNTPDYNPQLVKGVESVLVIGSGGLSIG
FT                   QAGEFDYSGSQAIKALKEANKRTILINPNIATNQTSHSLADEVYYLPVTPEYITYIIER
FT                   ERPDAILLTFGGQTGLNCGVALDKLGVLQKYGIKVLGTPIKTLITSEDRDLFAQALKEI
FT                   NIPTAESFACETVDEALSAAARVQYPVIVRSAYALGGLGSGFANNEGEMKELAAQALSL
FT                   SPQILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLGVHTGDSIVFAPSQTLSDE
FT                   EFHMLRTAAIKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPL
FT                   AYTAAKIALGYTLPELPNPVTKTTVANFEPSLDYIVAKIPRWDLSKFQHVNRSVGSSMK
FT                   SVGEVMAIGRNFEEAFQKAIRQIDPSFLGFQGSDEFGDKLDDVLANPTDRRWLAIGQAL
FT                   IYEGYSVEKVHELSKVDSWFLYKCMNLVDMYKELDAVNKLEDLDKDLLTRAKKMGFSDK
FT                   QIAVSINKGSEANVHELDVRKVRKSFGIVPFVKKIDTLAAEFPANTNYLYTTYNATKSD
FT                   IDFNDNGVLVLGSGVYRIGSSVEFDWCAVNTARALREKGKKTVMINYNPETVSTDFDEV
FT                   DRLYFEELSFERVMDIYELENSESAVISVGGQLPQNIALKMLENGANILGTSPVDIDRA
FT                   ENRHKFSSILDTIGVDQPEWSELSSVAEAKEFSQSVGYPVLIRPSYVLSGAAMSVVNSE
FT                   HELETKLTNASDVSPDHPVVISKFIEGAQEIDVDAVAYNGKVLVHAVSEHVENAGVHSG
FT                   DATLILPPQSLSESIKNRLYDIAQKVAEAWKITGPFNMQIIKDDRHAGTSLKVIECNIR
FT                   ASRSFPFVSKVLGCNFIDVAVKAFLGDDVPKPVNLMSEEYPYVATKVPQFSFTRLAGAD
FT                   PFLGVEMASTGEVASFGRDALESYWTAMQSTMNFSVPLPPSGILFGGDLSKEYLGQVAH
FT                   TIGTLGFKVYTTSEDAKQYLQKYVPASCEVGIIEFPKNDKRKLREVFQHYDIKAVFNLA
FT                   AKRAESLQDVDYVMRRNAIDFALPLFNEPQTALLFAKALSAKVGEKLKILESQDVIVPP
FT                   EVRTWHEWIGQRPM"
FT   gene            complement(<143734..>144675)
FT                   /locus_tag="KLTH0E01474g"
FT                   /old_locus_tag="KLTH-ORF10148"
FT   CDS_pept        complement(143734..144675)
FT                   /locus_tag="KLTH0E01474g"
FT                   /old_locus_tag="KLTH-ORF10148"
FT                   /product="KLTH0E01474p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23116"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH55"
FT                   /protein_id="CAR23116.1"
FT                   /translation="MPQPPKIIYGAFTFASLTQEEASKFVDVLEKYKVEELDTARIYPG
FT                   SEEAIGKFELPKSFIIDTKARGFGEGTLTKESINESIEESFGLLGVESVEIFYLHCPDP
FT                   ATPLEETLDAIDALYKEGKFKKFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNYNAVG
FT                   RKIETSLFPVLRELGLSFYAYSPIAGGFLAKTPEEVLGGKGRFDTSNHVGALYSKLYNK
FT                   PLLIKGLGQWGKIAEKVGISRASLAYRWVYNNSILDGKFGDGVIIGARTPESLAENIES
FT                   LKAGPLDPEVVKEIEEIWTLVEKEAILDNYSH"
FT   gene            complement(<146000..>148444)
FT                   /locus_tag="KLTH0E01496g"
FT                   /old_locus_tag="KLTH-ORF10145"
FT   CDS_pept        complement(146000..148444)
FT                   /locus_tag="KLTH0E01496g"
FT                   /old_locus_tag="KLTH-ORF10145"
FT                   /product="KLTH0E01496p"
FT                   /note="similar to uniprot|P40897 Saccharomyces cerevisiae
FT                   YJL212C OPT1 Plasma membrane transporter that transports
FT                   tetra- and pentapeptides and glutathione member of the OPT
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23117"
FT                   /db_xref="GOA:C5DH56"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH56"
FT                   /protein_id="CAR23117.1"
FT                   /translation="MKNVLKSILSSDAPVTDKKLLHPADSSSGAAASSASDAGKGKGDT
FT                   IVVTERDSSDHDIEKSRSVGLAALRSADYDPLGGKISAIAENDEYAGITVEDDSPYPEV
FT                   RASVPSTDDPSLVQNTIRMWTIGMIMTTIGCGLNMLFSMHSPTIVLTTFVTSILAWPLG
FT                   RAWDMVMPDKPVFGRFGGPSLNPGPFNVKEHALITAMGNVAFGSGNAYATDIILSMNNF
FT                   YNKDFGWGFDLLAVWSTQCIGFAMAGLSRKVLVTPASMIWPANLVTCTFLTNMHINENH
FT                   VANGWKISRLKFFMIVFIVGFVYYWFPGFIFQALSYFAWVTWIKPKDVIVNQVFGASTG
FT                   LGLIPLTFDWNQIAGYVGSPLVPPLGVIATILLSMVIIFWIVVPAVHYSNIWYGKYLPI
FT                   SDSGSYDRFQNTYNVSKIVSESLTFNKDAYREYSPLYLSATFAISYGLSFAGTMATITH
FT                   AICFHGKQIWGAIRNITSSEEEDVHAKLMRNYRDVPQWWFIVVFLIFFGLSIATVRAWP
FT                   TEMPVFTLIIALLIAFFFLLPVGIIYALTNIAVGLNVITEFIIGYMTPGKPIAMMFFKT
FT                   FGYITNNQAITFAQDMKIGHYMKVAPRVLFSAQLVATVWGGLVQMCVMKWAQGNIEDIC
FT                   TSKQKSHFTCPGSKVFFNASIIWGVIGPQRMFSAGQMYDKLMYFFILGAGLPVVNWLVL
FT                   KKWPRSLVRYLNWPVFFSGTGLIPPATPYNYGAYCMVGIFFGYFIKKNYFNWWAKYNYS
FT                   LSAGLDISLAWSSLIIFLALGLTNTDAPSWWGNNVINTIDYDGTAIQHQLTDGESFGLK
FT                   KW"
FT   gene            <149793..>150748
FT                   /locus_tag="KLTH0E01518g"
FT                   /old_locus_tag="Klth0E.mRNA.87.p"
FT   CDS_pept        join(149793..149822,149900..150748)
FT                   /locus_tag="KLTH0E01518g"
FT                   /old_locus_tag="Klth0E.mRNA.87.p"
FT                   /product="KLTH0E01518p"
FT                   /note="highly similar to uniprot|P32602 Saccharomyces
FT                   cerevisiae YBL050W SEC17"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23118"
FT                   /db_xref="GOA:C5DH57"
FT                   /db_xref="InterPro:IPR000744"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH57"
FT                   /protein_id="CAR23118.1"
FT                   /translation="MSDPQALVQKARKKAQPSSGFFKLFGASDSYKFEEAADLFVEAAN
FT                   LYKLRRELEPAGELFLEAASCQIKAGNDDEAGNTYVEAFKAFKAGASPSKACDALNRAI
FT                   EIFTRRGQFRRGANFKFELAEILESDLHDFPHAIDAYEAAADWYAQDQALALANKAYLK
FT                   CADLKALDARYIEACDVYRKVIANSVGNKLSQWSLKDYYLKTALCYLAADDQVAARRTE
FT                   SEALAEDSNFAGSREHDLLAALLEACSEGDAEKLSAKVYEFDRFSKLDKWKTTILLKIK
FT                   DTIATADDDLL"
FT   gene            <152132..>154267
FT                   /locus_tag="KLTH0E01540g"
FT                   /old_locus_tag="KLTH-ORF10126"
FT   CDS_pept        152132..154267
FT                   /locus_tag="KLTH0E01540g"
FT                   /old_locus_tag="KLTH-ORF10126"
FT                   /product="KLTH0E01540p"
FT                   /note="weakly similar to uniprot|Q08905 Saccharomyces
FT                   cerevisiae YOR381w FRE3 protein Ferric reductase, reduces
FT                   siderophore-bound iron prior to uptake by transporters"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23119"
FT                   /db_xref="GOA:C5DH58"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH58"
FT                   /protein_id="CAR23119.1"
FT                   /translation="MKFLFTAVLATVMTAVSAELGYQYDEVDYVGFSCKRALSVTAKFC
FT                   KVDTATSYDCYCEEPNAIASFFSCTNENLKSSKNRKAMEDFFQFRCPNITDSEMRSVTQ
FT                   NLSSSLVNTSLISGFNKTKPVTYPVYANKTAYQISYDSYKTRYSQFRMGQHYGAALVGY
FT                   WGIIMVCGMLSNLFCKFAPNLALSLNKKSSQLAPVRLYRKHISIPATFRSKHTTRNFVK
FT                   GLIPTRLESLIIFGFVVLCVIFHAVNFHSVPNNILFTTKPLEISRHVGDRSAMLANYLM
FT                   TLTFLLAGRNQIFITLTGWKQSTFMTYHKWVGRMLFCSVLVHTISMFTYSLMRDYYTYW
FT                   AAEEWWKYGAVAVVAGGIIAIQSFSWFREWNYELFLYVHIATAIAFLVGAWRHIHYFHY
FT                   AEWAYATAAVWCFDRFVRLVRIFMFGVKTAKVGIVSEETLVITVNKGSWWPFFPGAFGY
FT                   LHIMKLNIFWQSHPFTVVKTDNNELRFFIKIKRGATKKLYNQLLKEPNHESEIKVALEG
FT                   PYGDKKPVEAYDQVLLYSGGNGIPGPFAYAKELGEISKEAKSKFVKLYWVIRHWNSLDW
FT                   FLDELMILQRFSNVQTIIYVTRADDGKVGEKLAHHFDQGESESSEGEKGSNVVATTISD
FT                   YAETMQKALPHIEFRKGRPDIAALVEQDIDECHDQNAAIITCGHNEMCDRIRQTVAVKV
FT                   GDHKTSRIDFFEELQTW"
FT   gene            <154987..>155340
FT                   /locus_tag="KLTH0E01562g"
FT                   /old_locus_tag="KLTH-ORF10119"
FT   CDS_pept        154987..155340
FT                   /locus_tag="KLTH0E01562g"
FT                   /old_locus_tag="KLTH-ORF10119"
FT                   /product="KLTH0E01562p"
FT                   /note="similar to uniprot|P38191 Saccharomyces cerevisiae
FT                   YBL049W MOH1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23120"
FT                   /db_xref="GOA:C5DH59"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="InterPro:IPR034751"
FT                   /db_xref="InterPro:IPR039058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH59"
FT                   /protein_id="CAR23120.1"
FT                   /translation="MGIRYTSYIDHPKNKHTQFVTYGCCHCRTHLSSSAQVMSKDYRGT
FT                   TGDAYLMNRVVNVEEGGRETRCMLTGCYVVCDIKCHMCKNLVGWKYVESERKDQRYKEG
FT                   KFILELQTICKVR"
FT   gene            <155974..>158007
FT                   /locus_tag="KLTH0E01584g"
FT                   /old_locus_tag="Klth0E.mRNA.113.p"
FT   CDS_pept        join(155974..155997,156058..158007)
FT                   /locus_tag="KLTH0E01584g"
FT                   /old_locus_tag="Klth0E.mRNA.113.p"
FT                   /product="KLTH0E01584p"
FT                   /note="similar to uniprot|P47147 Saccharomyces cerevisiae
FT                   YJR110W YMR1 Phosphatidylinositol 3-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23121"
FT                   /db_xref="GOA:C5DH60"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH60"
FT                   /protein_id="CAR23121.1"
FT                   /translation="MEYIKIANVDDVILHRRGISAKGTLHLTTHHMIFSSAMLAREFWF
FT                   AYPTIGAAFKNRGSALISKSKDHNERQDPLYSGMDIWSFCNIKIVGKDYTVFSLDFQDE
FT                   RMAQDVYDSVLKLTVLQEETQLYAFIYTPNKAEKPFNSWNIYDPVREFHRQGLALDHAC
FT                   PWRLSDINKDYNFCKTYPHVLVVPRAISDTLLTHASRYRSQNRLPALTFYYRKTNSSIT
FT                   RCAQPLPGLIQQRSIQDEKLVNEIFGCSVPAGNEIPRAVKNIVVDARPATNAMAQTALG
FT                   GGTENMDNYNFGGTASRMFLGIDNIHIMRDSLNNVVDNHLVDNDLNLPIDRGSLNDGKC
FT                   AQWLKYIRTLLSSTETLVKSILFNQSNILIHCSDGWDRTTQVCSLVQLCLDPYFRTLEG
FT                   FMVLIEKDWVSFGHRFAERSGHLSSKNTFHDNSMRISISEAATTMTQGIDLNSRLFGFS
FT                   NSNNGSPQEKTEASTGELSDLSFSSQLPSSSELMHKVSRRVANRKSSNTSPIFQQFLDC
FT                   VHQLQRQNPSQFEFNERFLRRLVYHLYSCQYGTFLFNSEQERVAHDAQNKTRSVWDYFR
FT                   SRPAEFLNASYAPTSPSDDDWILPDLKDVKWWWQLFGRKNEEMNGTSKPSEDRPCSSEE
FT                   GKKTGLKFPSLRLDIFNRGNNR"
FT   gene            complement(<158057..>158872)
FT                   /locus_tag="KLTH0E01606g"
FT                   /old_locus_tag="KLTH-ORF10114"
FT   CDS_pept        complement(158057..158872)
FT                   /locus_tag="KLTH0E01606g"
FT                   /old_locus_tag="KLTH-ORF10114"
FT                   /product="KLTH0E01606p"
FT                   /note="similar to uniprot|P47148 Saccharomyces cerevisiae
FT                   YJR111C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23122"
FT                   /db_xref="GOA:C5DH61"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH61"
FT                   /protein_id="CAR23122.1"
FT                   /translation="MTVHILTAQRLVQLATFHPKLQNTWYLLAAATFSACNEPQEIPRL
FT                   YHFAMINELWMGQTLRAANKAIEITHDAENLQSQLNEVYREPTPFQKLATDKFREVLLK
FT                   SSALTGLPKAINSLQALKVVTPEGLGAAAEQVDTKSDMAWTDTKRCAEQNGQQTIRDGI
FT                   EHWSKIYNKVSDKVANNLNSSYPDLWQFTLCHVYGPLLSYDEVLSAQETSLAIIASLVP
FT                   QDVNPQLWGHLKGAVNVGCDPETIDAARNLSILVATWCNVRWRSEVVKL"
FT   gene            <159063..>159671
FT                   /locus_tag="KLTH0E01628g"
FT                   /old_locus_tag="KLTH-ORF10113"
FT   CDS_pept        159063..159671
FT                   /locus_tag="KLTH0E01628g"
FT                   /old_locus_tag="KLTH-ORF10113"
FT                   /product="KLTH0E01628p"
FT                   /note="similar to uniprot|P47149 Saccharomyces cerevisiae
FT                   YJR112W NNF1 Essential component of the MIND kinetochore
FT                   complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
FT                   kinetochore subunits contacting DNA to those contacting
FT                   microtubules required for accurate chromosome segregation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23123"
FT                   /db_xref="GOA:C5DH62"
FT                   /db_xref="InterPro:IPR007128"
FT                   /db_xref="InterPro:IPR016851"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH62"
FT                   /protein_id="CAR23123.1"
FT                   /translation="MSEHVRIRYLRLNQVCKKALQQSVNKVHNWDKIVSCFPQYATVDE
FT                   GATNLANCQRQVVEFWMELSKREFEEIFKERDIENKLNELDDLISRAKTIQRSMCDEGS
FT                   TRECIDELSPEQLISGNMHDTRVNLMNQLDERLDKMTNLNIQLEEQLQQLQAELELETG
FT                   DIHELYDRHLGEDSSLQDEALQQGLKNMLLDMRKEEPFD"
FT   gene            complement(<159757..>163947)
FT                   /locus_tag="KLTH0E01650g"
FT                   /old_locus_tag="KLTH-ORF10109"
FT   CDS_pept        complement(159757..163947)
FT                   /locus_tag="KLTH0E01650g"
FT                   /old_locus_tag="KLTH-ORF10109"
FT                   /product="KLTH0E01650p"
FT                   /note="similar to uniprot|P34216 Saccharomyces cerevisiae
FT                   YBL047C EDE1 Key endocytic protein involved in a network of
FT                   interactions with other endocytic proteins binds membranes
FT                   in a ubiquitin-dependent manner may also bind ubiquitinated
FT                   membrane-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23124"
FT                   /db_xref="GOA:C5DH63"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH63"
FT                   /protein_id="CAR23124.1"
FT                   /translation="MASVTFKTPLSAQEQEVYGQHFRKLDPEDLGIVTGESVKHLFNQS
FT                   GLNAQLLSQIWAICDNGNQGFLNLSQFSAALRIIGHLQSNPSLTVSADLFQKPPSKLAS
FT                   LNKPGMSLSNTSTGNSNTGAIPPVSSYDIAKFSQLFDRSTNGAPILPGDKAKDIFLKAK
FT                   LPTATLGSIWNLCDRENSGSLDKSEFIMAMHLIQLAMTNNPVLATVPDSLPGYLWEAVN
FT                   PSNLPQSSLSPSSTGLSVNSPVSRQPSLVRVPSSTFSNAASDWTLSFEKKQQFDAIFDS
FT                   LDKSKAGTLSSQTLVPFFLSSRLSQDTLASVWDLADIHNNAEFTKLEFAIAMFLIQKKK
FT                   TGIELPDVVPDQLLRSPALGLYPPAQQQAPASLPAVPSRDTKPSFNAPPQTVQRNQSAL
FT                   GDLLTLNESFSPQPTPVRAPSNPTGNSMGVPQSPAAGSTTGMRKFQPSSTFGQSIIKEE
FT                   AAESTPQNAGHFEPQQTTRQPLNPQYEAAQQPQYQTPQQQSQYQASQPQPQPQYQAHQQ
FT                   PPQFQSPIQTNQSLPNEESASNGAFEASRTTNTAAQPTSRSLAQQPQQGSHSSSLPNVP
FT                   NFSSPPLRQASLNISSQNDGNASLQLSQATTELANLSNQVGSLTNQATLVNERKTRAQQ
FT                   ELKRINNLKSSIETKMTTLRGSYEKELSETEQLESILTKSRQESEELKRELAVAEANHH
FT                   AVQGSLAELQQQLQESEQSNSQLKEKIGNLNAIAASLQAELNERQQKVKQERSMVDVNS
FT                   RQLEVSEITTTNLQNEIQGLEQHLDIFKQKHKELEDYKSTLESKHGELNSRHQVLEEQH
FT                   AGISRREQEVQERSRQVEEQEKIYHQEIAKLQSMFEDLSAQRESFAKAEDELQKQQFEY
FT                   AQKVQELSERRMKLAMGELPEDSDEISKNHRSFSSNQDHIAKFVDESVTNSRLGAQEDE
FT                   DKQESDVFDKDVPTVGSQTEIDDEDRRSNDDETAAQALADRFDGDLNEYGIPRTESVTS
FT                   SVMNNAPQSVRDYAEGDLATLAAPGENAPRTAEAQNAKTTETVEGNMPGGWSAEQANGA
FT                   KQQEEHQGPLPKSSDQESEAETLKNTTKESYEEPSESAGKAITEEFPPIQELDINESES
FT                   DSSLSDDDEGFKDAEGSAQQAAAKPTATKGTSSVKATAPAQGPKPAEEPVFPAQKTDAD
FT                   KPSAVGAIVENAANAKPATEQHAPQESASVKPSTEANPSTERTLKAEPSSMGAYTQEEK
FT                   SITKEKPSEDFDDEFAGLEQAAPEEEAIDHLNENEYSEGFETIDHNDLDEELNQGGFTG
FT                   APAAEEHAGTDNSAATVGADEWDEIFAGFGNAGQGPVSVTQPATSRIKQPTPVRTSREA
FT                   PAAPVNRGIATTPKSLAVEELGSMGFTTEEATKALEHCNWDLGAATNYLLDSS"
FT   gene            <164801..>164882
FT                   /locus_tag="KLTH0E01672r"
FT                   /old_locus_tag="Klth0E.tSer.AGA.2"
FT   tRNA            164801..164882
FT                   /locus_tag="KLTH0E01672r"
FT                   /old_locus_tag="Klth0E.tSer.AGA.2"
FT                   /note="tRNA-Ser (AGA) cove score=80.04"
FT   gene            <165164..>165550
FT                   /locus_tag="KLTH0E01694g"
FT                   /old_locus_tag="KLTH-ORF10103"
FT   CDS_pept        165164..165550
FT                   /locus_tag="KLTH0E01694g"
FT                   /old_locus_tag="KLTH-ORF10103"
FT                   /product="KLTH0E01694p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23125"
FT                   /db_xref="GOA:C5DH64"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH64"
FT                   /protein_id="CAR23125.1"
FT                   /translation="MPLINKKYFSTLLASSVLALFLGLTTDSKLTYFTSDHDKAAHFVV
FT                   FFLESWLFTKSLIPRRIKLLSHTVDKYILSLLVCAVGAGVGSEFAQAVLSRGRRQFDSL
FT                   DIVCNVCGGTLGVAVAGHAEFLWR"
FT   gene            complement(<165606..>166409)
FT                   /locus_tag="KLTH0E01716g"
FT                   /old_locus_tag="KLTH-ORF10100"
FT   CDS_pept        complement(165606..166409)
FT                   /locus_tag="KLTH0E01716g"
FT                   /old_locus_tag="KLTH-ORF10100"
FT                   /product="KLTH0E01716p"
FT                   /note="similar to uniprot|P47150 Saccharomyces cerevisiae
FT                   YJR113C RSM7 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23126"
FT                   /db_xref="GOA:C5DH65"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH65"
FT                   /protein_id="CAR23126.1"
FT                   /translation="MFALRRQLSPALWKNGPRLPASCVAVRHCELPNCIRFQSGTVDQR
FT                   TAEKASEDRSSLPDTEINSWLEAIESLRSEFTEQPYLPESSLAGPGQSKVNLLEEALNA
FT                   KKTFEPSEEQIAEWEVLKTVPLPERQDETLQHVTNMIMRHGKKQRAEKTLSRALYLVFC
FT                   YTRQDPIQLLKKALDDLAPMMVVKTFKTGVAKAAVIPVPLNARQRNRMAWKWIMEGANK
FT                   RVSSDFAVRLGEELISVFKGNSSGFDKRDQMHKTAIAHRAYIKLK"
FT   gene            <166653..>167789
FT                   /locus_tag="KLTH0E01738g"
FT                   /old_locus_tag="KLTH-ORF10099"
FT   CDS_pept        166653..167789
FT                   /locus_tag="KLTH0E01738g"
FT                   /old_locus_tag="KLTH-ORF10099"
FT                   /product="KLTH0E01738p"
FT                   /note="some similarities with uniprot|P38193 Saccharomyces
FT                   cerevisiae YBL046W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23127"
FT                   /db_xref="GOA:C5DH66"
FT                   /db_xref="InterPro:IPR015267"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH66"
FT                   /protein_id="CAR23127.1"
FT                   /translation="MMGIRSDFLYQSLTLMVVEKDASVLRKVEPQQLIPELLVHMTDTI
FT                   PHEIFQTGSDTESLVARLKFMGEHLTSQFANNHVYPFTMHRICEVCFHPLKYFKTHELG
FT                   KFVNALEKCCLVSSPLEEESETACEDVSDAGNVSLSKIPWVTQVDEKDLASFLREIEAT
FT                   VSANFGYEQDDDEGEEGDGLDISRNSDVQHNLLDDDDDDDDEDDEDYSDDLNDEEDAGS
FT                   GGGEDEEIIVEEQIEEDESYSDDETSNGSNEHRGEIEGAGAIDEGETTSEDEDTETSDA
FT                   LRKRKTTELDDFGERDSEVFPVNTTPKKKKHGLAGDASLAESPLFAQGTAVQSKSVEHQ
FT                   VSVLISPSTAIPPQPDKVAAVTDDGNETSPLSYKSSRR"
FT   gene            complement(<168037..>169383)
FT                   /locus_tag="KLTH0E01760g"
FT                   /old_locus_tag="KLTH-ORF10098"
FT   CDS_pept        complement(168037..169383)
FT                   /locus_tag="KLTH0E01760g"
FT                   /old_locus_tag="KLTH-ORF10098"
FT                   /product="KLTH0E01760p"
FT                   /note="similar to uniprot|P07256 Saccharomyces cerevisiae
FT                   YBL045C COR1 Core subunit of the ubiquinol- cytochrome c
FT                   reductase complex (bc1 complex) which is a component of the
FT                   mitochondrial inner membrane electron transport chain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23128"
FT                   /db_xref="GOA:C5DH67"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH67"
FT                   /protein_id="CAR23128.1"
FT                   /translation="MLRSATRSVFKRGLVTPASKPVVTELSNGIKVATLTNEQSAAATV
FT                   GVVFGSGSASENPYNNGVSNVLAHLFHSEGAQQAAKAGIQLSTKTARDYQSYVASFAAG
FT                   SGAVSKPLDLLQSHISAALESSSDAATAGALAKTAKEVAAFEASNHPGRVLEHLHATAF
FT                   QNTPLGLPVRGTVESIEALEKADLQTHARYHFHNSNAVIVGSGNVAHDELVKAVESQIS
FT                   LQSGDKPVEKKKSSFLGSEVRLRDDTLPKAWIAIAAEGEPVTSPNYYVAKVAAQVFGSY
FT                   AEAEPASRLQGVKLIDEVQEYHLCDSFDHYSLSYKDAGLWGFSAETSNIHQIDDLTHFT
FT                   LKQWNRLSISVTEQEVARAKSLLKLQLGSVAADSVKLAHSLGAETLALGAAPDLTRVFE
FT                   KIDNITVKDVKAWASDRLWDQDIAIAGTGKIEGLLDYMRLRNDMSMMRW"
FT   gene            <170763..>171386
FT                   /locus_tag="KLTH0E01782g"
FT                   /old_locus_tag="KLTH-ORF10089"
FT   CDS_pept        170763..171386
FT                   /locus_tag="KLTH0E01782g"
FT                   /old_locus_tag="KLTH-ORF10089"
FT                   /product="KLTH0E01782p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23129"
FT                   /db_xref="InterPro:IPR037738"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH68"
FT                   /protein_id="CAR23129.1"
FT                   /translation="MNQTPLLMSVSRQCLLAQKVRQKLIRCASPAKDTDIDLRLLVGHA
FT                   NLLDRLAREAADAAAAAVPYEATEQRTKSRHHVPKSSQSVLELENSDSESDSDADSDAD
FT                   ADEFWSSSDSDDDADSDDFYSESDGDSDLDPEEEADAEWDTQMGIAKYEAAGPYCLYKP
FT                   VSRYITTTTVVLSDEEDEDDEEPVCHDHTALRRFPAVEPALIRA"
FT   gene            <171881..>173620
FT                   /locus_tag="KLTH0E01804g"
FT                   /old_locus_tag="KLTH-ORF10084"
FT   CDS_pept        171881..173620
FT                   /locus_tag="KLTH0E01804g"
FT                   /old_locus_tag="KLTH-ORF10084"
FT                   /product="KLTH0E01804p"
FT                   /note="similar to uniprot|P27614 Saccharomyces cerevisiae
FT                   YJL172W CPS1 Vacuolar carboxypeptidase yscS expression is
FT                   induced under low-nitrogen conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23130"
FT                   /db_xref="GOA:C5DH69"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH69"
FT                   /protein_id="CAR23130.1"
FT                   /translation="MTNDYIPIDRPKPVQARRKWMITALAAFLTVCLCRLAYVTSHRAP
FT                   PAGQTLACDSVKTISELPVHKIQKLLDDKALYNQTLAKLQNAVRVPTEVYDTVVNPEID
FT                   ADDAVWAPFVEIHKQLARDFPAVWANLRVEKVNHYGLLITWEGSDSDLKPAMFAAHMDV
FT                   VPVERKTWSQWKHEPFSGDLTVDPDFGTLLWGRGSFDDKNMLIGVLQALEYMLTQEPEF
FT                   KPKRGVVVSVGFDEEIGGHFGAAYLTKILQERYGHKGMLSIIDEGVVGVKEIENVMIAA
FT                   PGIGEKGRIDLWFHLNTPGGHSSVPPDHTSIGIAAELISDIESEKFPATFAPQNPLSQY
FT                   YRCIAKNSDTMEKSLKRDFEFSMQDPKANSRVVEYLIETGGKKIEYLLRSTHAVDIIQG
FT                   GIKANALPETVSFLVDSRIAVDSSVAEVQDVFIKRAVKIAKKYDLGVVFEGEVLLPATP
FT                   NGNFNITLAGKPLEPAPPSPENDVWGIFAGSIKTFYEDVIFPKTFSEPRELVVGPSIMS
FT                   ANTDTAHYWDLTDNIYRYQPGFAMEDTLSTIHSVNEHINFDTVMHVVGFTYGYIHAVNK
FT                   FEK"
FT   gene            <173841..>174569
FT                   /locus_tag="KLTH0E01826g"
FT                   /old_locus_tag="KLTH-ORF10078"
FT   CDS_pept        173841..174569
FT                   /locus_tag="KLTH0E01826g"
FT                   /old_locus_tag="KLTH-ORF10078"
FT                   /product="KLTH0E01826p"
FT                   /note="highly similar to uniprot|P23724 Saccharomyces
FT                   cerevisiae YBL041W PRE7 20S proteasome beta-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23131"
FT                   /db_xref="GOA:C5DH70"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035202"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH70"
FT                   /protein_id="CAR23131.1"
FT                   /translation="MATTVASEYSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAG
FT                   DTRHTTDYSINSRYEPKVFDCGDNILISANGFAADGNALVKRFQNSLKWYHFDHNDKKL
FT                   SMRSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAA
FT                   SLIMPFLDNQVNFKNQYEPDSHGTKRKHVKFLTVEEVVQLVRDAFSSATERHIHVGDGV
FT                   EILIVTKEGVRKEFFELKRD"
FT   gene            complement(<174685..>175347)
FT                   /locus_tag="KLTH0E01848g"
FT                   /old_locus_tag="KLTH-ORF10075"
FT   CDS_pept        complement(174685..175347)
FT                   /locus_tag="KLTH0E01848g"
FT                   /old_locus_tag="KLTH-ORF10075"
FT                   /product="KLTH0E01848p"
FT                   /note="similar to uniprot|P18414 Saccharomyces cerevisiae
FT                   YBL040C ERD2 Integral membrane protein that binds to the
FT                   HDEL motif in proteins destined for retention in the
FT                   endoplasmic reticulum; has a role in maintenance of normal
FT                   levels of ER-resident proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23132"
FT                   /db_xref="GOA:C5DH71"
FT                   /db_xref="InterPro:IPR000133"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH71"
FT                   /protein_id="CAR23132.1"
FT                   /translation="MFNIFRISADLAHLASILILVHNIRKTRQIDGISLKTQVLYVLVF
FT                   CTRYLDLLTFRWRSVYNTLMKFVFIGSSVYVVSLIQKCRVTNPVAYRDMLVRDTFHIKY
FT                   LLAGSAVLALIFNYKFTFLEIFWSFSVWLESFAIMPQLFMISRSGKASTITSHYIFAMG
FT                   LYRALYIPNWIWRYSIDGRPLDKLSFCTGLIQTALYSDFFYVYYKKVVKGSGFQLPH"
FT   gene            complement(<175513..>176523)
FT                   /locus_tag="KLTH0E01870g"
FT                   /old_locus_tag="KLTH-ORF10074"
FT   CDS_pept        complement(175513..176523)
FT                   /locus_tag="KLTH0E01870g"
FT                   /old_locus_tag="KLTH-ORF10074"
FT                   /product="KLTH0E01870p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23133"
FT                   /db_xref="GOA:C5DH72"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH72"
FT                   /protein_id="CAR23133.1"
FT                   /translation="MLTPWLLLLSALYFGAKIALALSDVHTTPDAYEYLRSSQLPVLVM
FT                   VYMHGCRFCQELEPNFLFLERVFAGELALLKVDGKRAMTFSHDLNIRSFPELLLYGPGE
FT                   GAQAEAGSTLLGRYPSARDRDLGSLAMFVSERSALMAHWPHSSVRDVTQDPHAQLDALR
FT                   SEPLRVSVLVFVTPWMERRSLQLFNGEQSTCILDQLAETPELRENNVEIYRIDASNSTT
FT                   ALWTREFRVAVYPTIVLLAPDASGSQREIHVPLRAGDLELRNHEKDTLLRLVRHCAAGR
FT                   AADPDCLDFVRSYHGLRSLEPQGALPRNETQMAVEGPEFDFSSDDEQLFDSLRDL"
FT   gene            <177826..>178361
FT                   /locus_tag="KLTH0E01892g"
FT                   /old_locus_tag="Klth0E.mRNA.gf.411.p"
FT   CDS_pept        join(177826..177838,177910..178361)
FT                   /locus_tag="KLTH0E01892g"
FT                   /old_locus_tag="Klth0E.mRNA.gf.411.p"
FT                   /product="KLTH0E01892p"
FT                   /note="highly similar to uniprot|P00445 Saccharomyces
FT                   cerevisiae YJR104C SOD1 Cu Zn superoxide dismutase some
FT                   mutations are analogous to those that cause ALS
FT                   (amyotrophic lateral sclerosis) in humans"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23134"
FT                   /db_xref="GOA:C5DH73"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH73"
FT                   /protein_id="CAR23134.1"
FT                   /translation="MVKAVAVLRGDAGVSGTVHLEQKAENEPTTVSYEIAGFGSSGDHG
FT                   FHIHEFGDNTNGCTSAGPHFNPFKKTHGSPSDEVRHVGDLGNIAANDKGVCKGVLTDSL
FT                   VKLIGPTSVLGRTVVVHSGQDDLGKGGNEESLKTGNAGTRPACGVIGISN"
FT   gene            complement(<178565..>180295)
FT                   /locus_tag="KLTH0E01914g"
FT                   /old_locus_tag="KLTH-ORF10064"
FT   CDS_pept        complement(178565..180295)
FT                   /locus_tag="KLTH0E01914g"
FT                   /old_locus_tag="KLTH-ORF10064"
FT                   /product="KLTH0E01914p"
FT                   /note="highly similar to uniprot|P28274 Saccharomyces
FT                   cerevisiae YBL039C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23135"
FT                   /db_xref="GOA:C5DH74"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH74"
FT                   /protein_id="CAR23135.1"
FT                   /translation="MKYVIVSGGVISGIGKGVLASSTGMLLKTLGLRVTSIKIDPYMNI
FT                   DAGTMSPLEHGECFVLNDGGETDLDLGNYERYLGVTLTRDHNITTGKMYSHVISRERRG
FT                   DYLGKTVQVVPHLTDAIQDWIERVARIPVDDSGAEPEVCIIELGGTVGDIESAPFVEAL
FT                   RQFQFRVGKDNFSLIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLTPDMIACRCSEKLEE
FT                   HVINKIAMFCHVGPEQVVNVHDVNSTYHVPLLLLEQKMIDYLSARLKLSDIALNSEDKK
FT                   RGDNLLNRWRSLTTSIDESFECVKIALVGKYTNLKDSYLSVIKALEHSSMRCHRRLEIV
FT                   WVEASDLEPETTEHEKSKFHEAWNKLSAADGVLVPGGFGTRGTEGMVLAAKWARENNIP
FT                   YLGVCLGLQVATLEFARNVLGMKNVTSAEFDPDCAEEDQGVVYMPEIDKENMGGTMRLG
FT                   LRPTIFQAETEWSKLRKLYGGSHEVHERHRHRYEVNPKLVPRLEEQGLMFVGRDESGER
FT                   CEILELRNHPYFVATQYHPEYMSKVLDPSQPFLGLMAASAGILDEMLANDTRSNERAEF
FT                   "
FT   gene            complement(<181119..>181727)
FT                   /locus_tag="KLTH0E01936g"
FT                   /old_locus_tag="KLTH-ORF10058"
FT   CDS_pept        complement(181119..181727)
FT                   /locus_tag="KLTH0E01936g"
FT                   /old_locus_tag="KLTH-ORF10058"
FT                   /product="KLTH0E01936p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23136"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH75"
FT                   /protein_id="CAR23136.1"
FT                   /translation="MESRLQELEERHVSVYRELLTALDELYLLRKGIQPEDETLLVVRR
FT                   KLQSSLTMTAPMMSAMNGKTALDKRLTRLMKENHELDAEVAAHQDEKLRLLRELSDERM
FT                   RYKELVNNARELTERQAHAQGIGEQRMPRGRQDANKSTDSDLYDSSEQGDSTEAGSEQR
FT                   DKAQIERENEALRELLVGMIVHGGYLGTNKVFDEWLGDL"
FT   gene            <181815..>182357
FT                   /locus_tag="KLTH0E01958g"
FT                   /old_locus_tag="KLTH-ORF10056"
FT   CDS_pept        181815..182357
FT                   /locus_tag="KLTH0E01958g"
FT                   /old_locus_tag="KLTH-ORF10056"
FT                   /product="KLTH0E01958p"
FT                   /note="similar to uniprot|P47142 Saccharomyces cerevisiae
FT                   YJR102C VPS25 Component of the ESCRT-II complex, which is
FT                   involved in ubiquitin-dependent sorting of proteins into
FT                   the endosome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23137"
FT                   /db_xref="GOA:C5DH76"
FT                   /db_xref="InterPro:IPR008570"
FT                   /db_xref="InterPro:IPR014041"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH76"
FT                   /protein_id="CAR23137.1"
FT                   /translation="MTEKLPPIYNFPPLYTCQPNVLIREQQLSTWCDLILDFAKTNNAW
FT                   CMSQEGTVIKDSESSGQSIFRNESIQRSISVPFRDQIWNKMVQSEKAIKSNNGVFFILW
FT                   RSVDYWSSQILQWFETTGKVNQVVTVYELLEGDETLGWEFHGMHPSLCEESLQKLRDRG
FT                   RATLLKEQNKIMGVKVV"
FT   gene            complement(<182400..>183158)
FT                   /locus_tag="KLTH0E01980g"
FT                   /old_locus_tag="KLTH-ORF10055"
FT   CDS_pept        complement(182400..183158)
FT                   /locus_tag="KLTH0E01980g"
FT                   /old_locus_tag="KLTH-ORF10055"
FT                   /product="KLTH0E01980p"
FT                   /note="similar to uniprot|P47141 Saccharomyces cerevisiae
FT                   YJR101W RSM26 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23138"
FT                   /db_xref="GOA:C5DH77"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH77"
FT                   /protein_id="CAR23138.1"
FT                   /translation="MFRFASKRSIHSVPKLKNSGHVLEQGIPNVLSASGFNIAWTQQQK
FT                   YLCDKLTLATAGTSQESYLPFHLILNTAKKPFQTNIFNLASAAHNNHLFVENVLPGPAN
FT                   TAPSRLFRTRIEEQYNCTWEEFKTEMVRRAETDVVGQGWLFLVENSDKELHILTVQNNG
FT                   TPYYFPRNQSFDLNSALKLEEYSQLDAVRTIVKKGGKIQDWTMPLIAVSLWDHAYLHDY
FT                   GVKGRSQYVKNVLDNLNWTVVNNRLYTGPA"
FT   gene            <184381..>185367
FT                   /locus_tag="KLTH0E02002g"
FT                   /old_locus_tag="KLTH-ORF10054"
FT   CDS_pept        184381..185367
FT                   /locus_tag="KLTH0E02002g"
FT                   /old_locus_tag="KLTH-ORF10054"
FT                   /product="KLTH0E02002p"
FT                   /note="similar to uniprot|P47140 Saccharomyces cerevisiae
FT                   YJR100C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23139"
FT                   /db_xref="GOA:C5DH78"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH78"
FT                   /protein_id="CAR23139.1"
FT                   /translation="MFRRAFNRRWYSPLPRVVRHRPVPRAGRTTNAIYDATPSRGANEL
FT                   GSTRSIIQPHHPVATTILNEPTVVIERQIEMMNVFLGFEQANKYVIMDALGNRIGYMQE
FT                   RDFSIAKAVMRQFYRLHRPFVVDVFDNWGNLLLTIKRPFSWINSHIKAILPDDASPQQS
FT                   LGSSSVDVAPFGSGPVPKSTSTFGEGGILVGESVQNWHLWRRRYELFEREAPTEDSFSQ
FT                   FAEIDAPFLSFEFALKDEVGKTMGGVDRNWVGLGRELFTDTGVYIVRMDSQQSLQGVLP
FT                   AEIISDRILNLDQRAVLLANAVSIDFDYFSRHSRHGGGFIGFGDYGE"
FT   gene            <185547..>186506
FT                   /locus_tag="KLTH0E02024g"
FT                   /old_locus_tag="KLTH-ORF10052"
FT   CDS_pept        185547..186506
FT                   /locus_tag="KLTH0E02024g"
FT                   /old_locus_tag="KLTH-ORF10052"
FT                   /product="KLTH0E02024p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23140"
FT                   /db_xref="GOA:C5DH79"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR017390"
FT                   /db_xref="InterPro:IPR036959"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH79"
FT                   /protein_id="CAR23140.1"
FT                   /translation="MSWNTIESDAGVFTQLIRDLGVSGVQFAEIPMLDSLEELAPSLYG
FT                   VIFLFKYNSSDYAGNEPVQGAYDFDYPDSLFFANQTIQNACGTLAVLNTLLSLSNDFPE
FT                   EIRLGDTLSEFISFTAAFKDPVLRGESVSNSDHIRNVHNSFSTPEPFVLDEKTPDDGRK
FT                   AAEVFHFVSFVEHEGVLYELDGLRPTPIVHREYSNDSRDRLTFAQNIISVLQKRMQLCV
FT                   NSGGKFSVIAIHRDAIERLEDLRQQGAITDQDYQLECSRELQKRETWAKELSMRRQNLY
FT                   GLIFELLKQVSSSMTDEEFADHIKIAQKTTLERLKRRN"
FT   gene            <187098..>188762
FT                   /locus_tag="KLTH0E02046g"
FT                   /old_locus_tag="KLTH-ORF10050"
FT   CDS_pept        187098..188762
FT                   /locus_tag="KLTH0E02046g"
FT                   /old_locus_tag="KLTH-ORF10050"
FT                   /product="KLTH0E02046p"
FT                   /note="similar to uniprot|Q07109 Saccharomyces cerevisiae
FT                   YPR045C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23141"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH80"
FT                   /protein_id="CAR23141.1"
FT                   /translation="MDGAHHIPSKREVQISPSMKDQHGLSQVFDIDDVRERRMKKGGKK
FT                   YNQVQPVALGQSRKIPSSENRKAMSEKEKTELLQRIIGGGSQQFPSGMREFILGCFQLA
FT                   EQHKFDQSAHMLLVQQLKDLISKAYTEKKEYINDWWSQTIPCLTKSRTELVLACDKPSR
FT                   KPSAPVSSPRQSSLPPPPPPPPPSQEAVRGTLRVPPPPPTVDMARRQNSNTVAPDRLAS
FT                   RSRGSTELERRRKRMERFSNDSTGSKKSKVTSDENFANLNAISTNFYKFDKNKPVVGRC
FT                   QTLEKKYLRLTSEPNPDLVRPLNVLKKAYDSILEKHTKGEASYAYLCDQFKSMRQDLRV
FT                   QIIENQFALKVYQTHARLALQNNDIGEFNQCQSRLGQLFELPNLPNSNLEEFVSYRILY
FT                   YLMMNNQNSINELKLKYMTAENLAVYRHPIVRHALKMANSLLMDDYHSFFKLYAETSGP
FT                   TRCLVDTFISRERLRALNTISKSYNQIPLPFLFKELQLQSFDEGVEFIEQLGLSQYVSY
FT                   KNKGQEGELATLNTKTSRFSIIQQFEKSKRVDIKGQI"
FT   gene            complement(<188805..>189506)
FT                   /locus_tag="KLTH0E02068g"
FT                   /old_locus_tag="KLTH-ORF10049"
FT   CDS_pept        complement(188805..189506)
FT                   /locus_tag="KLTH0E02068g"
FT                   /old_locus_tag="KLTH-ORF10049"
FT                   /product="KLTH0E02068p"
FT                   /note="similar to uniprot|P35127 Saccharomyces cerevisiae
FT                   YJR099W YUH1 Ubiquitin C-terminal hydrolase that cleaves
FT                   ubiquitin-protein fusions to generate monomeric ubiquitin
FT                   hydrolyzes the peptide bond at the C-terminus of ubiquitin
FT                   also the major processing enzyme for the ubiquitin-like
FT                   protein Rub1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23142"
FT                   /db_xref="GOA:C5DH81"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR036959"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH81"
FT                   /protein_id="CAR23142.1"
FT                   /translation="MSLPRSVVPLESNPEVFTRFAHELGLSPEYAVHDIYSLTEPDLMA
FT                   FLPRPMKAIVLLFPINDVYESSKDTSTRNEGASQASPIWFKQTVKNACGLYALLHSLAN
FT                   NPDTLQENSKISHFLSSNPRPDNRFADEKTDEFIVSISELYNKNSSYGQTAVPQAEDEV
FT                   NLHFITYVKSGDYIFEMDGRRNGANLLGTSSSQDLLEEPLVRERVEWYMNNADENMKLS
FT                   FSLLGLAPSWD"
FT   gene            <189685..>190230
FT                   /locus_tag="KLTH0E02090g"
FT                   /old_locus_tag="KLTH-ORF10047"
FT   CDS_pept        189685..190230
FT                   /locus_tag="KLTH0E02090g"
FT                   /old_locus_tag="KLTH-ORF10047"
FT                   /product="KLTH0E02090p"
FT                   /note="similar to uniprot|P40993 Saccharomyces cerevisiae
FT                   YDR478W SNM1 Subunit of RNase MRP, which cleaves pre-rRNA;
FT                   not shared between Rnase MRP and nuclear Rnase P, in
FT                   contrast to all other Rnase MRP protein subunits; binds to
FT                   the NME1 RNA subunit of Rnase MRP"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23143"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH82"
FT                   /protein_id="CAR23143.1"
FT                   /translation="MSLNRQQREKFMASHICHKYNLLHVLPGIGQSQLSGLYLKSFYNG
FT                   VKRNQLQLPEPLVNGSKFCDSCGVVYIAGVNLDMKVQEAENDGVGAKSLVYTCRNCGKH
FT                   KHFQISVKIREPTPKPAEAFVAKWPAKKDESKVKKLTGKERAKKRKLDSLSSMLSRKRE
FT                   EEESKKKLSLSLDDFLQK"
FT   gene            complement(<190315..>191943)
FT                   /locus_tag="KLTH0E02112g"
FT                   /old_locus_tag="KLTH-ORF10045"
FT   CDS_pept        complement(190315..191943)
FT                   /locus_tag="KLTH0E02112g"
FT                   /old_locus_tag="KLTH-ORF10045"
FT                   /product="KLTH0E02112p"
FT                   /note="similar to uniprot|Q03370 Saccharomyces cerevisiae
FT                   YDR479C PEX29 Peroxisomal integral membrane protein,
FT                   involved in regulation of peroxisome size and number;
FT                   genetic interactions suggest that Pex28p and Pex29p act at
FT                   steps upstream of those mediated by Pex30p, Pex31p, and
FT                   Pex32p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02112g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23144"
FT                   /db_xref="GOA:C5DH83"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH83"
FT                   /protein_id="CAR23144.1"
FT                   /translation="MDSVAGFFWDDAATKRRRSSHNDPADGAKPSLSNERKGSVGSLQG
FT                   QGGVGSVSQNYLADKLVEKLIYMALPPSSELAKKTIEHRVEASRNRPGLSVPIMSRNFV
FT                   QLNSRLGPPFQVIDEVIKIFNWTNTAYTLSVLSLFTYTVMKPLPTLTSIPIFYLLFGVM
FT                   VPQYLKIHKPDSSLVFASNPVPATGPPLVKAEVPKPVPEFSKEFILNLTDLQNHMLLYV
FT                   SAFDFVNGILARFAFFTDESTSSAAFLALLVLAWFNALFMDTLSRFIPLKSLLIISGWA
FT                   LALALHPRYRDHFLSKIYSEETRLRALMISSKVEKRVNEYFQYREPRELRQASIFEVQK
FT                   LDTSIKTWGLVGYSTDHYALFSDYRISEKGLEDASHTLEEVKAPLEWEWTKGSKWVQDL
FT                   DPVSWVASEFVDYVDIDVEAKWVYDACLDGSRGDYRRRRWIRQCTRIAEQISVSENTSS
FT                   DTTDDVYQQGQFNGYASSFAPETVSGSTGVPKLQKDQPVAASSIPKSNSVGSASSVGSK
FT                   TTASESGKASSSKAAKSLTDLLNLT"
FT   gene            <192040..>193065
FT                   /locus_tag="KLTH0E02134g"
FT                   /old_locus_tag="KLTH-ORF10043"
FT   CDS_pept        192040..193065
FT                   /locus_tag="KLTH0E02134g"
FT                   /old_locus_tag="KLTH-ORF10043"
FT                   /product="KLTH0E02134p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23145"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH84"
FT                   /protein_id="CAR23145.1"
FT                   /translation="MLNHICTKTLKFKTSLARKVRHQRPNCKLGMQFECLKNVPEDLVS
FT                   SLLVSDRTPHINVTAWDGTVSLYDYNANELVVRMKHTDPLLCSAWLEHGSKKYAGSVAG
FT                   EVLEVDMESGKFHLVSDAAELGISAMRCSENDVLAGSWDGSLQALDTRSGKAWFTVRHE
FT                   NRKVLALDCAGNTVVVATTGGKVTIYDLRNMHNPKLQESGLKFQTRDIKLMPSGGGYVQ
FT                   SSLDGRVAVEYFGQDSSRFAFRCHRMNLSDTQFVFPVNALCFNRSDELLYTGGSDGRVF
FT                   SWNLTTRKKSEELPKFEDSVLKLGCNDDVFCVATGDDSFKTLATIQDADVQPGKIYYTK
FT                   L"
FT   gene            complement(<193083..>194579)
FT                   /locus_tag="KLTH0E02156g"
FT                   /old_locus_tag="KLTH-ORF10042"
FT   CDS_pept        complement(193083..194579)
FT                   /locus_tag="KLTH0E02156g"
FT                   /old_locus_tag="KLTH-ORF10042"
FT                   /product="KLTH0E02156p"
FT                   /note="similar to uniprot|Q07015 Saccharomyces cerevisiae
FT                   YDR257C SET7 Nuclear protein that contains a SET-domain
FT                   which have been shown to mediate methyltransferase activity
FT                   in other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23146"
FT                   /db_xref="GOA:C5DH85"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH85"
FT                   /protein_id="CAR23146.1"
FT                   /translation="MDTSEFETKTNNFLRWASKDAKLWISDKVKLLGTRDGDQGRYMVA
FT                   TQEIIKGEKLFEVPRGSALNVATLSLSMRDKQVYKKLTTEVGHWEGLVIAILYEFKVMN
FT                   QNSKWWPYFEVLPEPARLNSLMYWTGAELEYLKPSGVYERVDREGAEEMYARVMKCAED
FT                   LKITELTNITWEEFMHVASIIMAYSFDMERPDYEDSDEEVEESDEEEEEEKNTVWNDGY
FT                   FKSMVPMADMLNSDTHKCNANLTYSPEALIMVAVADIPSGEQIYNNYGEYPNSELLRRY
FT                   GYVEWSGSKFDCGEMPLETLLKAIEVCLEAPRRLIDKLVEILSHDNDIVEDILEGEPLV
FT                   MESYDCFLDGQVVPECATLVQILTIALQLPDVQQYDEKTLSGYLQRIIKRAIKTVNSVK
FT                   ITKKCLQVWKTASDARLQDYPSHSFREPSPDHVALTGDSLRRRMAECVLQSEVQSFQNC
FT                   FSSLEQRSKVIEDQQLLDMVLKRKQTAEKGSQKQQKRLKK"
FT   gene            <194914..>196695
FT                   /locus_tag="KLTH0E02178g"
FT                   /old_locus_tag="KLTH-ORF10038"
FT   CDS_pept        194914..196695
FT                   /locus_tag="KLTH0E02178g"
FT                   /old_locus_tag="KLTH-ORF10038"
FT                   /product="KLTH0E02178p"
FT                   /note="highly similar to uniprot|P15705 Saccharomyces
FT                   cerevisiae YOR027W STI1 Heat shock protein also induced by
FT                   canavanine and entry into stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23147"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH86"
FT                   /protein_id="CAR23147.1"
FT                   /translation="MSAEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRS
FT                   ACFTSLKKFNEALNDANECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTS
FT                   NKAAQDGLEQVQKAQKSQQQPDLGFGQMFSDPNMIEKLKNNPKTAELMKDPQLVSKVLQ
FT                   FQSNPQMMGPEILQDPRMMTIMAAMLGVDLSIGGDSNGQEPAAPSKEAPATKETASEAE
FT                   SAKPAPEAKAAPSASSAEASSSATADAGPMEVDEPQPEQDSKKNADAEKAEGNKFYKAR
FT                   KFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQGREMRADYKLI
FT                   SKSFARIGNAYLKLEDFKKAIEFYQKSLTEHRTPDILTKLRNCEKEQKVREAQAYIDPE
FT                   KAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDC
FT                   DMAISKDPNFIRAYIRKATAQIAVREFASAIETLDAARAKDTELNNGANVREIDQLYIK
FT                   ASQQRFQPQDPNETPEQAYARALKDPEVASIMQDPVMQSILSQAQQNPAALQEHMKNPE
FT                   VFNKIQTLIAAGIIRTR"
FT   gene            complement(<197021..>199363)
FT                   /locus_tag="KLTH0E02200g"
FT                   /old_locus_tag="KLTH-ORF10034"
FT   CDS_pept        complement(197021..199363)
FT                   /locus_tag="KLTH0E02200g"
FT                   /old_locus_tag="KLTH-ORF10034"
FT                   /product="KLTH0E02200p"
FT                   /note="highly similar to uniprot|P33416 Saccharomyces
FT                   cerevisiae YDR258C HSP78 Oligomeric mitochondrial matrix
FT                   chaperone that cooperates with Ssc1p in mitochondrial
FT                   thermotolerance after heat shock; prevents the aggregation
FT                   of misfolded matrix proteins; component of the
FT                   mitochondrial proteolysis system"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23148"
FT                   /db_xref="GOA:C5DH87"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH87"
FT                   /protein_id="CAR23148.1"
FT                   /translation="MLRLARTSALRASLARTATAASTRAAMASPARRLSALRVPATRFT
FT                   RPCNQYRTYVSLNMNNQEPQKPALEQFGTNLTQLAQEGKLDPVIGRDEEIARAIQILSR
FT                   RTKNNPVLIGRAGVGKTSLIDGLAQRIVSGQVPDSLKNKKLVTLDLGSLVAGAKYRGEF
FT                   EERLKNVLEEIDKSNGEVIVFIDEVHMLLGLGKTDGSMDASNILKPRLAKGLRCISATT
FT                   IDEFKIIEKDPALSRRFQPIMLNEPNVADTISILRGLKERYEVHHGVRITDSALVSAAT
FT                   LSNRYINDRFLPDKAIDLVDEACAVLRLQHESKPDAIQSLDRAIMRIQIELESLKKETD
FT                   PVSLERRTALEDELELKRKEHARLTEIWEKEKAEIESIKTAKADLEQARIDLEITQREG
FT                   NFAKASELRYAKIPELERRVARNAQKDAKENLLHDSVSSDDISNVIAKMTGIPMETVLK
FT                   GDKDRLLYMEDSLRKRVVGQDEAIDAVSDAVRLQRAGLTSEKRPIASFMFLGPTGTGKT
FT                   ELTKALAEFLFDNESNVIRFDMSEFQEKHTVSRLIGAPPGYVMSESGGQLTEAVRRKPY
FT                   AVVLFDEFEKAHPDVCKVLLQVLDEGKLTDSQGHQVDFRNTIIVMTSNIGQDILLSDTE
FT                   LGNDGKVSKATQERVIEAMKKSYPPEFINRIDDVLVFNRLSKDVLRSIVDIRIEEIQER
FT                   IADKRMKLNISDAAKEWLTDNGYDQLYGARPLNRLIHKRILNSMAMYLLRGQIRPEETV
FT                   NVDVKDGKLVVEPNHEEGEVVPAKDEA"
FT   gene            complement(<199706..>200500)
FT                   /locus_tag="KLTH0E02222g"
FT                   /old_locus_tag="KLTH-ORF10027"
FT   CDS_pept        complement(199706..200500)
FT                   /locus_tag="KLTH0E02222g"
FT                   /old_locus_tag="KLTH-ORF10027"
FT                   /product="KLTH0E02222p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23149"
FT                   /db_xref="GOA:C5DH88"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH88"
FT                   /protein_id="CAR23149.1"
FT                   /translation="MSNQSLPQMQGVQVLPSLNMRGGGAVNAAPGTGGATAQQQQQQQQ
FT                   QQHQHQQQLQAAVQPPQPQLQTGLVPHGALSAQGQHPGGLALPHPGQPLSMPYIPQVGP
FT                   HLGLSLGALGGVSGVSGAVNGVRVTSSSATPQPPGAGAGPAAGAAGGAAADARASEGEH
FT                   LDNSTGQLIGKSGKPLRNTKRAAQNRNAQKAFRQRRERYIKDLEVKAKEYDRMDAQTAA
FT                   LVQENESLKRYVLELEQRLGVRRAASTVGLPHEAHPAIKPPE"
FT   gene            complement(<200939..>201328)
FT                   /locus_tag="KLTH0E02244g"
FT   CDS_pept        complement(200939..201328)
FT                   /locus_tag="KLTH0E02244g"
FT                   /product="KLTH0E02244p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23150"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH89"
FT                   /protein_id="CAR23150.1"
FT                   /translation="MYRDSHFQSHHMLRSHHVLYLDWNNDVFTAPDQPVSNAPRAGSSA
FT                   LPINPFWDYFHDDDDWDRFHPLQVDCSGQLTAMPPLVPTPTALGSLFAPRRAELGAWRD
FT                   TGDLTSADLADRDPDAQAQGQGPDA"
FT   gene            <201608..>201680
FT                   /locus_tag="KLTH0E02266r"
FT                   /old_locus_tag="Klth0E.tAla.CGC.3"
FT   tRNA            201608..201680
FT                   /locus_tag="KLTH0E02266r"
FT                   /old_locus_tag="Klth0E.tAla.CGC.3"
FT                   /note="tRNA-Ala (CGC) cove score=68.35"
FT   gene            <201991..>202062
FT                   /locus_tag="KLTH0E02288r"
FT                   /old_locus_tag="Klth0E.tAla.CGC.4"
FT   tRNA            201991..202062
FT                   /locus_tag="KLTH0E02288r"
FT                   /old_locus_tag="Klth0E.tAla.CGC.4"
FT                   /note="tRNA-Ala (CGC) cove score=79.87"
FT   gene            <202124..>203809
FT                   /locus_tag="KLTH0E02310g"
FT   CDS_pept        202124..203809
FT                   /locus_tag="KLTH0E02310g"
FT                   /product="KLTH0E02310p"
FT                   /note="some similarities with uniprot|Q99234 Saccharomyces
FT                   cerevisiae YOR030W DFG16 Probable multiple transmembrane
FT                   protein involved in invasive growth upon nitrogen
FT                   starvation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02310g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23151"
FT                   /db_xref="GOA:C5DH90"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH90"
FT                   /protein_id="CAR23151.1"
FT                   /translation="MLSSRHVRIAWARCGSLQLLTHLSRAHPRCCTPRTPLSPPPPPHS
FT                   RLSRAMLRYAEDNTEGYQDGLETLLNLLRIEMGSDRWANCSVRMLNSGNLLLRNASTGQ
FT                   MCNRSSSSPSFFVWCADNSTLEYKALVDVLRNHTLPTFGVQIEKDGFSAGCLMASFILC
FT                   IVCAGSWMLLLVLLLLPANNHNHRKKMVYLGVVYQAIWHTVILDRSMDTVFEEQYMGNY
FT                   QNAGALYDNVMTSTLYSVMLFFATVISNLNWLDIVYYMFHNYRKTNSSWVPRLFNNRNK
FT                   RIIAVGVALTCAQAVLKAVKLWGARRYVGTVDVVLRSVDFTIYTLFSLSVAYYVWHDFG
FT                   FTLEPQKQQRARSWRALFVFIWNDYHETVLLLFYNAVVMASLYMCTILIMTMPRHVFTW
FT                   MQSLISFLNVLVTVNTWGLIGVLERRERTLSKETVLGRKINNRDKFFVDPKVDYDHGDG
FT                   LVVSDDLGLAPDAATVQNSVHRRFGLDPVLRPAKVLRSKLAAKRRRGENASRSRHEGST
FT                   FEIQSMRHSIGERRASADQDWAQGGDNESAETLLTRNYIYDHDG"
FT   gene            <204114..>204184
FT                   /locus_tag="KLTH0E02332r"
FT                   /old_locus_tag="Klth0E.tGly.GCC.5"
FT   tRNA            204114..204184
FT                   /locus_tag="KLTH0E02332r"
FT                   /old_locus_tag="Klth0E.tGly.GCC.5"
FT                   /note="tRNA-Gly (GCC) cove score=62.63"
FT   gene            <204306..>205139
FT                   /locus_tag="KLTH0E02354g"
FT                   /old_locus_tag="KLTH-ORF10013"
FT   CDS_pept        204306..205139
FT                   /locus_tag="KLTH0E02354g"
FT                   /old_locus_tag="KLTH-ORF10013"
FT                   /product="KLTH0E02354p"
FT                   /note="weakly similar to uniprot|Q12331 Saccharomyces
FT                   cerevisiae YDR262W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23152"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="InterPro:IPR040200"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH91"
FT                   /protein_id="CAR23152.1"
FT                   /translation="MKILNKPFSVGVLCTIPFLLACMVDGKNVANLDIVLDKQTGKLKR
FT                   QLPSLHARDGSLLRRDPKRLPLDLEDLFEGKLDKRSERETDRQEFFINHGQEGNADQGE
FT                   PSDPICLDSRIPSMNEISIFGSYLRDDITMSRIIEDPLEDVIIFAPSDSAIESLPLKPW
FT                   QFPADVSDIESGAEDEEAVDKLVSSNIRHFVNSHIATGTSIDKARSMKKCMGGSVVLRS
FT                   FAFEGDENSGDIMLKKKRGKYYVASSLDKKFQKVKRVERAQNGLILVIDATLISP"
FT   gene            complement(<205420..>207708)
FT                   /locus_tag="KLTH0E02376g"
FT                   /old_locus_tag="KLTH-ORF10010"
FT   CDS_pept        complement(205420..207708)
FT                   /locus_tag="KLTH0E02376g"
FT                   /old_locus_tag="KLTH-ORF10010"
FT                   /product="KLTH0E02376p"
FT                   /note="some similarities with uniprot|Q12398 Saccharomyces
FT                   cerevisiae YOR032C HMS1 C2H2 zinc-finger protein with
FT                   similarity to myc-family transcription factors;
FT                   overexpression confers hyperfilamentous growth and
FT                   suppresses the pseudohyphal filamentation defect of a
FT                   diploid mep1 mep2 homozygous null mutant"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23153"
FT                   /db_xref="GOA:C5DH92"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH92"
FT                   /protein_id="CAR23153.1"
FT                   /translation="MTSMGFNSGFSEAEMFLATLQSEDSSDGDKSDYNGYGLLQESPDQ
FT                   SMGNYGAWNNKQEPNLTPESFHSGVADLAEPRAPTRPAQDVQAGPGGVSATPLQQISSF
FT                   GSSSSYANGFDVSAGVNAGAPDSAVRIKEDASPELSLEPHELRELLADGSHEAQAGSVG
FT                   GPGCSKVFKPKRERTSHNVIEKKYRTNINDKILQLRDIVPTLRVATKREAGLMITAEDH
FT                   EELDGLDPARKLNKASILVKTIEYIRHLENKCEAYKYENTKLRSGQAFTTPESDRHASA
FT                   GYSELAPTGIQQAPTQSTPYANAYPTTSKDMTSQFLMGGLALTMGASCFGEGNDYDNAK
FT                   GLMSLPVFHYSPASGFTMTNANGVINLPTALLSLFRIFLLFATAFHLLSSLALRFRQGK
FT                   DKTREFPVVQFADTVCLGTGLVDTLKKTMIINRLKYPVNSIERIESEIANCFALKLYNP
FT                   SFPLNVLAARHIDFTWSKIKEQVETANKRSKGALKNGIEWEMITNVLTTSKDDTLSRGQ
FT                   LLEALARKGTFTLEGLVEFINNFLVKTRNESVVVDLLEETCASERPIKEVVENVFETEV
FT                   FNNEKLQLSSDNFVMLRCLFENTESNIDSLLKLVKANTGLGSEKGFNHDQVLVLYSSIV
FT                   QNLISQNQLKQAYHWVSKISPELVNTEEVSIVGVAAVFLLLRSLRENDADENVQSIYPR
FT                   LESLSGKLRVWLGSATGGCLNLGLRGKLVDFCVDTTLKCGMTAAKELEEDTDVEEDLDE
FT                   VSDDEAGDL"
FT   gene            complement(<209336..>211333)
FT                   /locus_tag="KLTH0E02398g"
FT                   /old_locus_tag="KLTH-ORF10002"
FT   CDS_pept        complement(209336..211333)
FT                   /locus_tag="KLTH0E02398g"
FT                   /old_locus_tag="KLTH-ORF10002"
FT                   /product="KLTH0E02398p"
FT                   /note="some similarities with uniprot|P39875 Saccharomyces
FT                   cerevisiae YOR033C EXO1 5'-3' exonuclease and flap-
FT                   endonuclease involved in recombination double-strand break
FT                   repair and DNA mismatch repair member of the Rad2p nuclease
FT                   family with conserved N and I nuclease domains"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23154"
FT                   /db_xref="GOA:C5DH93"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR032641"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR037315"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH93"
FT                   /protein_id="CAR23154.1"
FT                   /translation="MGIQGLLPQLKPIQQPITLIRYDGQTLAIDGYAWLHRAAHSCAEE
FT                   LALGRPTSKYLEFFIKRLNMLRNRFNINPYLVFDGDAIMVKKDTELKRKQKRAENKERA
FT                   LALWKAGDKRQAYDYFQKCVDVTPEMAKCVIEYCQVQDIKYIVAPFEADAQMVYLEKKG
FT                   LVHGIISEDSDLLIFGCRKLITKLTDHGEGIEICRDDFPRLPSKFPLSQLCPEETRAMV
FT                   CLSGCDYTAGIPKIGLLTAMKLVRKHKTMDNIIKNIQREGKFVVPKEFLEEYQLASFAF
FT                   QFQRVYCPENGMMTTLSEIPEELRNCQALFSCIGKVISKSEHTKVVIVDDSEVDHHLHG
FT                   RIAAGELCPYNFQKILVNRERKLQLTTKSEPIIGKPLASQAGSIDTFFSKTASVSVSST
FT                   STGVTTQMRFAIKKQEEKLIENERKIASAVERRKLFRRDTPVVAGVGMSRYFGKSQDHP
FT                   TNEEKDVTSTMATPTPVEPLISPRLPDFTKASTNSNFASCSNESLGSQDEAATDIPSSL
FT                   LSTEVPSSMVPTQVDMESSPYSEEDSEVLSEIEDTAEARRDEKASNKRHCNSIADLRES
FT                   FSYHRAPLQDKSVNVASGNGLLRNSKGAKSHVSAVKAPSLGLNSHVGAVKAPSLGTKRP
FT                   RHYVASPSSATAPRQATRTLSLSDFIYRGQ"
FT   gene            complement(<211548..>213752)
FT                   /locus_tag="KLTH0E02420g"
FT                   /old_locus_tag="KLTH-ORF9999"
FT   CDS_pept        complement(211548..213752)
FT                   /locus_tag="KLTH0E02420g"
FT                   /old_locus_tag="KLTH-ORF9999"
FT                   /product="KLTH0E02420p"
FT                   /note="similar to uniprot|P39010 Saccharomyces cerevisiae
FT                   YDR264C AKR1 Palmitoyl transferase involved in protein
FT                   palmitoylation acts as a negative regulator of pheromone
FT                   response pathway required for endocytosis of pheromone
FT                   receptors involved in cell shape control contains ankyrin
FT                   repeats"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23155"
FT                   /db_xref="GOA:C5DH94"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH94"
FT                   /protein_id="CAR23155.1"
FT                   /translation="MGTVEEGTESQTTNVDPNSQASVTSLEPIAPANSNPASTSDISLG
FT                   ANESSTHNQNPELQEYRDACQSGDLAKVKEMVELGLIDITHDYHEDEMVSGLHWASINN
FT                   RLGVAKYLVGKGADVNFKGGNLKATPLHWAARYGYVYIVDFLLESGADPTLTDHQGFNL
FT                   LHLSINSSNIMLVLYVLFFVVGDKISIDCVDPDNRTPILWAAYQGDSLSVKALLDFKAD
FT                   FRIADNGGFTPLHWATVKGQPQVLKHLIENGGDFLQNTNDNKNCFVISQEMRTEHSLTN
FT                   ALLESGFNAEGVPIIKLFKNPQHAKLLTFVTPWILVGLILKIMATLNTFVAITFTVLIG
FT                   WASTKILKKFVIPSYSLRQGGNAFLKTPFLAGLLFGSVIWVFYVWLTRVLPATVFDEPL
FT                   ANALFFVFLTVCLGLFGSLVLSDPGRITKEQELEPVRIAIKELLRIGKFDTRHFCVDTY
FT                   KRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVSCFFIACIE
FT                   YFDFLEDESKTDFKCGIFDDEICAGFHLDTFAFLVLSWTLIQAVWVFFLIAVQLFQTFK
FT                   GITNQELNSASRKRHARDSGNEFFTTTPTDLMDAEDLEALNQPALDSEEASQLKPRTCG
FT                   GVCFGLIGLDQIVLVVKGFFGGSRNLQLSHRPSHLSFETNYGWRTNLKDFWLLSDTTAP
FT                   LWQRLLYSQRGFKALLGGTEVDYQKLYTLPSPRFLADEMV"
FT   gene            complement(<213949..>216135)
FT                   /locus_tag="KLTH0E02442g"
FT                   /old_locus_tag="KLTH-ORF9996"
FT   CDS_pept        complement(213949..216135)
FT                   /locus_tag="KLTH0E02442g"
FT                   /old_locus_tag="KLTH-ORF9996"
FT                   /product="KLTH0E02442p"
FT                   /note="similar to uniprot|P51534 Saccharomyces cerevisiae
FT                   YOR035C SHE4 Protein containing a UCS (UNC- 45/CRO1/SHE4)
FT                   domain binds to myosin motor domains to regulate myosin
FT                   function involved in endocytosis polarization of the actin
FT                   cytoskeleton and asymmetric mRNA localization"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23156"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024660"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH95"
FT                   /protein_id="CAR23156.1"
FT                   /translation="MDVQKLAKRLNESCKVQIDAEDYIRGIDLIFEDSPAEKLEQGQIL
FT                   VRAFQDHSKSRQYLIEKVHSDVEKSLRVFQECDSGAISVLVDCFGNQTDSDTLVLEIKR
FT                   GLQDKRLNVVFLFTVMVQLLSKYHYNFVSLKFVIKEIILRCCEAEIRPLMLVIFAQLDK
FT                   GYKGEFEKYLLDIIGSLLIEADAEATDGSLLIVVELLTQLYPASTALCTSVFLGEEFQE
FT                   VSKRKLFKSDETLAFNLLTLLSVACVDETVRCYIADNYIDALGEGVKTEKFKAHSALVL
FT                   IKTWSFSKLKGMTVESLGRILIDALGKSEQHSEIAVEGLAYLTLKPSVKAMFLRDNDAL
FT                   LDLVSMLKSSQSAPIVSYGILVVVGNLSSKLEDLNSAEHSAHGLRAYADMKRLDQEEAE
FT                   GADAALSNEDIATFNRDIVIELNVLGISKAKLSSQSSGFRLQLVRIIHNLVSSKGLVAE
FT                   SVKQGSVTILLDALSSATTPENFKKLALRSLARTLVMINPELIFLRYSALNVLPFLFDL
FT                   IPDPEAPSAGVETTPRDSYEALLALTNLATLQDKSVCEKIISTPPYWSKIENLMLDTAV
FT                   EIQRSTLELLCNLMAGSLHLAAKFFNFENPRSVRNFNILAKLLNLEDLRSQLAVSAIFA
FT                   NVASSVPFIAQELASKKELLDNATEVLQKQCNETELRHRLIVFFDALASSSAEVRRSLS
FT                   HVSSLRNALLTARKYEANYPSDYLEALDSILGAH"
FT   gene            <216256..>217301
FT                   /locus_tag="KLTH0E02464g"
FT                   /old_locus_tag="Klth0E.mRNA.ld.289.p"
FT   CDS_pept        join(216256..216301,216358..217301)
FT                   /locus_tag="KLTH0E02464g"
FT                   /old_locus_tag="Klth0E.mRNA.ld.289.p"
FT                   /product="KLTH0E02464p"
FT                   /note="similar to uniprot|Q05568 Saccharomyces cerevisiae
FT                   YDR265W PEX10 RING finger peroxisomal membrane peroxin
FT                   required for peroxisomal matrix protein import interacts
FT                   with Pex12p links ubiquitin-conjugating Pex4p to protein
FT                   import machinery mutations in human homolog cause a variety
FT                   of peroxisomal disorders"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23157"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH96"
FT                   /protein_id="CAR23157.1"
FT                   /translation="MANSRKLEFADASAIVQSHQKDDQIESILTSKLADATRAIKGQYF
FT                   SNVYSKEISTCAKLLYLALTTLRGRRTLGEEYVDLLHVNRNGEKLPRMLQRLLFVLSHA
FT                   LIPYAYYKILGRLSRSKDAGGQNENGLQTPKSTLRKLLNTKTFQGVVNVSTDLNLLNFY
FT                   FKGAFYDISKRIFGLRYAVGHKISESEENFRSSSSKTYRLLGLVLLVQFVTRNVPPIVT
FT                   WLKKELIVSPLSDKTSSEIQNNASLVITGVPSKDIVNHVDLQDPAELSFIPSESRKCIL
FT                   CLSLMVDPSCAPCGHLFCWDCLLNWSKERPECPLCRQTCQTQSILPIR"
FT   gene            complement(<217352..>219211)
FT                   /locus_tag="KLTH0E02486g"
FT                   /old_locus_tag="KLTH-ORF9993"
FT   CDS_pept        complement(217352..219211)
FT                   /locus_tag="KLTH0E02486g"
FT                   /old_locus_tag="KLTH-ORF9993"
FT                   /product="KLTH0E02486p"
FT                   /note="similar to uniprot|Q05580 Saccharomyces cerevisiae
FT                   YDR266C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23158"
FT                   /db_xref="GOA:C5DH97"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR041888"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH97"
FT                   /protein_id="CAR23158.1"
FT                   /translation="MSTQPQQKRNFRRTQGAQSKPKKDLGKNGEQGWKRTFSQGREGGD
FT                   TASELDEEDICIICAEKIKYASISPCNHVTCNRCTFRQRALYNKRSCLVCRTESDLVIF
FT                   SADKKAAFGDINSQSLVDTNDKYGVSFTSKDAASATLNLLLFTCPFGDTGSTDYENFKK
FT                   YNAHLKNAHNKTICMICASHKKAFPSELRVYTPNQLRVHQSKGDSEGFKGHPMCGFCSG
FT                   QRFYSDDELNIHMRDRHERCHICDQENSASPRYFKDYDQLFEHFKFEHYICTVQSCLDS
FT                   KFVVFRDDLDLQAHILKEHGSILRNGNNNAALKGRKYQSQLSTFSRPSSRNSSTSDFGG
FT                   VSSKKEDPENSQEVKRLRMEERARHYLNYSHTDFEQFLAINESYKNKMITAQDVYSAYE
FT                   NLFKSPQANTALLLYDFSELFPKNTKFHQDLRAIYDSEQKKQDRFTNFPSLSNSSPSLL
FT                   AGNVVSGSWGRNGGTNKAARQFNFPALKKPSSPQPLLVPQKVSYSKPKSATPKVAPSLT
FT                   TRKSSSTESFYKPTYLDNKKASVAPSAAVDREKFPPLPKSQAKKFRAPLVNQPDIPDPS
FT                   QWGKTPPSSRQNSETSNRDTTDTASPIHVKKGKQKQLLFHIGI"
FT   gene            <219822..>220462
FT                   /locus_tag="KLTH0E02508g"
FT                   /old_locus_tag="Klth0E.mRNA.at.342.p"
FT   CDS_pept        join(219822..220022,220088..220462)
FT                   /locus_tag="KLTH0E02508g"
FT                   /old_locus_tag="Klth0E.mRNA.at.342.p"
FT                   /product="KLTH0E02508p"
FT                   /note="similar to uniprot|P38812 Saccharomyces cerevisiae
FT                   YHR100C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23159"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR027706"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH98"
FT                   /protein_id="CAR23159.1"
FT                   /translation="MNVSATLNVLRLLQNPGLCIPQLTVGNFGQIPVPIGPSIKAVVLD
FT                   KDNCFAYPHSNEVWPDYEACKGKTWVELKKAYPGASLLIVSNSAGSSDDKDLKQARLLE
FT                   ETTGVPVLRHKVKKPGCRDEILSYFSGKKITNDPSEIAVVGDRLFTDIMMANLMGSYGV
FT                   WVRDGVKPSKNPIVHFEKLLFKWLTPGS"
FT   gene            complement(<221189..>232354)
FT                   /locus_tag="KLTH0E02530g"
FT                   /old_locus_tag="KLTH-ORF9985"
FT   CDS_pept        complement(221189..232354)
FT                   /locus_tag="KLTH0E02530g"
FT                   /old_locus_tag="KLTH-ORF9985"
FT                   /product="KLTH0E02530p"
FT                   /note="similar to uniprot|P38811 Saccharomyces cerevisiae
FT                   YHR099W TRA1 Histone acetyltransferase component putative
FT                   ortholog of human TRRAP which is an essential cofactor of
FT                   c-Myc"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23160"
FT                   /db_xref="GOA:C5DH99"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033317"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH99"
FT                   /protein_id="CAR23160.1"
FT                   /translation="MSYLERIEGLASRLREDNDLAKSLSTISEICEMVEPLGSSAEYEK
FT                   FLNSILPALMERLESTLYTLDVMSPQQKLRNSILEVLNRCIMNEAFEPFAVKYLDKLLV
FT                   VLQQDNEENGVLAMKIITGFFKSYKSALQERVTDFIDVIMKIYKHMPELVRQTFNDDLG
FT                   DNGALDLTGLDNTSEVLDPRGNGEAVQSSDTLAATSKPLKRSMFSFKVLSECPITMVTL
FT                   YSSYKQLTTSSLPQFMPLVIELLTMEADAQRKTREDFEAQGKRWISVSPNIKNRSAYCD
FT                   FILSQIKATSFLAYVFIRGYAAEYLQNYVGFVPDLILRLLQDCPAELSAARKELLHATR
FT                   HILSTNYKKLFLSKINLLFDEKVLIGNGFTSYETLRPLAYSTVADFVHNVRGDLQLDDI
FT                   EKTIKMYTGFLLDESLALTVQIMSAKLLLNLVERVLKLGKENPNDSVRSKKLLIVIVDA
FT                   YTTRFRNLNRQYDNLMKHHEEYEKEKMKKSATFRKELEKANEETENFIREMLRVKEPLK
FT                   QETDAEGDVKMEENVEGHTETSPNDEESEPDNEDTTIDVFDIKFKSPILLSSPPNSDPL
FT                   KDAFYLYRTLMSFLKTIIHDLKVFNPPSTEYTTMNPKVWTSLSRIFSHEEVVVFKDLFH
FT                   ECILGLQFFSSPEGKTVTDKKHFDIAAPSLPVSATKDGRELMDYFAIMFMQIDSPTFND
FT                   IVEAEIDFLYQAMLRDSALLHVAQSFLTSETTSPKFTGILLRFLKSKLSSLGNVDGNKS
FT                   NILIRLFKLSFMSVNLFPITNEIVLLPHLNDLILDSLKFSTTAEEPLVYLYLIRTLFRS
FT                   IGGGRFENLYRSIKPILQVLLQSLNRMILTARRPHERDLYVELCLTVPVRLSVLAPYLS
FT                   YLMKPLVFALQGFPELTTQGLRTLELCIDNLTAEYFDPIIEPVVEDVIRSLFKLLKPQP
FT                   FNHQISHTAVRILGKLGGRNRRFLKPHSDLRIAEELDIPVNATFRILGINDEVPLSITP
FT                   GVRSALDILQDYRGEAFYKKSAYNYLKSILQLFLKPSLAIPENYEEWIGGALKVLAQEV
FT                   VKPPVSQDTEDEKIRDKRLLNSQEMLLAKILEAVIFSASIEELKSEANDLFQNVVNHFC
FT                   FLQLNNALNKKMGETEKFSLDVKLPKVSIDTNIILDAISEGLSSYMEESRNISVSAVKQ
FT                   IFGTSERIYGSELSLKYSFIPLLVEKFIHQCYDEAYFKKSSGVLGIQTMIEEVNIPVSF
FT                   LKSYQFDLIAGLLFVLIDTPLEAPGIIRERARKLIISILASTCKNITEESLNEKGLQNT
FT                   LIDIVCELSNANEAVRSACQDALSTVSEVSGIPIVKLMSHSKNFLLSPIFAKPLRALPF
FT                   PMQIGNVDAIIYCLSLQGSFLEFNEELYRLLHEAIALVDAEDESLASAQRVTEYQTAEQ
FT                   LVQLRVVCIKLLSLALKNEEFASAQQGATRIRILAVFFKTMLKTSPKIIEATYQGLKSV
FT                   LAENSKLPKELLQNGLKPMLMNLSDHQKLTVSGLEALAKLLELLIAYFKVEIGKKLLDH
FT                   LDAWCRVEVLDMLFGKDLKEQTPTKIIYGIINIFHLLPPQADIFLNDLLLKVMLVEKKL
FT                   RLQLDSPFREPMAKYLNRFHSSVTSYFKNNLGSRDLVLLMCSIIQRPEANNLRQDFEQE
FT                   LNNFYDYYMTGISSNKVRVVSFFANVVEIFYSLERVKGDAWLVNNGSFLYKLRSMLKLT
FT                   LDIVEENDFHFDFLQLSQATGKVQDLHTRYLELNGNNPAKLFEFLEFAFTSGLKPSQSI
FT                   LSFIEKSVITTSEVETKKLYLHHALLFATSDKPFPATVFVLKNIVNSTLVYEGLTHKSL
FT                   NRLIKEDDGTQPPWLGLLCSKIWKGSSTILDSFAAGEYDTFRFELLQLSSVFTEYAADL
FT                   DPAIRKDIIRFCWNFIKLEDALVKQGAYMVTAYFIAKFEFPVKIVTQVFVALLRTSQIE
FT                   SRYMVKRSLDLLAPVMHERMASADPPNAWINWVRRVLSENNASQNSTLYQLLINHPDEF
FT                   FESRELFIASVINFVGKLTLMTNPNLENQTLVIDLAELILKWEKKAKESDGGDDSVDGN
FT                   ETKEIKQQETFGQREAFVTYLVRYVCVSNHRTSETELGFRTLKVLSEILSENYWPDVTV
FT                   KLNFFEKFLVQHDLSSSNVSFYCVNALDVLDVILRNKSASWIVSNLVLIQSLLDKCLRS
FT                   DHHDIQEALQKVLGKVLSAIKHTEESSLESDTETPSKLLLNTLISIITEDLQGTSSVAA
FT                   GVMLTWTLFMHFPQYVDSLLPSIMKTFSKLCKDHLATSQPKDPATLEESRITTKLLEKV
FT                   LYLLSMKVALLGDARRPFLSTVALLIDRSMDQNFLKKVIMIARTWVFTNEIFPTVKEKA
FT                   AILTKMLAFEVRGEPKLSRQFYEIILELFENKDFNNSEITVRMEQPFLVGTRVDDIYIR
FT                   KRLMAILDESLERDIKERLYYVIRDQNWEFIADYPWLNQALQLLYGAFDKDFSLDLRGA
FT                   YQLDQLGTALAEITIEKSDTEHEESPLHGLLERHKEFASNFSQVTCNDLVGPLIDIFYR
FT                   SPQAIHAAWINVFGAAYQSIPKNEKFGFVRSLVTLLSKDYHARQLNVRSNVVSTLLDSI
FT                   SETDSLELPPHLIKYLATSYNSWYQSIKILESLEESASLENAKIIETNEDALLELYVNL
FT                   QEEDMFYGLWRRRAKYTETNIALSFEQIGLWDKAQQLYEAAQVKARSGALPYSESEYSA
FT                   WEDNWIMCAEKLQHWDVLTELAKHEGFTDLLLECGWRVADWSADREALEQSVKSVMDVP
FT                   TPRRQIFETFLALQNFAETKKGDQEVKRLCDEGIQLSLHAWASMPERFTPAHKFLLHSF
FT                   QQYMEFLEATQVYANLASTSIQNLDTKAQEVKRVLQAWRDRLPNIWDDINMWNDLITWR
FT                   QHAFQVINNAYLPLVPALQQASNNSNVNTHAYRGYHEIAWVINRFAHVARKHNMPDVCI
FT                   SQLARIYTLPNIEIQEAFLKLREQAKCHYQNMNELTTGLDVISNTNLVYFGTVQKAEFF
FT                   TLKGMFLSKLRAHDEANQAFATAVQIDLNLAKAWAQWGFFNDRRLSEEPQNISFANNAI
FT                   SCYLQAAGLYNNSKTRKLLCRILWLIGIEDSTGTLAGAFESFRGEIPVWYWITFIPQLL
FT                   TSLSHKEANMVRQILIRIAKSYPQALHFQLRTTKEDFSVIQRQTMVAMGNSRLPNNKSP
FT                   ATASGTRQPWEYLDELNGILKTAYPLLALSLESLVDQINQKFKTTSDEDLFRLINVLLI
FT                   DATYNYNRLPFPRENPLLPASTETNLVRFSENLLPPHISVKFNADFIDSKPNFEEYIKR
FT                   LRYWRNRLENKLDRAPKIENMEKWCPHLSNFHHQKFEDIEIPGQYLLNKDSNAHFVKIS
FT                   RFLPHVEFVRGTHSSYRRLTIRGHDGSLHSFAVQYPAVRHSRREERMFQLFRLFNETLS
FT                   KNVQTRRRNVQFTLPISVPLSPQVRIMNDSSSNTTMHNLYDEYCDKKGIDRGAIQDFVC
FT                   QQLDAAYDKVLPPPEITAVKVEIFSSIQSMFLPSSVMKNYFTGLFTQFEDFWLFRKQFS
FT                   SQYAMFIFMTYMLAINNRAPHKISIDQVSGNVFTLEMLPARYPYERVKQTAKNFEADIP
FT                   PDSPVFHNNEAVPFRLTPNIQKLIGESALEGILSVNIFLVARALLEPDHELNTYLSLFI
FT                   RDEVISWYSNLHRSIVEDPQLREIVRTNVDLITRKTAQLGHLSSKPSVVTQYVLEAISA
FT                   AVSPRNLAKMDQSFMPYF"
FT   gene            complement(<233320..>234822)
FT                   /locus_tag="KLTH0E02552g"
FT                   /old_locus_tag="KLTH-ORF9981"
FT   CDS_pept        complement(233320..234822)
FT                   /locus_tag="KLTH0E02552g"
FT                   /old_locus_tag="KLTH-ORF9981"
FT                   /product="KLTH0E02552p"
FT                   /note="similar to uniprot|P25346 YCR098C Saccharomyces
FT                   cerevisiae GIT1 Plasma membrane permease mediates uptake of
FT                   the phosphatidylinositol metabolite glycerophosphoinositol"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23161"
FT                   /db_xref="GOA:C5DHA0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA0"
FT                   /protein_id="CAR23161.1"
FT                   /translation="MSETNRYVTYDADARKMRVNTSREKRLYNTFMIVAAGFALISDGY
FT                   QNNVMSMLNKVFPLEYGKHAYNGDVSTRVSNASLVGTILGQVTIGVACDYMGRKWAILV
FT                   ATLMLVGGSALCAASHGKTVSGMFWMLTVMRGVTGFGIGAEYPCCSVSANEAANEHSEK
FT                   KRGGIMVMVTNLPLSLGGPFANIIFLIVFSICGKNHLNALWRVMFALGCFWPLSVFYFR
FT                   WKTSTNTLFQKGQFKSQIPYWLTIKYTWKRLLGRCFVWFCYDFVAFSNSLFSGTIISLV
FT                   IKNGNDLKTIAEWNLLLGIIAVPGCFVGAWLCDRIGRKYTLMFGFSGYLVFGLIIGCAW
FT                   DKISKITALFIIFYGLMNGLANAGPGDMLGLVSSESFPTAVRGTCYGLSAAIGKVGAVV
FT                   GTECFTPIKDRLGIRWVFIIAALCGVAGIIATWLLIPHLLESDLMEQDINFHNFLVKHG
FT                   WSGTMGFDTEDRLENKNSDADETADSLNKDLNPEIITREISV"
FT   gene            complement(<235174..>235246)
FT                   /locus_tag="KLTH0E02574r"
FT                   /old_locus_tag="Klth0E.tMet.CAT.30"
FT   tRNA            complement(235174..235246)
FT                   /locus_tag="KLTH0E02574r"
FT                   /old_locus_tag="Klth0E.tMet.CAT.30"
FT                   /note="tRNA-Met (CAT) cove score=73.94"
FT   gene            <235803..>237593
FT                   /locus_tag="KLTH0E02596g"
FT                   /old_locus_tag="KLTH-ORF9978"
FT   CDS_pept        235803..237593
FT                   /locus_tag="KLTH0E02596g"
FT                   /old_locus_tag="KLTH-ORF9978"
FT                   /product="KLTH0E02596p"
FT                   /note="weakly similar to uniprot|Q66RD4 Saccharomyces
FT                   cerevisiae YDR349C YPS7 Putative GPI-anchored aspartic
FT                   protease located in the cytoplasm and endoplasmic
FT                   reticulum"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23162"
FT                   /db_xref="GOA:C5DHA1"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA1"
FT                   /protein_id="CAR23162.1"
FT                   /translation="MLIFAVFVFAVALVRGASQSSSENSIDSFPVLTANRDRAGLYYVN
FT                   ASFGTPGQSQKLRIDLVQPYMWVFSEDMRQARQNRSARAKAETYYNASKSSTHEKLNGD
FT                   KIWSMHFMDHIAFNGTTVMDEVSFMWSSTSSSSDVATGDSNTTQDFSSANTSRISDKSF
FT                   SFLSANEVAAYIQQGALGLAGRAAQTGYDNDSSDFDSSYVLLDRLVDESLIYTSSFSMW
FT                   MGADTRDPLESPEPSNGCGKVIFGAVDTSLYTGDFVKFDTIPFHNARTGETSRGYPIIP
FT                   LTKVNVQSKSGETKNMTSDSFLEPVLIDSRFRYNYLPLEIIVQIAMQANAYYVESLNRW
FT                   LLACDVGRLGASIIFEFGNLSINVPLNNLMGPTFDSDTNGTLHFSNKQQACELKLLPST
FT                   ASGFNVLGGAFIKNVYMAAELESNQVALAQAQKVSSVTTTSSTAELSPTPTSSKSEEGG
FT                   DDAASHLSYFNLKPAKTISAIKSGMIPFATTNNLTSFQTMMLSDKATMSTSPNTRLFNQ
FT                   FTATISSDGVIFTGRSFYNTTNDVSVSSTTSASFALSETTSKSNAARTNFPLQSVGGSG
FT                   LSMHFYSVTVLLISAAIFAL"
FT   gene            <237948..>240656
FT                   /locus_tag="KLTH0E02618g"
FT                   /old_locus_tag="KLTH-ORF9976"
FT   CDS_pept        237948..240656
FT                   /locus_tag="KLTH0E02618g"
FT                   /old_locus_tag="KLTH-ORF9976"
FT                   /product="KLTH0E02618p"
FT                   /note="similar to uniprot|P38810 Saccharomyces cerevisiae
FT                   YHR098C SFB3 Member of the Sec24p family forms a complex
FT                   with Sec23p that is involved in sorting of Pma1p into COPII
FT                   vesicles peripheral ER membrane protein potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23163"
FT                   /db_xref="GOA:C5DHA2"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036174"
FT                   /db_xref="InterPro:IPR036175"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA2"
FT                   /protein_id="CAR23163.1"
FT                   /translation="MQRLNQSLSSLSLDRDSPSPIGVTRKNKRPNRAFHSFATDSYGLP
FT                   DPQASAQNNFQPLAASNLGNISGNQASNFRVPFPSPSQRVSSGGPAESITSHYVPKQRL
FT                   EDQQRYLTRSFVTSQDSVPPCVSTQYYCIDQGISDPRKLCLTMYNVPRNEQLRSATKLP
FT                   VGAIIQPFAASVPDTAIDIIDASQRNGPLRCRRCRSYSNPNYSFTFDSKAVCNFCQVST
FT                   QLSEEHYAPLNPNGLRADINERPDLTKGTVEFLVPDTYNTVPGKPNIPLHYVFLVDIST
FT                   LSNENKSSLAMVEGIRTCIEHISAKQPNCKVAIMAFDKEIRFFNLRPELNQAQEYIISD
FT                   LQDVFVPIFTGLFVRPEESMHVIQDTLCKITAYIEDGKFSHHFEACYGSALKAARLALD
FT                   TVTGGAGGKILASLSSKPTHGIGNLRLRNEDALKKTLKCENEAYVKLGQELLKNNISLD
FT                   LFCTGSAFMDMVSVAQPVKVTSGILKYYPGFQLDKDEFTFVNDLLHSVANTVGYAGQLK
FT                   VRCSSGLSVYNYYSESVENSDREPVIPVLHQDTTVNVLFKYDGRLPPAKDVHFQCALLY
FT                   TDLNGARKVRCLNASAAVSDNIHEIFKFINQDAVVGIVLHDMLTTLDDCNFVQKRKTID
FT                   DKIVDVLTQYRALVSKSSSSQLVLPDSLKTWAAYLLSFEKSELMKNNNKSANGNSRVYD
FT                   MFKYLNFTPAQLVFKLYPQILPLHELLQESDYTFYDENELLLQAAPLENLCVRASRSEL
FT                   VDGGCYLIFDGTTAYLWFNENTNTYLLRDLLDVDTDSVKHSEIALIGNAIPTLDSGINL
FT                   KARSVLRNWAQVSGRSYVPVSPLRPHVDVYYSHTMAALLVEDRSIEMIEAYDAYLVSLH
FT                   KRINEKVKREDYTKVGNPKDHEHITQKFIQF"
FT   gene            <241007..>241273
FT                   /locus_tag="KLTH0E02640g"
FT                   /old_locus_tag="KLTH-ORF9975"
FT   CDS_pept        241007..241273
FT                   /locus_tag="KLTH0E02640g"
FT                   /old_locus_tag="KLTH-ORF9975"
FT                   /product="KLTH0E02640p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23164"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA3"
FT                   /protein_id="CAR23164.1"
FT                   /translation="MMRRSNSEKSSARRMSSNNPFRNASVESEASQYQSDKDFQEWVSS
FT                   NTIYHPSGSRPKNSSMLSLTESIEEEPHRMASPSASLPREPYR"
FT   gene            <241639..>242844
FT                   /locus_tag="KLTH0E02662g"
FT                   /old_locus_tag="KLTH-ORF9974"
FT   CDS_pept        241639..242844
FT                   /locus_tag="KLTH0E02662g"
FT                   /old_locus_tag="KLTH-ORF9974"
FT                   /product="KLTH0E02662p"
FT                   /note="weakly similar to uniprot|Q66RD5 Saccharomyces
FT                   cerevisiae YDR348C Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery and bud neck potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23165"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA4"
FT                   /protein_id="CAR23165.1"
FT                   /translation="MTPPPRPASNNPFLDDMSPQSGSESPEEDYSPPQPTNGNGGGAGS
FT                   AYPTAQEEKNRLRRRYIEQPSISDPVVDDLPPSYDEVAAVSKKPAAPYPREKSSSRYAS
FT                   SSTRSSDRRESSERSAHRRHRDGSERTHHSSSRRHREAGTHSSDRRKSSKDKKSSSSSK
FT                   PLAKNVDTIDKLDVTGLFGGAFHHDGPFDACTPHRNRNTKVAPVMAFPADGPNSSIAGA
FT                   ANSKSPMKEVFGQEANDDDDAYLYGNKIYSRGNNSSTNTIGAIKPNMNGVTQFDVKAKN
FT                   LVHGPTTVGLGSTTFLDGAPATGAANSNNRLHPQHLSSSQMKKVPSQKSGNGDYAASGD
FT                   VYRREPLKLAKTHSGHLENDEDSPDEDVYLSTRFDPSAKKSSTSGNKFMRRVKSLKVGR
FT                   KS"
FT   gene            complement(<243196..>244116)
FT                   /locus_tag="KLTH0E02684g"
FT                   /old_locus_tag="KLTH-ORF9969"
FT   CDS_pept        complement(243196..244116)
FT                   /locus_tag="KLTH0E02684g"
FT                   /old_locus_tag="KLTH-ORF9969"
FT                   /product="KLTH0E02684p"
FT                   /note="similar to uniprot|P10662 Saccharomyces cerevisiae
FT                   YDR347W MRP1 Mitochondrial ribosomal protein of the small
FT                   subunit MRP1 exhibits genetic interactions with PET122
FT                   encoding a COX3-specific translational activator and with
FT                   PET123 encoding a small subunit mitochondrial ribosomal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23166"
FT                   /db_xref="GOA:C5DHA5"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA5"
FT                   /protein_id="CAR23166.1"
FT                   /translation="MLRYSLVPRTLARSYIAPSLEHLARGKGVRGLFSEKGLQTAWFDR
FT                   ADFYTENLNKYMGQSEEKPLENIVYENAKSASKRDIFNNASMLYNLRFALSCLRANDLP
FT                   SVTEKPGPQSLLATPSLELKFSNDPRDNGNEKLSAALASSFGSLVEFRSLLLNSNRAIS
FT                   GDGFTWLVARKVQSMHHESVISGTVEFDWLYVLNTYNAGSPFNFNRVGHMSDLKKQLSK
FT                   LQTVEETPSSNPFQMKSVEEARETESYRDITYVPLLAIDASPKAWITDYGVFGKDLYLE
FT                   RVWESIEWNVVEQRLPTRAPNYQLS"
FT   gene            <244394..>244465
FT                   /locus_tag="KLTH0E02706r"
FT                   /old_locus_tag="Klth0E.tAsp.GTC.6"
FT   tRNA            244394..244465
FT                   /locus_tag="KLTH0E02706r"
FT                   /old_locus_tag="Klth0E.tAsp.GTC.6"
FT                   /note="tRNA-Asp (GTC) cove score=69.96"
FT   gene            <244900..>246144
FT                   /locus_tag="KLTH0E02728g"
FT                   /old_locus_tag="KLTH-ORF9965"
FT   CDS_pept        244900..246144
FT                   /locus_tag="KLTH0E02728g"
FT                   /old_locus_tag="KLTH-ORF9965"
FT                   /product="KLTH0E02728p"
FT                   /note="similar to uniprot|Q05515 Saccharomyces cerevisiae
FT                   YDR346C SVF1 Protein with a potential role in cell survival
FT                   pathways required for the diauxic growth shift expression
FT                   in mammalian cells increases survival under conditions
FT                   inducing apoptosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23167"
FT                   /db_xref="GOA:C5DHA6"
FT                   /db_xref="InterPro:IPR013931"
FT                   /db_xref="InterPro:IPR033394"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA6"
FT                   /protein_id="CAR23167.1"
FT                   /translation="MLKWIQGGISAVTGIAEPEYGKDFIHPVTGQVKDKQPFHVAERED
FT                   FHWLSPTHTNVETMTFYFTDLKQGYIGFAQVIHSNVVGIHTTAQFTFRLYNVKEPKLNV
FT                   WTSTKLANFRIDGPNFYADDLSIEMNEAGSQVRFQSSVNPASVVDLTFERAVPGVKVGA
FT                   NGTTYYGDNLEQPWGSMRHVFWPRNFCHGTLKVKPELDSESDTEAEKEVPVQEIVFEKG
FT                   APVFSMFVMALQGMKPHHAAKAWNFLNFQSETHSAVLMEFTTPKSYANTKICVGILCDK
FT                   KDIIAVTIDNNFEHLDTKIDSVGWPVPHKIDVSFKGVKSDVSDEEVATASPVTALASGP
FT                   LEQLVERVDVMSEIPSFVKNIVSGVAGTKPYIYQYANDFSLRVDDAAPVSGTGWCEITF
FT                   ISEAEEVTEESYSET"
FT   gene            <248224..>249927
FT                   /locus_tag="KLTH0E02750g"
FT                   /old_locus_tag="KLTH-ORF9958"
FT   CDS_pept        248224..249927
FT                   /locus_tag="KLTH0E02750g"
FT                   /old_locus_tag="KLTH-ORF9958"
FT                   /product="KLTH0E02750p"
FT                   /note="highly similar to uniprot|P32466 Saccharomyces
FT                   cerevisiae YDR345C HXT3 Low affinity glucose transporter of
FT                   the major facilitator superfamily expression is induced in
FT                   low or high glucose conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23168"
FT                   /db_xref="GOA:C5DHA7"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA7"
FT                   /protein_id="CAR23168.1"
FT                   /translation="MSSSPEIGPSKSVSDDQGSHNSNVMNAPAPKLNREESHDEIDALK
FT                   KDAEQQLASKGSSDFVFVSMCCLMVAFGGFVFGWDTGTISGFVQQTDFLRRFGQKHSDG
FT                   THYLSNVRTGLIVAIFNIGCAIGGIVLGKLGEVYGRRLGLTIVVIIYSVGIIIQIASID
FT                   KWYQYFIGRIISGLGVGAITILSPMLISEVSPKHLRGTLVSCYQFMVTGGIFLGYCTNY
FT                   GTKRYSNSVQWRVPLGLCFAWALFMIGGMVFVPESPRFLVEAGRLEEARRSLARVNKAS
FT                   LEDAVVTLELENIEASVEAEKMAGKASWAELITGKPQMFKRTLNGIIIMSLQQLTGDNY
FT                   FFYYGTTIFKAVGMTDSFETAIVFGVVNFFCTSLSLYTVDRFGRRNCLIYGAIGMVACY
FT                   VVYASVGVTRLYPEGANHPDISSKGAGNCLIVFACFYIFCFATTWAPIAYVLISETYPL
FT                   RVKGKAMSIASACNWIWGFLIAFFTPFITSAINFYYGYVFMGCMVFAIFYVFFFIPETK
FT                   GLTLEEVNDMYAEGVLPWKSASWVPASRRGADYNADDLMHDDKPWYKRFF"
FT   gene            <252118..>253833
FT                   /locus_tag="KLTH0E02772g"
FT                   /old_locus_tag="KLTH-ORF9946"
FT   CDS_pept        252118..253833
FT                   /locus_tag="KLTH0E02772g"
FT                   /old_locus_tag="KLTH-ORF9946"
FT                   /product="KLTH0E02772p"
FT                   /note="highly similar to uniprot|P39003 Saccharomyces
FT                   cerevisiae YDR343C HXT6 High-affinity glucose transporter
FT                   of the major facilitator superfamily nearly identical to
FT                   Hxt7p expressed at high basal levels relative to other HXTs
FT                   repression of expression by high glucose requires SNF3"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23169"
FT                   /db_xref="GOA:C5DHA8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA8"
FT                   /protein_id="CAR23169.1"
FT                   /translation="MSSAPYQQETAATATPVDLHSTVSNGSQLSTPSNKASRDELKAAN
FT                   MAEDAADQVEIPKKPASAYVTVVILCLMVAFGGFVFGWDTGTISGFVNQSDFLRRFGQK
FT                   HSDGTHYLSNVRMGLIVAIFNIGCAFGGIILSKIGDVYGRRIGLMAVVVIYVVGIIIQI
FT                   ASIDKWYQYFIGRIISGLGVGGIAVLSPMLISETAPKHLRGAMVACYQLMITAGIFLGY
FT                   CTNYGVKNYSNSVQWRVPLGLCFAWALFMITGMSFVPESPRYLIENGRIEDAKRSLAKS
FT                   NKVTVEDPAILVEVDLILAGVEAERLAGSASIKELFSTKTKVLQRLIMGIMIQSLQQLT
FT                   GDNYFFYYGTTIFKAVGLSDSFQTSIVIGIVNFASTFVSLVTVEKFGRRGCMLWGSAAM
FT                   VACFVVYASVGVTKLYPNGADHPEVTNKGAGNCMICFTCFYIFCFATTWAPIAYVVVSE
FT                   SFPLRVKSKCMAIATASNWLWGFLIAFFTPFITSAIHFYYGYVFMGCLVFAYFYVFFFV
FT                   PETKGLTLEEVQELWEEGVLPWKSTSWVPSSRRGKDYNVEELKHDDKPWYRRVV"
FT   gene            complement(<254093..>254998)
FT                   /locus_tag="KLTH0E02794g"
FT                   /old_locus_tag="KLTH-ORF9941"
FT   CDS_pept        complement(254093..254998)
FT                   /locus_tag="KLTH0E02794g"
FT                   /old_locus_tag="KLTH-ORF9941"
FT                   /product="KLTH0E02794p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23170"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA9"
FT                   /protein_id="CAR23170.1"
FT                   /translation="MQAAQHPDSGSPRSEGLVDRIFDGLKHGGPPWTRHYGKSNIANGS
FT                   AAPRLSRSGNLKRSLRKAKMVLDGSRFGSSRQNRKKASSERPLNHLSFFSRGLQGSFSW
FT                   DSGSCIGSEGAAVSDADAPSTTLPTEINTKSDEDKENFQRQSAAPGGPASFHSPLQPLP
FT                   IDLKQYVTGYEIKSGNSEAFSEGPAPGPVSAPLKIAFSTLVSDVLRENRNWINELALAR
FT                   RQKPWKFSKKSKMESDAFLEFLERLESLLKFESAFIEELHLRQDTLHEENTLLRHQLVA
FT                   VRGVGLENHDIMPCVTSNSV"
FT   gene            <255428..>257365
FT                   /locus_tag="KLTH0E02816g"
FT                   /old_locus_tag="KLTH-ORF9940"
FT   CDS_pept        255428..257365
FT                   /locus_tag="KLTH0E02816g"
FT                   /old_locus_tag="KLTH-ORF9940"
FT                   /product="KLTH0E02816p"
FT                   /note="highly similar to uniprot|Q05506 Saccharomyces
FT                   cerevisiae YDR341C Cytoplasmic arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23171"
FT                   /db_xref="GOA:C5DHB0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB0"
FT                   /protein_id="CAR23171.1"
FT                   /translation="MLRRAVNFVAISRSFQVRLKQHRIWRLQGLRYFSHQPEIMSATSI
FT                   TSQLQKLSIQEPPALEGSFPNVNVVDLMRNFISVELSKISGVDTQLIYPALEWTNTLER
FT                   GDLLIPVPRLRIKGSNPKDLATEWAEKFPLGNFLTKVEANGPFVQFFFKPDFLFKVVLP
FT                   DILTRKEEYGSAPLVQNKKVVIEFSSPNIAKPFHAGHLRSTIIGGFLSNLYEKMGWDVV
FT                   RLNYLGDWGKQFGVLAVGFERYGDEEALSKDPIKHLYDVYVRVNQDITAEGDSLPEDKS
FT                   TDGQARAYFKKMEDGDENALKIWKRFRELSIEKYIDTYARLNIKYDSYSGESQASRESM
FT                   QLALDMFREKGLTHEDRGALLIDLTKFNKKLGKTIVQKSDGTTLYMTRDVGTAMDRHKK
FT                   YNFDKMIYVIACQQDLYTAQLFEVLKQLGFGWAKDLQHVNFGMVQGMSTRKGTVVFLDN
FT                   ILEETKEKMHEVMKTNKAKYAQIENPDEVADLVGISAVMIQDMQAKRINNYEFKWERMT
FT                   SFEGDTGPYLQYAHSRLRSVERNASEITQEKMVNADFSLLHEPAAVLLVRLLAQYPDVL
FT                   RNAIKTHEPATVVTYLFKLTHQVSSCYDVLWVAGQTPELAAARLALYASARQVLYNGMT
FT                   LLGLTPVDRM"
FT   gene            <257955..>258058
FT                   /locus_tag="KLTH0E02838r"
FT                   /old_locus_tag="Klth0E.tSer.GCT.7"
FT   tRNA            join(257955..257991,258014..258058)
FT                   /locus_tag="KLTH0E02838r"
FT                   /old_locus_tag="Klth0E.tSer.GCT.7"
FT                   /note="tRNA-Ser (GCT) cove"
FT   gene            <258370..>258939
FT                   /locus_tag="KLTH0E02860g"
FT                   /old_locus_tag="KLTH-ORF9936"
FT   CDS_pept        258370..258939
FT                   /locus_tag="KLTH0E02860g"
FT                   /old_locus_tag="KLTH-ORF9936"
FT                   /product="KLTH0E02860p"
FT                   /note="highly similar to uniprot|Q05498 Saccharomyces
FT                   cerevisiae YDR339C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23172"
FT                   /db_xref="GOA:C5DHB1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR037503"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB1"
FT                   /protein_id="CAR23172.1"
FT                   /translation="MGKAKKTRKFALVKRTLNAKKDVRLKANQAKEAHRDDPELTKNVP
FT                   QISSALFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMA
FT                   ELEKLGPKYRIALKLARDPRIQRLTCSHKGTYADDCLVNRVLQHKCYIVATNDAGLKQR
FT                   IRKVPGIPLMSVGGHAYVIEKLPDVF"
FT   gene            complement(<258995..>259561)
FT                   /locus_tag="KLTH0E02882g"
FT                   /old_locus_tag="KLTH-ORF9933"
FT   CDS_pept        complement(258995..259561)
FT                   /locus_tag="KLTH0E02882g"
FT                   /old_locus_tag="KLTH-ORF9933"
FT                   /product="KLTH0E02882p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23173"
FT                   /db_xref="GOA:C5DHB2"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB2"
FT                   /protein_id="CAR23173.1"
FT                   /translation="MNPLLFPLKYVAKKVFGEVEIGGKAEDPFFEEVEFQKRSFWSGST
FT                   KIVKKRRDKSVPEFVPEADSKILRRVRKRAYRLDMKFHLCGVRFGWIGVIGLLPVIGDL
FT                   FVLWLSLQVYREASKISGGLPPAEAARMITNICVDFGLGLVPIVGDFVSVAYKANSRNV
FT                   LVLEKYLTHKYNRVRVPAPAATQRI"
FT   gene            <259875..>260672
FT                   /locus_tag="KLTH0E02904g"
FT                   /old_locus_tag="KLTH-ORF9930"
FT   CDS_pept        259875..260672
FT                   /locus_tag="KLTH0E02904g"
FT                   /old_locus_tag="KLTH-ORF9930"
FT                   /product="KLTH0E02904p"
FT                   /note="similar to uniprot|P38806 Saccharomyces cerevisiae
FT                   YHR090C YNG2 Yeast homolog of mammalian Ing1 NuA4 histone
FT                   acetyltransferase complex component"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23174"
FT                   /db_xref="GOA:C5DHB3"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR024610"
FT                   /db_xref="InterPro:IPR028651"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB3"
FT                   /protein_id="CAR23174.1"
FT                   /translation="MDPSSALEQTTHDVSNLQAEFRYILDEIKNADLRVYEQRKKYVQR
FT                   DAQVQKFVKQHGSGTENPREGELSQKIERELQDCVESQRGKCVLANTALFLVSKHLSKL
FT                   EKTIRVLEGDNLLAPAEEDKETESGGDNSRESSVMSGERRRKATPTAAVVAPKRKRRAD
FT                   STPVPRQKDSTPGGGSDANFDLQDYNDDLFSGYNQAEEDDKQLYCFCQSVSYGEMVACD
FT                   GPNCKYEWFHYTCVNLKEPPKGAWYCPDCRQELANTRLKKRKA"
FT   gene            <260858..>262939
FT                   /locus_tag="KLTH0E02926g"
FT                   /old_locus_tag="KLTH-ORF9927"
FT   CDS_pept        260858..262939
FT                   /locus_tag="KLTH0E02926g"
FT                   /old_locus_tag="KLTH-ORF9927"
FT                   /product="KLTH0E02926p"
FT                   /note="similar to uniprot|Q05497 Saccharomyces cerevisiae
FT                   YDR338C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23175"
FT                   /db_xref="GOA:C5DHB4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB4"
FT                   /protein_id="CAR23175.1"
FT                   /translation="MATMFSKSLAQVHPKLLTNGIGIGNNHRRISLGFLKPSKRNPLVR
FT                   KYTRTRRRYGPDQQSFRSLGEDFGSTVARETPLDAVDEEDERHSEDGGELSRTVSLPSR
FT                   VSETPDLQPEVDWILEEHERRYSSVHASDDEEEEEAPHHEPRNMYSHPYYGNDEEQHQE
FT                   EVLEYDDFMKRVRQQLIYDVRKRQRSPSFVPVTSRGSVPNVYESTQDEEDYSHESVSYE
FT                   SEAKMLASYAFPLILTFLLEQIFPLVCSLTVGHLGKNELAAVSLASMTTNITLAVFEGI
FT                   STSLDTLCPQAFGAGNYRGVGIHLQRCIAFSMVVFIPFGFMWHFSEFFLGFVVPDKALV
FT                   ALTSKFLKIATLGAPAYIIFENLKRFLQAQGIFDAGIYVLLICAPLNVVTSYTLVWNSR
FT                   IGLGYIGAPIAMVLNFWLMLTLMLLYIIFVNGRKCWGGFNKKAFTHWKDLSHLAIPGII
FT                   MLEAEDLSYEILTLFSSYFGTTYLAAQSAVSTTAALMYMIPFAVGISSSTRIANFIGAK
FT                   RPDCARIASELGISCSFLVGIFNFTVLMTGRKVIAHVFSNDELVVKQITKLLPLVAFIE
FT                   IFDSLNAIAGSCLRGQGMQAIGSIINLVVYYLVAIPLGVLLGWTFNLKLYGLWIGIGTG
FT                   MFLIGVTEAYLVLSPNWEKILERAEMLKEADDEESDEEFEYSDSDSEPSETTGLLPVR"
FT   gene            <263206..>264675
FT                   /locus_tag="KLTH0E02948g"
FT                   /old_locus_tag="KLTH-ORF9924"
FT   CDS_pept        263206..264675
FT                   /locus_tag="KLTH0E02948g"
FT                   /old_locus_tag="KLTH-ORF9924"
FT                   /product="KLTH0E02948p"
FT                   /note="weakly similar to uniprot|P08465 Saccharomyces
FT                   cerevisiae YNL277W MET2 L-homoserine-O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23176"
FT                   /db_xref="GOA:C5DHB5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB5"
FT                   /protein_id="CAR23176.1"
FT                   /translation="MLLKTYPSLIRGLHRSLPRCSRSSNPAMQFPCLDKMEERSAQLKK
FT                   NTISCSSTDLTSSPNNEPVYGKVRSGFQIFKSNSPLFLDYGGVLPNFQIAYETWGTLNS
FT                   DRSNAVLVHTGLSASSHAKSSESNLQPGWWEKFIGPGNPVLDTDKLFVICTNILGGCYG
FT                   STGPSSPDPADGAPYATRFPMLSVQDIIRGQQELVKECLGIDKLYASVGSSMGGMQSLA
FT                   YAQQFPEAVEKVVTVSACARSHPSSIAMRHAQRQVLMADPHWSRGFYYPTEAEPNKILP
FT                   HVGMKLAREIATVTYRSGPEWESRFGTERLDDERTPVLCPDFLIETYLDHQGEKFSLEY
FT                   DPNSFLYLSKTMDLFDLSQSHQERSQRRRKEAFEQHRHQQVGNLTARLSDEPYEPVKRR
FT                   RTTTVEEAREDLRVGMESIRGKNVLVIGVKSDGLFPYWQQREIVDLLGGGPEVEHVELD
FT                   ESQSLYGHDTFLLDLEHVGGSIGKFLMKSFD"
FT   gene            complement(<264820..>265695)
FT                   /locus_tag="KLTH0E02970g"
FT                   /old_locus_tag="KLTH-ORF9922"
FT   CDS_pept        complement(264820..265695)
FT                   /locus_tag="KLTH0E02970g"
FT                   /old_locus_tag="KLTH-ORF9922"
FT                   /product="KLTH0E02970p"
FT                   /note="similar to uniprot|P21771 Saccharomyces cerevisiae
FT                   YDR337W MRPS28 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23177"
FT                   /db_xref="GOA:C5DHB6"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB6"
FT                   /protein_id="CAR23177.1"
FT                   /translation="MKLPLAGLQRQWVIPQVAQVRMFASSRPCGGHKAVKFLKAQRKRQ
FT                   VNQAKQLKLKTALDTIDPVFGRSSTPFIVRVMAEMKEPKVLAQGYENQEVEKLLAAVEA
FT                   AKREQIELSGFNNASLVPGASENDPEGLASKRESIMRILSMRNASNKDAMKLVVRQARE
FT                   EFQRFEGDTGSSEVQAAIMTVRIQNLAKHIQENKNDHKNTRILRMLVQQRQNILRYLKR
FT                   DKPERYFWTIQKLGLSDNAVVSEFNMDRRYMQDYKFFGDRILIKDSKKVADQKRRDLRK
FT                   QKRSARRAQL"
FT   gene            complement(<267098..>270199)
FT                   /locus_tag="KLTH0E02992g"
FT                   /old_locus_tag="KLTH-ORF9919"
FT   CDS_pept        complement(267098..270199)
FT                   /locus_tag="KLTH0E02992g"
FT                   /old_locus_tag="KLTH-ORF9919"
FT                   /product="KLTH0E02992p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23178"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB7"
FT                   /protein_id="CAR23178.1"
FT                   /translation="MLNESLMDVFGILNDRSGPTDEARVYKQLWELLKRDPTSIHALLS
FT                   HEFMNRPIEELAGCVAQECLEKRLVCLCVLDFRLRSGCVLPSPSDALSSIFSTVSMVQA
FT                   DPQATNACFRILSTVLAFAESTQTVGLRQCDVDCISSEHLVSENAAVLMDYVYLALTHP
FT                   WISESEAQQWLSELYRSGVFWWLRQKLQSTAKLDFLETLFEDTMKRAYNSFIQTMQTFL
FT                   RAQGIAKEWQFCGASKFSELFDPMVLKNCVEDALAALKIQPRTRDAGTAPRLLAHLSKR
FT                   PIQSRDFWQGIMLDRPALDLMWISPSRDMFTHASKTYMHEFAKLQCDIKNFILRINSRY
FT                   SISHGKLTGNSKYATSAYELGQDPVTKSWFIKVAKTFAPEAQVEKWGNIQGKRLCLSRL
FT                   DGAFFVVQVASVHKVGDMLQLFIGTENVSGLQNCQLLSVLSTELEFQVKAVDDLLKFNL
FT                   ENERLQAMTPMTNLVRSSCPSKTVILSNLFSDEQQIKNFLHENTESVKQKPSKRRLVPV
FT                   KEAISLDLEKGKWAIEKAVKNSPKHDFTLEQIESVIHGVCESASCVNGDVGTGKATIIA
FT                   AIIDNLHLNSFYKRFPQMCSRFLIVCDTDETCQKIASYLSIIQPQSVVHYSNDTSSLIE
FT                   KKKKGVKEALSRVQEIASILRIPGDHSSSVPAALSFLQHFLEPMLHDYRASIKTNDEIS
FT                   KRAFPLLEDGVLTSPSSEMAERIIETSYQVAVMYDQLQKWQFLFLNGDLEKTLTEACDL
FT                   LLISKDRFQKCLVDKKLSFNSFESLVICNADFFEPSEIWRALSLNTHWQRTIFSGDFTN
FT                   SPLPYVARQLFSSKSLQFRLTTSYNTNREVLRIRFPYEEQPDPVPVLYSPVQVIKTPGK
FT                   IVNNINWDEAEYCVLLYAYLRLAGYPAKVISIIALNPYQKYAIDTELEDWLQLEPSHKD
FT                   IKKPSSISSLENNRSHRNDIVIISTAGIQPNVPFLSRYARRGLLVLSAAGDDLQIVAGE
FT                   SFPSVKSDKREARRIQNLDQLKGLVDSLLCSKRPRKQSRKTHNE"
FT   gene            <270908..>271543
FT                   /locus_tag="KLTH0E03014g"
FT                   /old_locus_tag="KLTH-ORF9916"
FT   CDS_pept        270908..271543
FT                   /locus_tag="KLTH0E03014g"
FT                   /old_locus_tag="KLTH-ORF9916"
FT                   /product="KLTH0E03014p"
FT                   /note="some similarities with uniprot|P28007 Saccharomyces
FT                   cerevisiae YHR089C GAR1 Protein component of the H/ACA
FT                   snoRNP pseudouridylase complex involved in the modification
FT                   and cleavage of the 18S pre-rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03014g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23179"
FT                   /db_xref="GOA:C5DHB8"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB8"
FT                   /protein_id="CAR23179.1"
FT                   /translation="MSFRGGNRGGRGGFGGRGGFGGRGGRGGFGGRPMQQGPPDSVLEM
FT                   GSFLHPCEDEIVCRSINTKIPYFNAPIYLQNKTQVGKVDEILGPLNEVFFTIKCSEGVQ
FT                   ATSFKDGDKFYIAPDKLLPIERFLPKPKVAGPPKPKKKRAPGAPGGRGGRGGARGGFSR
FT                   GGSRGGFGGGRGGSRGGFGGPRGGSRGGFSRGGGRGGFSRGGGRGGRF"
FT   gene            complement(<271665..>272726)
FT                   /locus_tag="KLTH0E03036g"
FT                   /old_locus_tag="KLTH-ORF9913"
FT   CDS_pept        complement(271665..272726)
FT                   /locus_tag="KLTH0E03036g"
FT                   /old_locus_tag="KLTH-ORF9913"
FT                   /product="KLTH0E03036p"
FT                   /note="similar to uniprot|Q05473 Saccharomyces cerevisiae
FT                   YDR336W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03036g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23180"
FT                   /db_xref="GOA:C5DHB9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB9"
FT                   /protein_id="CAR23180.1"
FT                   /translation="MLKVHRVSQLLRGYRIKAGTRNTANTQWRNKNLENNDTDSNPNKS
FT                   SLDGGEQQISRDIKDRGAFITALHEKYNSDYKRPSKSDLSSVNHFFNSARVRYEWSAST
FT                   FLDIPGERLKQEAEKNVLTQASHEVEIGPTSDDTKGDKRIKKRFGKTDGIPFELLNGLP
FT                   EVAFLGRCNAGKSTLLNNITTQFSHVKLNEYAKASKKAGFTKTVNCFNIGGRFRIIDTP
FT                   GYGGKSTQEQGDVTMRYLRERQELKRCFLLVSAEQGFATTDSQVVDFLTKFGIPFEVIF
FT                   TKMDKIKDVSQLENVIEDSGVLELPTLPQMIFLNSETNKRYPKRYGIDALRSLILESCG
FT                   LEPNAKPSKTREK"
FT   gene            complement(<272968..>276630)
FT                   /locus_tag="KLTH0E03058g"
FT                   /old_locus_tag="KLTH-ORF9911"
FT   CDS_pept        complement(272968..276630)
FT                   /locus_tag="KLTH0E03058g"
FT                   /old_locus_tag="KLTH-ORF9911"
FT                   /product="KLTH0E03058p"
FT                   /note="highly similar to uniprot|P52918 Saccharomyces
FT                   cerevisiae YDR335W MSN5 Karyopherin involved in nuclear
FT                   import and export shown to be responsible for nuclear
FT                   import of replication protein A and for export of several
FT                   proteins including Swi6p Far1p and Pho4p cargo dissociation
FT                   involves binding to RanGTP"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23181"
FT                   /db_xref="GOA:C5DHC0"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040018"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC0"
FT                   /protein_id="CAR23181.1"
FT                   /translation="MDENGASQVVGALEAIYSPKSDNARRLEAQKFLDEVKMHEESPLW
FT                   GYEIALNNPGNSILKHYGLGLLAFAIKRRWADYDQNRRIALRKWVVELNYRVQESDPRY
FT                   IKEKLAFLWVEVAKCVWGEALKDDDPTDQQLEESWVGMDNDLSALWQLSEASRELTLII
FT                   FRTLFEDVFLVEDLTVLKRISVIQPLCVMVISPMDVFTARYRFTDKWTLFKSNGNGWFE
FT                   HWVSELRAALTVGNSVYVVRLLETLKTCLNWPLSEIMIRNDVCGLLLECLLSNIPKAQS
FT                   MALDSLHILLTRPYNDESHYQTVINRVFSSMDLLDKVYDNLQFDPNEIDEQKYPIVKKF
FT                   VDMVSCLYTCVFKTDEDEATIQKYLRLVLRTTFNPSLIVSGLTLDLWCSCLRNDDFLPA
FT                   LEGSIIPELLQFSADALIYYEQIENHVSKKFADIDFQSKSEFQSFCSTYRKRIRDIIRL
FT                   ISCVQLDFAYDWLNARLNSYFSSPFGQQVLSSQFLDHKTEPYLSSLSQLMVVECFINGC
FT                   IRWKIWFPDTSSYNTKLNEILVKIETLSDQLIALNLKEPLLLKKQIQNFALFLTMLKDN
FT                   VLLKLLEKIITSATLDYPNVDLDEKNEHSDAVRDLRYACGIELNRMAILMPDSLGKIYD
FT                   DLQNVVAGIMPKLSYHEKISFKSFLLTIVLKSSLGEKEERFTLIVDPELSAWSDKSTVV
FT                   GLTDLPWFMERLGIVQISEYFQKRGISENVDLLSIPIDEEGKQLKTQLSKRWQTLFPVR
FT                   ATRMFVHYSMQSIKNDEEFEVLQALWKPRVIPILPYIMRLLYQLQSYHDPENWRDLPVI
FT                   VQSFVKCSTIERFWEAGASNKSKDEFIDEHMKAMQTLRDFADSVGHIVRYTREYVLLVI
FT                   SAISSLGSVFYEIEELPQMLMDSIAIYKPATGEISPGVSTHGWKHIINVAIRPLLKNCP
FT                   PRSAKKFMTTFLPKLFDTLDALLCKKWSVYMNDIDVNPSPRDDDEMTEEILEENLLRQL
FT                   TTVVVRLLIDCVGQVGTNSQASKMKLNSHQIEMRKIIFGNSEVMASFLKLLNHLMSFRD
FT                   SKCSFNSILVMKSCLVDTLIKNESVDQFFTTEIMPNLLLNVLTQNAFKDSLYEGLYVFT
FT                   VIFLTLCKEYKSSIQYLCQLSNGFDVESLYESVRSVENYKSQRALMVEFIDWIKTVNGN
FT                   NMEDQDDDDKRRQEKRQILLERANERLIKKNKEQKDILDDPNTEDGAFGSLFTS"
FT   gene            complement(<277387..>278463)
FT                   /locus_tag="KLTH0E03080g"
FT                   /old_locus_tag="KLTH-ORF9908"
FT   CDS_pept        complement(277387..278463)
FT                   /locus_tag="KLTH0E03080g"
FT                   /old_locus_tag="KLTH-ORF9908"
FT                   /product="KLTH0E03080p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23182"
FT                   /db_xref="GOA:C5DHC1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC1"
FT                   /protein_id="CAR23182.1"
FT                   /translation="MSIYRTVLNDDYSWPGPLSQLPLKIDPSMIEKLDPEYVEFFNEVL
FT                   CERPDILETHKYPVAQTKAGGNVIPGQSPPKEMAKIYEIEIPRKYTSADTSIPARVFVP
FT                   KGNKPASGWPCTIWYHGGGWVLGSISTENSYCTHLADLAKCVVITVDYRLAPEFPFPAC
FT                   VDDAFEALLFVMENAAKLDVDNTKVCPAGSSAGGNLAAVMTHKYASSELSGGLPPLKFQ
FT                   MMVVPVTDNTATGETQLSWKENEKTPQLPATKMLWYRKIYLPEAGHTLSHPESSPLFHK
FT                   GDSFRNVPPAFIAAAECDVLRSEAEAYHAKLREHGIESKLVIYRGVPHTAMVMDNRLSQ
FT                   GAKLVRDTILSIRDALYS"
FT   gene            <278921..>280168
FT                   /locus_tag="KLTH0E03102g"
FT                   /old_locus_tag="KLTH-ORF9907"
FT   CDS_pept        278921..280168
FT                   /locus_tag="KLTH0E03102g"
FT                   /old_locus_tag="KLTH-ORF9907"
FT                   /product="KLTH0E03102p"
FT                   /note="similar to uniprot|P53095 Saccharomyces cerevisiae
FT                   YGL196W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23183"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC2"
FT                   /protein_id="CAR23183.1"
FT                   /translation="MSYPYQFTSRSSKQELLSAYYGKDLSDLPTPSLVVDRSVFKKNCE
FT                   KMLMNAEHLHADFRAHVKTHKTVEGTLLQLGSDERRTDKIVVSTLMEAWGLLPLIEKGL
FT                   INDVLFSLPVVKSRLSELAALSERVPNLRLMLDNREQLQVLSEFSESFTFQKKWSVFIK
FT                   INMGTDRAGFSDDFTLKETLCDLLKSPLKDYVSLYGFYCHAGHSYASSTEEQAKSYLLN
FT                   EITSGNAACKKALEVDPSLKLQLSVGATPTAHASEMLKVSSLGKLYGRLELHAGNYPFC
FT                   DLQQISTNCINSKQVSCKVLAEVVSSYPGRGLKAPGEQLVNAGVIALAREFGPLPGYGR
FT                   LSCPEEYENWIVGRLSQEHGILTPLKERETAMIPLGTKVQIIPQHSCITAASYPWYFII
FT                   DNGDSVVDIWVPWRGW"
FT   gene            complement(<280411..>283056)
FT                   /locus_tag="KLTH0E03124g"
FT                   /old_locus_tag="KLTH-ORF9906"
FT   CDS_pept        complement(280411..283056)
FT                   /locus_tag="KLTH0E03124g"
FT                   /old_locus_tag="KLTH-ORF9906"
FT                   /product="KLTH0E03124p"
FT                   /note="weakly similar to uniprot|Q12139 Saccharomyces
FT                   cerevisiae YPR022C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23184"
FT                   /db_xref="GOA:C5DHC3"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC3"
FT                   /protein_id="CAR23184.1"
FT                   /translation="MTEKKRKRGSGPFYCPFPGCFKSFSRSDHLGRHRANHSSQKFKCE
FT                   WPACEREFSRLDVKKKHFARHLKNSNEGFDRTSFLYDNERNPNTDDKNDKLDLTIMQGS
FT                   SSEQKMNGKKPRGSSILPPKSNGVGSVLENTDTTHTESNASSGPVTGNKKISPEELEEN
FT                   LAFTNDSAGEGGVVDNFSSTPTHSESLGLPTTLKNQKNCSTYIPQTNEAFQEVEGSNLP
FT                   GFFKPPGMGSSSTFQGIQWLLGHSPKTTSATGRHSNHPENGAFHGHYESPLELSSLSVL
FT                   EEIFSFSPEFPNAESQTSVDDEMLIEMAKCIPSVKNHPDFVAQKLEWFLEVYWLLYHSQ
FT                   YPILHRPSFSAHDTPPLLLTSMIMMGASLSKRTIEAVHIQLVDPDGLSGMIAGPLRWLI
FT                   FSSEQAKPPCKSWVIQSLIILETYEITSSSRCLHERACIYNGAKVQLLRRSPILGGDPL
FT                   KEVGSDTSRSQNLWSTWIESESMKRVALMSFYIDSVHAIIFGHPLNLLANQIKLSLPCP
FT                   DDLWEYNNIDRNKAPLSVAQTPLFCDAIKKLLQREEIEVGPFSMQILLAGLINLFLQIE
FT                   QNLSQWSSFGWKSIQDSWRSTICSAIDFWKTQIPSKNCCSTFSSVYHLNCTSAVNRPLP
FT                   PLLSSEDTRCSCPIYHAAQISTRMTHYDYIVFAGAPGRMNVAILDEDYEVVEQRIGKWA
FT                   ESQVGRLCVINSLILLCEVLLSPENSLEAVSYLYEPDKDPFLYRPNIVVSAVLSLWAYA
FT                   YYVLGSESSFRSANSTFQIQEGCTPAMEDAPTYLSRIRGELKSLTDKPFYTLNQMDTSE
FT                   YSDTITVYAQELPNVKNLNYMVGLLTSLRNGYNKCQWQVGREYAKLLDNCIQRSLGSEN
FT                   VFCQDMYDVK"
FT   gene            <283871..>285379
FT                   /locus_tag="KLTH0E03146g"
FT                   /old_locus_tag="KLTH-ORF9904"
FT   CDS_pept        283871..285379
FT                   /locus_tag="KLTH0E03146g"
FT                   /old_locus_tag="KLTH-ORF9904"
FT                   /product="KLTH0E03146p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23185"
FT                   /db_xref="GOA:C5DHC4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC4"
FT                   /protein_id="CAR23185.1"
FT                   /translation="MSVKLQENYEETPLDVKGSACLRGSISERETFSSEHNVLFDASLE
FT                   KSVCWKFDVRILPMIAVMYLFNALDKGNISNAKTDHIDKDLSIEGQQWNNMLSIFYIPF
FT                   VLFAFPLSLVIKKYNAANVIPILMFIFGSISLLSATAFNYGSLMAARWFLGICESAFFS
FT                   GIIYYLSTFYRRHELARRLSIFYAAANIANAFSGLLSFGVFQIKNSKLKGWQILFLIEG
FT                   SLTVTFAVVAFLYLPRSPEKSHFLTGDEKECAKWRIEVDSSAKSEERISFTDAVKVFKH
FT                   PIAIAWMVQEILIGVPLNSINNWFPQIVQSLGKGTVQTNLYTVAPNVWGAIALIILSFS
FT                   SDYARIRSVFIMIGVSVTLIGFVVFGCVDTKSHLGAAYFSCFLMTTGSSVSSVLTSTWY
FT                   NNNTPNENRRVVISAVGVPLANAAGLISTNIFRPKDAPKYLPALGITAGFGGAAILLVA
FT                   GILCYMIFDNHRRNKRQGIKLTYKDVPTSELAEGPSNPNYRWMY"
FT   gene            complement(<285658..>286104)
FT                   /locus_tag="KLTH0E03168g"
FT                   /old_locus_tag="KLTH-ORF9902"
FT   CDS_pept        complement(285658..286104)
FT                   /locus_tag="KLTH0E03168g"
FT                   /old_locus_tag="KLTH-ORF9902"
FT                   /product="KLTH0E03168p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23186"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC5"
FT                   /protein_id="CAR23186.1"
FT                   /translation="MAQFILQVPTFIYQLHDLGTSIMVAKKITWESIEGKEHPTLSPAF
FT                   VSNGHVFTSGIIGSKYGTGEVSQQIEDQVHLAIQNLENVLAVAGSSLEQVFKVTMFISH
FT                   AEYSKVVNEIYGQYFPQKPARSCVVVAFMDAAIKYELEAVATLE"
FT   mobile_element  287262..290045
FT                   /mobile_element_type="transposon"
FT                   /locus_tag="KLTH0E03190t"
FT                   /old_locus_tag="dnatranposon.6"
FT                   /note="DNA transposon of KLTH part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:degenerate
FT                   copy"
FT   gene            complement(<290159..>291568)
FT                   /locus_tag="KLTH0E03212g"
FT                   /old_locus_tag="KLTH-ORF9895"
FT   CDS_pept        complement(290159..291568)
FT                   /locus_tag="KLTH0E03212g"
FT                   /old_locus_tag="KLTH-ORF9895"
FT                   /product="KLTH0E03212p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23187"
FT                   /db_xref="GOA:C5DHC6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC6"
FT                   /protein_id="CAR23187.1"
FT                   /translation="MYKAPSRLLSKRCVCVKLDLKNITRSFNNTCVAASCEDMTVESPL
FT                   KIQSGRLNQTILESGDRFGAAFRWGEKFHEFGMKRLAGTKEDGAARDWFIEECKYLGCK
FT                   IKVDKIGNIFATYPGKNGGKPTAAGSHLDTQPEAGKYDGILGVLAGLEVLRTFKENKFV
FT                   PNYDICVVCWFNEEGARYAHSCMGSTVWAQNMPIQEAYEMKSINEEKPESVYESLKNIG
FT                   YIGDAAASYKENELDAHFELHIEQGPVLEGEKKEIGIVTGVQAYHWERITVGGVSAHAG
FT                   TTPWRLRRDALLMASKMILAAADVAKRHGGLFTCGVIDVKPYSINIIPSEAIFTIDFRH
FT                   HLDEKMSEIINETKVEFDKLVKEGKTAYKDEVLLTSKAVKFHDVCIDCVTKSALAQFDE
FT                   SKVMQLYSGAGHDSCQTSSRIPTSMIFIPSKDGLSHNYYEYSSPEEVENGFKVLLQAIV
FT                   NYDELRLRRGY"
FT   gene            complement(<293162..>294727)
FT                   /locus_tag="KLTH0E03234g"
FT                   /old_locus_tag="KLTH-ORF9893"
FT   CDS_pept        complement(293162..294727)
FT                   /locus_tag="KLTH0E03234g"
FT                   /old_locus_tag="KLTH-ORF9893"
FT                   /product="KLTH0E03234p"
FT                   /note="similar to uniprot|P15365 Saccharomyces cerevisiae
FT                   YJR152W DAL5 Allantoin permease;ureidosuccinate permease;
FT                   expression is constitutive but sensitive to nitrogen
FT                   catabolite repression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23188"
FT                   /db_xref="GOA:C5DHC7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC7"
FT                   /protein_id="CAR23188.1"
FT                   /translation="MLSQFKPNSPVFEMEKSCEKQHKVMTSSEEVALGEFEEGPLCSKA
FT                   GVDLGMEAAQESMGLQVDEVTNKRLLRKADCYICTMMSVVYAVQYMDKQTNSYASIMGL
FT                   RKDLKMHGNQYSWVGTCFYLGYMIFEIPSSLALQRFPIAKVSAVFIVLWGFVLCMTSLP
FT                   KNYASFIATRTVLGILESAVTPAFMLLTSQWYRREEQFLRTSIWSASAGLGAILGSLIA
FT                   YGLAVRDPSSLPIASWRLLYVVLGVVTIVLGVAFFFVPDTPASAWFLTKEERLLTVERI
FT                   RSNKQGFGNRHFKKNQLREVFMDIRTYIYFATMVAAEIPNGGIGNFGSIMLTDMGYNSK
FT                   RALLMGTPFGAVEFGGIILVGYIAQKKQKRMAAAFFSYCLNIVSGCLLAFPSNTNAQLA
FT                   GYYLQGMAVIGWICFISCVSSNTAGHTKKVVTSAICMIGYCVGNLIGPQTFKSAEAPHY
FT                   KSAKIAIVVCFVICLFLTVLLYCINVRANKIRDEKNEKLDSSFVNSEFADLTDFENPEF
FT                   RYSL"
FT   gene            complement(<294997..>297021)
FT                   /locus_tag="KLTH0E03256g"
FT                   /old_locus_tag="KLTH-ORF9892"
FT   CDS_pept        complement(294997..297021)
FT                   /locus_tag="KLTH0E03256g"
FT                   /old_locus_tag="KLTH-ORF9892"
FT                   /product="KLTH0E03256p"
FT                   /note="weakly similar to uniprot|P39529 Saccharomyces
FT                   cerevisiae YJL206C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23189"
FT                   /db_xref="GOA:C5DHC8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC8"
FT                   /protein_id="CAR23189.1"
FT                   /translation="MPPEKVAKERKRSKKACQRCSAQKVKCLGEKPPCRACVLSKNQDN
FT                   CIFPVKPRKITVLDTDVYQMEQKLQKLQSECSRLKGLAAAATCEPSEEAEDLDPLYHGP
FT                   TICTDSPGKSSGSNVAGSPSCQIFIGNLQWRILGDATKQKFDERATNNNTSMAAEEGRN
FT                   CLKRIHLNDRVINTKEAFEAPVLPLKAYALEMVHTVFNFFAREYGLFSKAGFEARLNET
FT                   YKHPNSQDSDWLAYLMITFAVGEQYMNEAGLKNQIPGMCYYISALKYFHEPIEEPNLDS
FT                   VRTLILIAFYSQGLNRMNSVYAYTGLALSTAVAQGIHRQANNHQFPRAEQEARKKIWWT
FT                   AFLMDTLWASRLGLPPHFNSCDIDIELPDESMSTEDGFDPKYLIANTHLALLVRSVMRE
FT                   VYGATRESFVENVFCNLKRLEIFMASLKPELKTYTTVAKDNRSTANLHLRYNQLIILTV
FT                   RPLYLSLLKDPKKRTEEIDRAIIKCTEAAAANVGILCTLFESKCFSAFGFLEAQCCFSS
FT                   ILILIMAVLDGHSFSELPVAVSLNSFMSNIGNITAIDNHCRLRTLIEVLPRSQNHSTTA
FT                   TAKSSVQSSAKPNSKTTPPAETNSRIKSTVTEFSNKFHVQDTCSTATCQSGKWPLDPEL
FT                   EFLGNLDECSNGFEQLTPETASNISSNLGKWDSFISKRS"
FT   gene            complement(<297218..>298024)
FT                   /locus_tag="KLTH0E03278g"
FT                   /old_locus_tag="KLTH-ORF9889"
FT   CDS_pept        complement(297218..298024)
FT                   /locus_tag="KLTH0E03278g"
FT                   /old_locus_tag="KLTH-ORF9889"
FT                   /product="KLTH0E03278p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23190"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC9"
FT                   /protein_id="CAR23190.1"
FT                   /translation="MPSGNPVLDSATRKSLKAPVFNNLYEKRAWMLEHMAGVLRIFGRK
FT                   GYNEGCAGHVTIVDPVDPTSYWINPVGVHFSMITVRDLVHVNAKGEAIGGSEAPFSLPG
FT                   FKIHSQMHKARPEISSICHAHTFYARTFSVFGKKLEMMSQDSCLVHNNYALMADYSGVG
FT                   LDEVEGDKVSKALGDKMAILLQNHGLMTVGKTVDEAGYLLILLENMCKAQLLADAAAGN
FT                   SAALKHIIPDNVAKSAFDVISGPDSLYAALQPDYELEVYLSKGDFL"
FT   repeat_region   299273..299419
FT                   /locus_tag="KLTH0E03300t"
FT                   /old_locus_tag="Klth0E.LTR.1"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   repeat_region   complement(300008..300424)
FT                   /locus_tag="KLTH0E03322t"
FT                   /old_locus_tag="Klth0E.LTR.2"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            complement(<300629..>301930)
FT                   /locus_tag="KLTH0E03344g"
FT                   /old_locus_tag="KLTH-ORF9887"
FT   CDS_pept        complement(300629..301930)
FT                   /locus_tag="KLTH0E03344g"
FT                   /old_locus_tag="KLTH-ORF9887"
FT                   /product="KLTH0E03344p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23191"
FT                   /db_xref="GOA:C5DHD0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD0"
FT                   /protein_id="CAR23191.1"
FT                   /translation="MRNQSKCHSLKIKKGRLNQTIIDTGERFGGVERWGNKPHEFGMRR
FT                   LAGTSADGAMRNWFVRECRSLGCDIKVDQIGNIFAIFRGREKGKPTAIGSHLDTQPQAG
FT                   KYDGILGVLAGLEVLRTFKENDFVPHYDVCVIVWFNEEGARFTRYCMGSSVWAGTLDLE
FT                   EAYGMLSVTDVKRESVRDSLLNIGYLGDAPASYLENGIDAHYELHIEQGPVLEDEEKKI
FT                   GVVTGVQACYWEKFTVFGIGAHAGTTPWRLRKDALNVALRMIIKAEEVARKFGGLFTCG
FT                   MIDVRPYSANIIPSEASFTLDYRHDFDETLFKMLEEAKASFSQLVESEEMSYKSERLAY
FT                   TPVVNFNPACVKCVSKSALSLFREIAVKNMQSGAGHDSCQVSTRVPTSMIFVPSKDGLS
FT                   HNYREHTSPEDVESGLEVLLGAVINHDTLRAERL"
FT   gene            <302895..>303683
FT                   /locus_tag="KLTH0E03366g"
FT                   /old_locus_tag="KLTH-ORF9884"
FT   CDS_pept        302895..303683
FT                   /locus_tag="KLTH0E03366g"
FT                   /old_locus_tag="KLTH-ORF9884"
FT                   /product="KLTH0E03366p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23192"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD1"
FT                   /protein_id="CAR23192.1"
FT                   /translation="MSIEFENHVISTEGQLKSRFKYLLECAYLKFFKVTTGDERNPFAF
FT                   TGDDKVDNMLESLARLKNDAETRRSEIQKLEVERQRNRKNIGQAVCDYSMPIVEENLDA
FT                   SESESSLSAIDDVNKPNRRTIKRKRVLEPPWNLPLLNHIRNSLPDTSLMADQLNLGLTN
FT                   SIAQAAEDRKRKDRELDTQQERLELDTQQERLELELQRQKMDMKRQEVDLKLQEMKLKS
FT                   QEAQKLIQLLELAGKSDGVERLCPRLTFLLQEKLDSLFKS"
FT   gene            <304078..>305088
FT                   /pseudo
FT                   /locus_tag="KLTH0E03388g"
FT                   /old_locus_tag="pseudo-Klth0E-304078-305088"
FT   gene            complement(<305592..>306473)
FT                   /locus_tag="KLTH0E03410g"
FT                   /old_locus_tag="KLTH-ORF9878"
FT   CDS_pept        complement(305592..306473)
FT                   /locus_tag="KLTH0E03410g"
FT                   /old_locus_tag="KLTH-ORF9878"
FT                   /product="KLTH0E03410p"
FT                   /note="highly similar to uniprot|P38805 Saccharomyces
FT                   cerevisiae YHR088W RPF1 Nucleolar protein involved in the
FT                   assembly of the large ribosomal subunit contains a
FT                   sigma(70)-like motif which is thought to bind RNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23193"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD2"
FT                   /protein_id="CAR23193.1"
FT                   /translation="MAPDELRIRNKMKRQELFAEVKDQKNKERHKMRKQRAKEERENPE
FT                   LKEKRLKENVTNTIDSLRVYDETIHQEVEGDEADFAQFFNNGTEPPKILLTTNVNAKKK
FT                   AYEFANVLIEILPNVTFVKRKFGYKLKEIVEFCSNRNYTDLVIINEDKKKVTGLTFIHL
FT                   PEGPSFYFKISSYVDVQKIVGHGRATSHIPELILNNFQTRLGNTVGRLFQSIFPKNPDF
FT                   EGRQVITLHNQRDYIFFRRHRYVFRNEEKVGLQELGPQFTMKLLRLQHGIKEETEWEHT
FT                   ADMDKEKKKFYL"
FT   gene            <308140..>310341
FT                   /locus_tag="KLTH0E03432g"
FT                   /old_locus_tag="KLTH-ORF9872"
FT   CDS_pept        308140..310341
FT                   /locus_tag="KLTH0E03432g"
FT                   /old_locus_tag="KLTH-ORF9872"
FT                   /product="KLTH0E03432p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03432g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23194"
FT                   /db_xref="GOA:C5DHD3"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD3"
FT                   /protein_id="CAR23194.1"
FT                   /translation="MATQMESPLLDPLSGVDRESQSSNMASPVQFIKEYIERTLNTPPG
FT                   FPVSVAAEHYKRQRLVEEIVESETEYVQMLKILRNCFLDVLSINDYIPMKVLNNVVGQI
FT                   LAHHEELCRCLQAVVDGSVKRFDETTELNWSDLSLTSWDHLEVCQQVAEILSTHAVQAK
FT                   QYCSYLYYYNQISHLLARMGRESEDGLLFAILFRIELCLPKYYSHTSHQGYKRDFSFRA
FT                   MIQMPINRIAKYRLFLESLVYLTETPSITDLRRLDETKCQALIHSIKTSLGSMYSNLQK
FT                   VDEANCEKLPDPALVLVYNRLTFSSPDERIPVEAMGNCYTRGCLAVAWTCMDEAAHSAG
FT                   SHRKSSARYFNNFHRAKRSLRIESEQLGVFLFKSYLIFAEIPSFKLGTASYEWPIKFAI
FT                   RLASCRLMDARPAVQRALQGGMKDCGIYSEYENAIKLQFEYDFKLWEILLLCWDSQELE
FT                   AWRKELSLFINEINGPHTFGVDPLRETVSQSALESTLHFSDSTTFPDQMLPFMVYNENL
FT                   SGRFDRTRAFKRGLSTRAGQCYEGQTVEVAVEFRNADVDMSPSSTWFLRGSSSRVNCTT
FT                   LASSSTCAFVEASTGVSSTPDAEAISINERCREQRDSSAPCAVLSRWRRGEIERAMRDV
FT                   WSSHLNLQAADIITTVAGASTGTSIYDDTLGSLRALLRTASDNCVAVTGTQSTPVKSSC
FT                   AQPPAPPARAATRWSIKRVFSRRRRGSQSVVRHQNALKR"
FT   gene            complement(<310411..>310737)
FT                   /locus_tag="KLTH0E03454g"
FT                   /old_locus_tag="KLTH-ORF9869"
FT   CDS_pept        complement(310411..310737)
FT                   /locus_tag="KLTH0E03454g"
FT                   /old_locus_tag="KLTH-ORF9869"
FT                   /product="KLTH0E03454p"
FT                   /note="similar to uniprot|P38804 Saccharomyces cerevisiae
FT                   YHR087W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23195"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="InterPro:IPR036786"
FT                   /db_xref="InterPro:IPR039100"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD4"
FT                   /protein_id="CAR23195.1"
FT                   /translation="MAATKYFYKGEETDLVIFVESQELADQYLKDPTIGKLTEAVGVFK
FT                   IFTNQQGEGAEGELGEASKAQIENEFGKGIKIEEAIARILQEGSPNARGDVNKDKFQSR
FT                   NDSK"
FT   gene            complement(<311391..>315815)
FT                   /locus_tag="KLTH0E03476g"
FT                   /old_locus_tag="KLTH-ORF9867"
FT   CDS_pept        complement(311391..315815)
FT                   /locus_tag="KLTH0E03476g"
FT                   /old_locus_tag="KLTH-ORF9867"
FT                   /product="KLTH0E03476p"
FT                   /note="some similarities with uniprot|Q05471 Saccharomyces
FT                   cerevisiae YDR334W SWR1 Swi2/Snf2-related ATPase component
FT                   of the SWR1 complex required for the incorporation of Htz1p
FT                   into chromatin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23196"
FT                   /db_xref="GOA:C5DHD5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD5"
FT                   /protein_id="CAR23196.1"
FT                   /translation="MTVAPNIDEQIADLKFNYEVLINELFHLKEFTSLVEYDPCFRNSS
FT                   ESFEHFVKTSGLGLSKPAIEAVEDASASRRVRRRQSRRETIPEASCSESVEGLIDERFH
FT                   ELECQMTNKKYKRQSPAIRELSAPKKRKAAVKVEAPPKESIKKEEEKIAPPSPPKLHHK
FT                   SSSIDNEQVSDKGYNSMCYTTSSSEDEAENRRTKRKRPRVNLIVNIPKQTVTNPLHVTK
FT                   PEFGSLSEFLQSYKSLDEDMSIEEFNKFIEEQRRLFANIRKGLESGVLKYDPATDSIEP
FT                   ITLKDAAGVHAHRPEPITYFYKEQQQYTFQDHLINQGIVMSRAFQETKKARISRIRKIT
FT                   QMIEQHFRHIAGAEERRQKEEEKRLKTMARTAVQAVKRRWVTAEKAYKVLKKDEEDQLK
FT                   KIQGKEHLSKMLEQSTQLLGAQLKRPNQDDTEKDLNTSASHSDVDQSDSNSDSFTSSDE
FT                   EDSASGNEDDARLSVEQLQMKYANLDSSPKSEDEESKTEREDSMDAAPVNLLSEKERLE
FT                   LKKDLEDKSLGLLDESDDEDTDSMSEHSSEPDSGEDEQGSEATSESVPKSDDGLASIFN
FT                   NIEEGESEVESDYASSTSAEEDDAFDSEESADDNSQEDLDHSANVGYEKKPEPQGGQLV
FT                   PEKDSLTVVDVPIPSLLRGTLRIYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISL
FT                   LAYLACEKQNWGPHLIIVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKDKRKGWNRP
FT                   DAFHICITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLT
FT                   GTPLQNNLAELWSLLYFLMPQTAVGNNGGIQGFADLEAFQQWFGRPVDKIIQIGEGYAQ
FT                   DEETRKTVTKLHQVLRPYLLRRLKADVEKQMPAKHEHIVYCRLSKRQRFLYDDFMSRAQ
FT                   TKETLASGNFMSIINCLMQLRKVCNHPDLFEVRPILTSLCVEKSVAHDYVYLNNLVSQK
FT                   LHAMDHEREIDLEVLNLKFTSNDWSLSTHHAASINKSQCVEQFVKEVSKLRAETEEQLK
FT                   MGASESALNFQDINQFYRTFAAKKTDDMMGRLEHLQYLNNMRCTRKPVYGNNLIKLLSI
FT                   NKPVREGPLKELCRPLQTRILDSDALIDKFAVITPTVVSLDSRNMALGLNDESEFHSNL
FT                   REDLKQVLRRTDNPLHKLQTKLAIAFPDKSLLQYDCGKLQKLATLLRDLKDGGHRALIF
FT                   TQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNTDNRITAFILSSRSGGLG
FT                   INLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQK
FT                   RQLDNVVIQRGDFTTDYFTKLSVKDLVGAEVPEIEANNRPLLMDADAATKDPRKLEKLL
FT                   AQAEDADDVKAAKLAMKEVEVDNEDFQEVKNGPQGPKEDDASEEDDPDDEYQGTRHVEE
FT                   YMIRFIANGWYWE"
FT   gene            <316845..>316916
FT                   /locus_tag="KLTH0E03498r"
FT                   /old_locus_tag="Klth0E.tAsp.GTC.8"
FT   tRNA            316845..316916
FT                   /locus_tag="KLTH0E03498r"
FT                   /old_locus_tag="Klth0E.tAsp.GTC.8"
FT                   /note="tRNA-Asp (GTC) cove score=69.96"
FT   gene            complement(<317318..>318868)
FT                   /locus_tag="KLTH0E03520g"
FT                   /old_locus_tag="KLTH-ORF9860"
FT   CDS_pept        complement(317318..318868)
FT                   /locus_tag="KLTH0E03520g"
FT                   /old_locus_tag="KLTH-ORF9860"
FT                   /product="KLTH0E03520p"
FT                   /note="similar to uniprot|Q00539 Saccharomyces cerevisiae
FT                   YHR086W NAM8 RNA binding protein component of the U1 snRNP
FT                   protein mutants are defective in meiotic recombination and
FT                   in formation of viable spores involved in the formation of
FT                   DSBs through meiosis-specific splicing of MER2 pre-mRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23197"
FT                   /db_xref="GOA:C5DHD6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD6"
FT                   /protein_id="CAR23197.1"
FT                   /translation="MSFGSSLNSFNYGSSRGDYAPQQSIHHTQSHSSPAEQSASRSNSL
FT                   YMGDLDPSWDENAIRAVWANLGEPNVQVKLIRNSGSTGGSSGYCFVEFPSHLNASNALL
FT                   KNGLLIPNARNRYLKLNWASFATAPGNEHSVFVGDIAPNVSEAQLFELFISRYASTLNA
FT                   KIVFDQMTGVSKGYGFVKFGQESEQQRALLEMQGVFLNGRAVRVSTTSKNRSKFQQPLQ
FT                   QQQQPYMQQQQPYVQQQARAPAFNNGNVQSQFIYPVQQQPTLTQYTDPNNTTVFIGGLS
FT                   SLVSEDELRAYFQPFGSIVYVKIPVGKGCGFVQYVDRISAETAIAKMQGYPIGNSRIRL
FT                   SWGRSAKQAAVMQQAFASSAQHRQQLSNQNALSTTNLPYNRQPAMPVSYGYSGNWDLLN
FT                   GGCSYKPSSPAHYANSVHDATGGSSTVLLPGVSNLEYVGAPSNSSSTSTFSYSPSYSAS
FT                   QSTTYSTSSQATDPVSAALGYGAQVHPQFLVQGNDAFDKSKSETIDRLERGSNGFIFA"
FT   gene            complement(<319728..>320810)
FT                   /locus_tag="KLTH0E03542g"
FT                   /old_locus_tag="KLTH-ORF9856"
FT   CDS_pept        complement(319728..320810)
FT                   /locus_tag="KLTH0E03542g"
FT                   /old_locus_tag="KLTH-ORF9856"
FT                   /product="KLTH0E03542p"
FT                   /note="similar to uniprot|P38803 Saccharomyces cerevisiae
FT                   YHR085W IPI1 Protein of unknown function essential for
FT                   viability may be involved in rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23198"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024679"
FT                   /db_xref="InterPro:IPR037947"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD7"
FT                   /protein_id="CAR23198.1"
FT                   /translation="MAKKKTLKQQDFQKKKLKVGKPKQQASNVTSTAFTARTISLPNQQ
FT                   KLKSAGNREDSGDERLEADILRRLSLCKHHSAVTRKETLVHFKHMVPRIITAKCMTPLL
FT                   NSCYPLICDQDIQVRSALLELLEEIGQYDQNVLRLHSRALVLFINSSMTHIVPAVQRDS
FT                   GKFLQCAVRYCGDELVRNSWVKMLKGMFSVLGWSLEAPGSKKSSKSVSMGVKTSSVVSM
FT                   NSTKAKRSLQANLETLLEFVKCGCLEPKPDPSSGELPHGPSAYDKYLIPALPQPYQHLK
FT                   LFVKELKNEKTASHSKLEELNNTSFQDYATRREVLLEHFYDRVLENVENVIADGGECGR
FT                   VAKSLKGTMGDIKSLQDACA"
FT   gene            <320984..>323116
FT                   /locus_tag="KLTH0E03564g"
FT                   /old_locus_tag="KLTH-ORF9854"
FT   CDS_pept        320984..323116
FT                   /locus_tag="KLTH0E03564g"
FT                   /old_locus_tag="KLTH-ORF9854"
FT                   /product="KLTH0E03564p"
FT                   /note="similar to uniprot|Q05468 Saccharomyces cerevisiae
FT                   YDR333C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23199"
FT                   /db_xref="InterPro:IPR006994"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD8"
FT                   /protein_id="CAR23199.1"
FT                   /translation="MSSRALRRLEENDLEKTLAKLAPSTQKQEPSAKTSSVKAPKQINL
FT                   FALMGQDEGDDSEDSEASNAEDRPIPASINDKPAQKPVQVLTKSQRKKNKKNKKSKQKP
FT                   KPAADLSETENGNGESDEELDRMILQFQKKDLEQRRSVDPGLTASDESDYDTAFEDEDA
FT                   SHLKGPADVKTDPGFTNFTSFSEIIKIFGDIDMKNLNPDNEYKLLFGDLSPESLADVDS
FT                   MTSTHVSPQVMKQIERLKHMVRNWGGRDHKTVPNGSTTRRLAFTKIREDWIPTPRGEYT
FT                   ITQLSQDEVVEWQSWLRSQDWMDEVRKTAHKWKDAGMNFYKFEPSNTETNRKAMTEFYM
FT                   SVVLHPDHEALIHLISSKFPYHVPALLQVALILVRQGDKANSNGLVERALFVFDRALRS
FT                   HISFNGLSCQLPYIYFFNRQFYFAIFRYVQILSQRGVVSTASEWCKVLWSLSPLEDPLG
FT                   CRYFIDHYLLLNKEYSYMANLASSPLVNTYMQWYTLGLSLGFVLSFLKLDMVEKAKTEL
FT                   RKAFTYHAASLSTIFKEVALGDANLLNGLDFPEPCSEIELESKAYLIRMKAIWGGVEIK
FT                   FLHDEILNILSEYKAGKIQLECTAPIETQNELFLGDIPINLLRFAVLSQESPLMACIPQ
FT                   EIWSERDVYEFDVLPPLPHDRESEDLVETVKTFVSESDLSMSQMEVMQDENMLNQIRQL
FT                   SLEQFLQENPNADLGD"
FT   gene            complement(<323231..>325336)
FT                   /locus_tag="KLTH0E03586g"
FT                   /old_locus_tag="KLTH-ORF9851"
FT   CDS_pept        complement(323231..325336)
FT                   /locus_tag="KLTH0E03586g"
FT                   /old_locus_tag="KLTH-ORF9851"
FT                   /product="KLTH0E03586p"
FT                   /note="similar to uniprot|P13574 Saccharomyces cerevisiae
FT                   YHR084W STE12 Transcription factor that is activated by a
FT                   MAP kinase signaling cascade activates genes involved in
FT                   mating or pseudohyphal/invasive growth pathways cooperates
FT                   with Tec1p transcription factor to regulate genes specific
FT                   for invasive growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23200"
FT                   /db_xref="GOA:C5DHD9"
FT                   /db_xref="InterPro:IPR003120"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD9"
FT                   /protein_id="CAR23200.1"
FT                   /translation="MLRGQPNAQEIVKTKAEGDSEESTPEQVEESLRLIEDLKFFLATA
FT                   PANWQENQIIRRYYLNNDQGFVSCVFWNNLYYITGTDIVKCCVYRMQKFGREVLDRKKF
FT                   EEGIFSDLRNLKCGIDATLEMPKSEFLSFLFKNMCLKTQKKQKVFFWFSVPHDKFFAYA
FT                   LERDMKRQSAGQLSTTRAVSEPALSFTYDDKSGLSLYDQLLQHMESQRIKVNASSSVDS
FT                   TTANPQLTSYSPAESDDPDSDAVIKTEFVGSSQESLAQISKYAPQELVVDPIEEGADEQ
FT                   PFELDSGAQAPFLLKDASQEEDDFPLDYFPVEVEYPNQQQLQPGGGQVYYDNDFEVEYV
FT                   PLSAVPPASAGFYDNSHFTEETAFAAPAVTSAARLAFQIPPPPMSASRSHFMTNGEYYA
FT                   SYVKDQEDRGCNRASDADVALDRSDAEEVVANGGDGTMNSKQGGMLHKPNIDFRAQNGG
FT                   YPVGSFYQGKHAYPVELQQGGADPHLTRSYAMEDYLCDNSALYEGFPGGAYLPPAANPF
FT                   TPSFLMTPVAPTSPYIGVTQYGAKQVVPASAKNYPINPYYQSSPGFQRWGNVHGYVRGF
FT                   PSIQATSAPPGAPLQMHNPQSASKLYFNKPGMIHKPPSRSQNQRHRARKTAFSSRPPMN
FT                   SSHTSNRSTSDGGNSVAFLVPSSESSMVLPDGSKKKLSTSASANEPSSTDDKEIIKKHE
FT                   DDNQFHD"
FT   gene            complement(<325715..>326689)
FT                   /locus_tag="KLTH0E03608g"
FT                   /old_locus_tag="KLTH-ORF9848"
FT   CDS_pept        complement(325715..326689)
FT                   /locus_tag="KLTH0E03608g"
FT                   /old_locus_tag="KLTH-ORF9848"
FT                   /product="KLTH0E03608p"
FT                   /note="similar to uniprot|P14693 Saccharomyces cerevisiae
FT                   YHR083W SAM35 Essential component of the sorting and
FT                   assembly machinery (SAM complex aka TOB complex) of the
FT                   mitochondrial outer membrane which binds precursors of
FT                   beta-barrel proteins and facilitates their insertion into
FT                   the outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23201"
FT                   /db_xref="InterPro:IPR021211"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE0"
FT                   /protein_id="CAR23201.1"
FT                   /translation="MRSILQVPGPVKAFFDQFPLQTYPAVSKKDDASVYEYNAQSYGFR
FT                   EQEAAQRSANDVFKLGVYNVVEDPESGCVLATDPWCLYAQLSLCKKNGLKLAHKKGAQQ
FT                   QQQRQQQRQQPALLVVSRLAASDKSLPILIEGCSKRNVRSTAGINEILSSRLRDAEELM
FT                   YVSLLDSVVYDCWTTQALCELSVAKFLELYDCAPIDVALLQRAFYQTLREDLLERNDFS
FT                   LRHLEISRHVRYMHLYQSRNAHQLTAPLFESCKAALDRFAALLGSRTFFSGEMEPGYLD
FT                   LKLASYVLCFLSLDDQESSLARYLRQEVHALAIHSRAVIAHFK"
FT   gene            complement(<327367..>329385)
FT                   /locus_tag="KLTH0E03630g"
FT                   /old_locus_tag="KLTH-ORF9846"
FT   CDS_pept        complement(327367..329385)
FT                   /locus_tag="KLTH0E03630g"
FT                   /old_locus_tag="KLTH-ORF9846"
FT                   /product="KLTH0E03630p"
FT                   /note="similar to uniprot|Q06683 Saccharomyces cerevisiae
FT                   YDR332W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23202"
FT                   /db_xref="GOA:C5DHE1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE1"
FT                   /protein_id="CAR23202.1"
FT                   /translation="MTSCTRFVGAAGALAKAGNSLCLASRPYSSLALRDYQHECIDRCL
FT                   ESISQGRRRIGVSLATGGGKTVIFSNLIDRLRRESGKSGYRTLILVHRRELAQQACRVL
FT                   QAFFPGLNFQIEMGNYKCDINSADVVVASVQSLIRRLERYDPSCIDLIIIDEAHHAAAK
FT                   SYLRILEHFKANHKDSILPVVGFSATFERADNKALSAVIDEIVYHRGILEMIDDKWLCE
FT                   GRFTTVSVSLDLSDVAVTGSDFNIDGLSKVVNTKEVNKVVLQTYLQKRDLHKLRSTLLF
FT                   GCDIKHIETLHSLFVKHGVNAQYVTGKTRQSERDAIVEDFKRGRIEVLMNCGVFTEGTD
FT                   IPNVDSILLCRPTKSRSLLVQMIGRGLRLHHSKKHCHIIDFVGASTVGVVSFPTLAGVE
FT                   AVSTGLDEATLQDLKAIKDEIVAKQLEAERKVLAEKEAESLLKRQFRDLMKSANAFDLT
FT                   LTTYKDFKSFYQQMAATNGSQEQDWGSEKGKEIRLFRDSSYPWVQFAKDAWGMPLDAGH
FT                   HLRIYRESREASRPSTYVLKLYKELPYKVRSELGIRYKPLTVKSSTDLSAVVASVENIV
FT                   QELTEGTSPRPKNFTKYASWRHTPATPKQTALLKSKILGHISKSGSKSEQLQATDIDKF
FT                   LGSVTKGDVSNVLFATSLAPVYPIKSLCKIISLRTKS"
FT   gene            <330227..>332671
FT                   /locus_tag="KLTH0E03652g"
FT                   /old_locus_tag="KLTH-ORF9842"
FT   CDS_pept        330227..332671
FT                   /locus_tag="KLTH0E03652g"
FT                   /old_locus_tag="KLTH-ORF9842"
FT                   /product="KLTH0E03652p"
FT                   /note="similar to uniprot|P38691 Saccharomyces cerevisiae
FT                   YHR082C KSP1 Nonessential putative serine/threonine protein
FT                   kinase of unknown cellular role overproduction causes
FT                   allele-specific suppression of the prp20-10 mutation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23203"
FT                   /db_xref="GOA:C5DHE2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE2"
FT                   /protein_id="CAR23203.1"
FT                   /translation="MTEDYEVYKEGGLLRERYKKVDDISEGSYGYVSLANDTQTKKLVA
FT                   VKYIFKNEELEHGSSFEGDTDMGSHNSSNQKKNEMIKHQKSLISDKVRSRLSKNICFEA
FT                   LYEVDIHTKVGKHKNITELYDFFDSFIIMEYCSGGDLYEAIRADLVPKKTKLITHIASQ
FT                   MMEAIDFVHKKGIYHRDIKPENILIEGSDWTIKLTDWGLATTETTSMDRSVGSERYMAP
FT                   ELFEENLDREERAEPYDCSKVDLWAIGIVLLNVVFHKNPFSVANQSDKSFCYFAANREA
FT                   LFDIFSTMSFDFFQVLRHSLTIDPTNRDLDSMKKELAQLGEYTLDDEYYNNLTDDGYTP
FT                   PKLEEESATPVSTSTTPITIEDGIGGKIPRISVETITPTASIKTKSKEKDPIPRFKFTK
FT                   RSHPNTRDGNNKPAKPIRIDNSKIIKNSRKPLAIPTPNTHINNFFHDYQSKEKESFNTR
FT                   DFFTPPSVHNRYMEGIFNKSSKHRGHRNRRPSSNGNLKFTPKQGANNLSTSFGRRGSTY
FT                   SQHSPSGKYVPPHSRPSSLYSGSPHIPTINSVLDGAESGPPVLTKSTYHEQHPAVVDNN
FT                   ENDLDDVLFTLEENDIDSFTNDIGGLAIEDTTIKSAPDTVEDIGASSANTGELPDLLKS
FT                   PTLANKELEPATRNPFFNQLQEQNPNKDTVYKHKPGVYIPPHHRKSSGGNSISNQPLSP
FT                   YGGEATLSVGQNSVSYGGLNTRRKSSGNSRAVKNTPKGRPFMSRNHGRATTEVQQSDIF
FT                   ADSNAVVFEEDDNELPSFSPSSFYQSGTFRTGRKSSSVQDELIGSLEQYKNNWLMLQQQ
FT                   QD"
FT   gene            complement(<333386..>334588)
FT                   /locus_tag="KLTH0E03674g"
FT                   /old_locus_tag="KLTH-ORF9837"
FT   CDS_pept        complement(333386..334588)
FT                   /locus_tag="KLTH0E03674g"
FT                   /old_locus_tag="KLTH-ORF9837"
FT                   /product="KLTH0E03674p"
FT                   /note="similar to uniprot|P49018 Saccharomyces cerevisiae
FT                   YDR331W GPI8 ER membrane glycoprotein subunit of the
FT                   glycosylphosphatidylinositol transamidase complex that adds
FT                   glycosylphosphatidylinositol (GPI) anchors to newly
FT                   synthesized proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23204"
FT                   /db_xref="GOA:C5DHE3"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="InterPro:IPR028361"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE3"
FT                   /protein_id="CAR23204.1"
FT                   /translation="MKCLWFIPTLFILLTSTLVGASHEHTNNWAVLVCTSRFWFNYRHM
FT                   ANVLSMYRTVKRLGIPDSQIILMLSDDVACNSRNLFPGSVFNNADRALDLYGESVEVDY
FT                   KGYEVTVENFIRLLTDRWSEEQPKSKRLLTDENSNIFIYMTGHGGADFLKFQDAEEISS
FT                   HDIADAFAQMHEKKRYNEIFFMIDTCQANTMYSKFYSPNVLAVGSSELDESSYSHHSDV
FT                   ELGVAVIDRFTYYTLDFMESINKNSSTTLQDLFDSYTFEKVHSHVGVRTDLFDRNLSEV
FT                   LVTDFFGSVKHIIKDENEQDESLETLSSGGEEDSIDNIVNLAISKNKENPLLRNTTLLR
FT                   VTQAQLMNTKDGLFNFDKKTKKSWSQTCLLSAFSVILVLVFRSLSEGRNNSGTAMLYNI
FT                   K"
FT   gene            complement(<335419..>336852)
FT                   /locus_tag="KLTH0E03696g"
FT                   /old_locus_tag="KLTH-ORF9836"
FT   CDS_pept        complement(335419..336852)
FT                   /locus_tag="KLTH0E03696g"
FT                   /old_locus_tag="KLTH-ORF9836"
FT                   /product="KLTH0E03696p"
FT                   /note="similar to uniprot|Q06682 Saccharomyces cerevisiae
FT                   YDR330W UBX5 UBX (ubiquitin regulatory X) domain-
FT                   containing protein that interacts with Cdc48p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23205"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR006577"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE4"
FT                   /protein_id="CAR23205.1"
FT                   /translation="MSQEDIDTFTAITSADNSELASQFLEMAGGNMEVAISLFYEHGGN
FT                   AQLTRSSGINDAEVAGNMQRDLYQQGQDNYRPPDEARHETLVDTHVFPSTYRGIGGQYG
FT                   PLRSVRGMFDGSRPQGIFNQHLDDDDDDDSEFSEEEDLRQSYEYVEESVVELDEDGNVH
FT                   EYTKLVKKPREMTKEQKLAMLFRPPFDMMAKVDLEGARLRGRERQKWIMINIQTVDIFQ
FT                   CQALNRDLWANKDVKRLVKDNFVFLQYQFDSQNAAPYIQFYGPHDKDELPHIAILDPIT
FT                   GERVKQWNRDVPSPNNFIQEIEDFLQIFSLNPASTNPTVKEPTPELDPTTLTEEQQLEY
FT                   AIRESIGRDSATETGAATTTLETDQEPAVDLPEADSHQMLFDSISPAHHDEPPNQPGVT
FT                   TRIQIRIGDGRRLVRRFNAKEDTVRTIYEVVKSEIEGFETVHFTLSDHKREDLLEKLDL
FT                   TINGAGLENSSLLLEVTQA"
FT   gene            complement(<337034..>337585)
FT                   /locus_tag="KLTH0E03718g"
FT                   /old_locus_tag="KLTH-ORF9832"
FT   CDS_pept        complement(337034..337585)
FT                   /locus_tag="KLTH0E03718g"
FT                   /old_locus_tag="KLTH-ORF9832"
FT                   /product="KLTH0E03718p"
FT                   /note="similar to uniprot|P38801 Saccharomyces cerevisiae
FT                   YHR081W LRP1 Substrate-specific nuclear cofactor for
FT                   exosome activity in the processing of stable RNAs homolog
FT                   of mammalian nuclear matrix protein C1D which is involved
FT                   in regulation of DNA repair and recombination"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23206"
FT                   /db_xref="InterPro:IPR011082"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE5"
FT                   /protein_id="CAR23206.1"
FT                   /translation="MDDSSKIKPYIAHLDGELKKLAKGIEQFTSKSLDEQLLEKKSERE
FT                   KLDLTNRYAYVLSSLLFAYMKLLGVKDITPIKQELDRVKRYMNLAKQLDQKNEGKTQHK
FT                   KDEQERAKKLINSALDGRASTPAISKVNFEGKHTRFEDQPVVSPEDREKLSQERQKQVP
FT                   ENKRSKGGSPRGRVSKKGRK"
FT   gene            <337770..>338270
FT                   /locus_tag="KLTH0E03740g"
FT                   /old_locus_tag="KLTH-ORF9830"
FT   CDS_pept        337770..338270
FT                   /locus_tag="KLTH0E03740g"
FT                   /old_locus_tag="KLTH-ORF9830"
FT                   /product="KLTH0E03740p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23207"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE6"
FT                   /protein_id="CAR23207.1"
FT                   /translation="MMEEAFLRDSKTLKRVAAVLKEKSHILQDADKVELTRLEHVICDT
FT                   LRAIERILEPKSSSMEISRMLNDPECAATPLGSFIPKNLRPGFKRTFFYSPEAPYARAR
FT                   DKSGSFRIAPPTPTQDRVFAKRSVHSASKDSQIQRSVSINFLLQNLALIENLRNLQRLG
FT                   QGP"
FT   gene            <338481..>339875
FT                   /locus_tag="KLTH0E03762g"
FT                   /old_locus_tag="KLTH-ORF9828"
FT   CDS_pept        338481..339875
FT                   /locus_tag="KLTH0E03762g"
FT                   /old_locus_tag="KLTH-ORF9828"
FT                   /product="KLTH0E03762p"
FT                   /note="similar to uniprot|P28795 Saccharomyces cerevisiae
FT                   YDR329C PEX3 peroxisomal membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23208"
FT                   /db_xref="GOA:C5DHE7"
FT                   /db_xref="InterPro:IPR006966"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE7"
FT                   /protein_id="CAR23208.1"
FT                   /translation="MSGRRSIWQRHRSKLYFSSAILATLLTTGAVSLYLIKKWLLRQQL
FT                   KISEQQFVKEQIKRRFTQTQQDALYTIYELMPVLSLVLAKDLDVDEIVGELKGKKLSRH
FT                   LSQRSASVKEDGEQDGLSSGMSTSLTDAQAPRASFAGQDPTAKTKAELWNELKLKSLTK
FT                   LCTVIYSTSSLLLLTRLQLNILARREYIETAVKVAVDKESSQSSIAGWLANWWHAETWA
FT                   AVQEDEKEPEGPELSEKAQQARRSSYINEQAFLSFSWWLLNRGWLQFKSLAENLVERHF
FT                   GDLNPRDMLTVEEFGGRLSSVLHAINQELLVKTDAEQALQMILLPDPNLEQFVLQQTLD
FT                   SEALKLLYEDNTVLRQLLNETTKCIESTASLIVLESLVNDAYQFAMSLIADNVSKKSKQ
FT                   KIDQDNSEASEPKFQMALFSITSKHCCDEMLKSGIVSMNNLFLQRLDSITELDDLSASV
FT                   YSNFGF"
FT   gene            <340081..>340638
FT                   /locus_tag="KLTH0E03784g"
FT                   /old_locus_tag="KLTH-ORF9827"
FT   CDS_pept        340081..340638
FT                   /locus_tag="KLTH0E03784g"
FT                   /old_locus_tag="KLTH-ORF9827"
FT                   /product="KLTH0E03784p"
FT                   /note="similar to uniprot|P52286 Saccharomyces cerevisiae
FT                   YDR328C SKP1 evolutionarily conserved kinetochore protein
FT                   that is part of multiple protein complexes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03784g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23209"
FT                   /db_xref="GOA:C5DHE8"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016072"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR016897"
FT                   /db_xref="InterPro:IPR036296"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE8"
FT                   /protein_id="CAR23209.1"
FT                   /translation="MGKDKAQNVVLVSVEGERFTVERKIAERSLLLKNYLNDMQDNGLQ
FT                   SDGSDSEEEEDADDEDGDDEIVMPVPNVRSSVLQKVIEWAEHHKDSNFPDENDDDARKT
FT                   APADPWDREFLKVDQEMLYEIMQAANYLNIKPLLDAGCKVVAEMIRGRTPEEIRRTFNI
FT                   VNDFTPEEEAAIRRENEWAEDR"
FT   gene            <341138..>345013
FT                   /locus_tag="KLTH0E03806g"
FT                   /old_locus_tag="KLTH-ORF9825"
FT   CDS_pept        341138..345013
FT                   /locus_tag="KLTH0E03806g"
FT                   /old_locus_tag="KLTH-ORF9825"
FT                   /product="KLTH0E03806p"
FT                   /note="weakly similar to uniprot|P38800 Saccharomyces
FT                   cerevisiae YHR080C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23210"
FT                   /db_xref="GOA:C5DHE9"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR031968"
FT                   /db_xref="InterPro:IPR040147"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE9"
FT                   /protein_id="CAR23210.1"
FT                   /translation="MGLFSKKRKGSTKKGNKHEAPKRAPSTSAENNGRHTVARRSIRDS
FT                   VTSNLTSDQGSSVAPGSATDTHFGSVKRRRSSPSPKRPKRRPSEIVKSKIGNLNHSKHL
FT                   HPPDELRSPQSATESSHTSPKLSTKISVLSNTKPWNANTNTNSDTAEGGNPDNKSDYEA
FT                   RNSSGIFSTIVSACHNAANHLLTKTSDKSFSADSQPWMPKEKARTSDTQPQEPQNSAFL
FT                   KHLDFLLSPSSMAQPNSQQTLLSSAPSQTGTNPSLASSRELRDSEISSQPSGHVDSIDG
FT                   HASAAETEIMSLTDGIRFYPRKGESHIATFGKGNLTLDALSKTSSSDEPLDAGSFHERE
FT                   LHTLSVTNAAKNPTRQRGKSLHSFDAKTRVQNLEENGSTISPVKSDPGTKVSSPLNEKD
FT                   DAADLSGKDVSKDVSKDASKLTEPNSEEKSRKRSSTFRIMCPRPSSPSLSALKVIPTRS
FT                   QRNSMQRARSSSITESGLHSPSGLSSDEEEHSLVEGTDKKIHKPHISEKKNNEFHALFK
FT                   DSGISPDEQLLADYSCAFSRDILLQGRIYISREHICFNSSILGWVTSFVIPFKEVVQIE
FT                   KKSTAGIFPNGIVFQTLHSRYIFASFMSRDSAFDYITHVWNHVVVGTDGSGSPNGTSGS
FT                   VGSNSRKRTMNSNFELETEGAGRLLSDGYSSGDETSDDEYEDETDMTTSDGEMSHTVRS
FT                   ASASSSQYDFETTNKSSVWTLGPSKHAPTSYDLDDADNRVVAETVFEAPLGKIVNILYG
FT                   DDVSYTEQILKAQKNYNISNIPTILGTKERKYSYTKPLAGAIGPSKTSCEITESLEHYD
FT                   LEDYVKAVQLSKTPDVPSGNLFVVKTSLYLSWAPRNSTKLTVVVSIEWSGKSWLKAAVE
FT                   KGTYDGVTNTTKTLIEEVNKIIQITDKKSVKTPPSEGEAEVPNLPTAGPSEHASTSSHY
FT                   TKEDGDVTIDDTIVIPAPLGTVYQLLFGSDTSYAQRIIEKQGNYDLTSVPKFKNDVREY
FT                   QYMKPLSGPVGPKKTKCLIEEKIEHKDFEDYVVARQITKTPDVPSGSSFSVHTKFHIYW
FT                   GPDNSTRILVVSKVVWTAKSWIKGAIEKGSLEGQKSSIKVLEQELKDIVSNAGKIKKTP
FT                   AKRSPRPRGKRQRTSEKAPIVDSSASSKGNTSFTSILKQFFNVSLSSYQMLGVIFVLFL
FT                   VFGATVRAFMGGNSNSFRVVKPGRIVIDGNSYNYAPTLNTLYGAYEQEVRSRKSVSRSP
FT                   NIVTSSEGEIWEWIKDRGNILPEDHSKKSARKRLTIHKRQELEEAVRLAEDKLKELKIQ
FT                   LNDSRLP"
FT   gene            <345775..>349131
FT                   /locus_tag="KLTH0E03828g"
FT                   /old_locus_tag="KLTH-ORF9819"
FT   CDS_pept        345775..349131
FT                   /locus_tag="KLTH0E03828g"
FT                   /old_locus_tag="KLTH-ORF9819"
FT                   /product="KLTH0E03828p"
FT                   /note="similar to uniprot|P32361 Saccharomyces cerevisiae
FT                   YHR079C IRE1 Serine-threonine kinase and endoribonuclease
FT                   transmembrane protein that initiates the unfolded protein
FT                   response signal by regulating synthesis of Hac1p through
FT                   HAC1 mRNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23211"
FT                   /db_xref="GOA:C5DHF0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010513"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="InterPro:IPR038357"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF0"
FT                   /protein_id="CAR23211.1"
FT                   /translation="MRRPRGIDLLAIFVWGLLLLIPAVSGSWLRWRGRREHTKESLAPL
FT                   ISEAQDAPISSLHNEVHRAKPTVFKKSLSVDTSSPAPAQLGERRPTDDSSKTKFTSNSL
FT                   LRNVHGFQDSPPPKNGVSVPFNHRNSEGLKILDYIIVTDLEGGLHAVHRKTGEILWSNT
FT                   NVSAPSIYVSEPTDSSNETLIVEPYGDGNIYYFNIYQGLQKLPISIKHLVNASPLDLKT
FT                   RIVVDENGTTIDDEKIYTGSRHSAVFNINIKTGQVLSAYGPGTENKAYDDLGTNCTEQS
FT                   FSTGACEDVFVLGRTTYELSIYSKLGTVYNVTYGAWQQNSADNSLANQYDRSADGILIA
FT                   PFGEKSLLAVDSELNFAKWISSQFSGTINNVFDVFLDGKTSEKIILPHPMNPRTVSNHQ
FT                   SRVLLGRTSEGCWYAMSDEFYPSLVDSSSISIYNHRREWKMPQTLKDVQSLQDAMVGVH
FT                   DLQSLQFEQIIEHEPRPSPKSLPASSMLLIDSPRPPRSDNRGLIVEEDSTKALEKYISK
FT                   EEMLALKLQAKEKMAKDLLSAHQKSFAYRFANFVYRIVEGGLMLLFSFFILGLLSRFKV
FT                   LAPLHVFLERSGLISGQNLETGSIKIEDKEDTSNTQDEPHEKHVQILNPTSDNEQNSKE
FT                   EGSSERRKRKRGSRGKKKNKKVHEFSQTDATGSSEADVEADLKHLTVSKKVLGYGSSGT
FT                   VVFQGTFQHRPVAVKRMLIDFYDIATQEIKLLTESDHHPNVVRYYCSEITGRFLYIALE
FT                   LCTSTLEDVVEGKKESSKIIEAREHLDPINVLFQIAQGVAHLHSMKIVHRDLKPQNILV
FT                   APTRKYMQHLDSSLAPMRVLISDFGLCKRLEPDQSSFHTKQGNASGTSGWRAPELLDGC
FT                   ATSDTENDGSYGSAESSISYVYDPFYHKRLTRAIDIFSMGCVFYYVLSKGSHPFGDKYS
FT                   RDSNILKESWCLDDINKSLKDRCSVIEAKDLIRQMISNNPSQRPAASQVIKHPLFWPIS
FT                   KKLEFLLKVSDRFEVERRVPPSPLLLKLEEASPRVIPNRDWTVKFDGVFMENLGKYRKY
FT                   SGEKLMDLLRAFRNKYHHFMDLPPELAEVMGPIPDGFFLYFARRFPNLLLEIYFVVQRN
FT                   LKHDQILGDYL"
FT   gene            complement(<349243..>352308)
FT                   /locus_tag="KLTH0E03850g"
FT                   /old_locus_tag="KLTH-ORF9816"
FT   CDS_pept        complement(349243..352308)
FT                   /locus_tag="KLTH0E03850g"
FT                   /old_locus_tag="KLTH-ORF9816"
FT                   /product="KLTH0E03850p"
FT                   /note="similar to uniprot|Q06680 Saccharomyces cerevisiae
FT                   YDR325W YCG1 Yeast Condensin G"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23212"
FT                   /db_xref="GOA:C5DHF1"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR025977"
FT                   /db_xref="InterPro:IPR027165"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF1"
FT                   /protein_id="CAR23212.1"
FT                   /translation="MKHKQTASGAKQAALPSTMPSDTEPTFENPGESHSTNSKIFRAVA
FT                   DVFQNAQSTYAGHRRHIAVLKRIQAKAVEQGYEEVFNYWFDKMVTLVLPLKRTEPVGDR
FT                   IVRLVGGFISSIEHELEATDDEYDRKEREEVFARFVDQFVRHMLRGIESRDKNARYRVT
FT                   QLLAVIMDNIGEIDEELYNLLMWSLQKRVYDKESFVRIQSIFCLTKFQDDESVSEAVDD
FT                   ATSKLMHAIQNDPSAEVRRAAMLNLVNTPNTKKLIMERARDVNPINRRLVYSRVLRGMG
FT                   SSVFEELNTESLDKLISWGLEDREETVRVACARLVSFDWLNLMDGDIIKLLTRLNVTTS
FT                   KVCEKAMDAIFKYRNDTVTKIKLPENVWGNLTAETSFLIKAFHFHCTKNHLDDVIDSNF
FT                   PEASKLSEIIQKYIDLRFVQSGLSAIDEECLDFIIQQLLSVAFNFDYSDEIGRRAMLIV
FT                   IRNTLASHKLKPSQVEICLKVLEVLSINERDFITMTVEIITDIRDEDIEKQEAEEAKKM
FT                   PSTNFNGTDEDEDDVESFHSAVDDLVNGNETPEGNSQLLVQEKEVSPEALLACLTMSQY
FT                   MLELVNSPLNENIMITTLIDTLITPAVRNTQPEVRELGVRTLGLCCLLDVDLAAESLYL
FT                   LGMCVSKGDASLKNTALKVIVDIFSIHGTKVVDGEGKVDSISLHKIFYKTLKNCELPNC
FT                   QATVAEGLCKLFLGDVFMDDDLFETLVLSYFSPANSKNEALVQAFAFCLPVYCFSHVRH
FT                   QRRMVRVAGDVLLRLSVLWDDIQTNEDESLPASSMLKPSVIFQELIEWTDSTKLVNKSS
FT                   ELDQKEDTQLDFLLSVLKVYYKLERKDLKKMILTNIGRFNFEDDNVSKWREAHDILEDI
FT                   LDNDDIDSATRNAVGKFTSLIKDFLATREESEQDITKNEASEDDEETSNILHTGASTHS
FT                   DGNPQAAESTDIIDGNQLSDLHLPGEKTDNTEEHLSLSNRKRKRLEERGCSERPSDPER
FT                   SSRMVSFVLPEDHSMSSGSSDDCKSDDEYNGE"
FT   gene            <353271..>355511
FT                   /locus_tag="KLTH0E03872g"
FT                   /old_locus_tag="KLTH-ORF9813"
FT   CDS_pept        353271..355511
FT                   /locus_tag="KLTH0E03872g"
FT                   /old_locus_tag="KLTH-ORF9813"
FT                   /product="KLTH0E03872p"
FT                   /note="similar to uniprot|Q06679 Saccharomyces cerevisiae
FT                   YDR324C UTP4 Nucleolar protein component of the small
FT                   subunit (SSU) processome containing the U3 snoRNA that is
FT                   involved in processing of pre-18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23213"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF2"
FT                   /protein_id="CAR23213.1"
FT                   /translation="MTQTAQNLLVHRARFVDYNGANITALSFSHGSRLDKRTPSDLRLA
FT                   LGRSNGDIEIWNPRNGWCQELVIQGGEGRTIEGLVWSNISGEPLRLFSIGGSTVVTEWN
FT                   LETGLPLKNYDCNAGVIWSMAMNESQNKLAVGCDNGCVVVIDISGGSGVMEHEAVLQRQ
FT                   DSRILSVAWRMDEHVIGGCADGRIRVWSALKGAEMRGRILQTMKVDKSKKESTLVWCVT
FT                   YLPKIDQIVSGDSTGSVKFWDFQYSTLAQSFKVHDADVLCLTADETNTKVFSAGIDRKI
FT                   YNFSLAPSSSNKKAARWVVSSNRLLHSNDVRTMASYQSKGADFLVSGGVEKSLVISSMG
FT                   SFSEGSYRKIPFVVPFHKNVLVNQQQRLCVMWQQSTVKIWAMGDEADSSNNYKLVCKLS
FT                   LKDEQNISTCALSPDGQVLIVGRATTTKMFHLLPSNDKLKVTKLDNDFLLKNGTSHVKF
FT                   VDNSRIVIVSPRNDFLLLNLEDEDSDEKPVKIELPDLKETNTGIKLPHINSINHLDVRG
FT                   SFAVISRICGAVDLVNLESTSAVPVARLMNLITAIHISTRRTIALTTADNKVLEFLLHE
FT                   EDGVNVGTISPWCKKNKDYLPKEFEQQKDKCLGIFSGSPDDDSIWFWSSNYLARFDMSQ
FT                   DLPLNTRKRPRKHKIDENTVTDKSTFIDEGEEEDDEDEDLMDETSDLLKSDLGKEDSTN
FT                   RVAKNNKPFFITDKYRSLLFADLLARDQIVVVERPSSTSSSAAAFDLPKIVF"
FT   gene            complement(<355551..>357152)
FT                   /locus_tag="KLTH0E03894g"
FT                   /old_locus_tag="KLTH-ORF9811"
FT   CDS_pept        complement(355551..357152)
FT                   /locus_tag="KLTH0E03894g"
FT                   /old_locus_tag="KLTH-ORF9811"
FT                   /product="KLTH0E03894p"
FT                   /note="similar to uniprot|P38799 Saccharomyces cerevisiae
FT                   YHR078W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23214"
FT                   /db_xref="GOA:C5DHF3"
FT                   /db_xref="InterPro:IPR015672"
FT                   /db_xref="InterPro:IPR022535"
FT                   /db_xref="InterPro:IPR025969"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF3"
FT                   /protein_id="CAR23214.1"
FT                   /translation="MLTSDVLLFILLSGSFFVAFKASNRVLWYKVQHIFDLDSAASRVG
FT                   GLDLNLLEAQTDGFLSKFHSQFALSSKKAMKGVRVLFSSTFALCLIAMEMTLCQIMAVN
FT                   DEVSAQSNLVTISWLITSVGLALNLILVQPYLILLSVLDKFYGDKIKVDYLALVASGLI
FT                   LGWVFTLNFFGWGPFFYSTNMLTKLSIMGVSVMAFLSGVASVSTPYYVFQLIRYKRRKP
FT                   DSSFSERIPVAWMDDVVLREQKGECERRIQEGLDTLKSINSQPNGANPVLRQRHIEEIA
FT                   KFQLELARLEPRTKESKHVRDLKKYSQLGFLVYCVYKLLNTFFWKIPVLAWHSFHYPFD
FT                   HSYERLGYSEGGSSSSDPLAVTVANVLSFFLFRFKDQQGKESLAKQISLVLSVSLFACS
FT                   VSTVTTTISYLTTLLPTRLQILALKTMQRDSSTNVLPTSSKPRYEYKQRPSVIKNLLVS
FT                   ELTGVYILATILMIRSNLPLDVASRLNQMLGEEFGVPDIVIEVWFDKVFAMSSILSFVG
FT                   IKVAGKTGAGQHNRTL"
FT   gene            <357296..>358855
FT                   /locus_tag="KLTH0E03916g"
FT                   /old_locus_tag="KLTH-ORF9809"
FT   CDS_pept        357296..358855
FT                   /locus_tag="KLTH0E03916g"
FT                   /old_locus_tag="KLTH-ORF9809"
FT                   /product="KLTH0E03916p"
FT                   /note="similar to uniprot|P32609 Saccharomyces cerevisiae
FT                   YDR323C PEP7 Multivalent adaptor protein that facilitates
FT                   vesicle-mediated vacuolar protein sorting by ensuring high-
FT                   fidelity vesicle docking and fusion which are essential for
FT                   targeting of vesicles to the endosome required for vacuole
FT                   inheritance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23215"
FT                   /db_xref="GOA:C5DHF4"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR021565"
FT                   /db_xref="InterPro:IPR036531"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF4"
FT                   /protein_id="CAR23215.1"
FT                   /translation="MNAVDGPGYLDEPQKSGSELNCPVCAQTLHDLAKLNEHLDRIHGF
FT                   GEVSNEDADSVNTQLTRSRNVVENSSKAAKANRFELKRDHWIKPVMGKSRCRTCSKSLT
FT                   QARQAINCRRCGEVYCKNHCNLIIKLNSNAEYNPLTGEWCKCCINCFGNRAGYNEFGAV
FT                   CNKTSMFKELRGSKVEDKQLRKLQLENRFIRLANGIQQINNQSSKSMLASIRKYTEINK
FT                   LERSVVPWTPDEAAFACSLCSKPFTLALRKHHCRLCGKVVCNESQTNCSNQLPLMSLIR
FT                   AASDLPISTEFVDNNAEDVQIRICSACVRILFIKRKFTRELSLPEPSILRIYENMRTTA
FT                   DVILSILPQVLNQAEEFSATPNAPDVALLTKMRRKLLDSFALYDRLTKQMLKIKPKNPA
FT                   EERIQRAIVFRASMLIQEHMLPLRSLTNAASTQNSSHETTPESERSMNQGYGNNLSIKE
FT                   VKEYRDQLMVLKEQKFLVENMIASASKQRKFDEAETLSGNLRELNEQVEMIARALGEEG
FT                   FS"
FT   gene            <359015..>362291
FT                   /locus_tag="KLTH0E03938g"
FT                   /old_locus_tag="Klth0E.mRNA.gf.334.p"
FT   CDS_pept        join(359015..359020,359091..362291)
FT                   /locus_tag="KLTH0E03938g"
FT                   /old_locus_tag="Klth0E.mRNA.gf.334.p"
FT                   /product="KLTH0E03938p"
FT                   /note="similar to uniprot|P38798 Saccharomyces cerevisiae
FT                   YHR077C NMD2 Protein involved in the nonsense- mediated
FT                   mRNA decay (NMD) pathway interacts with Nam7p and Upf3p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23216"
FT                   /db_xref="GOA:C5DHF5"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR007193"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039762"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF5"
FT                   /protein_id="CAR23216.1"
FT                   /translation="MNNERQLELFNLNSKAWAGESPLFEGGKKLDSSLKKNTAFIRKLK
FT                   LGISKDSKQNFLKDIRELSLEKYLSELVSTSSEGLSKVSGKAEDVDAAVEVMSALHQRF
FT                   SCKFTPVLMESFLNNFSLTQSSHESEKEELARILRLRSHVRIFTELYLVGLFRNTDYLN
FT                   KENVPAFIAKKLSKKEPIIFTILKEVLNYRFRTGLTTTIATSFITKFPILFEGNAFNEE
FT                   LELESGTRKLLQSLIKVYTEACIGQAVELNKTLNKLKREHSKAQIRTGKNTDEYIEEYN
FT                   DLLPVFERFEGAVNVLTDALQIEAPKLDKGIDSEANTTGPASIITNQLKPNSEKVWENE
FT                   EVRKFYEVLPDLSSVHHDIEDRDAPDSTKLSDFFAGLEFADTREAIDELSVKYWSDSLN
FT                   KKATRRRLLKFFIETQDWSKLRIYARFIASNAEYLSDTKDELIEYLDNGFRSQLRSNRI
FT                   NVKNIIFFSELVKFMLIPSYLVFHKIRTLAMNIQVPNNIEILTILFENFGKFLINHPTY
FT                   KDQMEKMVDLIQQKRKDHDLTVSNKCALDNLIVLIYPPSLSKLNSAVKELNPEQQFYQI
FT                   IIRRELHTISAEKTVKLLRKAHWKDEKIYKTMFSLFTKPEKVSYQSLDVLSSVLCGLYP
FT                   YYRNFVIEVIDTLLEKIERGLEISEFNLNMVRMAQIKYLTSLFNKKLVRLEVLIEIFCK
FT                   IMKFGYPGGRPNPYFLNEFDLPDNYFRVQLITTSLLSIEELPASKSDKMLLFMRLFEFY
FT                   TFVKEQPLPRETQFKVSSAFQKLTSTDNFKRSCDVAESAKELANALNIPQATSLGSSPH
FT                   QQTKKEGAYEEGEEDDDDDDEDDDAEIEEEVDNEEDDDEEDEDDDTEEGREPVKIIQED
FT                   EEGNLAALDSSDESASSDDSDDSGTSSNSDSDEEDGDDDEDDEDDEDDEDDDSIDLDGE
FT                   LERKRIHEEHLNRLRTEEELRAEEELEKQFQQLMQESMESRKNEKVSGNSIPIISAGYS
FT                   TSLGKESGGEALRALNKSHDGKSKKVAFTFLTKSGKKTQAKTLGLPRNVKFVSGVLEEE
FT                   QKLKAEREKIKNIVLNQKFD"
FT   gene            complement(<362321..>363349)
FT                   /locus_tag="KLTH0E03960g"
FT                   /old_locus_tag="KLTH-ORF9802"
FT   CDS_pept        complement(362321..363349)
FT                   /locus_tag="KLTH0E03960g"
FT                   /old_locus_tag="KLTH-ORF9802"
FT                   /product="KLTH0E03960p"
FT                   /note="similar to uniprot|P38797 Saccharomyces cerevisiae
FT                   YHR076W PTC7 Mitochondrially localized type 2C protein
FT                   phosphatase expression induced by growth on ethanol and by
FT                   sustained osmotic stress possible role in carbon source
FT                   utilization in low oxygen environments"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03960g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23217"
FT                   /db_xref="GOA:C5DHF6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039123"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF6"
FT                   /protein_id="CAR23217.1"
FT                   /translation="MFASSRTAGMRGFSASRSMCLWAALAVLLAMVLTAWPGAYRFKRW
FT                   QYRSFFSGPSGQGQSGGSAGFNYKYAVAYQAKDRSDSLYAGLDVDSPTGEDNYFLSARS
FT                   TSDLYAGVADGVGGWVEHGHDSSAISRELCAAMSEFAMLTKDNRSFTPKQLIDMAYSKI
FT                   KQEGQVKAGGTTAIVAHFPPSGKLELANLGDSWCGVFRDSKLVFQTKFQTVGFNAPYQL
FT                   AIIPKDLAKEAAGRGSSYIQNKPSDADEYQFQLKSNDVIVLATDGVTDNIATGDMELFL
FT                   GNNANATDLQQVTQKFVNQVVNLSKDSSFPSVFAQEISKLTGKQYLGGKEDDITVVVVR
FT                   VD"
FT   gene            <363598..>363876
FT                   /locus_tag="KLTH0E03982g"
FT                   /old_locus_tag="KLTH.mRNA.184ET.p"
FT   CDS_pept        363598..363876
FT                   /locus_tag="KLTH0E03982g"
FT                   /old_locus_tag="KLTH.mRNA.184ET.p"
FT                   /product="KLTH0E03982p"
FT                   /note="similar to uniprot|P81449 Saccharomyces cerevisiae
FT                   YDR322C-A TIM11 Subunit e of mitochondrial F1F0- ATPase,
FT                   which is a large, evolutionarily conserved enzyme complex
FT                   required for ATP synthesis; essential for the dimeric state
FT                   of ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23218"
FT                   /db_xref="GOA:C5DHF7"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF7"
FT                   /protein_id="CAR23218.1"
FT                   /translation="MSTVNVLRYSALALGAIIGLKTDLSLKSEAAKSSQQKEYAEKLKL
FT                   IEQAKAEYARLHAPKQVEKQADTKLDLEDPNLDYGKVILSAVESLKQ"
FT   gene            complement(<364090..>365163)
FT                   /locus_tag="KLTH0E04004g"
FT                   /old_locus_tag="KLTH-ORF9797"
FT   CDS_pept        complement(364090..365163)
FT                   /locus_tag="KLTH0E04004g"
FT                   /old_locus_tag="KLTH-ORF9797"
FT                   /product="KLTH0E04004p"
FT                   /note="similar to uniprot|Q06678 Saccharomyces cerevisiae
FT                   YDR322W MRPL35 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23219"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR035810"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF8"
FT                   /protein_id="CAR23219.1"
FT                   /translation="MLRRSLHSSVVKRSGSKIWSEFTSRPEALSIGSERIKKCVLEGTP
FT                   SQGPPSIKRRSNRVKYSSPEKIDEVFKTCYDFLESRSAVKYAELEREEDPAKRTKLLVE
FT                   AEVNNPEVLYNFQYGDKVENNPRFIDYNVPVYRHLGRQHWESYGQMLLMQRLETLAAIP
FT                   DTLPTLVPRAEVHLRFPFSTGLNKWVEPGELLSSNATTLPPAIKIQEYDDVDTESQEYT
FT                   VLILNPDEPDIASDSFKTTLQYGLTNLKISYNDNVVDSRKFTADNIIAGYLPPVPEKNA
FT                   GVQRFVVWVFRQSKHLAAGEAASARDNFNVRDFVHAHKLQPIGAHLWRSEWDSNVTNVR
FT                   AKYGLPEGRVFHRVRKA"
FT   gene            <366407..>369019
FT                   /locus_tag="KLTH0E04026g"
FT                   /old_locus_tag="KLTH-ORF9792"
FT   CDS_pept        366407..369019
FT                   /locus_tag="KLTH0E04026g"
FT                   /old_locus_tag="KLTH-ORF9792"
FT                   /product="KLTH0E04026p"
FT                   /note="weakly similar to uniprot|P32454 Saccharomyces
FT                   cerevisiae YKL157W APE2 Zinc-dependent metallopeptidase
FT                   yscII and to YHR047C uniprot|P37898 Saccharomyces
FT                   cerevisiae YHR047C AAP1' Arginine/alanine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23220"
FT                   /db_xref="GOA:C5DHF9"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF9"
FT                   /protein_id="CAR23220.1"
FT                   /translation="MTEKQTLPTHFQPLHYSIELDCLEANAKKFNGRVSIDFKVRQACN
FT                   KVYLNTRDLEIDSASIVKRTREFIGLMAQDYDPVNEVTVLTFAMELRDDFTLVLNYRGL
FT                   IQTNMTGFYQSEYSDATTGETKTMLSTQFEATDARRAFPCLDEPLLKATFDVSITASSE
FT                   LVVLSNMPSRHTEVSSDGKTTKHNFHRTPKMSTYLVAWALGEFEYIEGHTENRIYPANP
FT                   GCGAERQKLPIRVYTSQGKSHQGAFALGVASKVIDYYSRLFDIPYPLPKLDLLCVEAYS
FT                   HNAMENFSLITFRPTALLLEGDVASADPLALQKIAYVVSHEIAHQWFGNLVTMKWWDEL
FT                   WLNEGFATWVGYHAISEFFPEWDVPSLVMLDSHEVALQLDSLAESHPVKVHVKNAKDID
FT                   QVFDAISYLKGCSILEMISEYVGVEKFVGGVSLYLKRNVFSNATMEDLLGSIGEVCGCD
FT                   ILARLQNWILNIGFPLLKVQTADAGEVELCQERFLSTAVHSEDSTVWWIPLMTQGNLQN
FT                   RKLELWEKSSSFKVPEEGLLHFNAAGFGFYRVSYEDKRHLYRICDNLEFIPSRGKIGLL
FT                   SDVQTTESASVLLEVLSYFSRALKREDGYVWVMVYNVCASLLLLSYKSSSLEAFNKIKT
FT                   FVLSLLEPLIDDALAYLCDPSSVSSNQSDAHRSSRTRFYDQALLVAGALSHEKVVQNCQ
FT                   EIFRRNLVTPATRKVVLSTILSQPKAPECLFDEVAAELDTATLAHKETVIAALGKVQNP
FT                   ALFQKSLQLIFRLQSMDVQFLTAAWATNPFIWEYVWPFVRNNYDSIHKHISANPTVIER
FT                   FVRNVLNCLVGPSLKKDVERFFEGKDVAAFDRALHQGLEIIEKNTLYVKKNFESSASA"
FT   gene            complement(<369100..>370464)
FT                   /locus_tag="KLTH0E04048g"
FT                   /old_locus_tag="KLTH-ORF9788"
FT   CDS_pept        complement(369100..370464)
FT                   /locus_tag="KLTH0E04048g"
FT                   /old_locus_tag="KLTH-ORF9788"
FT                   /product="KLTH0E04048p"
FT                   /note="similar to uniprot|Q05031 Saccharomyces cerevisiae
FT                   YMR238W DFG5 Mannosidase essential
FT                   glycosylphosphatidylinositol (GPI)-anchored membrane
FT                   protein required for cell wall biogenesis involved in
FT                   filamentous growth homologous to Dcw1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23221"
FT                   /db_xref="GOA:C5DHG0"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG0"
FT                   /protein_id="CAR23221.1"
FT                   /translation="MLAQSFALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYA
FT                   GTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMP
FT                   SNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCG
FT                   GGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVV
FT                   LNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQI
FT                   VGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLME
FT                   ASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSD
FT                   NGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASIITAVILAVLVGGSIWMIF"
FT   gene            complement(<370706..>372865)
FT                   /locus_tag="KLTH0E04070g"
FT                   /old_locus_tag="KLTH-ORF9783"
FT   CDS_pept        complement(370706..372865)
FT                   /locus_tag="KLTH0E04070g"
FT                   /old_locus_tag="KLTH-ORF9783"
FT                   /product="KLTH0E04070p"
FT                   /note="similar to uniprot|Q08754 Saccharomyces cerevisiae
FT                   YOR299W BUD7 Protein involved in bud-site selection diploid
FT                   mutants display an axial-like budding pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23222"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG1"
FT                   /protein_id="CAR23222.1"
FT                   /translation="MCPRAAAAPPPLSPAALAAPRTNIEPPRRVREDEIGSAIEERRAK
FT                   LPQFQDLGPPDLVSIVKYTPSGSANAHNNKRSSMQLEPSTSSPAAGSAVAAAGDLHVND
FT                   KHKGEVGTFLYCVGADTSDPTSIAVFLKGMADAIAEKPQVWFGRHKPYRVARITFATWN
FT                   AFRQCDVEVVVHIPGAVQSYFLDTRGEVLAVAPDERELVWAETFASGVVRAIAMMADNR
FT                   EDGEVNNVVETRILNPLLSGEIGDVADHFIDVFPLLYARGVALGAPCDVACASRTNNYL
FT                   CETLLHVTRLTRNFRRCRAMLEGMLGDHPEAVVLLARVLFAADLEVDAVRLIHDDLAAH
FT                   GGVVTAHRSELLCVQAAFLLDAKRDYAAAQRLAQAAVDCAPSEFRPWHLLVQSYVGLND
FT                   IENALLALNGCPVAPHRDRYIFKRVISVAQDSANLHLPLPMDVVLDEVTGLNSRDIINE
FT                   HKSVSPALLNLPAATLKANARTRYHLLTEIARKTGWESLLRYRSKLFVMEEEYQVAATP
FT                   PAEEGDPLKPDGIRTKRLCERWLDNLFMVLYEDLKAYTLWQAEQLHFEAQNTHYSKTTT
FT                   EWELLGLCALRLGHREEAAAAFEAGLQHRFSAESCRKLLQIYLHERSRLKKDSDLSSSQ
FT                   VTAAVLDYDNKIIDLCVKICCWNHRWYSEFSILLLDSLSVVVDDMGITKLSNEISSRFP
FT                   ETVVQLANDNLLAFYADYTDGGYDK"
FT   gene            complement(<373159..>373599)
FT                   /locus_tag="KLTH0E04092g"
FT                   /old_locus_tag="KLTH-ORF9773"
FT   CDS_pept        complement(373159..373599)
FT                   /locus_tag="KLTH0E04092g"
FT                   /old_locus_tag="KLTH-ORF9773"
FT                   /product="KLTH0E04092p"
FT                   /note="similar to uniprot|Q05027 Saccharomyces cerevisiae
FT                   YMR236W TAF9"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23223"
FT                   /db_xref="GOA:C5DHG2"
FT                   /db_xref="InterPro:IPR003162"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG2"
FT                   /protein_id="CAR23223.1"
FT                   /translation="MTDDAQEEVPRDVRLLHLLLASQAIQHYEDQVPLQLMDFAHRYTR
FT                   GVLKDAMVYGDYAAGDAAAELSVEDIRLAIAARTQYQFKPTAPKELLLQLAAERNKKAL
FT                   PQVVNMWGTRLPPEKYCLTSREWRLEEERDEQGHAVGDGAAR"
FT   gene            <374102..>374557
FT                   /locus_tag="KLTH0E04114g"
FT                   /old_locus_tag="KLTH-ORF9770"
FT   CDS_pept        374102..374557
FT                   /locus_tag="KLTH0E04114g"
FT                   /old_locus_tag="KLTH-ORF9770"
FT                   /product="KLTH0E04114p"
FT                   /note="highly similar to uniprot|Q86ZS7 Saccharomyces
FT                   cerevisiae YOR298C-A MBF1 Transcriptional coactivator that
FT                   bridges the DNA-binding region of Gcn4p and TATA-binding
FT                   protein Spt15p; suppressor of frameshift mutations"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23224"
FT                   /db_xref="GOA:C5DHG3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013729"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG3"
FT                   /protein_id="CAR23224.1"
FT                   /translation="MSDWDSTTVIGSRARAGGSGPRAQVARTQGQINAARRSGNVLSVD
FT                   KKYSSSNAKGDPEGQRLTKIDRETDIVVPKKLDLSVGKAISRARGEKKLTQKDLATKVN
FT                   EKPTVINDYEAGRAIPNQQILAKLERALGVKLRGKNIGEPLGPKKKA"
FT   gene            <374713..>375945
FT                   /locus_tag="KLTH0E04136g"
FT                   /old_locus_tag="KLTH-ORF9766"
FT   CDS_pept        374713..375945
FT                   /locus_tag="KLTH0E04136g"
FT                   /old_locus_tag="KLTH-ORF9766"
FT                   /product="KLTH0E04136p"
FT                   /note="similar to uniprot|P11745 Saccharomyces cerevisiae
FT                   YMR235C RNA1 GTPase activating protein (GAP) for Gsp1p
FT                   involved in nuclear transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23225"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG4"
FT                   /protein_id="CAR23225.1"
FT                   /translation="MASLAFTPAHEQSHVFSVANRALKLTSSTDIAPLLEDLAKLPQCT
FT                   KIDFSGNTLGIEASRALAACIADNASVRDHLVELNFADLYTSRLVDEVVESLEIFVPVW
FT                   LACPRLSIVNLSDNAFGLRTIDSLEHYIRSAVQLEHLILSNNGMGPFAGERIGKALYQL
FT                   AQRKKAAGSPLLETFICGRNRLENGSAAHLALGLKAHGAGLKVVKLYQNGIRPRGVATL
FT                   IRHGLRHNTALQVLDLQDNTFTTVASAALAETLPVWRDSLVELNVNDCLLKGSGSDLVA
FT                   KALQAYEFPQLHALRLQYNELTQDTLESSLLPALQANKLPALKFLELNGNRLEEDSDTL
FT                   TELEQAFDGELDDLDDLEELDSEDEEDEEDEEEEDADASEETDIEALEKSLADLEINVD
FT                   ELAQDLQKTSI"
FT   gene            complement(<375986..>377395)
FT                   /locus_tag="KLTH0E04158g"
FT                   /old_locus_tag="KLTH-ORF9760"
FT   CDS_pept        complement(375986..377395)
FT                   /locus_tag="KLTH0E04158g"
FT                   /old_locus_tag="KLTH-ORF9760"
FT                   /product="KLTH0E04158p"
FT                   /note="weakly similar to uniprot|Q08750 Saccharomyces
FT                   cerevisiae YOR298W MUM3 Protein of unknown function
FT                   involved in the organization of the outer spore wall
FT                   layers"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04158g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23226"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG5"
FT                   /protein_id="CAR23226.1"
FT                   /translation="MSILDTLRTHFVGSGLQLRADNVPAALSLVLQLVLLVQYVAAYNV
FT                   WSFKTWIVEQSVDSRPSKWAIGTVSKTLIWIPLVGERLTENLEHVVCSIKLRVLPPMKR
FT                   VEERLELCYQVALADLTFRHGNVRLLVTGDTEGFPTAVTNKRSSLVIANHRSVMDYSLI
FT                   NYLAQGEERVAARQNFWRLFESKETDTMLGLKFVTWGRVCNMPSLRLLSSILAGDENCA
FT                   VDAARLQEFLEDRGNQILAVFPEVNVLTPELRLVQRKLAKDNYLPMLNNVLYPRFKNFK
FT                   AAIRCLSHVRGVGIARRGRRLRNAVTKADSMVCKIRHPGSRISDTQIAQVSMFLGRVED
FT                   DEALAKNKKKLKPTQRALLSVDPFVWDLTIVYYRAKISKGKDHAHLHEQEQKRLEDGAH
FT                   YQLEQVTPSFLQMASSSFQDSPLLIRIHTCKHPMSKLLALSDRKLEKWLERRWMQKDEM
FT                   IDSIQKNVKIS"
FT   gene            <377813..>378382
FT                   /locus_tag="KLTH0E04180g"
FT                   /old_locus_tag="KLTH-ORF9758"
FT   CDS_pept        377813..378382
FT                   /locus_tag="KLTH0E04180g"
FT                   /old_locus_tag="KLTH-ORF9758"
FT                   /product="KLTH0E04180p"
FT                   /note="weakly similar to uniprot|Q08749 Saccharomyces
FT                   cerevisiae YOR297C TIM18 mitochondrial inner membrane
FT                   translocase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04180g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23227"
FT                   /db_xref="GOA:C5DHG6"
FT                   /db_xref="InterPro:IPR007992"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG6"
FT                   /protein_id="CAR23227.1"
FT                   /translation="MLKRCFESNLRSGTRSVLTRAKLSQHRPSIGLRPMSLKPNFSKLK
FT                   IVPPPPGGVEGGVNDPLKPVEIDYFHGSYHWDYERITAVMLVPLTLVPMYGALSSGTLY
FT                   PLLDAMLCSVLLIHSQLGITSCIIDYIPKRKFGIWHKLAMGMLYTGSAVGLYGVYELET
FT                   SNNGLVDLIGRLWKEDESGLTIFSRF"
FT   gene            complement(<378494..>379639)
FT                   /locus_tag="KLTH0E04202g"
FT                   /old_locus_tag="KLTH-ORF9757"
FT   CDS_pept        complement(378494..379639)
FT                   /locus_tag="KLTH0E04202g"
FT                   /old_locus_tag="KLTH-ORF9757"
FT                   /product="KLTH0E04202p"
FT                   /note="similar to uniprot|Q04740 Saccharomyces cerevisiae
FT                   YMR234W RNH1 Ribonuclease H1 removes RNA primers during
FT                   Okazaki fragment synthesis degrades RNA attached to the 5'-
FT                   end of a DNA strand"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04202g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23228"
FT                   /db_xref="GOA:C5DHG7"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017067"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG7"
FT                   /protein_id="CAR23228.1"
FT                   /translation="MAKNSFYAVQNGRSTGVFNNWDTCKSLVSGFPGARYKKFDTMAEA
FT                   QSFAEQGKSFSKPSSSLRVPQSRQAYRESQSSQIGYGPHTMKSERSSGERNGPRDSRSL
FT                   ASKVKAGRTREMSPTRSSILRNNQESRKRGQKASQRFYGVKSSNPNYESKIFESWPECQ
FT                   RYVSRKSGISFKKLDSLEEAQNFINGTSSKDFEFIGQDQEQFLSQYSRVPEEGAVVQDC
FT                   NVYCDGSALSNGTRSSRAGYGVYFEQDGGNNISEPLLEGAQTNNRAEIQAVSSALDQIW
FT                   TNLTANKKNLRYQIKTDSEYVAKLLNDRYMGYSVQKLEQLPNSDLIAPLVQKFVKVKKF
FT                   YEINEEVFGSSKFHIEWVRGHAGEAGNEKADELARLGASKS"
FT   gene            complement(<380176..>384102)
FT                   /locus_tag="KLTH0E04224g"
FT                   /old_locus_tag="KLTH-ORF9755"
FT   CDS_pept        complement(380176..384102)
FT                   /locus_tag="KLTH0E04224g"
FT                   /old_locus_tag="KLTH-ORF9755"
FT                   /product="KLTH0E04224p"
FT                   /note="similar to uniprot|Q08748 Saccharomyces cerevisiae
FT                   YOR296W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23229"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR014770"
FT                   /db_xref="InterPro:IPR014772"
FT                   /db_xref="InterPro:IPR019558"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG8"
FT                   /protein_id="CAR23229.1"
FT                   /translation="MAARHVSASSTISSGSTSNLLMSGAPVPSMTQPELDAILHYTLKV
FT                   ILIEYINEPRFKIRAVKPRGPVRTASKSTKEKRNKRSSWLFSDDGARKDQAEAKQLQKL
FT                   TPTLENYLRMVAIDKIKVKQTQLRRSLLKLYNDAFLDPHASRSLLSLTRLEELVMLFTK
FT                   AANGELAKVGNTSKTKEELYSQVCCFLDTITQLATQQESSKSRLVTRIHEYKKQFSNPK
FT                   SMEPLFSSLPSNGSNTELSEPAVKPTFKLSDVAHSAYLMELFNMSEIELQQILIKNVNE
FT                   TNNSIFGRSMRALKAKVALQDNTESAYAFPITKSFEEWKTSEMQELDALIAKFGRHGAS
FT                   EYEATDLSRSIPEKARDLYTGLARLILEKELSAGPATSILPKDAVFLLTKCAYYWRVDL
FT                   SSTKATLLYTAANAGPLSGETNASEKFEMLFKIISTKALSKEEDLGSLPTWRIIDQQEW
FT                   MSNLTITFEQCMNSINLCLSAIYQKLMPKFSPILSIYYTYIEPGFELLGHNIAETNLFK
FT                   KHSRRLHRVLFRTSEQYYVSLVKGLPRDGSLEIHNVKHIADQILKNLQDIQKKYKNPLL
FT                   DQINLASECAKVLIEAFGVDCSAMLAQVERFSKAENQNKIPLYDATETYKTLRELRDVY
FT                   AQVQPSKKFPFKLEKHFLKYLSELCDDCCSGTLAVVKTALEKEDWEPADMSETYSTSVI
FT                   DIFKMIHESFDLFLKLGWADQYQISKICTFLLKSVADGLSYYANTVANLVESEMNISQS
FT                   EEGEFAETENERKVLDVISQTAAAKMKNTWLYSEMRSALKSSDVVIPKPYEFQSKTCTC
FT                   LNNLNQMMQMISDLEERINPEEMSSVVNQHERLDAKRRMMTDRQNKGLKHLYTVKIIRA
FT                   ENVQVTSHNAGLLSTVSIVDAKNKREVAKTREVLKASRPVWNEEFEIEIPVNDTRPFSF
FT                   ILWHHKPKSDSTSSRMSGRSFLYLDPHKFKNDGYPQDVCLNLDTHGQLFLQISVETERV
FT                   DALFAMGRAFRSLSRARDRSIELMVSKFQVFVHFAFSRTTLKTICGANGQIRPSNTEIY
FT                   DSIVPLFDYLNANLNILASRLSRELLHKIMLEAWEEILNEADALLLPFLSDAPRAYQRS
FT                   VKNKSIWENAVDVAKLGMSASSGSERPLTQIEIDTVFEWLRALCIDFFHNNGEGPPLTD
FT                   LKNMHYQALLLIPVFYDKNVSELKNEADALNRDYRKSMFGVNNNDADGPRRANSNLRRA
FT                   NTLARKRTIIANSSRKRRLEVDKEIKASEENPAENIVSTQDVILRILIAKGEAEFVLES
FT                   LSLRERVSKALRTEQIVKAAKKSY"
FT   gene            complement(<384279..>384973)
FT                   /locus_tag="KLTH0E04246g"
FT                   /old_locus_tag="Klth0E.mRNA.3332.m"
FT   CDS_pept        complement(join(384279..384872,384938..384973))
FT                   /locus_tag="KLTH0E04246g"
FT                   /old_locus_tag="Klth0E.mRNA.3332.m"
FT                   /product="KLTH0E04246p"
FT                   /note="similar to uniprot|Q05024 Saccharomyces cerevisiae
FT                   YMR233W and to uniprot|Q08747 Saccharomyces cerevisiae
FT                   YOR295W UAF30"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23230"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG9"
FT                   /protein_id="CAR23230.1"
FT                   /translation="MAELDTYISMIDAILGVSDPDEVSAKRIRRAIQELFAVDLEPERK
FT                   KVNALIIERFNRLQDARAEVSQDELVEDDAKVARTLAKKVNGKAKKDSRNTKVKKKRKV
FT                   SESSNSLNQKKMQLSDELQKLVGEPEMARTQVVKKVWEHIKEQDLQNPQDRREILCDEL
FT                   MKPIFGDKTTMFALNKSLSKHIYSRDKKVQATEPAGSPFTTEVSTA"
FT   gene            complement(<385182..>385799)
FT                   /locus_tag="KLTH0E04268g"
FT                   /old_locus_tag="KLTH-ORF9750"
FT   CDS_pept        complement(385182..385799)
FT                   /locus_tag="KLTH0E04268g"
FT                   /old_locus_tag="KLTH-ORF9750"
FT                   /product="KLTH0E04268p"
FT                   /note="highly similar to uniprot|Q08746 Saccharomyces
FT                   cerevisiae YOR294W RRS1 Essential protein that binds
FT                   ribosomal protein L11 and is required for nuclear export of
FT                   the 60S pre-ribosomal subunit during ribosome biogenesis
FT                   mouse homolog shows altered expression in Huntington's
FT                   disease model mice"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23231"
FT                   /db_xref="GOA:C5DHH0"
FT                   /db_xref="InterPro:IPR007023"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH0"
FT                   /protein_id="CAR23231.1"
FT                   /translation="MSSFAEEKKNLPVTVEKPIPVTYDLGNLAVFDSNTLDRNDLDSSN
FT                   AQREENIKKISRDNVQLMINQILSLPIKSTTESANGTSGQSASMTLVQLPEPTSELPRE
FT                   KPLPKPKAPSKWEQFAAKKGIKPKERSGKMVYDEDAGQWVPKWGFNGANKKLDKQWLVE
FT                   VDDEPKKAGDDLIDPRSLSRAERKKLIKKNELQHKRNMKGAN"
FT   gene            complement(<386032..>388005)
FT                   /locus_tag="KLTH0E04290g"
FT                   /old_locus_tag="KLTH-ORF9749"
FT   CDS_pept        complement(386032..388005)
FT                   /locus_tag="KLTH0E04290g"
FT                   /old_locus_tag="KLTH-ORF9749"
FT                   /product="KLTH0E04290p"
FT                   /note="similar to uniprot|Q05670 Saccharomyces cerevisiae
FT                   YMR232W FUS2 Cytoplasmic protein localized to the shmoo tip
FT                   required for the alignment of parental nuclei before
FT                   nuclear fusion during mating"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04290g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23232"
FT                   /db_xref="GOA:C5DHH1"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH1"
FT                   /protein_id="CAR23232.1"
FT                   /translation="MIKSTNSIYQLDYPAKSTLTPIRDSREAFFPNRGSSAYKNGSQLR
FT                   ETLPFNPYAKSMWTSECHYKASAKYPVAAKTHSIHTKPPKSRGFQRSASILISSTEPLN
FT                   LDFEKAPTKPASTSEFVGKKFFDAFYDFLGREEDYAYMTDMLNMIYRKELHHKKASGKL
FT                   MAQSSNEEILLFGNMDTISQLSRILVKSLRNYVSSCCKSGTACARWSGPDASFEIPESF
FT                   AEHFDPAEFFESHLSKIRSTYSTYFLSHRRQLELLEHLKKTKSTLFYRWYESCLDKADL
FT                   VKIEDIIAAPVKRLGEFYKDILNIIREGEDFLSGSALEKLRMFADKFHSFLSTAETLLD
FT                   EGAVAKEQAPFDSRSSNISNHLTVPLEGNSCRSSETHLSLSSSRYSDHLSVGDMDAAVI
FT                   SSHVKLNEAENEDPTLADYISRFKQVGKHMEKLEKELSDLDIAAILDQNMRQAEEWRKI
FT                   FEFEPLSQLLTEQPNVESIYTIYINKLHQQRQEVMLTKLGDLQEKVIAPLTLAKQSSKM
FT                   IQSKIQDLKELKKDYMSFLGSKDARSIKFKLIANHFQSTQRELLDGIPKYLDLISQFTI
FT                   LLMRSYNQIMMKYMEILSGGKRLLTRELQMLEKGEREQGDNFDILQSFASSRFYTKQLI
FT                   HENWNCHGRAVESRVVRKLFEI"
FT   gene            complement(<388173..>391268)
FT                   /locus_tag="KLTH0E04312g"
FT                   /old_locus_tag="KLTH-ORF9748"
FT   CDS_pept        complement(388173..391268)
FT                   /locus_tag="KLTH0E04312g"
FT                   /old_locus_tag="KLTH-ORF9748"
FT                   /product="KLTH0E04312p"
FT                   /note="similar to uniprot|P12868 Saccharomyces cerevisiae
FT                   YMR231W PEP5 Peripheral vacuolar membrane protein required
FT                   for protein trafficking and vacuole biogenesis forms
FT                   complex with Pep3p that promotes vesicular docking/fusion
FT                   reactions in conjunction with SNARE proteins also interacts
FT                   with Pep7p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23233"
FT                   /db_xref="GOA:C5DHH2"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016528"
FT                   /db_xref="InterPro:IPR024763"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH2"
FT                   /protein_id="CAR23233.1"
FT                   /translation="MSFQSWRQFQFFENTPVRDPKIGSDSPLFSDPTLSAACPALEDKL
FT                   FIVVQSRILKLVNLKSLEVELEFEAYSEGFQVTYLRFVADNYIVSAAEQLGRPCSIKIW
FT                   KLDKQPKNEFDYHSLIEVKNGKNTFPLSAISIWHDLTCLAIGFVNGRIVLIRGDIIHDR
FT                   GSRQRVIYDDPNKEPITGLMFDRDCRTCFASTTSGIFLFNTTGRNNGKPDTILNGSAGL
FT                   DLNCSCLSCDGQEFICCSAKSLDFYKSNGEKRSLVMELPLIKRIYAVDQHHILILLGVQ
FT                   TSNNTALNVANITTTNNRVIVLDIQNKLIAMNTLISGSVLDIFSNVFSGDPSVLLLTSD
FT                   GTMHKINEKPIKEKLQIVEQKELFPVALDLAQQCNLSAIEIEKIRKKFAEHLYKINLKT
FT                   EAIEQYLQCLNVTETSEVIAKFGINSTSDNSSVSDLSYYLLSMMKKGMSSSDHVTLYLI
FT                   ALIKLKNEEGIEQFVTHFSRSGQYLEEEEPEEDWKQDDESYYFSDTELFDLDLILRLLQ
FT                   DFGFFLQSFKLARKFSKDPAIVVEILIDGLKDPHSALRYIKSLPVDDTLRVLVAFSKKL
FT                   LELLPNDTNALLIELFTGKYQPLKYESVSDPVVSRREKFDKNVFYSYNSFIEYMKNVST
FT                   SKEQDITSSVPTYQPPKPTLIFTSFINQPFEFVVFLEACLGSYNEFHGFDHDKQLILTT
FT                   LYDIYLTLAKDDEKGRQQEWRDKAHTVYKESTKLATTSTASVDSSSAGRLNKAVDNSLM
FT                   MLISQVNNFEAALEGDDLQDELEFAKFGKLDLTYKFRSISLTNDAKTSLKFIEKFGEQE
FT                   PALYSMGLSHFISSKSMMKEIGGEAVFREKILNKVLEKDLMPLLDILQVLGSSNVASFG
FT                   LVQQILIEHIKSESQEIKNNKKLIQSYESELEEKESKLQSLTDDKSPAQIKLKNQTCNI
FT                   CQTALSAPLVFFKCDHIYHQRCLNEEESSESNNRFFRCPQCVVDFEASENMKRAQSETQ
FT                   IDTELLNLAMNDKDNKDRFKIVTDFIGRGGVESSFIRVQELD"
FT   gene            complement(<391495..>393723)
FT                   /locus_tag="KLTH0E04334g"
FT                   /old_locus_tag="KLTH-ORF9746"
FT   CDS_pept        complement(391495..393723)
FT                   /locus_tag="KLTH0E04334g"
FT                   /old_locus_tag="KLTH-ORF9746"
FT                   /product="KLTH0E04334p"
FT                   /note="similar to uniprot|P23561 Saccharomyces cerevisiae
FT                   YLR362W STE11 Signal transducing MEK kinase involved in
FT                   pheromone response and pseudohyphal/invasive growth
FT                   pathways where it phosphorylates Ste7p and the high
FT                   osmolarity response pathway via phosphorylation of Pbs2p
FT                   regulated by Ste20p and Ste50p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23234"
FT                   /db_xref="GOA:C5DHH3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR029458"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH3"
FT                   /protein_id="CAR23234.1"
FT                   /translation="MDDSETYVSHFLQELNCHQYLDSFKNWNLTSQDALAHIDKEILVE
FT                   VGVKKIGDRIRILKKCQSLRGSRTRPSHEVRELLQKFQALSVAQLTTTEELVTDKHSAI
FT                   FILNDGSAKKVNVNGCFNADSIKKKLIKKLPSEFIACTPQGEETRNSQDYDVFVVDYVK
FT                   NVLHLLYDVELVTICHSVDRVEKNRLIFVSKDQTPSDRATLTSKKLYLKTLSVIHQLGS
FT                   LSALAGTTSSARAKIHAVNELAAPGTAAGAPNSLRIENNKDTIRQIFNQRPPSELISTN
FT                   LSEYFPHTDAKSLRKTIGNSVRQSIRLSSINGSATPVGGNNVGDIWVNNSNAVGKALLQ
FT                   SLDGNHHVPTGSSLSKRRTQIEEDTLNFKAPESAHGESEVSKNSEGTTERRTGPTKRPG
FT                   LISHAEYLRQGPRKQKSSERIELLRVADSDNDEEDEDMISLPTKIATPKNWLKGARIGA
FT                   GSFGSVYLGMNAQTGELMAVKQVELQPTAVTAGVVSVSDEIKKQYNQNANASAVKNSSQ
FT                   VHRKMIDALQHEMGLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPF
FT                   EEPLIKNFTRQILIGLSYLHRKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQQ
FT                   QNKRASLQGSVYWMAPEVVKQVVTTKKADIWSVGCVIIEMFTGKHPFPDFSQMQAIFKI
FT                   GTNTHPESPSWASDEAKNFLLKAFELDYRQRPDSIELLQHAWLDTSIM"
FT   gene            complement(<394583..>395877)
FT                   /locus_tag="KLTH0E04356g"
FT                   /old_locus_tag="Klth0E.mRNA.at.341.m"
FT   CDS_pept        complement(join(394583..395791,395863..395877))
FT                   /locus_tag="KLTH0E04356g"
FT                   /old_locus_tag="Klth0E.mRNA.at.341.m"
FT                   /product="KLTH0E04356p"
FT                   /note="similar to uniprot|Q6B1J7 Saccharomyces cerevisiae
FT                   YLR360W VPS38 involved in vacuolar protein targeting"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23235"
FT                   /db_xref="GOA:C5DHH4"
FT                   /db_xref="InterPro:IPR040939"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH4"
FT                   /protein_id="CAR23235.1"
FT                   /translation="MYLLRRRLRHLKTISIFNVSLIKEQGNHAIEVKAVPSVFVVIEDL
FT                   KGRCLYVSEVQAGTQLHAQFNELPQLSYTISKVRLKVIGRVPGDLLADDSEEAWVVLAD
FT                   HVLSFNQLHHVPDNDLPLNFFKGVNVPVLHFSDGIFTLNGAIKSIVDSRDKASTSCTST
FT                   RAKSFNFNSLLKLNKLLEYSTQLHSELCELSNSISSEVPDQGECYSKNLLIDARKNLEE
FT                   TIRLRQERIKYLQDAVHGRPSAPRNSAEDAKVNEEYGSTFFEYSDTKHHLKTLKARRMQ
FT                   QLFQAMQETDLFTSNGLVIPDSEQSVFYAQLRKLNATSLARDSNRISTNTLLGHYLLFL
FT                   HILSEKILFVRLPHRLSYYGSTSVINNQLPLYLTSSPTQQHVADFERAVDLFNLDIMQV
FT                   RQFLERHR"
FT   gene            <396019..>397332
FT                   /locus_tag="KLTH0E04378g"
FT                   /old_locus_tag="KLTH-ORF9741"
FT   CDS_pept        396019..397332
FT                   /locus_tag="KLTH0E04378g"
FT                   /old_locus_tag="KLTH-ORF9741"
FT                   /product="KLTH0E04378p"
FT                   /note="some similarities with uniprot|P40544 Saccharomyces
FT                   cerevisiae YIL023C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23236"
FT                   /db_xref="GOA:C5DHH5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH5"
FT                   /protein_id="CAR23236.1"
FT                   /translation="MMYAALLSLLPKVMAHPGHHHGTSVMHGEVKDSVIAQFLFPYSAR
FT                   VNALLATVYISAAPCLIVTAIPELRKAKRGSLLSLLMSFAFGTLMGDIILHLLPEIFSE
FT                   AIDVNEEAQWLKFLDGLPLQDSTNGHVKDLLVTLKPSLTSHNSPSKMRTMALGFLVFCG
FT                   FVIFMVIDKGLKIANSGGEHEEGHHHGHSHIFSVQHEKEAEEGVEAVSSGKVVTSDEGM
FT                   NVVRRSKGNKTEGSDVDDDIGHERAPPQSSSLKASAYLSLVSAFAHNITDGVALASAFY
FT                   KSKHTGIVTTLAVLMHEIPHELGDFAILLASGINFNQALLLQLVGAFGALIGTLCGCIA
FT                   NEMAAGTADTGIASRIIPEIGFPTFVAHASSKWPISAGELMLPITTGGLLFISTVGVVP
FT                   ELLKVTGSSKKNELTNSLRHLGSVFAGFVLMAWMGLNE"
FT   gene            <397784..>399256
FT                   /locus_tag="KLTH0E04400g"
FT                   /old_locus_tag="KLTH-ORF9738"
FT   CDS_pept        397784..399256
FT                   /locus_tag="KLTH0E04400g"
FT                   /old_locus_tag="KLTH-ORF9738"
FT                   /product="KLTH0E04400p"
FT                   /note="weakly similar to uniprot|Q08777 Saccharomyces
FT                   cerevisiae YOR306C MCH5"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23237"
FT                   /db_xref="GOA:C5DHH6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH6"
FT                   /protein_id="CAR23237.1"
FT                   /translation="MSLPGQQEAPGLTESSKVLANISTSQGKKREEVVEDYSVPDEFEY
FT                   AEGGWKAWMAILGSFLGFFPTWGFFYTAGVMQNYIAKNQLATASTSTISWVFSVYNFCL
FT                   LGSFVFSGLYFDLNGARRPLILGNVMFLTGMFALGNCTKVWHFIVCLGILVGMGSGISS
FT                   SPLIGVVCHHFNRRRGIATALAMNGGSIGGVVIPLMLRSLFEKSGYPWAMRSLGFLSTG
FT                   FLVCSVFLAREDPAKLHKPQPGTLLRNTSGPSFVSSFLSYLSGSFDYKALKEPKYLFCT
FT                   LGCCMAELSTGATLTYITSYCEVVGYRDEDAFYIITVLNALSIVGGYICSLLADVLFGR
FT                   FNVMILINLLLGIIGFVMWLPFGSKGSGIMYAYGAIYGALYGSMLNLAPVCCGEISRVD
FT                   EFGRRYSTMYALVGFTFLAGIPISGAIIGEGTLESYDNVIIFFSAVSIAAGVFYLLSKC
FT                   FALQNPLKKSDSKESDFPGTLALLVKSSLRRF"
FT   gene            <399577..>400280
FT                   /locus_tag="KLTH0E04422g"
FT                   /old_locus_tag="Klth0E.mRNA.at.340.p"
FT   CDS_pept        join(399577..399762,399861..400280)
FT                   /locus_tag="KLTH0E04422g"
FT                   /old_locus_tag="Klth0E.mRNA.at.340.p"
FT                   /product="KLTH0E04422p"
FT                   /note="similar to uniprot|P40543 Saccharomyces cerevisiae
FT                   YIL024C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23238"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH7"
FT                   /protein_id="CAR23238.1"
FT                   /translation="MTLKQLRIPNYALGDISQKDKVIVTGNFDNWEHTKFVLKRNSEDD
FT                   SFEVEVPAVSSGVLTFKFVINDRDWVTLPYFDTEKDGNGFLNNVLKWQDADDERLEDIT
FT                   ISSTIHSQNNSPQDQCVHVTTAGCENLADHDYIQVSSQDELSSTENVDLVVHCSSSSVG
FT                   HENNREPSHEQSPDGDASQRRLQSLVSVVKRVKMYWSG"
FT   gene            <400548..>403871
FT                   /locus_tag="KLTH0E04444g"
FT   CDS_pept        400548..403871
FT                   /locus_tag="KLTH0E04444g"
FT                   /product="KLTH0E04444p"
FT                   /note="similar to uniprot|P40541 Saccharomyces cerevisiae
FT                   YIL026C IRR1 Subunit of the cohesin complex which is
FT                   required for sister chromatid cohesion during mitosis and
FT                   meiosis and interacts with centromeres and chromosome arms
FT                   essential for viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23239"
FT                   /db_xref="InterPro:IPR013721"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020839"
FT                   /db_xref="InterPro:IPR039662"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH8"
FT                   /protein_id="CAR23239.1"
FT                   /translation="MFTRLNVTTAFLGRRICIKRLVAESMSEVRRSIRIRDKSSRTDAE
FT                   DEDADSLGLVHADDRIDLGSESEEDDDEDANERDDEDYQDTAIKKRKRSASEAGTDSRR
FT                   GAKKSRLPSASRGSKRSREAFQQLQQDFEPTQLFQALAESEDISVEETANEWLDLYSES
FT                   RERALQEFINFILNSCGSLVQVQEHDVTSNETANETVAEIQLMFQKQGLHENHLRMSKT
FT                   NKKRAKFKPLYQNFTEFMHKVMELSNERGLLYEESPRESGESNSLILDILTWLSSFSVS
FT                   KLRCLRHAATLCMYSFQDYLTESSVILENNYLVKLRRQLSMEQKKKRANKKTAEKLEST
FT                   IAEIQETKSAVENSIDNIIKLAFVHRFKDVDEAIRADSISHLATWLENYPEYFMKVTFL
FT                   KYFGWLLSDSSAMVRLQVMKVLSEVVKFDIRRSKHKVGSSALRQFFERFKQRILEICIK
FT                   DVDMQVRLTAIQVLTQINSFGYLEDTEISKISSLIFDYQEINIASSAKHAKFLASVAKF
FT                   FATVQKDKIDQALEAHSFPRKLRGLEPEDVVRVGFFMRSLITSLSAYLKYSQDDTSVQE
FT                   RTHLLFQASEFLQPFFGDSISSMCKLLLYDGDLSEFAEISENDDSNEKLLLLPGDENST
FT                   IQFMIVLNGLCHGGVNNKSAKKSDVISAVLPHLEQLFATLPLHSAVITHHLFGIYMLFS
FT                   FEDWGSAGLEGDFQKITEVIVKNFDRMQFSNDKDDIKRLSYAKLLQFHQQLDLPNLNEV
FT                   WKDQVGHVRIPLQVFLETRGDDFEGQGLNELYRTVFESYVNKLVLLGKVVPLDFSKELM
FT                   QLFFSKVVGKLPQALEFLEMETLKSVDFKFVALVVLWNLQRWYEILQNTSDASPISRGV
FT                   LDMVIAMVKELSAILVTLATTQSSTLQARLHVEWRICDALADILTAFKMFELNLPEKDY
FT                   EWKHVVSREYAVAVKRDLAEVFLEVFLYLEGLWAKELDVQLDRFENEDVDLNNISDHTF
FT                   EGAEQELLVYVVKLKSLLKLGLIEDPALEKRISLNKSILGQDFQSIIDEDAFSTEPGPK
FT                   RSLASANHERQIFENRELNSPEELDPIQESSDPPEVPRLADPHTAQEDTEPHGYSSEFL
FT                   "
FT   gene            <404040..>404477
FT                   /locus_tag="KLTH0E04466g"
FT                   /old_locus_tag="KLTH-ORF9731"
FT   CDS_pept        404040..404477
FT                   /locus_tag="KLTH0E04466g"
FT                   /old_locus_tag="KLTH-ORF9731"
FT                   /product="KLTH0E04466p"
FT                   /note="similar to uniprot|P40540 Saccharomyces cerevisiae
FT                   YIL027C KRE27 Protein of unknown function null mutant shows
FT                   K1 killer toxin resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23240"
FT                   /db_xref="GOA:C5DHH9"
FT                   /db_xref="InterPro:IPR018937"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH9"
FT                   /protein_id="CAR23240.1"
FT                   /translation="MPLVSKALLVLAIFQLLHSGFSSHEFLTIKKRLVTQSNLDVAHLQ
FT                   LPKDVQLEAMSGVILLILSVFMSFSKLCYLSLGGKLKVLRVNEYLKEINMNKATSDKNL
FT                   AGCNPYGEMCYTPNLVDVHAKREQVAQWNKIRDPELFAKKD"
FT   gene            complement(<404527..>404832)
FT                   /locus_tag="KLTH0E04488g"
FT                   /old_locus_tag="KLTH-ORF9730"
FT   CDS_pept        complement(404527..404832)
FT                   /locus_tag="KLTH0E04488g"
FT                   /old_locus_tag="KLTH-ORF9730"
FT                   /product="KLTH0E04488p"
FT                   /note="some similarities with uniprot|P14724 Saccharomyces
FT                   cerevisiae YFR036W CDC26 Subunit of the Anaphase-Promoting
FT                   Complex/Cyclosome (APC/C)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23241"
FT                   /db_xref="GOA:C5DHI0"
FT                   /db_xref="InterPro:IPR018860"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI0"
FT                   /protein_id="CAR23241.1"
FT                   /translation="MIRREPTVIGLSPEDLAELEEELEEFKLQREIKAQQRNLQRSATV
FT                   LAEADLLESEAPVRDDTTHESPLQKPLGQQAPHRPPSQSVNAGPHAPRSNPFFSQQ"
FT   gene            <405275..>409048
FT                   /locus_tag="KLTH0E04510g"
FT                   /old_locus_tag="KLTH-ORF9728"
FT   CDS_pept        405275..409048
FT                   /locus_tag="KLTH0E04510g"
FT                   /old_locus_tag="KLTH-ORF9728"
FT                   /product="KLTH0E04510p"
FT                   /note="weakly similar to uniprot|P40318 Saccharomyces
FT                   cerevisiae YIL030C SSM4 Protein involved in mRNA turnover
FT                   integral nuclear membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23242"
FT                   /db_xref="GOA:C5DHI1"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI1"
FT                   /protein_id="CAR23242.1"
FT                   /translation="MGVAAEESSGENEHSAALNASCRICRGENTSDSPLFHPCKCRGSI
FT                   KYIHESCLLEWVASKNVDLARPGANIKCDICHYSIQFKTLYDENMPDRIPVGLVIRTTL
FT                   GSVFKEAQAVIRIVMATTLLVVGIPLAWNTLGKLIAMLLFGGSLPIQGDFWKSLLYGFE
FT                   ATVPENPSKLNIALQLLKNYRFSLTQIVFLTVIHIALYFQYDMVVREPIFREMVYHNIG
FT                   PRFNGEELATSLHNAMQFIRANEERLRAQRAVPLQEDLLRGQDLGFGNEGIQAGNDEHN
FT                   DDRHNSTHRNRGSEDGIFYNGEDDEDDDDYEPNEAVASEESIASSSSSDHEIDDEERQQ
FT                   LDENNGVFNFTMNHGRDNDLEFMVQNAQQNAEREQHEEPAVGPGRNDGAADPEEAWNQE
FT                   RPAIFGVQLRFRNLPFYFLAATAFLAIYLYLTYAIPTFLGNLLLTIYSKVFVWAFRGFI
FT                   KLVEISRTPTLYKELSRRFPRISSLNLWLNTKAMQIFSFISYVYTNYVDYNNKTSTVAQ
FT                   SIPALATYSTLLGILCASTGIMSRGYGPKNGMKNSNLRFVFHLFFAIRCSLKVFLLFGI
FT                   ELVGFPVLAGLMIDFSLISPCLTSHNKFLLIGGLDIWSPAKWVLYWVIGTFYMCWFAKY
FT                   VAMIRKYIIRPGVLFFIRSSDDPNIRILHDSLIHPMRVQISRLLLSIMLYALFIVIGFG
FT                   FHTRILFPLILKSKLLPFETAQDELFFYGIAAILHQPMRITEANKSFNLYVRQYWTKAF
FT                   DLSCKKLRLSSFILNKDISTERGYIVYRNLFYRFFFSEKAKWSNPDLYVDPKTPAQADE
FT                   LFKANLEIHAYFVPDGTLMRVPANDLISRNYVQTLFVPVTKENKLLKPLDVESIKERNK
FT                   ENAGDYSYLDDQSTEFDAYTVVYTPPNFRSRFSTLLLLIWVFASVLCMTLALFFNFVGR
FT                   LMLVAVLSPFSGNEKARGYLLAYRKFSSVSLWPIAIGAWITMRGTELFHKFKMTRVVHD
FT                   EYAVHPEAGDGAENDGGVREPENLEPAADFEENEEGANAPLPQDRLQWQGRLLFILLGK
FT                   MQAIKYCIVLYYNFAFVSLFVEIFILRIEKPWKIDTFFTPNSWAEFGTVVSERLVTFGL
FT                   FFTWFVLASIIDARKSIQRMLQLGQDERLKSLKILVIDLVKECVLTAGLSFALQMALCT
FT                   YEYLLKGPPSYESVLSAYSFLRTVRPSLSSSEVPWTIPHKLFFVIPPVLSGTFYLPKIF
FT                   KSVSDFIKKSVVNTREQVYGRGKTLTNLPEGL"
FT   gene            complement(<409294..>412407)
FT                   /locus_tag="KLTH0E04532g"
FT                   /old_locus_tag="KLTH-ORF9724"
FT   CDS_pept        complement(409294..412407)
FT                   /locus_tag="KLTH0E04532g"
FT                   /old_locus_tag="KLTH-ORF9724"
FT                   /product="KLTH0E04532p"
FT                   /note="weakly similar to uniprot|P40537 Saccharomyces
FT                   cerevisiae YIL031W ULP2 Peptidase that deconjugates
FT                   Smt3/SUMO-1 peptides from proteins plays a role in
FT                   chromosome cohesion at centromeric regions and recovery
FT                   from checkpoint arrest induced by DNA damage or DNA
FT                   replication defects potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23243"
FT                   /db_xref="GOA:C5DHI2"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI2"
FT                   /protein_id="CAR23243.1"
FT                   /translation="MGRRPGRLGGMAPIDTLSSSMSRRDPVPTRYTSHRKDPKVIQELN
FT                   RASVRDFMPDVSANSSLRASQAHESGDRSPIESPVTIESDAPVHTTPARKRQKISASLI
FT                   LSSPEISSDAAPGAQVCKSSGMVRVVIRTGKEIVKSNSVLKIVNDDEGVRFSIRWKGAD
FT                   IEGSQVDFLRDCEKVYFDALKSHMGVLLKHSRCVDLDDTCKTEKTKILLWSSNVGADVN
FT                   LIRLKEVIKNSMIDSAVLSNRLAILGTMKQAVARQELEAFSKRRFWEKPEFQSLGKRHS
FT                   KSSKSSSGSSGFKITVPHETEPDKDDKASHNTIPSTQFYTDGNTGSPPQSSNSLREHTL
FT                   SSLRRSTRTTKASSPDGTSFDDSCTVYEKPEVFKPSLFYKFDDNTTLSVTNQDFKCLYN
FT                   HDWINDSILDFFVKYWTEDSIRRGTIVREKVHVLSSFFYTKLISNADNYYNNVKKWVNH
FT                   TGLFKKQYLVMPININYHWFGCIIENLPSLFSFLKREREFKEKHQKSADGDDIENSDDL
FT                   SVTSPIVTILVYDSLRQTHSREVEPIKEFLIAYAADKYGLEVSRNQIKMKSCLVPQQPN
FT                   MSDCGVHVILNTRKFFENPTKTFELWKSAKSKNKTASKVINEYFEKKERINARPDLRSV
FT                   LWKLQEKQIEFNKLNGVTETSEDDGIKSDGEHSDIEIIENYEQPATRPEQTSGQINEEL
FT                   SKPNEGQYSTPEIPESKDQLCASSKKDAPTLNSELPKTDMITGPETSAGGVEGESKAYK
FT                   SQDRRFLESSPELLPAKLSEASSEHPAQDKGSVSKYFAKAKSKHGTQETRDDIEASALG
FT                   LDSTSGASYNVILKHKDAPDPDKITCGTGTLENDEDRDLRAPSQGSKVLGSPSSTNGIA
FT                   ILGSQAYEENKGNGGLTSSPDCNSDDDVRLVSTNSAGSLDLSGQHSSQGSFIKQLSPVR
FT                   KFQAAMSKYSGAADEEVSDRTDSIHQSPHLKALDAPLSRRSVIQDQVQDIDDGLSTKKF
FT                   AIDVDRSGSEESCDGEQESSTRRSGVHKFRNSLGCSPKLEHLGKPGKG"
FT   gene            <412896..>414335
FT                   /locus_tag="KLTH0E04554g"
FT                   /old_locus_tag="KLTH-ORF9721"
FT   CDS_pept        412896..414335
FT                   /locus_tag="KLTH0E04554g"
FT                   /old_locus_tag="KLTH-ORF9721"
FT                   /product="KLTH0E04554p"
FT                   /note="similar to uniprot|Q01852 Saccharomyces cerevisiae
FT                   YIL022W TIM44 48.8 kDa protein involved in mitochondrial
FT                   protein import"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23244"
FT                   /db_xref="GOA:C5DHI3"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR017303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI3"
FT                   /protein_id="CAR23244.1"
FT                   /translation="MVFNIAMSISETLLVVSINASDPNVLIGAVILVSLDTVILTVKKF
FT                   DILISYVLNSINQKGVARGKFRMLRPGRPLKSVVIRRNLAQTFKACQGNPRSPLQIFRE
FT                   TFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQKGSTIVGKTLKKTGDS
FT                   VEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKDVSEVMDSSNSSRYGGF
FT                   ISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESFGKKVDDFKEKTVVGR
FT                   KLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFKMMDGNFNSESFLSH
FT                   LREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDI
FT                   VSAKLLPPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAMVFTRDPENID
FT                   DKETEGWKILEFVRGGSRQFT"
FT   gene            complement(<414398..>414745)
FT                   /locus_tag="KLTH0E04576g"
FT                   /old_locus_tag="KLTH-ORF9718"
FT   CDS_pept        complement(414398..414745)
FT                   /locus_tag="KLTH0E04576g"
FT                   /old_locus_tag="KLTH-ORF9718"
FT                   /product="KLTH0E04576p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23245"
FT                   /db_xref="InterPro:IPR013898"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI4"
FT                   /protein_id="CAR23245.1"
FT                   /translation="MNGLKPMTGAQKVAVPDLRFEQTFQRALRREASKNQKATSQGHST
FT                   TDADATISASVICKVVLRDVLLMPFLQGILWTSALIALKPWLHMVRIRGQLVGHRIYEM
FT                   VLGKGLVRKRA"
FT   gene            <415348..>416334
FT                   /locus_tag="KLTH0E04598g"
FT                   /old_locus_tag="KLTH-ORF9717"
FT   CDS_pept        415348..416334
FT                   /locus_tag="KLTH0E04598g"
FT                   /old_locus_tag="KLTH-ORF9717"
FT                   /product="KLTH0E04598p"
FT                   /note="similar to uniprot|P16370 Saccharomyces cerevisiae
FT                   YIL021W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23246"
FT                   /db_xref="GOA:C5DHI5"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI5"
FT                   /protein_id="CAR23246.1"
FT                   /translation="MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLA
FT                   IDSVEVETNTSVLADEFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAV
FT                   GESESTTNVYAKDLVIVSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGI
FT                   SKEHAKWSPAAAIEFEYDPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYN
FT                   AKPTTFYMNVETVGSLTVDQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGTAGMVDQ
FT                   DGGAMPVEPDSGFAYGSGGPSSGSGMGGGPGAPFGHTGPSSGFDDAW"
FT   gene            complement(<416419..>417219)
FT                   /locus_tag="KLTH0E04620g"
FT   CDS_pept        complement(416419..417219)
FT                   /locus_tag="KLTH0E04620g"
FT                   /product="KLTH0E04620p"
FT                   /note="highly similar to uniprot|P40545 Saccharomyces
FT                   cerevisiae YIL020C HIS6 Phosphoribosyl-5-amino-1-
FT                   phosphoribosyl-4- imidazolecarboxiamide isomerase catalyzes
FT                   the fourth step in histidine biosynthesis mutations cause
FT                   histidine auxotrophy and sensitivity to Cu Co and Ni salts"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23247"
FT                   /db_xref="GOA:C5DHI6"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011858"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI6"
FT                   /protein_id="CAR23247.1"
FT                   /translation="MTRFVGCIDLHNGQVKQIVGGTLKEDQKEDLKTNFVSQHSSSYYA
FT                   KLYRDNEVSGCHVIKLGPNNDEAARLALASVPGFLQVGGGINYDNCQEWLEIASKVIVT
FT                   SWLFNSNGEFQLANLEKISSRCGKDRLVVDLSCRKVEDGTSHKWVVAMNKWQKLTDLEL
FT                   NHDTFSRLSQYADEFLIHAADVEGLCRGVDEALVAKLYEWTEHLPHLKIVYAGGAKSIQ
FT                   DLALMNRLSHGKVDLTYGSSLDIFGGNLVAFKECCEWNHRDHAQ"
FT   gene            <417387..>418391
FT                   /locus_tag="KLTH0E04642g"
FT                   /old_locus_tag="KLTH-ORF9714"
FT   CDS_pept        417387..418391
FT                   /locus_tag="KLTH0E04642g"
FT                   /old_locus_tag="KLTH-ORF9714"
FT                   /product="KLTH0E04642p"
FT                   /note="similar to uniprot|P40546 Saccharomyces cerevisiae
FT                   YIL019W FAF1 Protein required for pre-rRNA processing and
FT                   40S ribosomal subunit assembly"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23248"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI7"
FT                   /protein_id="CAR23248.1"
FT                   /translation="MSDDDYAKQLEIQRKAFEAQFGSLEAMGFEDKTKNETQENSSSVE
FT                   SQESEQEDGDNSSDEAESDASFHGFSDDESSAKQKAAHGASRAPRVIKFGGVTDAYVPP
FT                   SKKEQKLLRLGKAPVRKESESEEDGRSGARHGGSDGEGNVEAENLHNDLELQRFLKESH
FT                   LLSAFGSTPSGADLTLQTMDNVEYKDDAVFGKARARTLEMRLQNLSSANGRSRKLEKVP
FT                   MNIRKGMVQKHTKRIQQHEREARDAGVVLSKVKKGEFRKIDRTYRNDIERRIGSGQSAV
FT                   DPQRIKHRQRGLQVNSVGRSTRNGLIISSQEIKAITGSSGPKRAGGSKHKRRR"
FT   gene            <419041..>420441
FT                   /locus_tag="KLTH0E04664g"
FT                   /old_locus_tag="KLTH-ORF9709"
FT   CDS_pept        419041..420441
FT                   /locus_tag="KLTH0E04664g"
FT                   /old_locus_tag="KLTH-ORF9709"
FT                   /product="KLTH0E04664p"
FT                   /note="some similarities with uniprot|P07270 Saccharomyces
FT                   cerevisiae YFR034C PHO4 Basic helix-loop- helix (bHLH)
FT                   transcription factor binds cooperatively with Pho2p to the
FT                   PHO5 promoter function is regulated by phosphorylation at
FT                   multiple sites and by phosphate availability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23249"
FT                   /db_xref="GOA:C5DHI8"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI8"
FT                   /protein_id="CAR23249.1"
FT                   /translation="MNEAESFDSKSILDQVDQYLSDQSVRQGEQPGAAPFQELSFHALP
FT                   HGHEHNQDAEHGSEKGREHGHSFSQGDHSAHLGHGFQLELEVATHSHVRPDMVFSPVIS
FT                   PVVAPQHPSHTPFLRSQASGMSGGASTKPSFSPLSSPAIDAQFPEYPGAKRGSSSSSSR
FT                   GKKTPLSTPALTATTFSNSSGSKVAKNSPQLSSRRSALSKRKSAATNWDDMFKLPDSSI
FT                   PPPSVPLFGSAQQQQQQQQQQQQQQPQNTSHLHTHSLSESADDTVSGSCSSASSVRARA
FT                   SGTPALPSRDPDGAGHNDFNVTPATLMNYPKIILPSNSRDVGSHAQSPVRDQSTYAHSG
FT                   NGHVIMATDSPVIQAKNPNLPLSRHASNTSIPTRSTPELRPVRKSSKSSLVDSGPDPDE
FT                   DEQAKKEVHKAAEQGRRNRLNTALAELHTLVPAEMKEAVLIPSKATTVEMACTYIRQLI
FT                   QRVEELQR"
FT   gene            <420873..>421382
FT                   /locus_tag="KLTH0E04686g"
FT                   /old_locus_tag="KLTH-ORF9704"
FT   CDS_pept        420873..421382
FT                   /locus_tag="KLTH0E04686g"
FT                   /old_locus_tag="KLTH-ORF9704"
FT                   /product="KLTH0E04686p"
FT                   /note="weakly similar to uniprot|P00127 Saccharomyces
FT                   cerevisiae YFR033C QCR6 ubiquinol-cytochrome c
FT                   oxidoreductase subunit 6 (17 kDa)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23250"
FT                   /db_xref="GOA:C5DHI9"
FT                   /db_xref="InterPro:IPR003422"
FT                   /db_xref="InterPro:IPR023184"
FT                   /db_xref="InterPro:IPR036811"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI9"
FT                   /protein_id="CAR23250.1"
FT                   /translation="MISSITEFLEEVKDAFVPTVAKAEEQAEESTDDDKSENDDKPEDD
FT                   GEAAEGEAADAESADADAEAEGESDGDEGEDEDEDEDEDEDEDEDEDEEEQVDQMDALR
FT                   EECKNKEEAKPLVHHYMECVERVHKAQEDPGYADSEHKEDCVEEFFHLQHYIDGCVSPT
FT                   LFDRLK"
FT   gene            <422806..>422994
FT                   /locus_tag="KLTH0E04708g"
FT                   /old_locus_tag="KLTH.mRNA.196VL.p"
FT   CDS_pept        422806..422994
FT                   /locus_tag="KLTH0E04708g"
FT                   /old_locus_tag="KLTH.mRNA.196VL.p"
FT                   /product="KLTH0E04708p"
FT                   /note="highly similar to uniprot|P05747 Saccharomyces
FT                   cerevisiae YFR032C-A RPL29 Protein component of the large
FT                   (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23251"
FT                   /db_xref="GOA:C5DHJ0"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ0"
FT                   /protein_id="CAR23251.1"
FT                   /translation="MSKSKNHTAHNQSRKAHRNGIKKPKTYKYPSLKGVDAKFRRNHKH
FT                   ALHGTAKALAAKRAEKK"
FT   gene            <423242..>424117
FT                   /locus_tag="KLTH0E04730g"
FT                   /old_locus_tag="KLTH-ORF9698"
FT   CDS_pept        423242..424117
FT                   /locus_tag="KLTH0E04730g"
FT                   /old_locus_tag="KLTH-ORF9698"
FT                   /product="KLTH0E04730p"
FT                   /note="weakly similar to uniprot|P43607 Saccharomyces
FT                   cerevisiae YFR032C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04730g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23252"
FT                   /db_xref="GOA:C5DHJ1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034244"
FT                   /db_xref="InterPro:IPR034247"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DHJ1"
FT                   /protein_id="CAR23252.1"
FT                   /translation="MSPTQPNPAAALSGSAEPQTKRIYISNLDFSTTEEELEQFLQEFR
FT                   VVSVLIPSQTVRGFRNSTVRPLGIGYADFASAADALQAVENLNGKQLRERTLKIKMYVP
FT                   YSPRARAERRKEKRKVPAPQAEENPDAAPQDAQQPQPPAPAEEPTSKDTVYCAYLPSKV
FT                   TDVELREFFADYQPQDIYVYRTNGSRRKVYFHRRFTAALVTLGGEAELANAIETLGTRR
FT                   LMGKKITLRPARLSKVEEVQHAAARKLELEQIQQQTRQIAEHAMAMEEHRQQEAEIPAA
FT                   ETPDDVAATA"
FT   gene            <425094..>426160
FT                   /locus_tag="KLTH0E04752g"
FT                   /old_locus_tag="Klth0E.mRNA.366.p"
FT   CDS_pept        join(425094..425097,425400..426160)
FT                   /locus_tag="KLTH0E04752g"
FT                   /old_locus_tag="Klth0E.mRNA.366.p"
FT                   /product="KLTH0E04752p"
FT                   /note="highly similar to uniprot|P05736 Saccharomyces
FT                   cerevisiae YIL018w RPL5A and highly similar to
FT                   uniprot|P05736 Saccharomyces cerevisiae YFR031ca RPL5B
FT                   Protein component of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23253"
FT                   /db_xref="GOA:C5DHJ2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ2"
FT                   /protein_id="CAR23253.1"
FT                   /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDFAERHGYIRGVV
FT                   KQIVHDAGRGAPLAKVVFRDPYKYKLREETFIANEGVHTGQFIYAGAKASLNVGNILPL
FT                   GSVPEGTIVSNVEEKPGDRGALARASGNYVIVIGHNPDENKTRVRLPSGAKKIINSSAR
FT                   GVIGVVAGGGRVDKPLLKAGRAFHKYRVKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKA
FT                   STISRGAVPGQKVGLIAARRTGLLRGSQKTQD"
FT   gene            <426535..>430047
FT                   /locus_tag="KLTH0E04774g"
FT                   /old_locus_tag="KLTH-ORF9690"
FT   CDS_pept        426535..430047
FT                   /locus_tag="KLTH0E04774g"
FT                   /old_locus_tag="KLTH-ORF9690"
FT                   /product="KLTH0E04774p"
FT                   /note="similar to uniprot|P38989 Saccharomyces cerevisiae
FT                   YFR031C SMC2 Component of the condensin complex essential
FT                   SMC chromosomal ATPase family member that forms a complex
FT                   with Smc4p to form the active ATPase Smc2p/Smc4p complex
FT                   binds DNA possibly in the cleft formed by the coiled-coil
FT                   of the folded dimer"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23254"
FT                   /db_xref="GOA:C5DHJ3"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027120"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ3"
FT                   /protein_id="CAR23254.1"
FT                   /translation="MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAI
FT                   CFVLGISSMATVRASNLQDLIYKRGQAGVTKASVTIVFTNDDKANSPIGFESYPKISVT
FT                   RQIVLGGTSKYLINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILS
FT                   LIEEAAGTKMFEDRREKAERTMNKKETKLQEIRTLLIEEIEPKLNKLRNEKRAFLEFQE
FT                   TQSDFEKTSRIVNAFTYSTLAQSRKNFEETFKSNESRIEQLEEAIQKTRQGMTNLEEDL
FT                   DVARTQKRNEMGKNGKLGQLEALENQLNNDLSRLKASLTITTDNLNEENVRRESLERSI
FT                   CDYESSLEKNTTHSKNTEDEYLSLNNLVSNLEKQLQTKEELLSTLTTGISSTGATTSGY
FT                   NLQLSSAKARFNDAQVQVQRFGMKIDLLRKELSANEPKLAKAKSICEEAKKEIEAHRMQ
FT                   CSKLNAHLEKLGFNPDLFKQLKEEESTLRQSIYKLSSEMESLKRRVANIEFTYSKPSEN
FT                   FNPSSVKGVAAQLFSLDEKNYSSATALQVCAGGRLFNVVVDNEGTASQLLERGRLRKRV
FT                   TIIPLNKISARSLHQNAVKAAKELAPGNVELALNLIGYEEEVSKAMEFIFGTSLICQDA
FT                   ETAKKVTFHPRVRARSITLQGDIYDPEGTLSGGSRNNSSSFLIDIQKFNSISKKVIDLE
FT                   NKLADVIGRIKQYSEISVKTKSVQNELNLATHKLHLANRSLENNPSAQLLARNKEIQEE
FT                   IENCTESMKNGREDVRRLEGEVSRIEKDIEEFSKDKGSKLDELKNEVTSISKQIEQKKI
FT                   VLEKKEDVNQTLQLKMDQLKSDISSARDGIKESLEVSKELDEKRVQVEGNLELTSGQLS
FT                   ETKAEVLEEKKRLYEIDEEMRVLADLLRTKGEGLKNDEVELKKLSNEVSKLANSTHSVE
FT                   ERIQLLLREEQWLADEGLVSSIVVQNQGINLAEYRQRAEQLGEKFNNMKRKVNPNIMSM
FT                   IESVEKKESALKTMITTIEKDKTKIQDTIAKLNEYKRETLIKTWEKVTVDFGQVFSELL
FT                   PNSFAKLVPLEGKDVTEGLEVKIQLGNIWKESLVELSGGQRSLIALSLILALLQFKPAP
FT                   MYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFKTRFQDGTSV
FT                   VSAM"
FT   gene            complement(<430153..>433263)
FT                   /locus_tag="KLTH0E04796g"
FT                   /old_locus_tag="KLTH-ORF9686"
FT   CDS_pept        complement(430153..433263)
FT                   /locus_tag="KLTH0E04796g"
FT                   /old_locus_tag="KLTH-ORF9686"
FT                   /product="KLTH0E04796p"
FT                   /note="similar to uniprot|P39692 Saccharomyces cerevisiae
FT                   YFR030W MET10 Subunit alpha of assimilatory sulfite
FT                   reductase which is responsible for the conversion of
FT                   sulfite into sulfide"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23255"
FT                   /db_xref="GOA:C5DHJ4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ4"
FT                   /protein_id="CAR23255.1"
FT                   /translation="MGLEFSTNPFGIPSNWKESNAYTTPVTAISSVLAGNLESVFSYKT
FT                   FSEPDLLDGALKKWSSKGYTTLQFEELQLRSGAGLAPLGFARGSGHSSLYGIITPGYGL
FT                   SYFANAFTREAETKNRFLFNVGALEYNEESGQVASDFVTPVKIAASMGLPVVSPTSVKE
FT                   VKHTALLAIALAKFGKPIGAVNLFDGANYAKTVLNIDEQESQDIIGELSSSLVVGSTFD
FT                   QILDKFNEVSSAKLHNFDYHGDENAETVFVTFGCVESELFSTSLRGNTNNVGHIAIRIP
FT                   LPFDTEKFVAQIPKSAKNLVVIGQSLDGQSPTTLKSQISAALFFQKAKTVKVSEYLYLP
FT                   SFVWSADAVKQVVSTFAPEFSSYVSHQAENFIYWASDSSVNLDVASRLVHALSLVDNRE
FT                   VSFRTKFDNNANGGVFQAQFSSGKQSGSHVFSNIDSANVAVVENLSILNAFDVAKTVDN
FT                   NGVVLIITEKSIKDKDLSDSKVLAEELKIPISFLRQAVDKNLLLAFLDTETIGDKEETK
FT                   GRTASFVTQAAFWKYAYKLSVAESVRRIWSSAGSDIELLAAVLSETITTAFEVGLHEVP
FT                   AEKLSKSIPEVSPEKDEEGPLPSLLTETCFKPNPRKSEEHSEVELSSKASVAQQLSFKE
FT                   AFATESSLRPDLPMKNFIVKVKENRRVTPDDYDRYIFHIEFDITGTGLTYGIGEALGVH
FT                   ARNNQPLVREFLESYGLSENDIIQVPSKEDHDVLESKTVLKAFTENLDLFGKPPKAFYQ
FT                   SLIDFASNEDEKRKLEELVSPEGAVLLKKYQDVEYYTYADIFKLFPSARPGITDLVRII
FT                   SPLKRREYSIASSQRVHPNEVHLLIVVVDWIDNKGRKRFGQSSKYLAELPVGAELVVSV
FT                   KPSVMKLPPSPQQPVIMSGLGTGLAPFKAIVEEKFWQKQQGHDIGKVFLFLGSRHKREE
FT                   YLYGELWEAYKDAGIVTHIGAAFSRDQPHKIYIQDRIREALKELQTALIDEKGSFYLCG
FT                   PTWPVPDITKALQDIIKADADERGEKVNLDEAIEELKETSRYILEVY"
FT   gene            complement(<433487..>436198)
FT                   /locus_tag="KLTH0E04818g"
FT                   /old_locus_tag="KLTH-ORF9683"
FT   CDS_pept        complement(433487..436198)
FT                   /locus_tag="KLTH0E04818g"
FT                   /old_locus_tag="KLTH-ORF9683"
FT                   /product="KLTH0E04818p"
FT                   /note="similar to uniprot|P40547 Saccharomyces cerevisiae
FT                   YIL017C VID28 Vacuole import and degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23256"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR038739"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ5"
FT                   /protein_id="CAR23256.1"
FT                   /translation="MPTSTSEASTQVSDQLNALKYTLLGDTFAKWNLMVSGQDVIEKVV
FT                   DVASCGGNLAVEALDVLLSFLNFSNEIKAEMGPRYYEVVTNITQKLQISSADPDIILLR
FT                   KLQLANICAGDYEPASMVADLQTCFLDVVKYKRRRFLSSKHRMAIIVELLACLSKNDGG
FT                   LEPEVKPATQQLLLDFTRKYADQLSFRYLFEKKADHSHASNLQDYDPLRNPGIGSKLTM
FT                   PLQTCPNQVDIYDPLDRPSFAFSLNVYLRMLESSSAAFLETNNLWECGPFVLLTSSFLK
FT                   SDDLVLKCCALRFFAYPYICRQELELKREPLELWLPHLVECFNYDNIPWWFDPFDTLIR
FT                   LVDHYNETTPLNNPVSNFLFDTKTTNGIVRLLAGFLSLEQQNGSTIDIVFKLIKLCASL
FT                   TSFDEKTRKLLLVDKAILYHAESGLQSHLNLLKRFLSHKDQHLDELKDVTVPPIYDSGL
FT                   TLSWILLLKSFSRSVTALRTFLKRNKLASLLLELVKVIFSLTKSYNFDGEQLIKAEIQI
FT                   MSAALGVLSNFVVEFSNLQSFVIENGVMDIVGSILKDPFFNDKIGGSAEMPYCAASQIS
FT                   TAGVQTNALWVLRHLMYNSHNDEKLELLSIIPMEVILQFVNNRNWLVQEQCFQLLRNLT
FT                   CNSRRVVNMLLESFSDSDSSLDSSKSGGRIESTYLFEFLAHKLKMLDSNDLNQRKTLEG
FT                   VLYVIVNITATNENKRQLVIEQDELLRLIKSILAENAESDHTAHSKTDIQIASLWILTN
FT                   LIWASTTSNFHMHATEPHSVMDLDETNPTRSGGSEDMQQNKTQSQESDDPYDEDMSDSF
FT                   KEDDEENQDEEGGGSSPFADNTGLIDRFERDKQVRGASKLKISAAERCSKLVKMGFYDI
FT                   VKLKTLDTQLRVREQAKLLLFHMELLRKGVQE"
FT   gene            <436597..>437133
FT                   /locus_tag="KLTH0E04840g"
FT                   /old_locus_tag="KLTH-ORF9681"
FT   CDS_pept        436597..437133
FT                   /locus_tag="KLTH0E04840g"
FT                   /old_locus_tag="KLTH-ORF9681"
FT                   /product="KLTH0E04840p"
FT                   /note="some similarities with uniprot|P40548 Saccharomyces
FT                   cerevisiae YIL016W SNL1 Integral membrane protein
FT                   containing a Bag domain suppressor of nup116-C lethal"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23257"
FT                   /db_xref="GOA:C5DHJ6"
FT                   /db_xref="InterPro:IPR003103"
FT                   /db_xref="InterPro:IPR036533"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ6"
FT                   /protein_id="CAR23257.1"
FT                   /translation="MDMVRSWLQSPTVKPTKDYVTSSLEPWVRKLRNDNMAMIYTATAV
FT                   GALLLVLVFKPSKSSKPKKSHKSKGKKAKNPERSVQRKPLTLEEQIEGVHQKFVNEYKE
FT                   GLDRLAKNYDAKSEKDQYQLNYYNEMLLKLVIELDGVDLVEVEPELKAKLKSRRKQVIH
FT                   EIQSNLKKLDQLKRQ"
FT   gene            <437543..>438250
FT                   /locus_tag="KLTH0E04862g"
FT                   /old_locus_tag="KLTH-ORF9679"
FT   CDS_pept        437543..438250
FT                   /locus_tag="KLTH0E04862g"
FT                   /old_locus_tag="KLTH-ORF9679"
FT                   /product="KLTH0E04862p"
FT                   /note="similar to uniprot|P38145 Saccharomyces cerevisiae
FT                   YBR256C RIB5 Riboflavin synthase catalyzes the last step of
FT                   the riboflavin biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23258"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ7"
FT                   /protein_id="CAR23258.1"
FT                   /translation="MFTGIVELIGTVAEYKEYDTTHSGGGGVSVTVKDASPILGDCHIG
FT                   DSIAVNGICLTVTEYSSDSFKVGISPETLRRTNVASWQPGSKVNLERAVGQDVRFGGHY
FT                   VQGHIDGTAKVVSRVAEGNSIVFGFKLHEKEFEKYIVEKGFICIDGTSLTITKVEPDGT
FT                   FYIAMIKHTQEKVVMPLKTVGDEVNIEVDLTGKVIEKQVVLQLQEQISNEHSPLAILVD
FT                   KLVEAKVKKFLSK"
FT   gene            complement(<438303..>439622)
FT                   /locus_tag="KLTH0E04884g"
FT                   /old_locus_tag="KLTH-ORF9676"
FT   CDS_pept        complement(438303..439622)
FT                   /locus_tag="KLTH0E04884g"
FT                   /old_locus_tag="KLTH-ORF9676"
FT                   /product="KLTH0E04884p"
FT                   /note="similar to uniprot|P35184 Saccharomyces cerevisiae
FT                   YIR012W SQT1 Protein involved in a late step of 60S
FT                   ribosomal subunit assembly or modification contains
FT                   multiple WD repeats interacts with Qsr1p in the two-hybrid
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23259"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ8"
FT                   /protein_id="CAR23259.1"
FT                   /translation="MSEYPSEQEHQTGDQIPEEEFITNQEVDQEVVLDDNDNDGDFPVD
FT                   EDDLEEIDGAGEDAEDEEDTIEIDMSNNSIAYFDKHTDSVFSIFAHPTLPLVCSGGGDN
FT                   TAYLWTSHSQPPKFAGSIAHSESVIGGGFTPDGQFLITADMNGQILVHKASNGGAKWKK
FT                   CAELQEVQEVVWIKVHPTVSGVFAFGSTDGSVWCYQVDSQSGELEQIMSQFVHQSDCTM
FT                   GEFINVEQGDANLSLVTCSLDSTIIGWSCYTNQQIFKVTSSEIRGYEAPWVSLAKAPVS
FT                   MTKNTPVVACGANNGTMAILNCSNGAVLQLSIVIELQADQDELDASIESIAWSEKLPLM
FT                   AVGLVSGEVLLYDALTWRIRRKFVLPDSVTKLQFEDSAATTLLASCINGKVYQYDARTG
FT                   SEKFVCVGHNMGVLDFVLIENGKKLITAGDEGVSLVYQLP"
FT   gene            <440170..>441069
FT                   /locus_tag="KLTH0E04906g"
FT                   /old_locus_tag="KLTH-ORF9672"
FT   CDS_pept        440170..441069
FT                   /locus_tag="KLTH0E04906g"
FT                   /old_locus_tag="KLTH-ORF9672"
FT                   /product="KLTH0E04906p"
FT                   /note="similar to uniprot|P38637 Saccharomyces cerevisiae
FT                   YIR011C STS1 Protein that interacts with the karyopherin
FT                   Srp1p may have a role with Srp1p in ubiquitin-mediated
FT                   protein degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04906g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23260"
FT                   /db_xref="GOA:C5DHJ9"
FT                   /db_xref="InterPro:IPR013868"
FT                   /db_xref="InterPro:IPR038422"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DHJ9"
FT                   /protein_id="CAR23260.1"
FT                   /translation="MSQSVGFNWGFKPSTAENTSSAISTCKVTKPRVKRRFAGEEAASG
FT                   GSPTYNNRPRAVAKRRTAVSGIQGQPLPLSRALELMDRTQLQSTLLELVKLHPEIQSTF
FT                   MALQPPSRGLDQYVTLLRGKLEQVYANLPYSRLRDRLPDDTGEGLNDYTFVRVKSFLLE
FT                   FLNCLVDCLLESIPPQVQNPLHSLKLLDTATGLLSQLPHFSTASNNYYKNVCYEQVAEI
FT                   WSTVIRQATQDISFLGATSTVLDWLQILQKHNEKSQGKLQRPLSLLQTFQESLEPVQAP
FT                   AGISQDQQQPSNLWNNIV"
FT   gene            <441235..>441656
FT                   /locus_tag="KLTH0E04928g"
FT                   /old_locus_tag="Klth0E.mRNA.at.339.p"
FT   CDS_pept        join(441235..441294,441360..441656)
FT                   /locus_tag="KLTH0E04928g"
FT                   /old_locus_tag="Klth0E.mRNA.at.339.p"
FT                   /product="KLTH0E04928p"
FT                   /note="similar to uniprot|Q3E776 Saccharomyces cerevisiae
FT                   YBR255C-A Hypothetical ORF identified by homology"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23261"
FT                   /db_xref="GOA:C5DHK0"
FT                   /db_xref="InterPro:IPR038882"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK0"
FT                   /protein_id="CAR23261.1"
FT                   /translation="MGGVQPIHYDRETVKELTKEILTASGIGAFRGAIIGLTTALLLRR
FT                   FSTVYRNVRTQVRVFYHCSWISMGAVFYADKQLIKFQNRYYENEIKRRSRILDEAAERG
FT                   IFLEEDSVVTSTTS"
FT   gene            complement(<441717..>443321)
FT                   /locus_tag="KLTH0E04950g"
FT                   /old_locus_tag="KLTH-ORF9670"
FT   CDS_pept        complement(441717..443321)
FT                   /locus_tag="KLTH0E04950g"
FT                   /old_locus_tag="KLTH-ORF9670"
FT                   /product="KLTH0E04950p"
FT                   /note="some similarities with uniprot|P38335 Saccharomyces
FT                   cerevisiae YBR255W Protein of unknown function required for
FT                   normal growth rate at 15 degrees C green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm in
FT                   a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23262"
FT                   /db_xref="GOA:C5DHK1"
FT                   /db_xref="InterPro:IPR038769"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK1"
FT                   /protein_id="CAR23262.1"
FT                   /translation="MKNGATEHMSSSDKLEGDEARHVSSYRISQTAKLLTNAKISLLED
FT                   LNVDNLTVGNTEKSGAATLGKVLNEQNKGRPLKILSKASRIRADRVRSYIQFYYHLIEK
FT                   EITTGGTGLYKGVEGKYNPLQVIRNRKIKKKLHENPKNEIAFMKPPVLAIRDFSKHPDR
FT                   ENQWFVGVNETTADLAWRVSHWDELRRPDGKPWFKSKSKRRSQSAAEVSRAYKGERPPN
FT                   HSRNSSSILLRQTSSNWELPQISVESVDGPVTDGPRGRESKFDKALEKTKRLSRSALQS
FT                   KSASQQHIIYDERNPDSKPLGNAHNLYLTPTEPVHHPNIADIPINSFRTRTAEERSSES
FT                   SNRASEEFLELSEPFNIPKESVLQKQYNELIYLRCTFQVVRHRQETSRIIQARTSAKAS
FT                   VFVPEDPTQICKPAEDVLHEYENELVKALKTCDIWKSRLLNDYSIRVETLISTSDRVLS
FT                   DINSTLTLRLKMLQEKMDKFGTLRRMNREPLRVFLYRVLEVAITLLFWMIWVIFIIVKS
FT                   GKIMILSLLRVVRWITW"
FT   gene            <443419..>443931
FT                   /locus_tag="KLTH0E04972g"
FT                   /old_locus_tag="KLTH-ORF9668"
FT   CDS_pept        443419..443931
FT                   /locus_tag="KLTH0E04972g"
FT                   /old_locus_tag="KLTH-ORF9668"
FT                   /product="KLTH0E04972p"
FT                   /note="similar to uniprot|P38334 Saccharomyces cerevisiae
FT                   YBR254C TRS20 Trapp subunit of 20 kDa probable membrane
FT                   protein mutations in the human homolog cause
FT                   spondyloepiphyseal dysplasia tarda (SEDL) a genetically
FT                   heterogeneous disorder characterized by short stature and
FT                   early-onset osteoarthritis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23263"
FT                   /db_xref="GOA:C5DHK2"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK2"
FT                   /protein_id="CAR23263.1"
FT                   /translation="MPCYFAIIGARDNPIYEAEFTSQQLNSFPPELKELNPFILHASLD
FT                   IIEDLQWQVNPQSINSGGGSGGFLRSRHSNNNGNCYLGKIDHFYGLAITGYLSYGNMKF
FT                   VMIHSSNGNGSTPAQVEDGSVKNFYQEVHELFVKTLMNPFYKLNDPITSPVFDSKVRTL
FT                   ARRYLLK"
FT   gene            complement(<443995..>445623)
FT                   /locus_tag="KLTH0E04994g"
FT                   /old_locus_tag="KLTH-ORF9667"
FT   CDS_pept        complement(443995..445623)
FT                   /locus_tag="KLTH0E04994g"
FT                   /old_locus_tag="KLTH-ORF9667"
FT                   /product="KLTH0E04994p"
FT                   /note="some similarities with uniprot|P40568 Saccharomyces
FT                   cerevisiae YIR010W DSN1 Essential component of the MIND
FT                   kinetochore complex (Mtw1p Including Nnf1p- Nsl1p-Dsn1p)
FT                   which joins kinetochore subunits contacting DNA to those
FT                   contacting microtubules important for chromosome
FT                   segregation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23264"
FT                   /db_xref="GOA:C5DHK3"
FT                   /db_xref="InterPro:IPR013218"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK3"
FT                   /protein_id="CAR23264.1"
FT                   /translation="MSRERPRSLTPQGRASQRKHGLKVQTLPLPPELKSYDSVRTTQEL
FT                   EENGEPDEYRRNNPQSSFEKDEDFKFKRHKHRNNAGTASLGERLDSLHELQNARWVDNF
FT                   NSSVNMDRRARNSQRENPSQESQRSIPALPAQSIPPSYMPYMYYYPFAPMVHPMSTSPA
FT                   RAANGEMPQYISSSQGYPNTSTQPFMPPMPPMPQPNTQLMPPPPLYPNYSSYNYYNNAN
FT                   EDVAKKSQRRREKRSSLMAQRGRRLSLLSFQENSQIISPHKDVPERDFYRHIANTSFGQ
FT                   DLQIRQLFSWCLIRCLRKWESNEHQPSREEAKSNEETYADPKKIALTIVKEFVEELRKG
FT                   KTDVNWDAEEYTDSSTEDNTQFQEEDTELRELFDEDDDDTDILHSRPRKRRRQQPLKIP
FT                   NEKNVENAKNLKVLEKQISSLEEEIKTWIQELDKIDHTSEWRSFKSQLIKLATAEIKPA
FT                   SPSPLLHDLKTELECRVESLRVTSHFLHSNSELLSLSTQQKVQKLTQCINNGVFSARTD
FT                   PQTNKHTTRNLLRGLSRSLTKEDSP"
FT   gene            complement(<445941..>446309)
FT                   /locus_tag="KLTH0E05016g"
FT                   /old_locus_tag="KLTH-ORF9664"
FT   CDS_pept        complement(445941..446309)
FT                   /locus_tag="KLTH0E05016g"
FT                   /old_locus_tag="KLTH-ORF9664"
FT                   /product="KLTH0E05016p"
FT                   /note="similar to uniprot|P32570 Saccharomyces cerevisiae
FT                   YBR253W SRB6 Protein involved in transcription as part of
FT                   the Srb/Mediator complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05016g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23265"
FT                   /db_xref="GOA:C5DHK4"
FT                   /db_xref="InterPro:IPR009332"
FT                   /db_xref="InterPro:IPR016530"
FT                   /db_xref="InterPro:IPR038427"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK4"
FT                   /protein_id="CAR23265.1"
FT                   /translation="MSNRGLLEQLERTTETLSHSLSNLIKYSSVAKERDDEDSGEQHEL
FT                   PESTAKNSTSGLMMVNAQTAQLIKGIQDLLVMTRSIREKWLLTQIPDEGVDSQSELDYE
FT                   KCSQLLKQWTQEVVSSEE"
FT   gene            complement(<446503..>446973)
FT                   /locus_tag="KLTH0E05038g"
FT                   /old_locus_tag="KLTH-ORF9662"
FT   CDS_pept        complement(446503..446973)
FT                   /locus_tag="KLTH0E05038g"
FT                   /old_locus_tag="KLTH-ORF9662"
FT                   /product="KLTH0E05038p"
FT                   /note="highly similar to YBR252W, uniprot|P33317
FT                   Saccharomyces cerevisiae YBR252W (DUT1)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23266"
FT                   /db_xref="GOA:C5DHK5"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK5"
FT                   /protein_id="CAR23266.1"
FT                   /translation="MTNIDAPARKQQKLNNSLLIQLRSPDAIAPTKGSASAAGYDIYAS
FT                   QGSVIPARGQGLVSTDVSFTVPVGTYGRIAPRSGLAVKHGINTGAGVVDRDYTGEVKIV
FT                   LFNHADKDFEVRKGDRVAQLILEKIVDDAEIVVVDSLEESARGAGGFGSTGK"
FT   gene            <447698..>447768
FT                   /locus_tag="KLTH0E05060r"
FT                   /old_locus_tag="Klth0E.tGly.GCC.9"
FT   tRNA            447698..447768
FT                   /locus_tag="KLTH0E05060r"
FT                   /old_locus_tag="Klth0E.tGly.GCC.9"
FT                   /note="tRNA-Gly (GCC) cove score=62.63"
FT   gene            complement(<447921..>449132)
FT                   /locus_tag="KLTH0E05082g"
FT                   /old_locus_tag="KLTH-ORF9659"
FT   CDS_pept        complement(447921..449132)
FT                   /locus_tag="KLTH0E05082g"
FT                   /old_locus_tag="KLTH-ORF9659"
FT                   /product="KLTH0E05082p"
FT                   /note="similar to YGR111W, uniprot|P53265 Saccharomyces
FT                   cerevisiae YGR111W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23267"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK6"
FT                   /protein_id="CAR23267.1"
FT                   /translation="MTKQTQKDNLVFEETKDPEVIRFTHMQNGENWAPPFMSKEDYLQR
FT                   ERVIGTSEISTKHLCPKMQKRFPEGSECLGIKYYVLRNLGLPATSKTSQVVASCETLNR
FT                   VGMAASPQTGGAVQPVLTACIGGVYTLPEYRCKGYGSQMITRLNKLYDEYSQRADTPPL
FT                   AKTVVMTLYSEVGEYYSKFGFSSRPVPVHVVKNIDRLLNEYCGGEPGGGDGGGRALDFD
FT                   GCESLLERQVREFSQNITRLQKENPNAFVFAVEPSLDNFRLFHRRGLFHKKYVEPDSPV
FT                   TFGYALPNGSHLVWHHNYYPGDRALFLLKLHVSEDSEDKDADLKLLLAQAICEAKKTKI
FT                   DRLQFWDTELGHQAWSKPFMEFLGKIEDKSGLYQENPSRSAVRVSGFKGEDIIWDHNTK
FT                   YCWF"
FT   gene            complement(<449481..>453038)
FT                   /locus_tag="KLTH0E05104g"
FT                   /old_locus_tag="KLTH-ORF9655"
FT   CDS_pept        complement(449481..453038)
FT                   /locus_tag="KLTH0E05104g"
FT                   /old_locus_tag="KLTH-ORF9655"
FT                   /product="KLTH0E05104p"
FT                   /note="similar to uniprot|P40851 Saccharomyces cerevisiae
FT                   YPR122W AXL1 Haploid specific endoprotease that performs
FT                   one of two N-terminal cleavages during maturation of a-
FT                   factor mating pheromone required for axial budding pattern
FT                   of haploid cells"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23268"
FT                   /db_xref="GOA:C5DHK7"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR032632"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK7"
FT                   /protein_id="CAR23268.1"
FT                   /translation="MSGMSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLISDPAD
FT                   TSVSSSVSVASGSHADPDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAY
FT                   TTGENTTFYFELPASNDSGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNK
FT                   ASTPKQLYHATRLLANPRHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATR
FT                   MALCLRGPQSLNALAKLAKKYFGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFK
FT                   NSKQQTQVQDAFVPDTSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFF
FT                   GDEGVGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDL
FT                   FIPRLIHDKTKDIAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKC
FT                   LLKGSPLIECNQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCP
FT                   KSDLLSSVTSVSKTDAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRK
FT                   LGLIKQALQASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKS
FT                   IISIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLS
FT                   FTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAMFRKARVAVRNKYEEAASANSTTLAT
FT                   LGLLIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEIST
FT                   FLDSGLTSHLSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRD
FT                   DAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHL
FT                   ESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEA
FT                   NVHSGNLPEQGAAMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKI
FT                   SICSTTRSKLSVMVASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKP
FT                   STLMRGLFKFFLARGETLRLCNVILKELSKAVVLSLKPRPTNNNSAGVLQNVRKEVSTA
FT                   VPLIEVQANHFRQRSPVTG"
FT   gene            complement(<453279..>453367)
FT                   /locus_tag="KLTH0E05126r"
FT                   /old_locus_tag="Klth0E.tTyr.GTA.29"
FT   tRNA            complement(join(453279..453314,453329..453367))
FT                   /locus_tag="KLTH0E05126r"
FT                   /old_locus_tag="Klth0E.tTyr.GTA.29"
FT                   /note="tRNA-Tyr (GTA) cove"
FT   gene            complement(<453418..>453705)
FT                   /locus_tag="KLTH0E05148g"
FT                   /old_locus_tag="KLTH-ORF9650"
FT   CDS_pept        complement(453418..453705)
FT                   /locus_tag="KLTH0E05148g"
FT                   /old_locus_tag="KLTH-ORF9650"
FT                   /product="KLTH0E05148p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23269"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK8"
FT                   /protein_id="CAR23269.1"
FT                   /translation="MGAMANLKEKLVKLKRFLSGEPVEGETYEKSPDVKDLPHMKDADG
FT                   KLIAVSSGNRELSPVLSAKLNIQNSQGLSKSGSRNEPIDSRFSGEDKIAA"
FT   gene            <455057..>456283
FT                   /locus_tag="KLTH0E05170g"
FT                   /old_locus_tag="KLTH-ORF9645"
FT   CDS_pept        455057..456283
FT                   /locus_tag="KLTH0E05170g"
FT                   /old_locus_tag="KLTH-ORF9645"
FT                   /product="KLTH0E05170p"
FT                   /note="similar to uniprot|P30283 Saccharomyces cerevisiae
FT                   YPR120C CLB5 B-type cyclin with a role in DNA replication
FT                   during S phase has an additional functional role in
FT                   formation of mitotic spindles along with Clb3p and Clb4p
FT                   and uniprot|P32943 Saccharomyces cerevisiae YGR109C CLB6"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23270"
FT                   /db_xref="GOA:C5DHK9"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK9"
FT                   /protein_id="CAR23270.1"
FT                   /translation="MSELTRSRTLNNAVTDENASRSVGRAKTIAGASLGAQRKALGEVR
FT                   NWQTQSQDDAKIETTSTQEVRSQRDWELEGPSRKKRQIYMSDDESESDDESQGSGASTS
FT                   STKRPRLEEGPAHRALQSWRDLDRDEKDDVCMVYEYTDDIFDHLYQREKQTTPTYNYLT
FT                   ATDSPQYLRPSLRAILIDWLVEVHQKFQLLPETLYLAINVMDRFMSMRKVSMAKLQLLA
FT                   VSSLLIAAKFEEVNLPKLSQYAYITDGACSSQDIKDAEMYVLTTLKFNIGWPNPLNFLR
FT                   RISKADNYDVQARSVAKFFLEYAMCCPKFVDIIPSRVSAMAMFCARQSLDKDDKWDSTF
FT                   EHYSGGVDPLNEPEFQDLCRDLIKEISKPTTQLKALEAKYSSKQMGSVFEPAKIWCDLM
FT                   VASKFEDLF"
FT   gene            complement(<456907..>458370)
FT                   /locus_tag="KLTH0E05192g"
FT                   /old_locus_tag="KLTH-ORF9643"
FT   CDS_pept        complement(456907..458370)
FT                   /locus_tag="KLTH0E05192g"
FT                   /old_locus_tag="KLTH-ORF9643"
FT                   /product="KLTH0E05192p"
FT                   /note="similar to uniprot|P24869 Saccharomyces cerevisiae
FT                   YPR119W CLB2 Involved in mitotic induction G(sub)2-
FT                   specific B-type cyclin and uniprot|P24868 Saccharomyces
FT                   cerevisiae YGR108W CLB1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23271"
FT                   /db_xref="GOA:C5DHL0"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL0"
FT                   /protein_id="CAR23271.1"
FT                   /translation="MSFAHNDNSQDSRPRTLKSTRTALNNVTNTTIAQEVKSANSSARS
FT                   LGKVLRAARSKLQSDKTVGSLIPQIRREGTLSEIPPSSSSSTSLSSAGTIPASQVTSSE
FT                   LDKENMDPFASKLPSIEEEQQSQSLSSSREALQYSEHQTMLKDSDYASAMQSDLQAQQQ
FT                   QQRSSNILEPAADVSKKRPISTVVEQEEPKKFKVCAKGTEYEWEDLDAEDINDPFMVSE
FT                   YVNDIFEYLHKLEIMTLPNRHDLYKHSNIRQNRDILVNWMVKIHNKFGLLPETLYLSLN
FT                   IMDRFLCRELVQLEKLQLVGTACLFIASKYEEVYSPSVKHFAYETDGACDEDEIREGEK
FT                   FILKTLEFNLNYPNPMNFLRRISKADDYDIQSRTLAKYLLEISVVDFRFIGVLPSLCAA
FT                   TAMFLSRKMLGKGKWDGNLIHYSGGYTREELAPVCNMVMDYLVQPVVHDEFFKKYASRK
FT                   FMKASVISRQWAKKVVAHGYDIMTLHEPT"
FT   gene            <459225..>459314
FT                   /locus_tag="KLTH0E05214r"
FT                   /old_locus_tag="Klth0E.tLys.TTT.10"
FT   tRNA            join(459225..459261,459279..459314)
FT                   /locus_tag="KLTH0E05214r"
FT                   /old_locus_tag="Klth0E.tLys.TTT.10"
FT                   /note="tRNA-Lys (TTT) cove"
FT   gene            complement(<459700..>460953)
FT                   /locus_tag="KLTH0E05236g"
FT                   /old_locus_tag="KLTH-ORF9638"
FT   CDS_pept        complement(459700..460953)
FT                   /locus_tag="KLTH0E05236g"
FT                   /old_locus_tag="KLTH-ORF9638"
FT                   /product="KLTH0E05236p"
FT                   /note="highly similar to uniprot|Q06489 Saccharomyces
FT                   cerevisiae YPR118W Methylthioribose-1-phosphate isomerase
FT                   catalyzes the isomerization of 5-methylthioribose-1-
FT                   phosphate to 5-methylthioribulose-1-phosphate in the
FT                   methionine salvage pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23272"
FT                   /db_xref="GOA:C5DHL1"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DHL1"
FT                   /protein_id="CAR23272.1"
FT                   /translation="MSLEAIQFDRSHRDDISVRVLDQLLLPYTTKYVPIYTIDDGYTVI
FT                   NTMQVRGAPAIAIVGALAVLMEIQLLQNDGFARTQTFYDISSFELTRSALSQRLDFLLS
FT                   SRPTAVNLSNALREIRVLLAQSAGLAAFGNGVYDFVCRLIDEDLTNNVKMGDNGAAFLL
FT                   DALQQEGFDEDFAVLTICNTGSLATSGYGTALGVVRSLWNDSLAKSQAPGDGSAKKRKL
FT                   NQGRAKMVQVYPLETRPYNQGARLTAYELVHDQIPATLIPDSSIAYRIATSPVPIKAAF
FT                   VGADRIVRNGDTANKIGTYQLALVCKHFGIKFFVTAPKTTIDSKTETGAGIVVEERKPN
FT                   EFKHVSGTLIDSQTGLPCVDNQDKPVSASVGVAPSEIDVWNPAFDITPHELIDGIVTED
FT                   GVFTKSASGSFDLTNLFA"
FT   gene            complement(<461191..>461271)
FT                   /locus_tag="KLTH0E05258r"
FT                   /old_locus_tag="Klth0E.tLeu.GAG.28"
FT   tRNA            complement(461191..461271)
FT                   /locus_tag="KLTH0E05258r"
FT                   /old_locus_tag="Klth0E.tLeu.GAG.28"
FT                   /note="tRNA-Leu (GAG) cove score=65.59"
FT   gene            <461626..>462387
FT                   /locus_tag="KLTH0E05280g"
FT                   /old_locus_tag="KLTH-ORF9633"
FT   CDS_pept        461626..462387
FT                   /locus_tag="KLTH0E05280g"
FT                   /old_locus_tag="KLTH-ORF9633"
FT                   /product="KLTH0E05280p"
FT                   /note="weakly similar to uniprot|P53262 Saccharomyces
FT                   cerevisiae YGR106C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23273"
FT                   /db_xref="GOA:C5DHL2"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL2"
FT                   /protein_id="CAR23273.1"
FT                   /translation="MLLKSLFLFLAALFQACAAETSFLSVNSRRYRDALGDDQVGSLEE
FT                   LTKISDAEEPMVWFKFDKFDLLGELARSTAETRFLTAFFEGSVTDVLDQDSSSKAAENV
FT                   RSEKFEVAEIPASAFESLYDRVHPSDGALVFEFTESNYDLALLDEYLEAVYIYLEETLA
FT                   NIDNLAFQVPTSGKNYARAHSKVEVTDPEKKPGSSTDGVQSALWTEGLISCLIVAALLL
FT                   WILVIAISWITSLDISYGALEKPANPLKKTN"
FT   gene            complement(<462508..>462817)
FT                   /locus_tag="KLTH0E05302g"
FT                   /old_locus_tag="Klth0E.mRNA.3287.m"
FT   CDS_pept        complement(join(462508..462734,462808..462817))
FT                   /locus_tag="KLTH0E05302g"
FT                   /old_locus_tag="Klth0E.mRNA.3287.m"
FT                   /product="KLTH0E05302p"
FT                   /note="similar to uniprot|P41806 Saccharomyces cerevisiae
FT                   YGR105W VMA21 Protein involved in vacuolar H - ATPase
FT                   assembly or function required for the biogenesis of a
FT                   functional vacuolar ATPase (V-ATPase) but not part of the
FT                   final enzyme complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23274"
FT                   /db_xref="GOA:C5DHL3"
FT                   /db_xref="InterPro:IPR019013"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL3"
FT                   /protein_id="CAR23274.1"
FT                   /translation="MCLGLNSSVVQKLMFFTAAMVILPVLAFFIVQQFTANTLVSGGLA
FT                   ALAANLVLIGYVVMAFREDTTQEEAKLEEKKRD"
FT   gene            <462964..>463791
FT                   /locus_tag="KLTH0E05324g"
FT                   /old_locus_tag="KLTH-ORF9628"
FT   CDS_pept        462964..463791
FT                   /locus_tag="KLTH0E05324g"
FT                   /old_locus_tag="KLTH-ORF9628"
FT                   /product="KLTH0E05324p"
FT                   /note="similar to uniprot|P32585 Saccharomyces cerevisiae
FT                   YGR104C SRB5 subunit of RNA polymerase II
FT                   holoenzyme/mediator complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23275"
FT                   /db_xref="GOA:C5DHL4"
FT                   /db_xref="InterPro:IPR019095"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL4"
FT                   /protein_id="CAR23275.1"
FT                   /translation="MMLQLSLVSSIDDASYDLFVSTLSNLCGNPPVVFGNFTAMLKPNP
FT                   AFDIEQVNSKNQLVEQSRIKLCRGLPLQEVEADNAKRDFRLLKKYQNDEVQGLDLQIIQ
FT                   DMLHGSRDLDEMEVDGGSNKGGSGAQDVWSLSISDIPTAGSGRKVSTQAITETTVLASG
FT                   GSSPSIVSFLSELGYVLDFQLLVLGIKFNMNNGVFLELSKIWRLNDGRTEQITKGGFLV
FT                   KAFVNVAKSTDIKSINSGTTSLLALQKELSGYVELEIPDRKSMDSRLENKNDI"
FT   gene            complement(<463898..>465709)
FT                   /locus_tag="KLTH0E05346g"
FT                   /old_locus_tag="KLTH-ORF9627"
FT   CDS_pept        complement(463898..465709)
FT                   /locus_tag="KLTH0E05346g"
FT                   /old_locus_tag="KLTH-ORF9627"
FT                   /product="KLTH0E05346p"
FT                   /note="similar to uniprot|P53261 Saccharomyces cerevisiae
FT                   YGR103W NOP7 Nucleolar protein involved in rRNA processing
FT                   and 60S ribosomal subunit biogenesis constituent of several
FT                   different pre-ribosomal particles"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23276"
FT                   /db_xref="GOA:C5DHL5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR010613"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL5"
FT                   /protein_id="CAR23276.1"
FT                   /translation="MRIKKKNVSGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPRE
FT                   PRNKKKANKGSTAPTTFYYFKDIQYLMHEPVLERFREHKTFSKKLTKALGRGEVSSAKK
FT                   LEEKSPSYKLDHIIKERYPSFADALRDIDDALNMLFLFANLPASDQVSARVTKDAQVIC
FT                   NQWLAYVARERAVRKVFVSIKGVYYQASVKGEDIRWLVPYKFPENIPSDVDFRIMLTFL
FT                   EFYSTLMHFVLYKLYTDSGLVYPPKLDAAKDKIIGGLSAYILESNAEDSSLTAPQLADS
FT                   NSDAKALDAKTLSSAIKADASEKAADDAEDAGGEDAEDELGEGELDTFEDKNKNQGDLL
FT                   IQPSKYDSPTATLFSDFVFYISREVPVDILEFLVLACGGSVICEAALDQLESKKDIDLG
FT                   KVTHQIVDRPVLKNKVGGRTYIQPQWVFDCINKGELVPANLYLPGETLPPHLSPWGDAA
FT                   GYDPTAEPAEDESGDESEDVSDQEAGAESDDAEASAEAAAEDAAEEESDEDLEAQKELE
FT                   LEAKGIPYSDAKDKKEVKKKSKKPEKRKATEEDEEKDLKTIMMSNKQRKLYKKMKYSNE
FT                   KKDDRVEKLKQKKKAIAKAKSKLEKTN"
FT   gene            <465977..>466504
FT                   /locus_tag="KLTH0E05368g"
FT                   /old_locus_tag="KLTH-ORF9624"
FT   CDS_pept        465977..466504
FT                   /locus_tag="KLTH0E05368g"
FT                   /old_locus_tag="KLTH-ORF9624"
FT                   /product="KLTH0E05368p"
FT                   /note="similar to uniprot|P53260 Saccharomyces cerevisiae
FT                   YGR102C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23277"
FT                   /db_xref="GOA:C5DHL6"
FT                   /db_xref="InterPro:IPR027499"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DHL6"
FT                   /protein_id="CAR23277.1"
FT                   /translation="MLKVSARHAPVLRLPRRFYAQKTRVVIGPRLKNLDEIKEYLGKPT
FT                   WSVEKYLQSSSNGETQPPSRETVEKLLKLSGLPNENVEMFQATLGKQLAFINKVQSLPV
FT                   DESLDPSHARIIDRNSEALDYESLSCSVEQQETEKDSKMGEVGGSWDGTGLAAISENGF
FT                   YVLREGLLKNRK"
FT   gene            complement(<466567..>467571)
FT                   /locus_tag="KLTH0E05390g"
FT                   /old_locus_tag="KLTH-ORF9623"
FT   CDS_pept        complement(466567..467571)
FT                   /locus_tag="KLTH0E05390g"
FT                   /old_locus_tag="KLTH-ORF9623"
FT                   /product="KLTH0E05390p"
FT                   /note="similar to uniprot|P53259 Saccharomyces cerevisiae
FT                   YGR101W PCP1 Mitochondrial serine protease required for the
FT                   processing of various mitochondrial proteins and
FT                   maintenance of mitochondrial DNA and morphology belongs to
FT                   the rhomboid-GlpG superfamily of intramembrane peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23278"
FT                   /db_xref="GOA:C5DHL7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL7"
FT                   /protein_id="CAR23278.1"
FT                   /translation="MNSFVSRFGKHFFLSNAINIQTKPLSASILGPLGLNLRQRIPTQP
FT                   ARFFSRTSEIKSSWRDVFNGAGASRYARLNRFQQFEKGSRNTNNPFSNNSLRNVTIAGA
FT                   LFMGGTYFGLPYLFDNVPPFTYFRAHPSSLVYGLIGLNCGVFALWRVPQCWRFLQRYML
FT                   LEKDHIYSKWSLIGSAFSHQEVWHLGMNMLALWSFGTTVATMLGPANFMSLYLNSALAG
FT                   SLLSLWYPRIARISMMAPSLGASGALFGVFGCFSYLIPHAKIMLFVFPIPGGAWLAFLG
FT                   SMVWNAAGCALRWGSFDYAAHLGGSVAGIVYAYLISEQLKKEKARRMQRFSVF"
FT   gene            complement(<467786..>470611)
FT                   /locus_tag="KLTH0E05412g"
FT                   /old_locus_tag="KLTH-ORF9620"
FT   CDS_pept        complement(467786..470611)
FT                   /locus_tag="KLTH0E05412g"
FT                   /old_locus_tag="KLTH-ORF9620"
FT                   /product="KLTH0E05412p"
FT                   /note="similar to uniprot|P53258 Saccharomyces cerevisiae
FT                   YGR100W MDR1 Cytoplasmic GTPase-activating protein for
FT                   Ypt/Rab transport GTPases Ypt6p Ypt31p and Sec4p involved
FT                   in recycling of internalized proteins and regulation of
FT                   Golgi secretory function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23279"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL8"
FT                   /protein_id="CAR23279.1"
FT                   /translation="MSFFDSLRQKAANVKFLDKLADNFTPVMNRDEKFRLEYKLPEEEH
FT                   VLDDTNADVSILNPYKRAKRAENSERSELAYVFSGRLYLTPHYLVFRDSFDSTSCNFTL
FT                   NISTIRKVERAPIMSYAYSLAITLHCGTRMVIQFIGLRNRTDQFCHKFKELLRENIPNT
FT                   KLLAPFLETCYSEYLIARNVLRESDVNPPPGGLGQRYRYPGDASKEKPKLKLWLDYFQD
FT                   QGKNLTIVKNHMFYKLIRVGVPNRLRGELWEVCSGSLYSRFANPGEYKRLLEANEGKDS
FT                   RAIEEIEKDLNRSLPEYAAYQEKEGIQRLRNVLTAYSWKNPDVGYCQAMNILVAALLIF
FT                   MTEEQAFWCLVSICDNYIPGYYSKTMYGTLLDQRVFESFVEQKMPLMWEHITSHDIQLS
FT                   VVSLPWFLSLFFTSMPLPYAFRIMDILLVNGPKTFFQVALAVLKINGEDLLEVDDDGMF
FT                   IAILKNYFQTLDHSAHPDSADIRYRQITKFQELLVVAFKEFSIITDSMVDQQRSKYRKD
FT                   ILHNIESFAKRTQLRNLPQVRNLTPDNLSNIYDLFYLCIESHKISMGTGSSNMDFEAFV
FT                   QFLSKFCDWCKPSESDERPNFRKQKRAFLKRLFTKWGSSGSQELTLNDVVFGLDGLLSK
FT                   DLMSSINYFFSLFDEQGKDEINGESILQISEALLFLTEAWKSGRYVDKLTQKSIEDDIA
FT                   DSIVMNNSAKGGTLEDIELPAGVTIDEEKYKQEQAERYLQAASNFLQRSFEYARPSEEK
FT                   EVDLIDLSDDETESKQAKEKKWESLKANVALNPNQTSVMDLATFRMIILADETYEMFFA
FT                   HTLRNSIHVDEKIGSRDSRGGALRNMFDGFLADGKRVASQVRRRVDSVATKNSSSSGSA
FT                   AEATDIQDEVDDFTSGHTFEHDDLLKHDLISLEDNEGNEPNPESQRKKLESFSFSDPSE
FT                   TREHSLIEFEA"
FT   gene            complement(<470916..>478109)
FT                   /locus_tag="KLTH0E05434g"
FT                   /old_locus_tag="KLTH-ORF9618"
FT   CDS_pept        complement(470916..478109)
FT                   /locus_tag="KLTH0E05434g"
FT                   /old_locus_tag="KLTH-ORF9618"
FT                   /product="KLTH0E05434p"
FT                   /note="similar to uniprot|Q06116 Saccharomyces cerevisiae
FT                   YPR117W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23280"
FT                   /db_xref="GOA:C5DHL9"
FT                   /db_xref="InterPro:IPR019409"
FT                   /db_xref="InterPro:IPR019415"
FT                   /db_xref="InterPro:IPR019441"
FT                   /db_xref="InterPro:IPR019443"
FT                   /db_xref="InterPro:IPR019449"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL9"
FT                   /protein_id="CAR23280.1"
FT                   /translation="MHQFLTWLPLASRYAIYAALLLLLIPNVIIHFCICHISQNSALPS
FT                   RLTLVPWINGVRFLYVTSERYTLWVRRIKLKFKRALEIELEGLSITLKGSQHLTKSNPH
FT                   AADLKKPLPQIFIKPLWLTLLKFVRPRKLILKDLVLHVPASKRTFKIETLLIECKPLPG
FT                   KSPSVSVSLVAICLSDSLGQFSAHTIDYASSYSFTRQNTSRGFCFELKNHVQALTIRGL
FT                   QARLDKSSQTNYEKRAQHTEEPHSSLDLKRFSEVLIALSDLEIRLENLALLLEDSLQFR
FT                   SSGILFTTKAIDPSHHSMLDLFPAERKLPLNHEITLSINSLTGLVNGQEVLRIPSINCT
FT                   SASDLTSFLLLRKPPQLKIGLTLTIVDTAITATKEQLGKLWVIYTTAKSSSPKSGTSRW
FT                   RYWFSQIKCPHFIVKIIMSNFSFTLRLSQSKHFVVRVSNLHAFGHNSMKPNTIVAYERL
FT                   NVKGMKNTRDYVDNFLKIDRFSLSYFRADEATNIKVHDIPVVVFSKWEFFSKKIITEES
FT                   NLTSTLRDLKISLEHSEVLAGASNFLDEWTYTLSAFNQKKDPTDAKGLKYSLRLRLKNT
FT                   SLSVLVANHLKKELDVLGDDKFNLADYTRGASVCLEEAFLDAMPDECKLHIVHAFVYRV
FT                   MGHPDVYARSDEIANLKDFVISSNSLTNHCFAPALNIKVDVNAIWLYYYLKDIATNYLR
FT                   PKKLRASSDKVPFNDLCKEWHVEVASLLIEIGLPHSTKLLFDFENAHFSGESLALHLDR
FT                   LVMFSPSVYREEEIFVPLALINDFTLDIERLVAKRIVSLNAGFMSLKFEYHLRLYKILD
FT                   NVMTLVKCFKQIRACFESPIGFKRLKPVPEEPKRVFPIDLSLDLLSLNVEEDPFEQELG
FT                   LVFKVGVSEQQERLEKLRLFYEEIDSFEPNKVLSQEEMKLKYDSRMQKLFENFSTSWIN
FT                   RIRKARLTFFGNPSQTIKLRNAGTFRFRSLDGMNSTVLKVELERLKMKLREPSFSLDKC
FT                   SEFLYKYGKQIPKDTAFTTLLPLGISLETERWEIRLRDYPLPILFFPSVEISGDITFAE
FT                   RMPQPFSERFVHVPFVPMASLAKYSNIDSVYGASVIRTLNPVKTYMNLRCQIDSTRPTT
FT                   ITWGKALQPGYQSVMIWFDYLTKPPIDPSEKLGFWDKFRLLIHGKFVFEWAGDSHIHLN
FT                   IKGSHDPYLITDDGAGLSFCWGGSARLAIHESSDPTEFLKITSKHFLLAIRDFTSPQKI
FT                   EKALMELNGTITWTMGLAFESGNPKNPGMEERSSNFKPHYHINLFNPAFLEGDKTHDSY
FT                   AGFRSDFIHLFFRVHASSNPEGSNKVFLAPHCMAHFLKWWSLFSTYTSGPIRQGSLFPD
FT                   LVQNPKKFSKALFTVKYELHLTPLVISHTYRHADSRLNIESDNETAFTSLKGKFETLKL
FT                   ELHQKRVKMMHSDKKLNVSRTVWKFKMNAGEIDCVSADIRFVYTMLGHPSGPRKGGATA
FT                   NIENDVLKSSWFDFEDYNDLNQITFADPIPLNFCEAPLLYSPRISYLRELNEGVPLDYP
FT                   FGDESVHECTLGHNHPEVTQRELAKKRAREIETQLDQIEQSIEALSSVAMKGSNGSVQK
FT                   LELLGRQLHEFRHRLHIIHKVLEDLKLSKMPSSSLLSDDIESELSERHSDKTQDELENA
FT                   LAATATIASFRSMRKVTSAFVKSSFDNRFIIHNMLLKVNNKTRDLLLNYAFNVFSRKKS
FT                   SFFQTYKAVALLDELLKNRLWNTSSRAKDSAGFFTLEDNLSNADLLERCDEIIREVFED
FT                   GFKTFDNYQIKFVSPQIQVTSEAVPRKCILVTARDIETSIVDVNQLLETNQNVPLDVNS
FT                   LVETRYCAKLNEAHFLIFDKCEIAIDDGLGFQTNGYGMDTNSSFWPPWLPMEMCYNCES
FT                   LTDSVFLSRSEMILLFTQPNSLFFQDKTKNFGRSEAKFRIGFPELFLTSTSDQYSSIYA
FT                   IAVELLHFASSFDNKADKLSRVLLAEEVRNNLDRLDTSIIVNLQKTVKNLYRTRGYLKV
FT                   HDPKGYEKVAQSIAAEIEATVLELNLLMSAIKKNHDRLKVSNVKGSSQDRLNWQIGADE
FT                   VTWQLYDEFKNSFVSFELGPACFIRSQAPDGANNNKVSISSLECFNLQKNAVYKQLLGP
FT                   HDNDTDTEKPMIQILWAMGPAIGGIADLEQLVVLLEPFKFKMDHLTSDILLKYLFPGTN
FT                   EASTAAQSDIAFDVASIGLSKKNTESSETWKLKSVPSLLPPNPLKKSDTEARNSVSLSR
FT                   RGTGRDMNEMVTRSSRYFNVRSVVIRKVTMSISYKGSRSLITNVDGLTVKVPTLRYTNK
FT                   LWSRDEFIATLKKDIIKVVLQHTGYIIGNKFTLHKKENEAKFSKALIKTSVGEADSLRS
FT                   ASSSQHKTPQLRHISSSLKPESSSDGRSGHLSQDQRSGADDVTAFYPASHQ"
FT   gene            complement(<480127..>482205)
FT                   /locus_tag="KLTH0E05456g"
FT                   /old_locus_tag="KLTH-ORF9611"
FT   CDS_pept        complement(480127..482205)
FT                   /locus_tag="KLTH0E05456g"
FT                   /old_locus_tag="KLTH-ORF9611"
FT                   /product="KLTH0E05456p"
FT                   /note="similar to uniprot|P53038 Saccharomyces cerevisiae
FT                   YGR099W TEL2 Essential DNA-binding protein specific to
FT                   single-stranded yeast telomeric DNA repeats required for
FT                   telomere length regulation and telomere position effect"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23281"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019337"
FT                   /db_xref="InterPro:IPR038528"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM0"
FT                   /protein_id="CAR23281.1"
FT                   /translation="MSVNQAIETLKSQPSLEVISQCLITLKEETRSNIEAAAVIVKYVV
FT                   LVYPSLSDQVRKLLVSNLSNSFLLLTHVMNFISLLQNSTEAKICKRFLIDTLRSNVTCL
FT                   NSYMRLYTSSTEKQMLKATFFGSKLLNALNGEIDIEDYLEIMKNQLVYILARHEVVEEK
FT                   ACTDFFISFLSLHPACASNVFFGGLVFSNEDMFRKYVQLLRNSSAFTQKRLVKSMVQFL
FT                   NSNTTYSSSDSIYNVLLHTGTSMIGFETLMRLRSNFLQAIVVHLLTDTELLNLYRYLMS
FT                   FFPRPDHPEDETVCYLLSILLEKLTSAEREQKGHDPIFLDAVTSRLSSQNSEARERTMF
FT                   IAKKIAGSELKYESSFTIEIPVILKPKTENIDYRVFWASSGIDVEGNLERKSFSSPSNK
FT                   INNELASLKLSDEETNEEGPQIVFLKDLVREFELDNKSHRSQVFLLKATVKLVRQKIDF
FT                   QLEIQSYSSILLSIIGSLSNTLEEPAFEEWKINALVSLLFVAPEKVVDLVRILFGNELS
FT                   LQQRMSLLSALGLAARELRGIDDNMILKPQTDFPTKRLPWDEGDKESKPALAQSSRIDA
FT                   SPLRGEQVVWKSRKLKMNASETVAPENRFRKFAPKFFYPLAHGWLNGIDMGTYDHMFKK
FT                   HYLSTMQIILSASFPHYEFRAMYQQMCTILENALEQGIEVDATRVSNLSKLALQELE"
FT   gene            <482401..>487293
FT                   /locus_tag="KLTH0E05478g"
FT                   /old_locus_tag="KLTH-ORF9609"
FT   CDS_pept        482401..487293
FT                   /locus_tag="KLTH0E05478g"
FT                   /old_locus_tag="KLTH-ORF9609"
FT                   /product="KLTH0E05478p"
FT                   /note="similar to uniprot|Q03018 Saccharomyces cerevisiae
FT                   YGR098C ESP1 Separase with cysteine protease activity
FT                   (related to caspases) that promotes sister chromatid
FT                   separation by mediating dissociation of the cohesin Scc1p
FT                   from chromatin inhibited by Pds1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23282"
FT                   /db_xref="GOA:C5DHM1"
FT                   /db_xref="InterPro:IPR005314"
FT                   /db_xref="InterPro:IPR030397"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM1"
FT                   /protein_id="CAR23282.1"
FT                   /translation="MGEKDVALSDIDLNSPIKRVGSTTNAFFEQSKENNTDTWLKKAKE
FT                   DGLCDNSIARPSLPINIELERNEIHKFLQKPCLDLADRVHLSSRRLYQAYLWKHQIKRI
FT                   KEFTKQHMLVIIKLIDLGGIESAEQEVLNLYNGTNLGKIETLDHVLLADFSVSNNYYLS
FT                   TLKLLVMQIIIRGKMHDKHSAAIIQLFAYDSRYLLRSEKTKAQSLIKLLLNFFSILPTY
FT                   KILFGLKFLQYIKQFDLCYGDFVKNMPIQRFQELLSQWGRKSFVHICDFLNLFYVSYSK
FT                   HFFTVDKIMLHDITETIHSDRVKPLLCCFDSTPPHQWELQLKSLSPLSSTEKNSLIDFM
FT                   AENLKERAYDFPKLILLATWFLRICNKEFVPAPKEVWRVIDKITILINTHLKLIDMHVS
FT                   KEIMGTLSDFCINNLEPKRLLNIVNVGFNSFIIFKNEIFLFEAAKLEIARQVILENGDL
FT                   CLSRLEKFISNASKEYRIKLFSMFFNIFTCFKYETLASLMHIMTQFSRSVKHIRNFSSK
FT                   ELLETSELMLCLLSTNQPVQTTSISAWSPLTQKLFLSLSDFRGANDIEIKNGREPLDPL
FT                   RPYEPVIMSMYYLGLEIKKGSCISLAKITDAFIKEWVLRSDPLGEPVSLLELSLVDALF
FT                   GFLKFNKFYKKVVHLANALKESYFFSHENCAENVLEQLVEGYAGLQLRDCVIATSTEVE
FT                   SRRNPSRIDDMSEDEFSRFARLQLMKCFWKKDVNTFNELFVEKVPKVKPEVFDVNNTSR
FT                   IPTKTYLGFLILNIRITSTASALQLYNDNMVEALIEAKKSLKLCQTLLKKSAQLPHNVR
FT                   WDILTFLSKSFSDVIDIYTHLGVSKDCDFYTTEYLRVACSVKDAVIVHECLQKSVVYYR
FT                   ITLQNNLAGALIKKANAVFGRLDGSENFEALALFLFNNGETDKLNESLHLFFKDHFKDS
FT                   FLFASWKLLLGCTIDITHGHLQFVKANDINYSKEIYSRISLQMESDPFFRSMRDSVTSI
FT                   PSFALRIPDKRTEICIKGIEFNTPVKNRTRNVIINSPRPSSLTPRGKSLKQSFDRAKAT
FT                   NDLELIKRKIEFLDIEGMKSYEIAEASALYSLSLSLISSINASKAYSSVLDRKFALAEI
FT                   PKYTPMFFDKLLSKQGNEIYSSFIPKCIQLKVSGSKNSTDSTKQVHLSEVQSSFGLEFS
FT                   GAFNVISIDVCEITGDLLLSKMDSGRDSKVCLRLPLNRSNSRDMDEIELSFDNAVNELT
FT                   QIIKESNKTTSVEVTSNISTKDARKRWWQYRYELDSKLQSLLSKIESSWFSGFKTFFAQ
FT                   EIIEQKDLEKFRVCFEEILQQTLPTRKQCGNPSDFFRINDVVLELFLKLNPSDKSFMEM
FT                   MEDLIFFVFDLLLFHGEENAYDEIDIDSIHVQLEALINDYRKEIPSPAKVSHTFLVVCS
FT                   AGHMIPWESLDFLASNSVSRIPCFQTLKSIMDDRSGPFPPTVELDERLSMILNPHGDLQ
FT                   RTQSNFDDIFREWSRELPDSNLVVGEKPEESKFIEMLNNSKAFIYVGHGGGEQYVRLKK
FT                   IKQQSKIAPSFLLGCSSAFMENRGKLEPTGVSYSYLLGGCPMVVGNLWDVTDKDIDKFS
FT                   RTMFEELGLIGGSKIHKTVSEALALARGSCQLKYLNGAAPVMYGIPLRFTR"
FT   gene            complement(<487303..>488139)
FT                   /locus_tag="KLTH0E05500g"
FT                   /old_locus_tag="KLTH-ORF9602"
FT   CDS_pept        complement(487303..488139)
FT                   /locus_tag="KLTH0E05500g"
FT                   /old_locus_tag="KLTH-ORF9602"
FT                   /product="KLTH0E05500p"
FT                   /note="weakly similar to uniprot|Q06109 Saccharomyces
FT                   cerevisiae YPR116W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23283"
FT                   /db_xref="GOA:C5DHM2"
FT                   /db_xref="InterPro:IPR031415"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DHM2"
FT                   /protein_id="CAR23283.1"
FT                   /translation="MSKPSVLKGCLESLVALEKTKRIPKKPSCDASPLISNFENWSGKP
FT                   RKLYLRDARSMKRQGLPYELNSNMFAQLLASPMRLDKITRVRAPKELLVQIKLRKADTD
FT                   ISAARGKPFELRPSFGMERGHPTSYVSNSVALVHKYASSAMKWLPSSANSTIRHINQAD
FT                   VATQPEWYSQAYTEQMLGSLREALSSTLMHLGKAPESDPRDVIIVCNPQLPAISLRKSE
FT                   NPFIALATTVLNLYPIKDPELEKVVNNRDIELCSSKHRSLCFLIYRLLAFQADRII"
FT   gene            <488343..>488969
FT                   /locus_tag="KLTH0E05522g"
FT                   /old_locus_tag="KLTH-ORF9601"
FT   CDS_pept        488343..488969
FT                   /locus_tag="KLTH0E05522g"
FT                   /old_locus_tag="KLTH-ORF9601"
FT                   /product="KLTH0E05522p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23284"
FT                   /db_xref="GOA:C5DHM3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM3"
FT                   /protein_id="CAR23284.1"
FT                   /translation="MRFPIVRFQPTLGRSALVQQKFKDSMARMGGQAMILTSAGKKALP
FT                   HDLFRGVTLSSVSSLSLKPQPLLQFNLQLPSFTSESLHMHEYFALHLLKPDANSITLAR
FT                   AFSKGAMKNHENGEVVPTQPFKELTESVHYRTYGLSNSDLAVPILINSERVFVCRKKEV
FT                   FRVGDHEIWVGMVDDIIEGDDVNQDVSGGLLYCNRKFHKLGGRIE"
FT   gene            complement(<489071..>492214)
FT                   /locus_tag="KLTH0E05544g"
FT                   /old_locus_tag="KLTH-ORF9599"
FT   CDS_pept        complement(489071..492214)
FT                   /locus_tag="KLTH0E05544g"
FT                   /old_locus_tag="KLTH-ORF9599"
FT                   /product="KLTH0E05544p"
FT                   /note="similar to uniprot|P48361 Saccharomyces cerevisiae
FT                   YGR097W ASK10 Component of the RNA polymerase II holoenzyme
FT                   phosphorylated in response to oxidative stress has a role
FT                   in destruction of Ssn8p which relieves repression of
FT                   stress-response genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23285"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM4"
FT                   /protein_id="CAR23285.1"
FT                   /translation="MSSAKQSGFHDTEPTQRDFLAPEREEDDASSLFSSDSGYLMDLAD
FT                   ASEDTETILPKTDFHSPYYVNVPLPSQSGLTSDYTEPSQDSTSTGFVREYPTDILLDRF
FT                   NKWRKILKGLANYLREVAYAQERFARINYGLRSTVKFSFLTDLEESTNRVIDPFQQRAK
FT                   KQAGASAASLNSSLRTPSAPGEESPGGINSSQSALDVKNVPMAPGDNSSASSGFMKFGS
FT                   GSIEDIQVVLKKYHASIANQQIKMSKEITTMVVPKLDDLRKDLQLKIKEIKELHGDFRT
FT                   NIGEHIALTGQLLQKYMAAVEFMSTNSNDQKIFKLKNQKLKPKHDPYLLKLQLDLQLKR
FT                   QLLEENYLQEAYINLQSSGMELEKIIFGEVQHTLQRYSALIGTSARISISNLCNELHQG
FT                   VLSKPPAIEWDHFVGHHPKCLIDWKSTEPIPQPRKLSDIRYPKMKSSLAKCIKAGYLCK
FT                   KSQILKNYNKAYFVLTSNYLHEFKSSNFFKLSQENSEKKDHGEVQTGSKKRAMVPVTSL
FT                   SLNSAQLLEASEHKFSIRGVTSYNNFEKKSAETGKIISKSTSSIHKFLKSGSKLQPHKK
FT                   DQHHHGSIAGLPSGAGAHGPSEDLDDVATWVFKAASSKPEDAKDLKKWVTEVKNLSSFM
FT                   NSDERAKFIEEKILRAHNRASSMNLSKMAAESGNNGRRQDRLPSHKVSGTRSKPQFIHL
FT                   GPQEMQDPALARAKVNTPAIDDNGNLITAGERRSSSLKSPSEVPSPHLSPTPTNHSGGG
FT                   TTPGSSGHGSDTPMKQQGFVITSNGITPINRTPGSASKRNVSGVVPSGGSSDGSNSAPM
FT                   NSPGSSSAPVNSPGSNSQTNFFGSNNSPIHSPGSGILPLNSPASHLSGGSGSGGYFAIP
FT                   VRPSSQASTPGLGNPDSTAAAAQTQGSNVPRLRVNDRDMSQEKTDKNLPHSEQSTEKPA
FT                   GSGRPAEGGPLSRGAPVHLRKTSNPGGISTFISEPHQTIYSNPRQSLSSQTLGSTNHQH
FT                   VRKHKKNVSFGSLNSLLFSKKGGDVSNNNMTDYFMSGNRIQENDDPDALNVNQSLYRS"
FT   gene            complement(<493049..>493975)
FT                   /locus_tag="KLTH0E05566g"
FT                   /old_locus_tag="KLTH-ORF9588"
FT   CDS_pept        complement(493049..493975)
FT                   /locus_tag="KLTH0E05566g"
FT                   /old_locus_tag="KLTH-ORF9588"
FT                   /product="KLTH0E05566p"
FT                   /note="similar to uniprot|Q06107 Saccharomyces cerevisiae
FT                   YPR114W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23286"
FT                   /db_xref="GOA:C5DHM5"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM5"
FT                   /protein_id="CAR23286.1"
FT                   /translation="MDAAVHFLMGLEPPSRFPIHWLTRYGIITSPNILAHLHSVLYVAL
FT                   AYHAVFLASKWVLFPPLVRRRLAHSKDHSRRGRQGLVNQAALHFVSLVQSFVILYLCLS
FT                   YWRTHGRGSSHPTAEQRVFRQERDTDTVCVFAIGYFVWDALISMVYSSAPFVLHGVISA
FT                   VMFLIGLKPYIQFYAPAFLLFELSNPFLNVRWFGIKFFPQLSDHNTTRAARVLNVFQLA
FT                   NNVALVLVFFGARIVWGWCQIFHLCRDFWQMRHDPRFLPLETLTIVSGNFVLDVLNVVW
FT                   FSQMLLVAKRILSRRGRVQDKPATEAH"
FT   gene            complement(<494815..>495861)
FT                   /locus_tag="KLTH0E05588g"
FT                   /old_locus_tag="KLTH-ORF9581"
FT   CDS_pept        complement(494815..495861)
FT                   /locus_tag="KLTH0E05588g"
FT                   /old_locus_tag="KLTH-ORF9581"
FT                   /product="KLTH0E05588p"
FT                   /note="highly similar to uniprot|P00330 Saccharomyces
FT                   cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved in
FT                   the production of certain carboxylate esters"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23287"
FT                   /db_xref="GOA:C5DHM6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM6"
FT                   /protein_id="CAR23287.1"
FT                   /translation="MSVPKTQKAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCH
FT                   TDLHAWKGDWPLATKLPLVGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESC
FT                   ELSNESNCPHADLSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVYKAL
FT                   KSANLRAGNWVAISGAAGGLGSLAVQYAKAMGYRVIGIDGGDEKEQLFKKLGGEYFVDF
FT                   RKSKDVVAEILEVTGGGAHGVVNVSVSEAAIESSTHYVRANGTVVLVGLPGGAKCCSDV
FT                   FNHVVKSISIVGSYVGSRADTRQALDFFARGLVKSPIKIVGLSELPDVFEKMEKGQIAG
FT                   RYVVDTAK"
FT   gene            complement(<496524..>497189)
FT                   /locus_tag="KLTH0E05610g"
FT                   /old_locus_tag="KLTH-ORF9576"
FT   CDS_pept        complement(496524..497189)
FT                   /locus_tag="KLTH0E05610g"
FT                   /old_locus_tag="KLTH-ORF9576"
FT                   /product="KLTH0E05610p"
FT                   /note="similar to uniprot|P06197 Saccharomyces cerevisiae
FT                   YPR113W PIS1 Phosphatidylinositol synthase required for
FT                   biosynthesis of phosphatidylinositol which is a precursor
FT                   for polyphosphoinositides sphingolipids and glycolipid
FT                   anchors for some of the plasma membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23288"
FT                   /db_xref="GOA:C5DHM7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014387"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM7"
FT                   /protein_id="CAR23288.1"
FT                   /translation="MAKVTASQVLWYVPNQIGYMRVFTAILSFFLMAKHPIWTTWIYGI
FT                   SCLLDALDGTMARKYNQTSGFGAVLDMVTDRSTTSSLICFLCVLFPRYAPVFQLLISLD
FT                   LSSHYLHMYATLSTGGASHKTIEKEQWLLYMYYSRRWVLFTVCAFNELFYLALYLYGFP
FT                   QLKHFDVPLWGRAHIGGVMAAVCLPGYVFKQVANVIQLKRAALLLASKDAEAASEKRA"
FT   gene            complement(<497958..>498728)
FT                   /locus_tag="KLTH0E05632g"
FT                   /old_locus_tag="KLTH-ORF9570"
FT   CDS_pept        complement(497958..498728)
FT                   /locus_tag="KLTH0E05632g"
FT                   /old_locus_tag="KLTH-ORF9570"
FT                   /product="KLTH0E05632p"
FT                   /note="highly similar to uniprot|P29453 Saccharomyces
FT                   cerevisiae RPL8B and to YHL033C uniprot|P17076
FT                   Saccharomyces cerevisiae RPL8A Ribosomal protein L4 of the
FT                   large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23289"
FT                   /db_xref="GOA:C5DHM8"
FT                   /db_xref="InterPro:IPR001921"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038524"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM8"
FT                   /protein_id="CAR23289.1"
FT                   /translation="MAPGKKVAPAPLASKAGKAGKAKNPLTNSTPKSFGIGQDIQPKRN
FT                   LSRYVKWPEYVRLQRQKKILSIRLKVPPAIAQFQHTLDRNTASETFKLFNKYRPETAAE
FT                   KKERLTKEAAAIAEGKTRQEASPKPYVVKFGLNHVVSLVENKKAKLVLIANDVDPIELV
FT                   VFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVREEDESALAKLVSTVNANY
FT                   LEKYEETKKHWGGGIVGQKAQAKKDQRAKASEAN"
FT   gene            complement(<499361..>501421)
FT                   /locus_tag="KLTH0E05654g"
FT                   /old_locus_tag="KLTH-ORF9565"
FT   CDS_pept        complement(499361..501421)
FT                   /locus_tag="KLTH0E05654g"
FT                   /old_locus_tag="KLTH-ORF9565"
FT                   /product="KLTH0E05654p"
FT                   /note="similar to uniprot|P32190 Saccharomyces cerevisiae
FT                   YHL032C GUT1 Glycerol kinase converts glycerol to glycerol-
FT                   3-phosphate glucose repression of expression is mediated by
FT                   Adr1p and Ino2p-Ino4p derepression of expression on non-
FT                   fermentable carbon sources is mediated by Opi1p and Rsf1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23290"
FT                   /db_xref="GOA:C5DHM9"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM9"
FT                   /protein_id="CAR23290.1"
FT                   /translation="MTAAAPTGATEEPSEVPLVASIDVGTTSSRVILFNMLGQEVSKHQ
FT                   IEYSTSASREKYAPVGKRRHSVDETTAAAAGGGSDSRRASRASPPSPAQPIFSAEGIAI
FT                   EANEYLEIEDLERPSVPTLSFPRAGWVECNPLGILAHVVQCFAANLVSVDRVNGSRVSN
FT                   GLAPYRIRCVGIANMRETTLVWSRKTGEPVVPYGIVWNDTRTSAIVTEKRNSTPQAVQD
FT                   RLRAKTGLPLYSTYFSCSKLRWLLDNEPAVRACYDAGDLMFGTVDTWLIYHLTSNRAFV
FT                   SDVTNASRTGFMNLDTLVYDDELLNYWDLARDKVNLPRIVSSAEYYGDFALPECVRTNL
FT                   TPVAWSLLTDFCARTPAVPIQGCLGDQSASLVGQLAFKPGAAKCTYGTGCFLLYNTGTK
FT                   KLISSHGALTTFGYWFPHLENEEHAQPHFALEGSVAVAGAVVQWLRDNLRLIPKAEDIG
FT                   PLASRVSDTGGVVFVPAFSGLFAPYWDASARATIMGMSQHTTASHLARAAVEGVCFQAR
FT                   AILKAMSSDAAGEGRKDRDFLEEVADGTYEKAPLSMLAVDGGMSRSKEVMQIQADILGP
FT                   CVKVRTSASSECTALGAAIAAALAYEKREDRVLWKDLKDVKKWVMYGGTEPGNRPPVDE
FT                   ESFRTRIFRSKSIDTERRRKWKLWEAAIERSRGWMNIVEQSTHDNATAKNM"
FT   gene            <502686..>504530
FT                   /locus_tag="KLTH0E05676g"
FT                   /old_locus_tag="KLTH-ORF9551"
FT   CDS_pept        502686..504530
FT                   /locus_tag="KLTH0E05676g"
FT                   /old_locus_tag="KLTH-ORF9551"
FT                   /product="KLTH0E05676p"
FT                   /note="similar to uniprot|P23900 Saccharomyces cerevisiae
FT                   YLL043W FPS1 Plasma membrane glycerol channel member of the
FT                   major intrinsic protein (MIP) family of channel proteins
FT                   involved in efflux of glycerol and in uptake of the
FT                   trivalent metalloids arsenite and antimonite"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23291"
FT                   /db_xref="GOA:C5DHN0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN0"
FT                   /protein_id="CAR23291.1"
FT                   /translation="MSKKSLPDSQDGNQRKPQEYMNDFLSDAESGSNVSHDQQNGGDGG
FT                   EHYIPSRDFAPQHRISASASYVPRNGEGGGGSNYAVQQVVPNTHIPMSRSNSGNNGSGG
FT                   GGGGGGGSGHSTGYRNRAQSGVSSNYMNMRSVQSNSGSAQNVNQPEASADPRDNDIPLM
FT                   VKPKTLYQNPQTPTVLPSTYHPINTWSTLKQTYLKEFLAEFMGTMVMIFFGCTVVCQVR
FT                   SGQQQQRVTFLKELSASTQVPAENKIELLQYLMPVDQFGTYDDVALIWGGAVVMGYFAA
FT                   GGSALSGGHMNPALTLSNCVFRGFPWRKVPVYWAGQLLGAYCGALIVFAYYMPVIKYVY
FT                   PDWNGNETVLGMFCTSPLQYLDSSRQFISELICSAVLQVGIFALTDPYTCLRSDLFPLM
FT                   LFVLIFCLIGATALQTGAGLNPARDLGPRLALATVGFESDTLWRAHHHYFWVPIVAPFV
FT                   GTLLGGTVYDICIYQGHESPLNWPYSLVKHKARRAWSNRPRFYRKRAGSDSAVSDWEYD
FT                   NESNNASARDTDNEDTPKTGFFPESDPQIQKHVQFKSMSKNFNGKRNPVSGIPTIFEEG
FT                   DDDDVDDADEAASGNETEKRPPLKPKSSKSFDKKGKKQ"
FT   gene            complement(<504588..>505232)
FT                   /locus_tag="KLTH0E05698g"
FT                   /old_locus_tag="KLTH-ORF9545"
FT   CDS_pept        complement(504588..505232)
FT                   /locus_tag="KLTH0E05698g"
FT                   /old_locus_tag="KLTH-ORF9545"
FT                   /product="KLTH0E05698p"
FT                   /note="similar to uniprot|P38736 Saccharomyces cerevisiae
FT                   YHL031C GOS1 v-SNARE protein involved in Golgi transport
FT                   homolog of the mammalian protein GOS-28/GS28"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23292"
FT                   /db_xref="GOA:C5DHN1"
FT                   /db_xref="InterPro:IPR023601"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN1"
FT                   /protein_id="CAR23292.1"
FT                   /translation="MASFVTVRGQAISLESQTESLLSKFSQYAQTTSSEPTSQERNLDS
FT                   KLDSLLTQRQEVVDSLSNICNENPSISASKLSQLQRHREILQEHWQHFRNLRSSIQQER
FT                   NRLNLLFSVKKDIAQQSEQDQDKYIQDEARRIDESHNVVDSLVSQAWDTRDQFSSQRTV
FT                   LQTANNRMMQTLQRVPGINQVIAKINTRRKKNAVILASLITLCILFLFFTW"
FT   gene            complement(<505291..>505767)
FT                   /locus_tag="KLTH0E05720g"
FT                   /old_locus_tag="KLTH-ORF9544"
FT   CDS_pept        complement(505291..505767)
FT                   /locus_tag="KLTH0E05720g"
FT                   /old_locus_tag="KLTH-ORF9544"
FT                   /product="KLTH0E05720p"
FT                   /note="weakly similar to uniprot|Q07879 Saccharomyces
FT                   cerevisiae YLL042C ATG10 Enzyme that mediates formation of
FT                   the Atg12p-Atg5p conjugate which is a critical step in
FT                   autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23293"
FT                   /db_xref="GOA:C5DHN2"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN2"
FT                   /protein_id="CAR23293.1"
FT                   /translation="MIPLGEFREQLQALIPVLQLWPKCLSVHASLNGEALIGLAEHPTL
FT                   AFYTYEFEIGYSQTYQEPRLIFKIWEATTEQGAELQRPCFPADLSRLMNVQDFSIGLDH
FT                   LHEARKDSWFSVHACDTSHIVGSVKHHYLKRWASVYLSLFDPCFSNTYLFVDDV"
FT   gene            complement(<505942..>506733)
FT                   /locus_tag="KLTH0E05742g"
FT                   /old_locus_tag="KLTH-ORF9543"
FT   CDS_pept        complement(505942..506733)
FT                   /locus_tag="KLTH0E05742g"
FT                   /old_locus_tag="KLTH-ORF9543"
FT                   /product="KLTH0E05742p"
FT                   /note="highly similar to uniprot|P21801 Saccharomyces
FT                   cerevisiae YLL041C SDH2 Iron-sulfur protein subunit of
FT                   succinate dehydrogenase (Sdh1p Sdh2p Sdh3p Sdh4p) which
FT                   couples the oxidation of succinate to the transfer of
FT                   electrons to ubiquinone"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05742g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23294"
FT                   /db_xref="GOA:C5DHN3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN3"
FT                   /protein_id="CAR23294.1"
FT                   /translation="MMMSGILKRNIAGVVARRGLATEVVQEPRLKTFKIYRWNPDHPAD
FT                   KPKLQEFKVDLNKCGPMVLDALLKIKDEQDATLTLRRSCREGICGSCAMNIGGRNTLAC
FT                   LCKIDTDVSKQTKIYPLPHMYIVKDLVPDLTQFYKQYKSVQPYLQRSKMPEDGKENLQS
FT                   IEDRKKLDGLYECILCACCSTSCPSYWWNQEQYLGPAVLMQAYRWLIDSRDEASKFRKE
FT                   MLQNSMSLYRCHTIMNCTRTCPKGLNPGYAIAEIKKALATS"
FT   gene            complement(<507436..>516744)
FT                   /locus_tag="KLTH0E05764g"
FT                   /old_locus_tag="KLTH-ORF9541"
FT   CDS_pept        complement(507436..516744)
FT                   /locus_tag="KLTH0E05764g"
FT                   /old_locus_tag="KLTH-ORF9541"
FT                   /product="KLTH0E05764p"
FT                   /note="similar to uniprot|Q07878 Saccharomyces cerevisiae
FT                   YLL040C VPS13 homologous to human COH1 component of
FT                   peripheral vacuolar membrane protein complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23295"
FT                   /db_xref="GOA:C5DHN4"
FT                   /db_xref="InterPro:IPR009543"
FT                   /db_xref="InterPro:IPR017148"
FT                   /db_xref="InterPro:IPR026847"
FT                   /db_xref="InterPro:IPR026854"
FT                   /db_xref="InterPro:IPR031642"
FT                   /db_xref="InterPro:IPR031645"
FT                   /db_xref="InterPro:IPR031646"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN4"
FT                   /protein_id="CAR23295.1"
FT                   /translation="MLESLAAGLLNRFLGSYVENFDPKQLNVGIWSGDVKLKKLKLKKE
FT                   SLDALDLPIDVRFGFLGDLTLLVPWSSLKNKPVKILIEDVYLLCGPRDQSAKSFAEDEE
FT                   RELRLKLQKLDEYEALGKSQPTGKEDSSSSESFTQSLLTKVVDNLQISIKNIHIRYEDM
FT                   DCVFGEVPYSLGATLSELSIVSTDEHWEPSFISITSSIARKLLTLNSLSVYWNTDCESV
FT                   YHPDHDELFRRLRNSISSKKNIPDHEFLLRPVTGIGRLVLSKKGSTETNPHVDIALVFD
FT                   EFGFDINNCQYEDILNTASKLHWYQKTLKSRKHRPNFPVSEDPKAWFKYAAKAVLQEVH
FT                   EKNYKWSWDYIKWRRDRRIEYIPLWKKKLGTEKKTQSLSDEEQQKLKELHKELSFEDIK
FT                   LFRALAKKSYLTEKLEVSNSAAESKGSSAAGSSGWFSSWWNGNSPQNDDDLVMSEEQQQ
FT                   ELYDAIEFDENKQVIDSIDIPKDRITAKVTCVLNRGSLSIVDKNRSIKLGEMVFEGCET
FT                   EFLQRPDSFFCSFKLHEFKVEDGSPNTLYKHIVSVKNLQMNEGNVSQHDEPFFKVAVEK
FT                   NPLDDSADSKIDIKLRSMTIFYHVHFVNEIIKLFRPPRQHLDTIGAIMSAAEATVEGWT
FT                   VQTRMGLESILEDHKTVNLSLDLQAPLLIIPLDPHVWASPCAVIDAGHMSIVSDLVPKE
FT                   TLTKYKNMSSSEYEKLDTRDIKRLMFDRFKLRLTDTQFLIGPDIRSTISNLNVSERESS
FT                   FVILDKLEVELDVDVSILPKALNLPKIKIYGKLPLLKLSLNDYQYKVMMQLIDQCLPDL
FT                   DYPESDLDSVDPKTSSDSKILNSLESKEVAILRQTLSRLQKMSEAELKQRLLQLTFDVE
FT                   VIQLSIFKCNNAETMKSDLLVDLFGDRMHLTFAKKAQDMDLHLNLQSFKVVDHIDSGAS
FT                   SEFKNMIASSNENTQASHLFELKLNRAQRIVTYNNTLIEVFDQDVSLDMTELTFVLTPK
FT                   SILTILNYTLTTFTNPEAPELPGDALKHNSPDLADAPQKINLRMNMDNIIVILNDDSVK
FT                   LATFRLSAAQIEQLLLPEKMKINAKLGAMQLTNDADDGLSIDSPLRELISMSGSELAEL
FT                   TYETFDPSTEKLDYSSLLKYKTGSMNVNFVDHAVNKIVNYLAKFQKMKVFFDRAREAAY
FT                   NQAGNIETVNNIKLDILVRAPVITFPKLIDPRRNLFDHVSFFLGEFFLQNSFHNEGERL
FT                   VNKIKAGIRSGNLGSTFHMEHELTQNLHIIENLDLHFDIDHYQGTKQIPVKIDAKGVFE
FT                   PLAAHLTELQLQYIYLLSQRLPNAFIIDYCEDDFAEIQDVARNANTFVSPEAKTETKPD
FT                   PILFTEEEDRTSETEFSVNFTAPQLSLTIYNDTKNSSDISQSGITKISLNDIGLSLGID
FT                   KDSRMRAETHIASFTVDDIRKVKQNKHDKIIPKVSHDSYQFMASYTKEQHESLTVDNVN
FT                   VTVDSPRIILALDYLFALKSFIDASVNINPPAKVFDKSPAHASPPALEQEQQPSSTKFQ
FT                   YSINVVDSSLVLLSDPSEENTEAIVFNVGQLLFADQNIMTASANNIGMFLCRMQSFDKN
FT                   RIRLLDDFSSSILFDQRSSTSEKLITDVHASVEPLVMRLALRDIRLAMSIFNKAMTLAR
FT                   EHGLSPQVEPEADESGTKYGSFSKEFKKTLSRYAPSIVSSMSNISKSDDISEEELETIV
FT                   KHEKLEANFEGLRLVLIGDIHELPIIDLSIKPFTLNAKDWTNDVEAVASIETYANVFNY
FT                   SRSSWEPLLETVPLSFHLSKGIETDAALCFDIISRQLAEVSLSSRTIALLSQIPNSLYY
FT                   TKDTEARGATKPYKICNDTGMDLKIWIASEKPQSKDQITILKSGETIPWEFEDWRKVRE
FT                   NLDTDDSMNTLGASIEGGHYESTLKIDVTSEGEDVYTLQPKVNGVHTRLACELKLCEDN
FT                   VKLLIIRSTLTLENATSDLLEFKLSNEDGIFTINPGESRSIPAEKAYSSRFLLKPSGNY
FT                   GWSRESISWRDLMSRPRSVVCENKEDPALFYYEVDAKFDKEEPLASIYPHMKVIISSPL
FT                   ILENLLPYSMKYKLFWRSESANATKGKEETETRLLHKGERVLIHSVTLRDYLLLAVQPM
FT                   DDGLQMSEQSLINTRPNSELKAESKLFLKYENGQKLNLNLHYRTVEGSRAKIISVYSPY
FT                   VILNGSNRDIQVEGDRNNIAISKVLLKDDSSKYTNPRMFSFERDRSNKNRARIKFKDSD
FT                   WSVRTSFDAIGQSVDLTMDIPNKNQESNIGVVVSEGEGKYALSKIIKIMPRYILRNNLD
FT                   VDLEVSEYGSSNVLTAFSKVSFPLYKMRNIVNKHLSIKFLGSQSEWSSPFMIKDIGSSY
FT                   VKVLKNRSGHQLLKLDIVLEDSTIFISIDNADGEWPYSIRNFSDHEFIFYQRDPHTFDT
FT                   EEDYDLYDDLGDMKYEALYYRVPPRSAMPYAWDYPAARQKKLVLVCRQRQREIQLAEIG
FT                   NLRPMRIPSRNGNEAPAIVDLNVVADGPTQALIITNYRPELSLYKLKTGNTTSSSLSSD
FT                   KGDRFEVRDEDKNVFTKVVVSFEGVGISLINTRLQELCYVTLNGLELRYNESDLYQTAS
FT                   VKLKWLQIDNQLFGGIFPNILYPTAIQKTAKELNNHPVLSGSVSKVKDDTHGVLYLKHA
FT                   TLLLQELTVQLDEDFLMALIDFTKVPGASWVNNVEDNMCTECTMLSYPSELQRNNDIYF
FT                   EVFHLQPTMLHLSFVRTERLNVEGEKVDPQNTLMFFTNVLTMAFANINDAPIKLNSLFL
FT                   DNAKVPLPMLMSAIQVHYGQQFFYQIHKILGSADFLGNPVGLFNNISSGVWDIFYEPYQ
FT                   GYMMNDRPQELGISIAKGGLSFVKKSVFGLSDSFARFTGSVAKGLSVATQDAQFQERRR
FT                   LEQRKARNNKSINGFGSGATSFVNGVSSGLRGIAFDPYQGASKEGVPGFLKGLGKGLVG
FT                   LPTKTAIGMLDLASNVSEGIRNTTTVMDGSLTTQVRLPRYIGYDKIIKPYNLRESQGQY
FT                   WLKSANGGECITDQYLAHVVLPGKQLAVLVSLQHIIEVRLASLEIMWKVRYTDVRSMTL
FT                   ERAGLVIVLKGASSELFVPISDPEEKRFLYKNISVAVNEYNKYCQAEL"
FT   gene            <517896..>520349
FT                   /locus_tag="KLTH0E05786g"
FT                   /old_locus_tag="KLTH-ORF9531"
FT   CDS_pept        517896..520349
FT                   /locus_tag="KLTH0E05786g"
FT                   /old_locus_tag="KLTH-ORF9531"
FT                   /product="KLTH0E05786p"
FT                   /note="weakly similar to uniprot|P39961 Saccharomyces
FT                   cerevisiae YER184C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23296"
FT                   /db_xref="GOA:C5DHN5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN5"
FT                   /protein_id="CAR23296.1"
FT                   /translation="MRYVESRSGYLLLDHAYKAKCMAQDSRPPQVMATPRVTKRAYTIR
FT                   KTPQACISCRRRKVKCNGCRPCSSCKTNGLECAYDTPSLEQVNIKGKPHIDTSEALRLI
FT                   SNLHSTLRNLSSLAQDDPGSMSSTVTDISMRVHDLESRLHMQLNPYKAANCRGEKSLEY
FT                   KLASFGPAKVGYEENPNSPVEPALSLGRFHGLYSPLSMLSLDNLEKIFEKVHEELSPAK
FT                   VQEAFFLLGRYFDLATVGYQQTLALHRSPIRTCAQHFGLKGSSSSEAIYDKLLELIPLE
FT                   LRQAHLQSEKQKDAGSRWRFVALSELFQDHCRNGKSLDVSSATTAELWRFFEVYSVISI
FT                   LSTEQLQKDWFSEFFSMEHFECLLNYIECRVSFDQTLILGRVVCFLVRFAIDNGLNRWE
FT                   FYHNLKESEADHHRKLWWKCYWWDKFYAVSHGKLPLLRDEESVCLFPRCVMALGVEDSM
FT                   SCETLIERVSLKGASSDAASLFGYIFMGKMIERASRNLLFARKYTTYQMSGSKFGSSAT
FT                   EVVNSLKSDYQDTIALITSFRRLFSDSEPSDVPKPSSKWTVIIEYCYLCLLLAFEKLIL
FT                   RLSKTTNSARDLASSIEDCQTRYIECARANLLRGTRVGSAPVFCALMIPNYTSFLVVSD
FT                   CYINHRGENSDFDISVLCFFASLLMRIGGGEGLDQQHLRQFLQPRIQAGQAISLVICRI
FT                   CLQLYLKRSQHLFGNELPTEVKELDQKLNEFCSKTLDSNSDLWRLFETKSKKKSLYHET
FT                   FTTFMKKKGWSIDKHDIPAESKDTPEHSSATEFTTVLSSMFNEDIWGFQFDEQDLMPFL
FT                   YHDTN"
FT   gene            <520621..>521553
FT                   /locus_tag="KLTH0E05808g"
FT                   /old_locus_tag="KLTH-ORF9529"
FT   CDS_pept        520621..521553
FT                   /locus_tag="KLTH0E05808g"
FT                   /old_locus_tag="KLTH-ORF9529"
FT                   /product="KLTH0E05808p"
FT                   /note="similar to uniprot|P40100 Saccharomyces cerevisiae
FT                   YER185W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23297"
FT                   /db_xref="GOA:C5DHN6"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN6"
FT                   /protein_id="CAR23297.1"
FT                   /translation="MGTSTSDFELYNYTPSTSAAALFAAVFALSLLVLSVEVIVLQRRA
FT                   KKTISVTMDDRLNHSEYSMVGLSRKKPSSKFVCLIVGCGLETIGYIARAYSSKNQDKIL
FT                   PYVIQSMFVLVAPALIAASIYMIFGAMLSLLDCSSLSIIPARFNTMFFVCGDIFSFLLQ
FT                   CGGGGLMAKSSSQKTGEILAIIGLIVQLVFFGFFLLTEIRFLILARGRADLTLKFGNKW
FT                   KIINWTLIVSSIFILIRCIVRTAEFCQGREGYLMSHEWTIYVFDALFMTASVWVFAVSL
FT                   PFASLFDLNMVKMAVNEFKVVPSEYESRY"
FT   gene            <523206..>528761
FT                   /locus_tag="KLTH0E05830g"
FT                   /old_locus_tag="KLTH-ORF9528"
FT   CDS_pept        523206..528761
FT                   /locus_tag="KLTH0E05830g"
FT                   /old_locus_tag="KLTH-ORF9528"
FT                   /product="KLTH0E05830p"
FT                   /note="similar to uniprot|P38737 Saccharomyces cerevisiae
FT                   YHL030W ECM29 Major component of the proteasome tethers the
FT                   proteasome core particle to the regulatory particle and
FT                   enhances the stability of the proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23298"
FT                   /db_xref="GOA:C5DHN7"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024372"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN7"
FT                   /protein_id="CAR23298.1"
FT                   /translation="MKGPMMLSESQELQLIEKVDLRFVLASSEDALERSLDTFFPALLL
FT                   KLDSPHGSARVAVFNSIKNVMGRISSLTSVKLPVKKLIVQAKTWKPSGDHSENSVGLYS
FT                   LLFASKGVDRLSPEEKTELIPEGIKGISALPVSLKPRMFHILCKLLLSWKAPTESSEDS
FT                   AKTFLTIGSALDRSYLFQKFRQFFFLNPLKPELGSAAIPRGYSCPGLNVQEVEFFTFSA
FT                   GVSFTRDSLSTYKRAIFTFMTRAFALEDRALLEFLVVVSADSTDLSDQAIALVKKYQVP
FT                   YEDQQFVDTLIGLYIGERLTNRPPVGRELQEVILSILIKSVCATKSPGKVSLICSMGLN
FT                   STHYKLRSLSLTFVQHVARHNYEALTFQDTQSDYSVNIASLIRNNLHGEGWPQYQLNSS
FT                   VPNFNIGLEQRRRQYETLGVVLKQDPQLLMDFSFIEFLFDSLKSDLREFRKSIQETLNS
FT                   LCVHVACLPEASKFKLRTLAKKLLADNFDVVYGDKEAIDALMYCRAVAIKFVNSAFPFD
FT                   DSEARLLNVMGLFRENRHDIREESTKGLHPYWFKMTQCINRSKTGVLEDFKSPSTNEVI
FT                   FPDVRSLMDLFQSQMEHSTDVKTSALFQSFDYGANFVFQTLISQAIVGKKSSVLQDEFW
FT                   HLRVAHAIQSDSNVRSLVESEVLSLDSNVLSTFTHMLLSHFVGRESRSENNSVNNETFS
FT                   MGFVSLFFASYMNHSMLQKMSDFLPKLFELLHRYLLLSEADIECAAKIYGIIQSSNFSD
FT                   GTASRMAEATRVPIESGDFVPAILTSSFTLPLLGLQEKALTAEEALPLIDKVIVSLEVT
FT                   DLKPNGLRCLDPILKFGLLRLLSKEKRKATVQRVMIALRRYPLRTQPTIQAWSQLSLYA
FT                   AEFGFIDTFFDALEESHLSKEVDVLFFAGEGMTVLAGGWNSSILRDKEYLKKNELDFLT
FT                   NTFGDTSSELIIGKLLVLCEASKPSLRKAACIWLLCFVQYLGHTDSVRTHARKIHVSFA
FT                   RFLADNDDLVQDSASRGLGLIYDVSDKDLQEEMLKGLFKFFIDPKAALDMSSGTISSES
FT                   QLFEPGTMNTGEGSISTYKDLLSLASEAGDPSLVYKFLPLARNTALWSSRKGVAFGLTS
FT                   IFSKSSVDEFLRSTPHASQKLIPLLYRYRFDPFKNVSEAMNGIWNALVDNTSATITEYF
FT                   DEILNSILQGIGGKDWRVREASTTALIDLLEITNEKQYQDKLEEIWTMAFRAMDDIKES
FT                   VRSAGIKVTKILSKILVRSVKHDDINGKSSQPILEKLIPFFLGHKGLNSDAEEIRAFSL
FT                   ETLLVLIKEASSAVRSFAPSLIYEFLLLLSPLEPQVVNYLTMNAEKYNLNTSDVNAQRA
FT                   LGVQQSPIMRSIETLVGNCDTGLLPSVVDKVIKASKKSVGLPSKIGSSKVISLLVLQNP
FT                   TSLSEFGSKLLKTCFSGLNDRSFTVSEAYTVSFGRVCKVCKPGKVGKYAGKLTEKYFNS
FT                   EDSSSRVIAGMAIMSMFKYSTEMFQNVESALLPLVFIGMHDSDDVAETYTKIWNESTSS
FT                   SSGTVNLYLEEIISLAAQRLKSNNFNIKITCAKSVCEACAQASVETPLNTIPQLFKVIL
FT                   ETTQGRAWQGKETVVETLVVLARKFKPFYLNSTAIRSSVESRLINEISRTNFGYVRDVI
FT                   FTSLSYSADFWSPALHEKNLEVAMHIIERIDNGADETASDENLDESNYKKQRVSTDVNR
FT                   KSRKDNVASEEYKIKLLKKVVLLYRMSDDGDLSQRTLEAITKASLNLFESSNIIFTWRS
FT                   QIAVCELGSAILERAPQGLTEGEQTCLKELWTKSFAQASSPESIENVKIQCVRFGKSLL
FT                   EKKVNFWFIVENDLRRLMHLDPSPVVSVELKNAGVV"
FT   gene            complement(<528861..>530090)
FT                   /locus_tag="KLTH0E05852g"
FT                   /old_locus_tag="KLTH-ORF9524"
FT   CDS_pept        complement(528861..530090)
FT                   /locus_tag="KLTH0E05852g"
FT                   /old_locus_tag="KLTH-ORF9524"
FT                   /product="KLTH0E05852p"
FT                   /note="highly similar to uniprot|P04838 Saccharomyces
FT                   cerevisiae YLL039c UBI4 ubiquitin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23299"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN8"
FT                   /protein_id="CAR23299.1"
FT                   /translation="MVIPEHQLGAELPKPIFAVENYVREQCSSCGGRDKRKGCERGARF
FT                   RGRLSEANGLPEHRSINTKELEYLPPLLTAERHSFPSVKASNNDTRKRLTERKTQARDT
FT                   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY
FT                   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR
FT                   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
FT                   VKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
FT                   TGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL
FT                   HLVLRLRGGW"
FT   gene            complement(<530814..>531581)
FT                   /locus_tag="KLTH0E05874g"
FT                   /old_locus_tag="KLTH-ORF9520"
FT   CDS_pept        complement(530814..531581)
FT                   /locus_tag="KLTH0E05874g"
FT                   /old_locus_tag="KLTH-ORF9520"
FT                   /product="KLTH0E05874p"
FT                   /note="similar to uniprot|Q07872 Saccharomyces cerevisiae
FT                   YLL038C ENT4 Protein of unknown function contains an N-
FT                   terminal epsin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23300"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN9"
FT                   /protein_id="CAR23300.1"
FT                   /translation="MSLLRTVRSFGQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYS
FT                   SRTLREITAVVRKRLSGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLI
FT                   DSLKEFTIGSRGQERMAVQIRSLASTLSVILRDDELLRQRRSDVTLFRSSISTPGRKST
FT                   DNSHLKFTQLSNRAEDLRNTRPTRSLDVGSRSYPRHSLDHARARVALDPLTEEEALDKE
FT                   NICPSVRSEQKFQEEGVFRRRGVTRLASNNPFR"
FT   gene            complement(<531754..>533364)
FT                   /locus_tag="KLTH0E05896g"
FT   CDS_pept        complement(join(531754..533294,533352..533364))
FT                   /locus_tag="KLTH0E05896g"
FT                   /product="KLTH0E05896p"
FT                   /note="similar to uniprot|P32523 Saccharomyces cerevisiae
FT                   YLL036C PRP19 Splicing factor associated with the
FT                   spliceosome contains a U-box a motif found in a class of
FT                   ubiquitin ligases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05896g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23301"
FT                   /db_xref="GOA:C5DHP0"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR038959"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP0"
FT                   /protein_id="CAR23301.1"
FT                   /translation="MFCAISGKPPKTASFSPSSKCVFEKSLIEAYVAENGIDPISKEPL
FT                   QIDQLVEIAKAPEQYAMSNSVNSPSLNSNYSIPNLLSALQDEWDAVMLENFQLRQQIEA
FT                   SKKELSTALYRCDAAMNVAARATMEADKLKQELNILTTNLAPAKAQDTQLPSAEQGLVS
FT                   ELPRDLVAELGARSRNFAAESRKIKFSAPSCSEMTRASDVEPVNIPKGEARIAAAFIDG
FT                   NIANGKLISFYNADGDCYVCSAASSWKGYQNVTFEGNALISYAAPLNAAEMIVGTQDGR
FT                   HGIYDLNTEKISTAFHSNDESPVVFALGLQEVYGGSYIAINARGRILYVVPEERHVFDA
FT                   EVDSFPTEFAHIHKDGLLIAQANSAQLIVRDLTNLHEKPIHYLHDVEKEGEITSARFAS
FT                   NGYWLIVSAQKALKVFDLRKTPNTLAADPILFENETLKAWDIEPSMKILFTVTEDANGT
FT                   NLIRRYRFTKASKSWTLESSINCEDLLEVKEVHGLSYLWDQASGFLKVQNGNELITVRV
FT                   "
FT   gene            complement(<533655..>535355)
FT                   /locus_tag="KLTH0E05918g"
FT                   /old_locus_tag="KLTH-ORF9516"
FT   CDS_pept        complement(533655..535355)
FT                   /locus_tag="KLTH0E05918g"
FT                   /old_locus_tag="KLTH-ORF9516"
FT                   /product="KLTH0E05918p"
FT                   /note="similar to uniprot|P38738 Saccharomyces cerevisiae
FT                   YHL029C Cytoplasmic protein required for replication of
FT                   Brome mosaic virus in S. cerevisiae which is a model system
FT                   for studying replication of positive- strand RNA viruses in
FT                   their natural hosts"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23302"
FT                   /db_xref="GOA:C5DHP1"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DHP1"
FT                   /protein_id="CAR23302.1"
FT                   /translation="MTDRKTLVHSHLHWRNVKRKHWQKDLVAKVVELIKVGDHDALALV
FT                   ARTAGIPPQLRKHVWPVLLKFHPMVVSPNIMSNTLVWDSQHQKWHYHPEIRSEDEIRDQ
FT                   MAHDLGKYFHKRTSAGKRAQSAASGPGAAPGGDLSPLPPGQQRVVAALQQCILKFLQKW
FT                   AQFFKYESGLAWIALALAEWCPLDGGEDVLPGKRHGAPVNLYHEYFLPEEIRDQLPSES
FT                   EFAFDELFERLVLVILHSPDIPKAERLARAESEMTSVLQYYPVISGGDLSFQCQLFFKV
FT                   FSVILPELYQPVSDEETLRPSKKTNWMYWWFKCSGARVFHKQDRARIWDTLLGWRPHPR
FT                   SLNFYLNYNSKLFDHLYSTRTSSALDSEFFHKICKYGHDAFWFPDLDSLSLGSQDLKCD
FT                   FQVLSELVRRNKYDNSDDELEITPKNNGTVGSKIKKGVEIPFSLLDPHVQLIFIYMAIL
FT                   QQHEFKLLEFEEAEISEFFNNVPSLSRADDHNYRSLYEEEIESRSVSSSETEPEDLFKR
FT                   PGSSASTPHMLIEVGDDDKASKSFDDLYNLAGDIWRKWIWRELEDNAGT"
FT   gene            <536972..>538642
FT                   /locus_tag="KLTH0E05940g"
FT                   /old_locus_tag="KLTH-ORF9502"
FT   CDS_pept        536972..538642
FT                   /locus_tag="KLTH0E05940g"
FT                   /old_locus_tag="KLTH-ORF9502"
FT                   /product="KLTH0E05940p"
FT                   /note="some similarities with uniprot|P38739 Saccharomyces
FT                   cerevisiae YHL028W WSC4 cell wall integrity and stress
FT                   response component 4 Putative integral membrane protein
FT                   containing novel cysteine motif. Similarity to SLG1 (WSC1)
FT                   WSC2 and WSC3"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05940g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23303"
FT                   /db_xref="GOA:C5DHP2"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP2"
FT                   /protein_id="CAR23303.1"
FT                   /translation="MNVRSRSPSRLAWSCVLLWACVSSFAAAAQTYCSSENTASTAAKW
FT                   WQYQSNGWCSDECAGYSYAVLQGHNCWCSNTEPQSTTSVSDCSDTCPGYHEQCGNVDEG
FT                   LFGYIYLGEASSTSSASSTVSSTASSVSSTASSVSSTASSTASSVSSAASSTASSVSSA
FT                   ASSTASSVSSAASSTSSSIITSSSTSSSTSSSTSSTSTSSSTSSEATSSATSPASSASS
FT                   SSSSSSPPTSSEPSSTSSTTPTASSAAASASASTSASSSATPSTSSSVTSTPLTTSSSS
FT                   TSQTSSSSSTLQTTSSSSTPQASSSAALSSTSPPSSSLKPTSSSRSSPRSSSTSFSQNM
FT                   VTSILYSVQTVTASPAAGGTSDDRVFTTQIMTTVYATPSGQLPSLSSSSSNANANSRNS
FT                   GGSGFWGSPGKVAGTFVAVGVVVFCLALLGFILWYRRRRRNEEDFEKRYNDVTAPAGSN
FT                   TSIDPASAGSHAAFVYADEKGIEVPPTPVEKKETFTRLSQPASFTDNESGIPQDEGPVV
FT                   VDQRLDPRQVFMHWENEGSKTSLADDVDYSRRVLRVINE"
FT   gene            <539474..>540739
FT                   /locus_tag="KLTH0E05962g"
FT                   /old_locus_tag="KLTH-ORF9492"
FT   CDS_pept        539474..540739
FT                   /locus_tag="KLTH0E05962g"
FT                   /old_locus_tag="KLTH-ORF9492"
FT                   /product="KLTH0E05962p"
FT                   /note="weakly similar to uniprot|P33400 Saccharomyces
FT                   cerevisiae YHL027W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23304"
FT                   /db_xref="GOA:C5DHP3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP3"
FT                   /protein_id="CAR23304.1"
FT                   /translation="MAPLKDLLNEEEAPGYLSSPPSEDERKYWERSSCSSDSRSVSEAS
FT                   GSESDSGALLTCDWDSCGQKYAQPELLYHHLCQDHVGRKSQKNLQLNCRWGRCTTKTVK
FT                   RDHITSHLRVHVPLKPFACSTCTKKFKRPQDLKKHLKVHLEDESVIRRRRGPKPSLKKV
FT                   YKAAQRSPDAPVLPSISFEKFLADEMPHYKPYYTPQLGERLQTVLPPPSSVISAPGEVS
FT                   AAGTPTFSRSPCSNPQDLRAAAGFFSTLSQDMHRRLPRLPHLNSVVPPAPVSPLTAASA
FT                   PSRYPPVLQLPPIHASVPYPNVPYVSSRVDTSARLPHFNRAETYSLHQKNSGDQQGNET
FT                   QEQIEELMSKLALESEEIDMADILLKVNTIRDYLMCALLEEEYEDEQDPSDFAPSGTSS
FT                   ETANQGAPVEPRPLSKYPTVMV"
FT   gene            <540906..>542904
FT                   /locus_tag="KLTH0E05984g"
FT                   /old_locus_tag="KLTH.mRNA.222AT.p"
FT   CDS_pept        join(540906..540915,541001..542904)
FT                   /locus_tag="KLTH0E05984g"
FT                   /old_locus_tag="KLTH.mRNA.222AT.p"
FT                   /product="KLTH0E05984p"
FT                   /note="similar to uniprot|Q9P4W6 Saccharomyces cerevisiae
FT                   YLL035W GRC3 Protein of unknown function required for cell
FT                   growth and possibly involved in rRNA processing mRNA is
FT                   cell cycle regulated"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23305"
FT                   /db_xref="GOA:C5DHP4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP4"
FT                   /protein_id="CAR23305.1"
FT                   /translation="MVNGVQSTFGPSYDKNDDDDSSDASSITATLNDEALPSAGSDSEY
FT                   FEDEEHDEVNGGIENGYKWETFKAVSGVNYFPLNDGAGTVLIGLKQGQEVMISGSYRLQ
FT                   IAKGGIKYNDIHYNASWRSISIWHPTCSSMSPILSSYYADWNERTFIPVEASKTSLKHE
FT                   DFECILKVSSRCSGLLKIAELNPAFKDLWIPQDYRPEEGVFAKPSFCVISKDTVRDTTN
FT                   IAALKISERWHTSLSDLTLFHKNSPHDMRVVVLGGKNSGKSTFLRLLAQRLLHTGRQED
FT                   DFLYFLDIDPGQSEFSRPDCISLSKLGSNFELGNHLGQAEAEQVLEYYVGTSSPHVFPT
FT                   KYLSDVSRLIDSFSEENSMGSALLNVPGWIKGFGVQIMNDVINRFKPTHVVFIDSNSRS
FT                   EAFLNELQIESTFSTPQREEYEPCIYKIDGYHGSPTSGIHSRLHAPHLRLFRLLAHFHK
FT                   VENTRSLISYDFTPLVRRAPLQVSFSPGPIKAFDIVDFNDAVSDEVFKDIMDGSIVGMF
FT                   CFEGECETHKDGKFPILKRECLEESFVSLGLIHSVDTENSCINIYIPESTVGSVRGRKN
FT                   STWLIRRCKTATPICELFPSSKELSTFKSSGLPFLSFHKQAKYEFIWKVRRNILRRGHQ
FT                   NR"
FT   gene            complement(<542954..>545413)
FT                   /locus_tag="KLTH0E06006g"
FT                   /old_locus_tag="KLTH-ORF9487"
FT   CDS_pept        complement(542954..545413)
FT                   /locus_tag="KLTH0E06006g"
FT                   /old_locus_tag="KLTH-ORF9487"
FT                   /product="KLTH0E06006p"
FT                   /note="highly similar to uniprot|Q07844 Saccharomyces
FT                   cerevisiae YLL034C RIX7 Putative ATPase of the AAA family
FT                   required for export of pre-ribosomal large subunits from
FT                   the nucleus distributed between the nucleolus nucleoplasm
FT                   and nuclear periphery depending on growth conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23306"
FT                   /db_xref="GOA:C5DHP5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP5"
FT                   /protein_id="CAR23306.1"
FT                   /translation="MVKARKSKAPLSQGFDNKISDLIYLMLDEKSLEKRRANAAEKARR
FT                   EEEELADEEETAEDDFSDIFLARDLSFGEVLAFVQSKDLSLQRVKKVVLEKTVDKVLKQ
FT                   AIEEEEEQFAAYFANETSKDDQMNLDSESLSQQNLMVTPTSNDMNKSITSIWATTKSEE
FT                   NKEDGDKKLSSKKRAKETGSKPKRQKTQEDRSPPSSNLSSLGGMDDVVAQLMELIGLPI
FT                   LHPEIFASTGVEPPRGVLLHGPPGCGKTSIANALAGELQVPFISISAPSVVSGMSGESE
FT                   KKIRDLFEEAKSLAPCLVFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDELSFEKTG
FT                   GKPVIIIGATNRPDSLDAALRRAGRFDREICLNVPNEISRLHILKKMSSTLKIDGSIDF
FT                   LKLAKLTPGFVGADLKALSTAAGTCAIKRIFQSYASLAPTSMEVDDETLTSDGSQEPKN
FT                   TVNMIDPLPLSTVQKFIQSFPEPLTEEQLASLSIRYEDFLKALPTIQPTAKREGFATVP
FT                   DVSWANIGALNRVRIELNMAIVQPIKRPELYEKVGISAPAGVLLWGPPGCGKTLLAKAV
FT                   ANESRANFISIKGPELLNKYVGESERAIRQVFSRARASVPCVIFFDELDALVPRRDASL
FT                   SESSSRVVNTLLTELDGLNDRRGIFVIGATNRPDMIDAAMLRPGRLDKTLFIELPNFEE
FT                   KLDIIKTLARTNGTPLSSDVDFEAIIRDESCRNFSGADLAALIRESSVLALKRSFFRTE
FT                   EVHSITENNLEKEFGELNTSSEDVIVTMQDFSNALKKVKPSVSDKDRQKYERLNKKMGW
FT                   VDEADGS"
FT   gene            <545638..>546252
FT                   /locus_tag="KLTH0E06028g"
FT                   /old_locus_tag="KLTH-ORF9481"
FT   CDS_pept        545638..546252
FT                   /locus_tag="KLTH0E06028g"
FT                   /old_locus_tag="KLTH-ORF9481"
FT                   /product="KLTH0E06028p"
FT                   /note="weakly similar to uniprot|Q07843 Saccharomyces
FT                   cerevisiae YLL033W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23307"
FT                   /db_xref="GOA:C5DHP6"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DHP6"
FT                   /protein_id="CAR23307.1"
FT                   /translation="MASRGITITTNKAITTSKSTLILKHDKFLPPRNMINEFPHDDVLR
FT                   MCYRRHMRLKPFISQRSMIQTTYVDYVRYKYKNEDYPKKCRASGIAHKTPVQSVLQQAE
FT                   LSLRFCLQAVMQVKKGVSDERSVSNEIRLSRNMLKNILAIEHEKAKLIAQNPRQNYPIL
FT                   REAFSYISPTAHKSSLLLRFNALREFDRCLIRFNMCMGTKL"
FT   gene            complement(<546306..>548399)
FT                   /locus_tag="KLTH0E06050g"
FT                   /old_locus_tag="KLTH-ORF9480"
FT   CDS_pept        complement(546306..548399)
FT                   /locus_tag="KLTH0E06050g"
FT                   /old_locus_tag="KLTH-ORF9480"
FT                   /product="KLTH0E06050p"
FT                   /note="weakly similar to uniprot|Q07834 Saccharomyces
FT                   cerevisiae YLL032C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23308"
FT                   /db_xref="GOA:C5DHP7"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP7"
FT                   /protein_id="CAR23308.1"
FT                   /translation="MPNTIALYPFETTIFFKPENSEFTSQNLWKSLKKEHVQRLELDDE
FT                   QQEVLGDIPREAVIHDFERFPNCIRCKCSIQSASPAEPTVKFETPLERRLSTQESRQLM
FT                   ELSSTLGVEAVVASTQLYSTFPDPLKQRLLYVLGLESLVAAAMPQVLAFVALLKGRFVE
FT                   YTKIESPVLLPSCVGNEQLNIKNILDIYKTEVVTPELWSQDSSDIFLINEVHSLNLLAK
FT                   EKLEQMVGVARNSILCSSIYNISETKLHYLKMFRKRELTDIMSRYQCYVKINKSSIDFV
FT                   AGSIQVIEQTMKQLTLELLMTAYEAQIIIHDQEGNVVQGRLTAKLRELASQNQVIILQL
FT                   LPNALNCVIVGSPHNVSKCIDSFEKEEFKDDVQIRFLVELHPDYKEFISGKKNGKMSKI
FT                   IENAKCAVSLELREDQTNMCIVLTSNSFAAAKIGVRLLSDELPAEDSFFIPDSYHRPVI
FT                   GTGGSVIQTIMRRYNVFIQFSNTYQVPYINIGFTRRNNVVIRCPHKNQKSISQARDELM
FT                   RLVSEYSEMQARTFVNLSPGQYRHCFLQNSNFMQDVVSDLEKKTGVYIKFPTTCPRENV
FT                   IFEVRGDEQNSVNAAKELVRRFALEREITVDAKIKDVEDFTNKLVVPLKSGFDIETSVK
FT                   GSTVTLTYSEAKVPLMKKARDILRAYLSSKGMQVVAEKELDRNSALETRHNPKQEIIAG
FT                   PLY"
FT   gene            <549274..>550182
FT                   /locus_tag="KLTH0E06072g"
FT                   /old_locus_tag="KLTH-ORF9478"
FT   CDS_pept        549274..550182
FT                   /locus_tag="KLTH0E06072g"
FT                   /old_locus_tag="KLTH-ORF9478"
FT                   /product="KLTH0E06072p"
FT                   /note="weakly similar to uniprot|P18888 Saccharomyces
FT                   cerevisiae YHL025W SNF6 Involved in global regulation of
FT                   transcription subunit of the chromatin remodeling Snf/Swi
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06072g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23309"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP8"
FT                   /protein_id="CAR23309.1"
FT                   /translation="MPPRKRRTHNLKGLRGSQDQQQSHSSYFATRLKPEQVGALVHDES
FT                   DTISYRAYLVQNFIRSSEMMDALMTQNVPLPKIKAPPIFRNPNVEEMKRAVVSEREQLD
FT                   AIESHLQSYAIDLPDGYHQLKELSMQIDLSQDVSDNSIQAAESAYKAQTGKYTQDDRIV
FT                   VHKDRFPQLRGDHSKAPPDYWERRLDILASQQQEALRLKIMQEEEEELKRRTEEENRLR
FT                   QKQEEQRLYEDPFQQQATHAQPMAGPVTANPGIPDPQPAQQPSDQPPHAMLGSIFGDMN
FT                   GENFNNGFEDDEFADLDTAFF"
FT   gene            complement(<550258..>553308)
FT                   /locus_tag="KLTH0E06094g"
FT                   /old_locus_tag="KLTH-ORF9475"
FT   CDS_pept        complement(550258..553308)
FT                   /locus_tag="KLTH0E06094g"
FT                   /old_locus_tag="KLTH-ORF9475"
FT                   /product="KLTH0E06094p"
FT                   /note="similar to uniprot|Q07830 Saccharomyces cerevisiae
FT                   YLL031C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06094g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23310"
FT                   /db_xref="GOA:C5DHP9"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR037675"
FT                   /db_xref="InterPro:IPR039524"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP9"
FT                   /protein_id="CAR23310.1"
FT                   /translation="MPPIDSTNEDYVKKNMLSSSIEDKRLFKSRIQRFKTTHRLYIYLM
FT                   GSLAVLQIIAIAFFARGFLLTRTVLENVATGADHEARFSKCVILVIDALRFDFSIPVDP
FT                   ADNAFNSYFHNNLDVLHTSFNNATSETHSSLLLKFIADPPTTTLQRLKGLTTGSLPTFI
FT                   DAGSNFNGAVIEEDNLIKQMFLNNQSVLFAGDDTWDNLFNPFLSPASQPFESLNVWDLD
FT                   TVDNGVIRFFEDNLFAKSEKSEEWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQANEFI
FT                   KRICESIDDDTLLVVMGDHGMDHTGNHGGDSKSELEAALWLHSKRPNMWSHLPEQFYDI
FT                   SALGENYRQVNQIDLVPTLSLLLGLPIPFNNLGWPIQEVAATQEQLRSYSKIALDQIKA
FT                   YKDISRVITAAEKNERLNELLNESLEDILQASEYQKIFLESCKDLWARFDYFSIATGII
FT                   LLTASLVLLITITKLIPSIVVGQMVTELVPSITIMALVSNVCFIGIFHVLHQPKFLENW
FT                   IWCSLLATAVGIIVGCFIPLFDRYNFAWITVKFIEDLSDYWSRIAAMCVTLHALLFTSN
FT                   SFTIWEDKIVSFLLATLGMLTLYEFVFLPKRKLTTALLSAAMGEKRGSSSSNASSSSET
FT                   ESSPLGKFARFVGSYHSIVLIACTRISSMITICREEQGEYCTPTFTTANNYSPWCLSLC
FT                   LVLVAYLPSLIKGYYNVCSSYQAAAPIWIGQFLKFVLLGNFVYWTVCAMENTVPTWSWD
FT                   VKIFKLTLSRIIAGFSLVAANIGWLMGPLCVKINIHNNDVKSQQATILGYANAYGSQYF
FT                   LLILNFFMCIMLFNKPMAQLSLSLMCTQLLSMLEIFDLLKLKENLIGPVSMGLLAYQQF
FT                   FSTGHQATIPAVQWDIGFILTERITFPFTHLGIVLNTFGPHIIVALSVALLTLWKQPPS
FT                   VLKPQTLLARIVSNCGMLLIYNTVLCLSSFVWVTHFRRHLMVWKIFCPRFMFASLSLIV
FT                   TQVIVTLVTIAFASGRLIRQINTIFPS"
FT   gene            complement(<553784..>556297)
FT                   /locus_tag="KLTH0E06116g"
FT                   /old_locus_tag="KLTH-ORF9473"
FT   CDS_pept        complement(553784..556297)
FT                   /locus_tag="KLTH0E06116g"
FT                   /old_locus_tag="KLTH-ORF9473"
FT                   /product="KLTH0E06116p"
FT                   /note="some similarities with uniprot|P39720 Saccharomyces
FT                   cerevisiae YAL051W OAF1 Oleate-activated transcription
FT                   factor acts alone and as a heterodimer with Pip2p activates
FT                   genes involved in beta-oxidation of fatty acids and
FT                   peroxisome organization and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23311"
FT                   /db_xref="GOA:C5DHQ0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ0"
FT                   /protein_id="CAR23311.1"
FT                   /translation="MTSNPPAVKAPREKPAAMFTCKSCRQRKRKCSREKPACQRCVRLA
FT                   IPCVYELPPKHLIRSVSTGTIEGVGADSAGGAGSAGSASASASTSVSVDVSGRSSACST
FT                   AGAAGSGLLRDFPAGFMHGSALASLPTLEPTGSLDTDTRISGQPLKVHFHTTLDLDSHL
FT                   HKDPFLLEFAASCVACGPQLARNPQSSGLGHAWFSLTVQCHDLLVPRLNSLKTPSPVPS
FT                   LLAPGTPRTRAFQGPRSEDFQASCAALIADISSALPSMQAIETYKVQFYQNVYTAVPVL
FT                   NIQTFERSFQDLVVGDSCGAARLKFGSADHHPKITHLVILLMAIRMGYVCLCLYNDRVE
FT                   RDALLKKQTELWLRQNAVPRDVLLLVKRCLELLDVYENPSEDILCCLIYLRQILLLERS
FT                   DGWSLIGVTNAELLEATVYLASRMNLYSNAIDTMTEGATTVQEKLYRRKLWLSICSISL
FT                   HEHTLRGGEPFVKARQLRQFSDHYQVFDDYRAISLRELPLDDQIELDYHIMLLKNHQFM
FT                   EVLCDIEESHPSNVEFLDNKVHENERLALFFKDGFPDADPAYKIDVNLPLYLLCNSGHI
FT                   PVRIGSVKQIAVFQTRFALLIKQLSNSSLLMFYYEKEYKFSNAVDSLYNFERHLFDSMK
FT                   ILLQLFEYYRDYAFGRLAEVTPSAMRYILANTMSPIFNRTTLVIHGIILRFVYLQERAD
FT                   FERDLEKAPLLQKIVSQLRALVVTSSDCMKMEFLPPKSLDLNRNFIRLLDARVLLISTK
FT                   QYAVLDDIDLEKQHDAMQICGPGYADYYNNAVTQLSLNSLGKFLQLLESTTFNKKSDSP
FT                   MNIFSNIASYSGASLDANENTSSFS"
FT   gene            <558501..>560345
FT                   /locus_tag="KLTH0E06138g"
FT                   /old_locus_tag="KLTH-ORF9464"
FT   CDS_pept        558501..560345
FT                   /locus_tag="KLTH0E06138g"
FT                   /old_locus_tag="KLTH-ORF9464"
FT                   /product="KLTH0E06138p"
FT                   /note="similar to uniprot|Q07824 Saccharomyces cerevisiae
FT                   YLL028W TPO1 Proton-motive-force-dependent multidrug
FT                   transporter of the major facilitator superfamily able to
FT                   transport eight different compounds including polyamines
FT                   quinidine cycloheximide and nystatin involved in excess
FT                   spermidine detoxification"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06138g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23312"
FT                   /db_xref="GOA:C5DHQ1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ1"
FT                   /protein_id="CAR23312.1"
FT                   /translation="MSTSLSSSSSSASFTHERGAGAAGAANRASSDDTRSSASDPTLNA
FT                   KMHSFDTAGNTGVADSGVMADDVRSDTDVLNERKRHSAASASFEQDLERTGTNATSETH
FT                   AAINRRVSRILSGSQNEVEKVKVDYSHCPPMGGGRPFPPTLPSREPYEVAFDGPDDPIH
FT                   PYNWPMRKRAFLCLLLGLNAVTVAMGSSIFASAVPQICAKYHVAQVVGVLGVTLYVFGF
FT                   AASPVIYAPLSELYGRQKLLIISSFGFVLFMFATATAKDLQTIMICRFFAGFIGAAPLA
FT                   IVPACFFDMFDNETRGTAVVVFAMGVFMGPILAPVFGSYIVQHTTWRWTQYCVGMFAAL
FT                   VTILLAIFYEETHHPTILVNKARRMRQISGNWGIRAAHEDAELSLKEIAQKTVTRPIYM
FT                   LVTEPILFAITLYHSFVYGILYLLLEAYPIVFVKKYHFYVNGELPYIALLIGMGVNAAY
FT                   NIWEEKSYVRKVRENSGKPLPEERLKTMILAGIVFPIGILWFCWTGNYSDKVHFMVPTV
FT                   AGSFIGFGLIGIFLPCFNYIIDSYLFLSASAIAGNTFMRSSFGAAFPLFAGFMFNNMGV
FT                   NWAGLLLGLFALAMVPVPILFIKYGKALRQRSKFAFVL"
FT   gene            <560782..>562956
FT                   /locus_tag="KLTH0E06160g"
FT                   /old_locus_tag="KLTH-ORF9461"
FT   CDS_pept        560782..562956
FT                   /locus_tag="KLTH0E06160g"
FT                   /old_locus_tag="KLTH-ORF9461"
FT                   /product="KLTH0E06160p"
FT                   /note="similar to uniprot|Q07825 Saccharomyces cerevisiae
FT                   YLL029W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06160g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23313"
FT                   /db_xref="GOA:C5DHQ2"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ2"
FT                   /protein_id="CAR23313.1"
FT                   /translation="MSTRQNTLNMKNSLSSMNTFGGATPVAGSARPSRPCANCTCSPGL
FT                   LSRQNRRSSLLLRQVSSSRKRPILRTSVATGGSGESIYSSDTICQVKNVNTSERLLHLR
FT                   RKMSEKEICCYVVPSEDEHQSEYVSQADQRRSFISGFTGSAGVACITRDLLNFNNDKPE
FT                   GKSILSTDGRYFNQATQELDFNWTLLRQGEDKMTWPEWCVYEAKEMSLALGGKEARIGI
FT                   DPKLISYDQVIRFQKLIKDKTDGSKAKVSLVPVVENLIDAIWSRFEPLPVRDANDLLLL
FT                   NSHFTGETFKEKRERLMNYLNEKTPGCSTFCIAALDEISWLLNLRGSDIEYNPVFYAYL
FT                   LVHNEETILFTDDPYDDKIKGYFEDNNIAVKAYEDVWSFLCSTATKTKSSNDVMAIASG
FT                   SSWEIVRSLGNAPYKQIQSPLELLKAVKNDVEISNARAAQVKDAVCLVQYFAWLEEQLI
FT                   SKEALIDEYKAACKLVEIRKTQKNFMGNSFETISSTGPNAAIIHYAPPAENSAMIDPCR
FT                   IYLCDSGSQFLEGTTDITRTLHFTKPSDEEVRNYTLVLKGNLALERLVIPQGTSGYNID
FT                   VIARQFLWQHGLDYRHGTGHGVGSYLNVHEGPIGIGFRPHLGNFALEKGNIITNEPGFY
FT                   KDGEYGIRIENDMLVQKAEGLKFGEHEFLKFENITLVPYCRKLIDRKLLTHEEKAQINS
FT                   YYKRIWHTVVPFIQPQSISYKWLKRETAPL"
FT   gene            <563423..>564226
FT                   /locus_tag="KLTH0E06182g"
FT                   /old_locus_tag="KLTH-ORF9460"
FT   CDS_pept        563423..564226
FT                   /locus_tag="KLTH0E06182g"
FT                   /old_locus_tag="KLTH-ORF9460"
FT                   /product="KLTH0E06182p"
FT                   /note="similar to uniprot|Q07821 Saccharomyces cerevisiae
FT                   YLL027W ISA1 Mitochondrial matrix protein involved in
FT                   biogenesis of the iron-sulfur (Fe/S) cluster of Fe/S
FT                   proteins isa1 deletion causes loss of mitochondrial DNA and
FT                   respiratory deficiency depletion reduces growth on
FT                   nonfermentable carbon sources"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06182g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23314"
FT                   /db_xref="GOA:C5DHQ3"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ3"
FT                   /protein_id="CAR23314.1"
FT                   /translation="MRFAMSCHESLAVRSLQAFRLFSSRSILLNSAPAQASHTENHTYR
FT                   ARNAKRFLQTNHLQRTLGNSGPERWSFDFNQEKKSAPFKKPALTPLKPFHQESKESTIQ
FT                   TAASPNASKWSTYSMPSKESLAKQQDQAKRQGQEIEKQLASEPKPVKKQKRRLRPRKAL
FT                   ISLTPNAVDHLKLLLNQPEPKLIRVGVKNRGCSGLTYDLEYITAPGKFDEVVEQDGVRV
FT                   ILDSKALFSIVGSEMDWIDDRLSSRFVFKNPNSKGTCGCGESFMV"
FT   gene            <564895..>567618
FT                   /locus_tag="KLTH0E06204g"
FT                   /old_locus_tag="KLTH-ORF9458"
FT   CDS_pept        564895..567618
FT                   /locus_tag="KLTH0E06204g"
FT                   /old_locus_tag="KLTH-ORF9458"
FT                   /product="KLTH0E06204p"
FT                   /note="highly similar to uniprot|P31539 Saccharomyces
FT                   cerevisiae YLL026W HSP104 Heat shock protein that
FT                   cooperates with Ydj1p (Hsp40) and Ssa1p (Hsp70) to refold
FT                   and reactivate previously denatured aggregated proteins
FT                   responsive to stresses including: heat ethanol and sodium
FT                   arsenite involved in [PSI ] propagation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23315"
FT                   /db_xref="GOA:C5DHQ4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ4"
FT                   /protein_id="CAR23315.1"
FT                   /translation="MNDETQFTERALTILTLAQKLAQDHQHAQLQPVHILGAFVETPED
FT                   GSIPYLQNLIEKARYDYDTFRRTVNKHVVRIPQQNPAPAQVTPSYATGQVLQEAMKIQK
FT                   QQKDSFVAQDHILFALFKDSTIQQIFKEAQVDVEAVKQQALELRGNQKIDSRGADTSSS
FT                   LEYLSKYAIDMTEQARMGKLDPVIGREEEIRSTIRVLARRIKSNPCLIGEPGIGKTAII
FT                   EGVAQRIIDDDVPSILFGSKLFSLDLAALTAGAKYKGDYEERLKGVLKEVEESKTLIIL
FT                   FIDEIHMLMGNGKDDAANILKPALSRGHLKVIGATTNNEYRSIVEKDGAFERRFQKIDV
FT                   QEPTTRQTVAILRGLQQKYEIHHGVRILDSALVTASQLAKRYLPYRRLPDSALDLVDIS
FT                   CAGVAVARDSKPEELDSKERALQLLQVEIKALERDEEADPTTKERLQQARQREASLQEE
FT                   LEPLRQRYNEERKGHEELTKAKKKLEELENKAADAERRYDTATAADLRYFAIPDLKNQI
FT                   EVLENQVLEEESRAGSGAMVQNVVDSDTIAETAARLTGIPVNKLTESENEKLIHMEREL
FT                   SSEVVGQSEAIKAVSNAVRLSRSGLSNPRQPASFLFLGLSGSGKTELAKRIAAFLFNDS
FT                   DAMIRVDCSELSEKYSVSKLLGTTAGYVGYEEGGFLTNQLQRRPYSVLLFDEVEKAHPD
FT                   VLTVMLQMLDDGRLTSGQGKTIDCSNCIIIMTSNLGATFISSQSGSRIEESTKNLVMGA
FT                   VKQHFRPEFLNRISSIVVFNKLSPKAIHRIVDIRLKEIEDRFEENDKHYKLDLTPEAKN
FT                   YLARNGYSEDMGARPLNRLIQNEILNRMAMRILKGQIKDKETVRVVLKHNENPDMEEPD
FT                   QLDVLPNHQSSDADMDVDNDWDEDLDDSVTDATPLD"
FT   gene            <568785..>571112
FT                   /locus_tag="KLTH0E06226g"
FT                   /old_locus_tag="KLTH-ORF9451"
FT   CDS_pept        568785..571112
FT                   /locus_tag="KLTH0E06226g"
FT                   /old_locus_tag="KLTH-ORF9451"
FT                   /product="KLTH0E06226p"
FT                   /note="weakly similar to uniprot|P38741 Saccharomyces
FT                   cerevisiae YHL024W RIM4 Putative RNA-binding protein
FT                   required for the expression of early and middle sporulation
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23316"
FT                   /db_xref="GOA:C5DHQ5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ5"
FT                   /protein_id="CAR23316.1"
FT                   /translation="MSLESATTAIDPTAAFAAQTSAKDGLLVPDVSDSIAQFLPTEVSS
FT                   SESEDEEEAGSAAGGSARPPTASDPHPESCGAPESESEFLEELDDISDGEGAGAASKEK
FT                   DSAPGAGAGAGAGAGAASGIASAHVAPRSGIAASEAAPKFRGRPSSCVFVASLAASLGD
FT                   DDLCLSVTENFKKFGRLTMVKVLRDPANRPYAFVQYTNDADAKKALKEAQGSSLNGRTI
FT                   RCGPARVNRTLFVCYKGRNLNSSGLVSAAFVNQLLEKFGELEQLVACRDQFFHRKNNAY
FT                   SGSDRSNAWFIQFAYRDDAIRAFANLKSDLNWVVEWAQNIEAPSHMNMLSDSKNLVIRE
FT                   ETEPENEGACIMPADSYSESSGSEVVIDQKSIFVGQLDPMATEEGVLERFSRHGSILEL
FT                   NLISKPNNVFAFIRFTTEEAAAAALEMENHAMFLNKTMHVQYREIGGIKKFRRGNYNHR
FT                   NNNNGVHGNHNPSGSGNGSRHESTSNSQAYNQATYQPPRLNLAPPPINVGKRRSSTGSG
FT                   NYNHHYQHYPFGHEFQVYAHQPHQLSMMGGPKKSKASLRHRNVEITKSIDESNNDSTNT
FT                   SSNNNNNDTDNLNGGASEKSKGLPNELKSAASQSFVTDVTSDTSGSAGNNDASTNASTS
FT                   RYTYSAGGINYKKKLDEYKKRGNYPTFDPYYYPPYYYPVEFPLNPMGPSGLAGRAGPGA
FT                   PLSASGSPAHPGNQPYFMYYPLPQGSGMEFADMHNMMVPHLGGSPGPMGSPIFPLPISQ
FT                   QHFIPSDRSVSFNGEEKAALEY"
FT   gene            complement(<571398..>574007)
FT                   /locus_tag="KLTH0E06248g"
FT                   /old_locus_tag="KLTH-ORF9445"
FT   CDS_pept        complement(571398..574007)
FT                   /locus_tag="KLTH0E06248g"
FT                   /old_locus_tag="KLTH-ORF9445"
FT                   /product="KLTH0E06248p"
FT                   /note="some similarities with uniprot|P38742 Saccharomyces
FT                   cerevisiae YHL023C RMD11 Protein required for sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23317"
FT                   /db_xref="GOA:C5DHQ6"
FT                   /db_xref="InterPro:IPR005365"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ6"
FT                   /protein_id="CAR23317.1"
FT                   /translation="MSLNLPNPCLLGIVLTISTHSGPQVVFHYPPTDRSPGSRHVKRQQ
FT                   KADDHGFENKESSYSLRSQGKGSTPKKRSQKFQHDGESEANLSIHSNKTENVDSDMSSS
FT                   SSDEDPSTGLSDGDISTDYADVSSSSSSSASDSESEDFNATRSYLENSASLKSQDISMS
FT                   GSFKGTQVSATKVFQLLRPDESKRNSVVSRHTSTRGPEVSWLNAVRSISDSEYGEEPLC
FT                   ELNDQHFGSDFQDINKILRFDKDFFAEISSPPKEMCNTRFELTIDELALVGLPIHRNAD
FT                   GQWRKTKKRKSSSRSKRSNSSSRTRKVSRSHYEGTDVTGDSEILEEQLSGSQLFEEETG
FT                   KAEYEALEKSVNMFHLCFLTNPRLVEYNKRVDDIYHYVVSRLSLVLRYAQIKSGYVTRE
FT                   CYEIIKTQDRILKSSERYKSIKGPANKARYLYQKIIQRSSLARAISKCFDAISQNEVAN
FT                   LEINGDKIISLQIPIINEFDVLPDLKTDPVLKGSFLTSILNRKFLEEGSATMNEAWARS
FT                   HDENDDLLDYAVLLLNEPAIIIQELQFSSPQNDITSVLLTSLVKHLKPTVPLRNYQYVI
FT                   DEIVGKPVASESDVEERNSFQTSMLRSLALHLMYWRHARVIIPVSSKNTYIVSPLAPIT
FT                   GNTKDDFSGNRLDSEESKPLILQNQEVFSKKFPSLPPLPVFLSLVSSMKPRAFGSIIPS
FT                   KDHKSVYLSALAWLIRYGYLTQLLTFAWVRVDSRIKIAVDEDLEIDGVRRSKRAQGQSL
FT                   NSDISDNIVSRDQIRTDSAEDDLDFFYYGGDEDIINNSDFTIILSPETATAVEKRWLYK
FT                   CIEGQPVDIQVMFHRVVKYMNGKIPIELVQLREGISRHEIKRLFHALGKYLVDVYHW"
FT   gene            <575037..>575108
FT                   /locus_tag="KLTH0E06270r"
FT                   /old_locus_tag="Klth0E.tHis.GTG.11"
FT   tRNA            575037..575108
FT                   /locus_tag="KLTH0E06270r"
FT                   /old_locus_tag="Klth0E.tHis.GTG.11"
FT                   /note="tRNA-His (GTG) cove score=63.64"
FT   gene            complement(<575313..>575921)
FT                   /locus_tag="KLTH0E06292g"
FT                   /old_locus_tag="KLTH-ORF9443"
FT   CDS_pept        complement(575313..575921)
FT                   /locus_tag="KLTH0E06292g"
FT                   /old_locus_tag="KLTH-ORF9443"
FT                   /product="KLTH0E06292p"
FT                   /note="similar to uniprot|P32803 Saccharomyces cerevisiae
FT                   YGL200C EMP24 Integral membrane component of endoplasmic
FT                   reticulum-derived COPII-coated vesicles which function in
FT                   ER to Golgi transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06292g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23318"
FT                   /db_xref="GOA:C5DHQ7"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ7"
FT                   /protein_id="CAR23318.1"
FT                   /translation="MKFFICSLVALMWCSLCGAHNVLLPAYGERCFFETLSKNDELAVS
FT                   FQFGDRAPDSTEQLKGDFIMYSSDRRDALRTFRDVSHGDVRLRVPHGGKFEYCFVNINS
FT                   GATTKDVTFNIEGTIFVDPNDPKSDSLDGAVKQLSRLTKELKNEQSYIVIRERTHRNTA
FT                   ESTNDRVKWWSVFQLGVVIASSLFQVYYLRRFFEVTSYV"
FT   gene            complement(<577084..>578536)
FT                   /locus_tag="KLTH0E06314g"
FT                   /old_locus_tag="Klth0E.mRNA.3152.m"
FT   CDS_pept        complement(join(577084..577842,578360..578536))
FT                   /locus_tag="KLTH0E06314g"
FT                   /old_locus_tag="Klth0E.mRNA.3152.m"
FT                   /product="KLTH0E06314p"
FT                   /note="highly similar to uniprot|P32598 Saccharomyces
FT                   cerevisiae YER133W GLC7 Catalytic subunit of type 1
FT                   serine/threonine protein phosphatase involved in many
FT                   processes including glycogen metabolism sporulation and
FT                   mitosis interacts with multiple regulatory subunits
FT                   predominantly isolated with Sds22p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06314g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23319"
FT                   /db_xref="GOA:C5DHQ8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ8"
FT                   /protein_id="CAR23319.1"
FT                   /translation="METPAVDLDNIIDRLLEVRGSKPGQQVDLEEHEIRFLCSKARSIF
FT                   IKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI
FT                   IDEKIFCMHGGLSPDLNTMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGV
FT                   SFTFGPDVVSRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAM
FT                   MSVDESLLCSFQILKPAQKTLPRPQGKKKK"
FT   gene            <579448..>579554
FT                   /gene="SNR52"
FT                   /locus_tag="KLTH0E06336r"
FT                   /old_locus_tag="Klth0E_snoRNA_222"
FT   ncRNA           579448..579554
FT                   /gene="SNR52"
FT                   /locus_tag="KLTH0E06336r"
FT                   /old_locus_tag="Klth0E_snoRNA_222"
FT                   /product="snR52"
FT                   /note="Pol III C/D snoRNA monocistronic SNR52"
FT                   /ncRNA_class="snoRNA"
FT   gene            <579575..>580306
FT                   /locus_tag="KLTH0E06358g"
FT                   /old_locus_tag="KLTH-ORF9433"
FT   CDS_pept        579575..580306
FT                   /locus_tag="KLTH0E06358g"
FT                   /old_locus_tag="KLTH-ORF9433"
FT                   /product="KLTH0E06358p"
FT                   /note="some similarities with uniprot|P53093 Saccharomyces
FT                   cerevisiae YGL198W YIP4 Protein that interacts with Rab
FT                   GTPases computational analysis of large- scale protein-
FT                   protein interaction data suggests a possible role in
FT                   vesicle-mediated transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06358g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23320"
FT                   /db_xref="GOA:C5DHQ9"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ9"
FT                   /protein_id="CAR23320.1"
FT                   /translation="MSDLVEPDLIENDRSQSPFWPESNASPNLDGYNIDLNARAGESTR
FT                   GTLDEPVFQTLKRDVLQINTRLKQVVYPHFPLPGRNADTSEISDPAAIVGNNCTDLWAP
FT                   LVFTILYAVALSRTSDRFSGSFILSWAAIIAMAIHLTVTRSESVSNGPVLTYVSSAGYC
FT                   LFPQVLNAVLSAVLFPLATAAIPNHAWKVRVLVLLRLFSFVTCSFWACRSSFKATAASG
FT                   RTERFPLLLLQLTLGWACMVT"
FT   gene            <580587..>585320
FT                   /locus_tag="KLTH0E06380g"
FT                   /old_locus_tag="KLTH-ORF9431"
FT   CDS_pept        580587..585320
FT                   /locus_tag="KLTH0E06380g"
FT                   /old_locus_tag="KLTH-ORF9431"
FT                   /product="KLTH0E06380p"
FT                   /note="similar to uniprot|P53094 Saccharomyces cerevisiae
FT                   YGL197W MDS3 Protein with an N-terminal kelch- like domain
FT                   putative negative regulator of early meiotic gene
FT                   expression required with Pmd1p for growth under alkaline
FT                   conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06380g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23321"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHR0"
FT                   /protein_id="CAR23321.1"
FT                   /translation="MSPLLPSPVTSHTLKLPELDPQSQVSLSECEKKARTLSCRTGSAV
FT                   VLARSAIFVNGGFTIPLDLAEVNSISIQKELILYFSRESKSPDSFQNLSEWISTETFFL
FT                   DLISRTWERVITEEGTSPIVEGSENNKSAVMRERVFHSICHHDGHLYIFGGLVVSSQSD
FT                   YELIASNELWSLDLETKTWLRLSSDPSITRRFNHSMHLVPGNDESEDTRIYIVGGLNKF
FT                   DRPVHVVDCFNLTQQRWEFADDEPDHGNRPEIITNINGQNTHLVKNSGFSLLLRDQISD
FT                   EPSIAMYNPSDDGSGDIVNPFVAQPLVPGSRGQRMMSFQGYSSSEKQSFEVPFNLQHAS
FT                   GDYFGYNIILSGFHPDVQPENFRCFTYNIPTGKWTEINTMSDDPSGATPRLWQLFVWHS
FT                   HHKVVFLGTRGKGNHLPSVQKFDTLLCIALPMINVFHKAMHYAQGTRGKSAASSEQLTL
FT                   GHEGFEGYSRYSAPPLEITTIGSVFPSHAMALGKDSLEFYGQHLSDFEIVTEDGDSVRV
FT                   PMYLLRKRWGRYFDEVLSQGYVKAIKDFENQNRHNEFAKLSYDSSHHNVSTPTTQHFGS
FT                   TGSKDAPGTSLNGSFDAGNSKTEQVQVSQPLYPLVSRKSSPLFFANKSSQNDKAEKNDN
FT                   GTADSRNAPAMHHSKSDSSAICSANTLSQYSKDAQDTVKADSQTSQNSNKTTSSSGGMV
FT                   FRLPFQEASNTTFSTLVPHASMLDSGRSDGGDRHLGQYNRRRSSASTSLLFDVGGQNSR
FT                   RASHPAVFNSDERFAIPGILQQSQSPFCSRKASVTSQNSSISYVSSTSDRMGNPAYRHM
FT                   SQDSGTTNSTFNSVGSQIPPPQPMPMEPVPIPPQSHLEISNCPPSAKNSPFSSRRSSLY
FT                   HELLRPGLASSVSQSIIGVQGNSGLESGPLYEPDPHSIHKRSMDRQLLEDNLIDVELEG
FT                   NFGNVSQRYTATRCPKASREDSYGNTSVHVEGGRPSYFSTADSNCSVTGTITNELEPLL
FT                   LPRSLYMPWPTSTIRSFTEFFYTGQVNGKWLLSPVALNLLVMAKLYEIPLLYDLMSEVF
FT                   YSILGRKGESLLTTAEAMRHVFVSSFLAKHEGNEETVKQLKENFVYQEILDIEDSLRSI
FT                   DNGHFNTHLLRDLTRLGSTSSSESGEKITSREGKDGTSLNVPILFAGGPRGSHNSVGSV
FT                   GLPPNLALSPFKGAQPNISQPHKKSSLSKDVTADQPERVNLEGVNGTKTVTLERTEKTN
FT                   QENKAEKIEQMKLSNMSQNESSALSNQVAGIKSPTGGCEGEAEKEPEYNMKQGENNKTL
FT                   EDSTSSSESGDISAGFGLASTSKIEKKLRRRDSEKSIDPLSKLSDSRNSSLKNVIPYFK
FT                   QGEKYFKTDNSPRNVDTLTLDNMASPNALPPVDYVIELIHETASLVHDVRLIVRCISVI
FT                   KLSKALKSLKQQLDHEFASLSEEFRRAETPTDTTPRSPGPGLKSDGAPTLTPTTSVDKI
FT                   TKTTSNISLAKKISKPGTPESNARNPNTEVASRFTVSDPNLADKSDTASINTKNSKASS
FT                   KQARIKKVNSHLAGSGLTGAALFMSGSFAPTPSKPKKESSSNNLSAMGGIPFFGKRK"
FT   gene            complement(<585734..>585896)
FT                   /gene="SNR4"
FT                   /locus_tag="KLTH0E06402r"
FT                   /old_locus_tag="Klth0E_snoRNA_220"
FT   ncRNA           complement(585734..585896)
FT                   /gene="SNR4"
FT                   /locus_tag="KLTH0E06402r"
FT                   /old_locus_tag="Klth0E_snoRNA_220"
FT                   /product="snR4"
FT                   /note="C/D snoRNA monocistronic SNR4"
FT                   /ncRNA_class="snoRNA"
FT   gene            <586109..>594130
FT                   /locus_tag="KLTH0E06424g"
FT                   /old_locus_tag="KLTH-ORF9427"
FT   CDS_pept        586109..594130
FT                   /locus_tag="KLTH0E06424g"
FT                   /old_locus_tag="KLTH-ORF9427"
FT                   /product="KLTH0E06424p"
FT                   /note="similar to uniprot|P33892 Saccharomyces cerevisiae
FT                   YGL195W GCN1 Positive regulator of the Gcn2p kinase
FT                   activity forms a complex with Gcn20p proposed to stimulate
FT                   Gcn2p activation by an uncharged tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06424g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23322"
FT                   /db_xref="GOA:C5DHR1"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022716"
FT                   /db_xref="InterPro:IPR033173"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHR1"
FT                   /protein_id="CAR23322.1"
FT                   /translation="MNLFKDSLEGVGPILEKSCRESSLNARVPVLEEVHLILQDQGQEL
FT                   GEPVIQEIANTLLESYVYIRDQKSGRLITSIFEDLFLRRPALLESSNTFIFNTLKKSLG
FT                   TKAISDYLNLLDWTNAFLKFAACHSADFTVDSAKLLPTLCLVVYCIEIALDGHEDTKRS
FT                   KLSQNQHRKRIRQSILQSLNKTLAFCLRHGKGVSVDTIVNGTLLSTVSKLPPAGLIIVM
FT                   GSLVKAVLQLLPSQPAHHAALEVDFVVPFCEYVGKEALLGKEPPSPFCIETFFAPFAQE
FT                   YVTSDLFKTYILPSLEKCILRSAEAGLTLANELYICIDSQKIDLCSIFTESKLMSQSFS
FT                   SLKSSKDSVRKAALESMLTLLRMLRPETCNPESLRKFVNELFKNLKSNLNTDYKTVVSR
FT                   LLLVTPPFFPEAVSDIVKGLTPYVSKESNEAALEPMLKAYFAHYSKMGSSTKEGYAVIK
FT                   AGLNDKKQQVRRLWVVSLVEVIDASWEDAIHEFLPMILDFMRDILMSPFKHPARSILSC
FT                   FVCVDRAHETEKNTLSTELHSLIDDIHQKSHSLGDAWLVATTSANLAAEDRKAALSLLS
FT                   RAYERHPLMVGLDVIKSLEEETRQGFASGKNGVSIRYSTPVFNVLACTIDDKAALEGIL
FT                   VDLLVLAQHPGFKLKNGWAGLVMQAQLDPNHLVLKFADKIVEKFETYLGGEHIALSPLE
FT                   KATVKSLSYAAFINSSATAPLLVGIFERDFDNNRLSHIDDSQIKIWRGAEGQLVVNVLD
FT                   KKDKKLEDKNSKDYETLKWEEDIRKKQAKKNAPSRKLSKEEKELVDAQLSKESSVRKNV
FT                   NKIVSELRRSCLLVQELVHGARLVDNGTDTWFSVAVSRLLSALRQEVFTELLPGDGVET
FT                   FLDLSNVISERLGNIRYFTAVATLRSYGVHAIPENLTQEPLLDLISRVLFRIKFAANKK
FT                   RFESLTLTFLLPLLSKVLEDGKNVSLKNASKPLVKSEFIEEDKEEEHLLLAMEIISSHA
FT                   ESFSDPAIPREHILEVLLSLLSVPSKARSSKECFLALCQNISISPNAEDLELILGTLMS
FT                   PSEFVRATILEAIDDEFELSPYMKFSPQIFILMQDASESNRDTASFIWQFNKFEVNEEL
FT                   MISLLNFFAQTDSGLRLFVARAYANALRILTAKSEGFFEKYLGVLMDFYSSKARVPDPI
FT                   VDEYGLVVMSSEAQKDHWEERSTAAIAFKEFSTFYPEDSECAVKFVEFLVNSGALGDRE
FT                   LLVRQELKEAGIEIIAHHGIRNVEKLIPVFERELAENNDVATKENVIILYGTLARHLPA
FT                   EDSRVVVILERLLNTLNTPSEAVQQAVSACISPLVKLLGSQVEGYIEDTVQKLLNSRET
FT                   MTSRRGAAWGLAGLVKGFGIGALSQFDIIRNLVDASEDKKDPVRRESVAFAFECLSKVL
FT                   NKFFEPYVIEVLPNILKNLGDSVPEVREATANATKAIMANTTGFGVKKLIPVAVNNLDD
FT                   ISWRTKRGSVELLGNMAYLDPTQLSASLSNIVPEIVAVLNDSHKEVRKAADQSLNRFGE
FT                   VIRNPEIQKLVPTLIKAISDPTKHTEEALDALIQTQFVHYIDGPSLALIIHVIHRGMRE
FT                   RSANTKRKSCKIVGNMAILVDSNDLVPYLQQLIDEVELAMVDPVPNTRATAARALGALV
FT                   ERLGEEQFPHLIPRLMSTLSDESRAGDRLGSAQALAEVISGLGLSKLDELLPNIMAGVT
FT                   NYKTYVREGFMPLLLFLPVCFGAQFAPYISQIIQPILAGLADVDESISDTSLKAGKLIV
FT                   KNYATKAIDLLLPELEKGMFDENERIRLSSVQLTSDLLFQVTGISSKNEFTDEEGDFNH
FT                   EVTKQLVEVLGQDRRDRVLSALFVCRSDSSGVVRATTVDVWKAIVPNTSRTVKEILPTL
FT                   TNIIVVHLASPSATLRHIAAQTLGDLVRRVGGNALSQLLPTLENSLIESNGSDSKQGVC
FT                   IALCELTQSSSPENLVEYQAEIVNIIRSTLVDDDVVVREAAALSFDAFQEVFGKVAIDE
FT                   VLPHLLNMLTSSEDSEYALLALQEIMSTKSEVIFPVLIPTLLQPPIDAFRARALGSLAQ
FT                   VAGSALYKRLSLIINALVNTLERNDVDDPTNIVLEDALDKVLSSVTDDEGMHPLLQQIL
FT                   SLMKDENKKKRVIVLQRLANFFKNTVLDMNIYIPEIISQSVVLFDDENPHVLQSVFDEL
FT                   TVLVKKQDKLMLEKLVKPAKQALQLVGRGDEELEVFKLPKGPSCILPIFLHGLMYGSNE
FT                   DRELSAMAIADVVKRTPATNLKAFVTVITGPLIRVVGERFPSDVKAAILYALNVLFAKI
FT                   PQFLRPFIPQLQRTFVKSLSDSSNETLRLRAAKALGSLIEYQPRVDPLVVELVAGARQA
FT                   TDSGVKTAMLKALLEVVSKAGSKLNENSKSSIINLVEEEILVVDNKLATAYAKLIGSLS
FT                   EIMTKEEAANILNEKVLQVDLSSESGRFAILTLNSFLRDAPAHILQSEVVSELVNYLIV
FT                   AANSNSPYISDNALTAIGKLLLLENEKKSPFSKRESETFFALGEQNIRALVEVLAKDML
FT                   VPASNSLDSRRLSLVVVRTLARFKFDECVKPYYDQLGPSVFSCLRDTIIPVKLAAEKAY
FT                   LAIFRLVEEEDMCSFESWFKGLTGPSVKSSAGSEIQLRSIGDYTKRVGKRLASVERERI
FT                   AAGGDPETVFSDRYEDESEIWAVGGVELVKDV"
FT   gene            complement(<594807..>596156)
FT                   /locus_tag="KLTH0E06446g"
FT                   /old_locus_tag="KLTH-ORF9423"
FT   CDS_pept        complement(594807..596156)
FT                   /locus_tag="KLTH0E06446g"
FT                   /old_locus_tag="KLTH-ORF9423"
FT                   /product="KLTH0E06446p"
FT                   /note="highly similar to uniprot|P53096 Saccharomyces
FT                   cerevisiae YGL194C HOS2 Histone deacetylase required for
FT                   gene activation via specific deacetylation of lysines in H3
FT                   and H4 histone tails subunit of the Set3 complex a
FT                   meiotic-specific repressor of sporulation specific genes
FT                   that contains deacetylase activity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23323"
FT                   /db_xref="GOA:C5DHR2"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHR2"
FT                   /protein_id="CAR23323.1"
FT                   /translation="MSDTLQFDAKTESLKPRFEFGAPYEPNVSYHFNSDVSQFHYGVRH
FT                   PMKPFRLMLTDHLVSSYGLHKIMDLYETRPATREELCEFHADDYVEFLAKVSPDNLSKL
FT                   PRGTLEKFNIGDDCPIFQGLYQYSTLYAGASLDATRKLINGQSEIAINWSGGLHHAKKS
FT                   SPSGFCYVNDIVLSVLNLLRYHPRVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYNGE
FT                   FFPGTGNLDETGCSRGKHFALNVPLEDGIDDDSYINLFKSIIDPLITSFKPTVIIQQCG
FT                   ADSLGHDRLGCFNLNVKAHGECVRFVKSFGIPMLVLGGGGYTPRNVSRLWTYETALLNG
FT                   VSVPQEIPEDIPFRDWFGPDYTLHPTLDDLYENKNSKKFLENVRIRCLENIRFLQGAPS
FT                   VRMDQEVIPSQDLSALTQEEEDAIKELNEETDRLRLEQMEKDSMRIGELY"
FT   gene            <596870..>598438
FT                   /locus_tag="KLTH0E06468g"
FT                   /old_locus_tag="KLTH-ORF9422"
FT   CDS_pept        596870..598438
FT                   /locus_tag="KLTH0E06468g"
FT                   /old_locus_tag="KLTH-ORF9422"
FT                   /product="KLTH0E06468p"
FT                   /note="similar to uniprot|P41833 Saccharomyces cerevisiae
FT                   YGL192W IME4 Probable mRNA N6-adenosine methyltransferase
FT                   that is required for IME1 transcript accumulation and for
FT                   sporulation expression is induced in starved MATa/MAT alpha
FT                   diploid cells"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06468g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23324"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHR3"
FT                   /protein_id="CAR23324.1"
FT                   /translation="MNMQLITYLIENHAALLNPPISGDLANIYILFASTSKHESAGMKQ
FT                   QEAKLAAFWKELKDIADLCPGCFIFASTGYGSAALSSRDVTVEYIDIQALRMIRDSMIS
FT                   TPAEVARPVRPLGRESSEELALSDRLLSVLDSDAAATPNKRVLAKLEHFLSVKPASYRL
FT                   GHERAQKFTPHSKFIPICGNRSHTNALASIASIAGNRVLSLDWNQLAGADQSTPGLSRC
FT                   VQSKIHHIPNLKPQTDKTLGDCSYLDTCHKLSTCRYMHYLQYVPESLVQSVAARSRELN
FT                   DAESDSKSICLYTRNLCCSVASKSVLPAQWIQCDVRKFDFSVLGQFSVVVADPAWNIRM
FT                   NLPYGTCNDSELTDLPLELLQREGVLFLWVTGRAIEVGKESLRKWGYEVCNQISWVKTN
FT                   QLGRTIVTGRTGHWLNHSKEQLLVGLKGQPEWLNRQCDVDLIVSGSRETSRKPDELYEM
FT                   IERMVGPHARKLEIFGRDHNTRPGWFTIGNQLTGDSLCEPDVQRKYRQFLHTQRTSYGC
FT                   SSVAA"
FT   gene            <599026..>599096
FT                   /locus_tag="KLTH0E06490r"
FT                   /old_locus_tag="Klth0E.tGly.GCC.12"
FT   tRNA            599026..599096
FT                   /locus_tag="KLTH0E06490r"
FT                   /old_locus_tag="Klth0E.tGly.GCC.12"
FT                   /note="tRNA-Gly (GCC) cove score=62.63"
FT   gene            <599391..>599774
FT                   /locus_tag="KLTH0E06512g"
FT                   /old_locus_tag="KLTH-ORF9420"
FT   CDS_pept        599391..599774
FT                   /locus_tag="KLTH0E06512g"
FT                   /old_locus_tag="KLTH-ORF9420"
FT                   /product="KLTH0E06512p"
FT                   /note="similar to uniprot|P32799 Saccharomyces cerevisiae
FT                   YGL191W COX13 Subunit VIa of cytochrome c oxidase which is
FT                   the terminal member of the mitochondrial inner membrane
FT                   electron transport chain not essential for cytochrome c
FT                   oxidase activity but may modulate activity in response to
FT                   ATP"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23325"
FT                   /db_xref="GOA:C5DHR4"
FT                   /db_xref="InterPro:IPR001349"
FT                   /db_xref="InterPro:IPR018507"
FT                   /db_xref="InterPro:IPR036418"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHR4"
FT                   /protein_id="CAR23325.1"
FT                   /translation="MLRQAIRRASSLPPHALKPAYGPGDAAAAKAFKEMAQNTKHHAKE
FT                   TSGLWLKISFFVAAPAIALAAVNTYFVEAEHAEHRKHLKHVPDSEWPAQYDYQNIRSKP
FT                   FFWGDGDKTLFWNPIVNRHVQQE"
FT   gene            complement(<600189..>601571)
FT                   /locus_tag="KLTH0E06534g"
FT                   /old_locus_tag="KLTH-ORF9418"
FT   CDS_pept        complement(600189..601571)
FT                   /locus_tag="KLTH0E06534g"
FT                   /old_locus_tag="KLTH-ORF9418"
FT                   /product="KLTH0E06534p"
FT                   /note="similar to uniprot|Q00362 Saccharomyces cerevisiae
FT                   YGL190C CDC55 Non-essential regulatory subunit B of protein
FT                   phosphatase 2A has multiple roles in mitosis and protein
FT                   biosynthesis found in the nucleus of most cells but also at
FT                   the bud neck (large-budded cells) and at the bud tip
FT                   (small-budded cells)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23326"
FT                   /db_xref="GOA:C5DHR5"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHR5"
FT                   /protein_id="CAR23326.1"
FT                   /translation="MSKNSFDFKFSQCFGDKADIVVTEADIITAVEFDHTGDFLATGDR
FT                   GGRVVLFERNNSKHCEYKFLTEFQSHDAEFDYLKSLEIEEKINQIKWCRPTNQSHFLLS
FT                   TNDKTIKLWKVYEKNIKLVSENNLSENSFARGSTGSGNGSINSSNGNGAAKAVLSLSTL
FT                   KLPKLSQHDKIIAAAPKKIYSNAHTYHINSISINSDQETFISADDLRINLWNLDIPDQS
FT                   FNIVDIKPANMEELTEVITSAEFHPQHCNLFMYSSSKGTIKLADMRQNALCDYRAKTFE
FT                   EYMDPINHNFFTEITSSISDVKFSPDGRYIASRDYLTVKIWDINMGNKPVKTINIQDQL
FT                   KDRLSDTYENDAIFDKFEVSFSGDSSSLMTGSYNNTFMIYPDVVKGKTSTSPPMDEIVL
FT                   QADKTAFKSKKLGSLEQQSARNKEWGDDIDFKKSILHFSWHPRENSVAIAATNNLFIFS
FT                   AL"
FT   gene            complement(<602002..>602361)
FT                   /locus_tag="KLTH0E06556g"
FT                   /old_locus_tag="KLTH-ORF9415"
FT   CDS_pept        complement(602002..602361)
FT                   /locus_tag="KLTH0E06556g"
FT                   /old_locus_tag="KLTH-ORF9415"
FT                   /product="KLTH0E06556p"
FT                   /note="highly similar to uniprot|P39938 Saccharomyces
FT                   cerevisiae YGL189C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23327"
FT                   /db_xref="GOA:C5DHR6"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="InterPro:IPR038551"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHR6"
FT                   /protein_id="CAR23327.1"
FT                   /translation="MPKKRASNGRNKKGRGHVKPVRCVNCSKCVPKDKAIKRMTIRNIV
FT                   EAAAIRDLSEASVYPEYALPKIYNKLHYCVSCAIHARIVRVRSRVDRRVRTPPQRQRFN
FT                   RENRVSPADAAKKAV"
FT   gene            complement(<603270..>603737)
FT                   /locus_tag="KLTH0E06578g"
FT                   /old_locus_tag="KLTH-ORF9414"
FT   CDS_pept        complement(603270..603737)
FT                   /locus_tag="KLTH0E06578g"
FT                   /old_locus_tag="KLTH-ORF9414"
FT                   /product="KLTH0E06578p"
FT                   /note="highly similar to uniprot|P04037 Saccharomyces
FT                   cerevisiae YGL187C COX4 Subunit IV of cytochrome c oxidase
FT                   which is the terminal member of the mitochondrial inner
FT                   membrane electron transport chain N-terminal 25 residues of
FT                   precursor are cleaved during mitochondrial import"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23328"
FT                   /db_xref="GOA:C5DHR7"
FT                   /db_xref="InterPro:IPR002124"
FT                   /db_xref="InterPro:IPR036972"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHR7"
FT                   /protein_id="CAR23328.1"
FT                   /translation="MLSLRQTLRFMSPASRAFSSQRVAFQKQIVKTATKLSEVDGRTTL
FT                   VGPGAKEGEVPTELEQATGLARLELLGKLEGIDVFDTKPLDSSRIGTMENPIIVDTYDD
FT                   YRYVGCTGSPADSHSIMWLKPSVNKVARCWECGSVYKVNPVGVPTDDDHHH"
FT   gene            complement(<604346..>605974)
FT                   /locus_tag="KLTH0E06600g"
FT                   /old_locus_tag="KLTH-ORF9412"
FT   CDS_pept        complement(604346..605974)
FT                   /locus_tag="KLTH0E06600g"
FT                   /old_locus_tag="KLTH-ORF9412"
FT                   /product="KLTH0E06600p"
FT                   /note="similar to uniprot|P53099 Saccharomyces cerevisiae
FT                   YGL186C TPN1 Pyridoxine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23329"
FT                   /db_xref="GOA:C5DHR8"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR030175"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHR8"
FT                   /protein_id="CAR23329.1"
FT                   /translation="MGAEKVEDIVFEEIEKPKTDEGQGVFAKVLTKISAASKRLDAMGV
FT                   EMRGIQRIPGYERGTSKQFLSVAGLWLSAAGGLSSMSSYFLGPLLFELTFRQSLVSGLI
FT                   SMALGCAVAGYLSTMGPQSGCRQMVTARYLFGWYFVKFVSLASIIGVMGWSIVNCVVGG
FT                   QMLAAVSDSKIPLWVGIIIVTAVSFFVAIFGIKQVLRVETFLSVPVLTCFTLLYIAASD
FT                   KFHLLDSFQNGDVDRLTIKGNWLSFFSLCYSITSTWGSITADYYILFPEDTAHYKVFLL
FT                   TFFGTLLPTTFVGVLGLILGSCALSYEPWNEAYGKYGMGGLLYSGFQRWNGFGKFCVVV
FT                   LILSLISNNIINTYSAAFNLQLSSIHMARVPRWIWAILCTIFYLVCALVGRNHFSDILG
FT                   NFLPMIGYWISMYFIILLEENLIFRSHFLHLYTKEFPPQPVEERLSRLMLRDIKNKKVS
FT                   ARKCSYNWEMWNNERVLTHGYAATFAFLVGVGGVALSMAQAYWIGPIARHFGEYGGDLG
FT                   MWVSMGFSGVVYPALRYLELRKFGR"
FT   gene            complement(<606340..>607473)
FT                   /locus_tag="KLTH0E06622g"
FT                   /old_locus_tag="KLTH-ORF9409"
FT   CDS_pept        complement(606340..607473)
FT                   /locus_tag="KLTH0E06622g"
FT                   /old_locus_tag="KLTH-ORF9409"
FT                   /product="KLTH0E06622p"
FT                   /note="similar to uniprot|P53100 Saccharomyces cerevisiae
FT                   YGL185C Putative hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23330"
FT                   /db_xref="GOA:C5DHR9"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHR9"
FT                   /protein_id="CAR23330.1"
FT                   /translation="MSPKPAILFISSPDYSSELYQTTIKNEFQVVHHDFQSSDPQDFLN
FT                   FLHGNFDANSKPLTAIYGGFPSFHPIGGLTEALIEDKLFPKDTIKCIVLCSRGVNGVDI
FT                   PALERNNIKLFNYNDEPDSYSKNNKVLKKAGVVGNDVADCVLWHVLEGYRKLSYQQLHL
FT                   RKTRNTLTSRLAAAGKSPDLNEFAFGHELVSCCVESPRDKKALILGLGSIGKQIALKLH
FT                   YGLGMQIHYAKRTCDSEVPWCYHPLDASIYDKLSQFSTMIVALPGTPETKHLIDKDFLS
FT                   YCSRDLVLVNIGRGSVLEPDAIESALEQGQIRHLGVDVFYNEPEVEEWLTKNTARVSLT
FT                   PHVGSGTKDNFYQSCEFALNNIIEVVLRNSDGYSRVV"
FT   gene            complement(<608116..>609498)
FT                   /locus_tag="KLTH0E06644g"
FT                   /old_locus_tag="KLTH-ORF9407"
FT   CDS_pept        complement(608116..609498)
FT                   /locus_tag="KLTH0E06644g"
FT                   /old_locus_tag="KLTH-ORF9407"
FT                   /product="KLTH0E06644p"
FT                   /note="highly similar to uniprot|P53101 Saccharomyces
FT                   cerevisiae YGL184C STR3 Cystathionine beta-lyase converts
FT                   cystathionine into homocysteine"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06644g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23331"
FT                   /db_xref="GOA:C5DHS0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006238"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHS0"
FT                   /protein_id="CAR23331.1"
FT                   /translation="MSQQSLQTKLVSVVQHVDQHGSSVPPIYQSTTFKIGSLEDDASQP
FT                   YDYTRSGNPTRTVVQHQIGKLYDVDAAQVLAVSSGMTALDVILRALVLTNKSRVPTIIA
FT                   GDDLYGGTQRLLTHLESRNHARVLHVDTANYETFVEVFKQQEHVDCVLLESPTNPLLKV
FT                   ADLPRLTHFIKSANEACLVAIDNTMMSGMLCNPLKFQCDVVYESATKYLNGHHDIMAGI
FT                   VVTQTLKMAQEIYFVINSTGSGLSPFDSWLLVRGLKTLGVRLYQQQHNAMVLAHWLENS
FT                   CGFVGKKGVKGSPRTRFVGLKSHPQFELHKSFNAGPGAVLSFETGSYEHSRRLVSSRKI
FT                   KIWAVTVSFGCVNSLISMPCKMSHAAIDPALRQERDFPEDLVRLCCGIENISDLQNDLL
FT                   EAMIDADIIELRDEGKTIYNKLNGHIATNTIGQGKLPNIYEEFFSQDLVERGSILTSRA
FT                   KL"
FT   gene            <611348..>614188
FT                   /locus_tag="KLTH0E06666g"
FT                   /old_locus_tag="KLTH-ORF9402"
FT   CDS_pept        611348..614188
FT                   /locus_tag="KLTH0E06666g"
FT                   /old_locus_tag="KLTH-ORF9402"
FT                   /product="KLTH0E06666p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23332"
FT                   /db_xref="GOA:C5DHS1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHS1"
FT                   /protein_id="CAR23332.1"
FT                   /translation="MSSKLIPIKDQAALVLEDGKIYKIQHRRQRKILSCVPCHKRKIKC
FT                   TREQPSCSKCLKRNWDCSYFLNDRVSRGGQPTAETRTEGSAQLPTNIVSGKHDPQKKKQ
FT                   LLMAIEKAKSMINDERNLLELNRKQKREYPRRKQAWETDQPVSGTVTPSGGHNQHEYPV
FT                   ASVTSGTSQSTPTISPPMSYSSMQDSPRPLSGENSLPMYLPTRQRAVELFEVYRNTVHP
FT                   IIPLLDFSKFMSDQETFWNEVDQGESGNTDFLLILFPVLYAASKSQFHQCNDNDALFQE
FT                   MASFLEATNVLYGIHDFPNNFTMQMITGSVLINSIIENPSVTTIAQLSRLAQRAMLSRD
FT                   PASYHQITDLGLIQCRRILFWQIFQLDTMTSLYDNLPPLIKVDDFDTALPAEVVRGELD
FT                   PSLCLLNAKYRFVLLLNELCSLTNRGTFQGLKERIVDLHVCCMGSALSLRNYNKENGRL
FT                   TTSDAKFIDWAVFMLNTFADRACLLLHLNIIKTSLPILMKRRRIWKKELDSKPGAPSDP
FT                   ISESGYGQNFLTIQAILNDSGNLTLDHALMGLGDSNSAGLVYDYEDLTNNLIPASLHYL
FT                   DEFLKYHSDDTYSCYNWELLVGNMPINAITFSLKTLALDLNRAQQMGEVLILQNDLRYI
FT                   LLSKAIPVAEMKVDPKTAVCKNCFQLIMLLFRLIIVKYGKAMQLLSDNQLDASKMFYSK
FT                   YDVGNALLTSDRSGVVPQPSVGPMSGSHGSERHSQALNGSPADVDSSRDANRILSITSI
FT                   INSEDLFNDGFSFSGNLIYNNNALDTSYTTSCAQIAPRIMRTLSSAPQNQSGAPNFGEA
FT                   GPQPSQPAEGEANVSTANVYFNPYVHNMPLSPTPALAPLPAMATDYATANALYGNGKPA
FT                   FQSAGAVSNESGSVGRTEPEVQPQPEIEWIRQEVQRHILLLNSDTGEMETIGTGDEYYR
FT                   EFENALLEIICGILSG"
FT   gene            <614548..>615741
FT                   /locus_tag="KLTH0E06688g"
FT                   /old_locus_tag="KLTH-ORF9396"
FT   CDS_pept        614548..615741
FT                   /locus_tag="KLTH0E06688g"
FT                   /old_locus_tag="KLTH-ORF9396"
FT                   /product="KLTH0E06688p"
FT                   /note="weakly similar to uniprot|P39959 Saccharomyces
FT                   cerevisiae YER130C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23333"
FT                   /db_xref="GOA:C5DHS2"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHS2"
FT                   /protein_id="CAR23333.1"
FT                   /translation="MSIYQIQRTMSNDTLVGIYGNSTLNGSKGELNTPTNGDATFNFQI
FT                   IQKPSAGKSIANDLTGNTLAGARSENAQFQDTSPIEEMLNIEDTVGNGLLHRTPQSPGL
FT                   SANNHKRLSISEYNSSKPVYYEYEFFEKGIHRPDEEDDIMVTDDEGLDMFSFPLGKARK
FT                   DSVFSDYGNEMVMNLSPEAMLAQIPAPRQQPQDDNDLSNLSGGDNQQRKKVKDYFKLNL
FT                   FGGSKNEEALIDPDLLEEPQPFLKKKYFWSRKPTIPISSSGSLSMVEPVVNPSELLTSN
FT                   SIDTRYILSNSTAHFSSPENSQAPPELVPEAGVVKKKRLGFPKTRGRKPSPILDASKQF
FT                   ACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVKTHSEGGPL"
FT   gene            complement(<615944..>617051)
FT                   /locus_tag="KLTH0E06710g"
FT                   /old_locus_tag="KLTH.mRNA.264VL.m"
FT   CDS_pept        complement(join(615944..616618,617037..617051))
FT                   /locus_tag="KLTH0E06710g"
FT                   /old_locus_tag="KLTH.mRNA.264VL.m"
FT                   /product="KLTH0E06710p"
FT                   /note="similar to uniprot|P53102 Saccharomyces cerevisiae
FT                   YGL183C MND1 Protein required for recombination and meiotic
FT                   nuclear division"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23334"
FT                   /db_xref="GOA:C5DHS3"
FT                   /db_xref="InterPro:IPR005647"
FT                   /db_xref="InterPro:IPR040453"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHS3"
FT                   /protein_id="CAR23334.1"
FT                   /translation="MPSVPPPKRTTISLAQKKSSILEFFQCEHSVYNIKELEKLIPKKC
FT                   SGVASMLVKDLIQQMIDEDGIISVEKCGNTNIYWCFRNQIITKMSREIDMLNQRIEAAK
FT                   LEISQTKMALDVSTKSSRKESFEVDGAVFSRAEKLEELESLDKAVKHSRSVYDQKSEHT
FT                   WDQAKINAKTEALSAQVAKLDTVTDNIELIVSFLCRRFLMDKRSLQSELGIPEEFLEFT
FT                   NMPQTSK"
FT   gene            <617502..>618557
FT                   /locus_tag="KLTH0E06732g"
FT                   /old_locus_tag="KLTH-ORF9394"
FT   CDS_pept        617502..618557
FT                   /locus_tag="KLTH0E06732g"
FT                   /old_locus_tag="KLTH-ORF9394"
FT                   /product="KLTH0E06732p"
FT                   /note="some similarities with uniprot|P40956 Saccharomyces
FT                   cerevisiae YGL181W GTS1 Contains a zinc- finger in the N-
FT                   terminus and a long Gln-rich region in the C-terminus
FT                   regulates ultradian rhythm cell size cell cycle lifespan
FT                   sporulation heat tolerance and multidrug transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23335"
FT                   /db_xref="GOA:C5DHS4"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHS4"
FT                   /protein_id="CAR23335.1"
FT                   /translation="MRYKGSKAAERELRSILNSSENGNKCGECGSTYPTWCSINLGVFL
FT                   CGRCASVHRKILGHRDDNVYSDVRSLTMDRWSTSDLDDISESGGNRRNKAVWNPQGVPF
FT                   PFDGDEDKGAVESYIREKYVLQKFRNDRDRPVNFDSRTSRSSSRPTTSRGGSSRGSFSE
FT                   RPSTSSSAPVASNPPLPRRPVTNVGPRPAIFDGSDSAMSVPAAGLPAQPAVFDGFVQQY
FT                   VDPATGMVYVDQRQYGMALQQQQQQEQQALQQQQQQQLLLQQQQQQLLQHQQFQAQAQK
FT                   NQLLSLYQRPDLYTSAVEISPSHPQYQELMQMQQLQLQQQQQLQQQQLQMQQQQPQQTF
FT                   AQGQPGFYYSM"
FT   gene            <619163..>621784
FT                   /locus_tag="KLTH0E06754g"
FT                   /old_locus_tag="KLTH-ORF9388"
FT   CDS_pept        619163..621784
FT                   /locus_tag="KLTH0E06754g"
FT                   /old_locus_tag="KLTH-ORF9388"
FT                   /product="KLTH0E06754p"
FT                   /note="similar to uniprot|P53104 Saccharomyces cerevisiae
FT                   YGL180W ATG1 Protein serine/threonine kinase required for
FT                   autophagy and for the cytoplasm-to-vacuole targeting (Cvt)
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23336"
FT                   /db_xref="GOA:C5DHS5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR022708"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHS5"
FT                   /protein_id="CAR23336.1"
FT                   /translation="MSSGGQEEAPKAPIMISDKFVVEKEIGKGSFATVYKGRLAANQDH
FT                   NNDFIAIKAVSRSKLKNKKLLENLEIEIAILKKIKHPHIVGLMDCERTGSDFFLIMEYC
FT                   ALGDLTFLIKKRGGLIEKHPLVRTMFEKYPPPSESHNGLNRVVVVSYLQQLSSALMFLR
FT                   SKNLVHRDIKPQNLLLSTPLVGYDDRETFHKMGYVGIYNLPILKIADFGFARFLPNTSL
FT                   AETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEMCCGRPPFKASNHLELFKKIKRA
FT                   NDVISFPSHCNIEPKMRELICGLLTFDPSQRMGFSEFFGNEIVNEDLSRYEEEHIPDLE
FT                   NKSKDVAESNMFISEYLTKPTKTVFMEPLNEVSNSRIEESKHKPHEAPDTRLKSYASNE
FT                   VEKGAKSDVNSLAVSHAHPRQDASIEREYVMVEKKSVEVNALADEFANLGARGGPSADR
FT                   TQPSAKLQQQTAVPQSAAIRKTSSGGGTTARRPSLVERRLSISSLSPSNALTKALGIAS
FT                   TRLFGSQQNTSLSVSPNYNNQPLLSRQVFHELTENVVLSADHHTNSIKDNDGFDVDIIA
FT                   FLESLAAKAFVIYSFAEVKFSQIVPLPPSSVGDPFSKRSSNGSCAIEEEDEEPETEGNN
FT                   ERVRGGTLESESIMAKMRKRSSSDNVAFDGVMKDLPPWEVQQLCTEALVLYMKALSILA
FT                   KAMQTTSSWWYRSQEKNCSLKLNVLVQWSRDKFNECLERAEFLRLKLPPMDLHSADEST
FT                   IKASQINDSKDGVSKRSSYSELSEPVFLEKLIYDRALEISKTAAKYEMQGEYLNNCELA
FT                   YATSLWMLESILDKDTDSDNIGDFGSWATEALDEADKQMIKKYIDSIANRLRILRRKMN
FT                   HS"
FT   gene            complement(<622147..>625575)
FT                   /locus_tag="KLTH0E06776g"
FT                   /old_locus_tag="KLTH-ORF9385"
FT   CDS_pept        complement(622147..625575)
FT                   /locus_tag="KLTH0E06776g"
FT                   /old_locus_tag="KLTH-ORF9385"
FT                   /product="KLTH0E06776p"
FT                   /note="weakly similar to uniprot|P38990 Saccharomyces
FT                   cerevisiae YER129W PAK1 Upstream kinase for the SNF1
FT                   complex partially redundant function with Elm1p and Tos3p
FT                   members of this family of kinases have functional orthology
FT                   with LKB1 a mammalian kinase associated with Peutz-Jeghers
FT                   cancer-susceptibility syndrome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23337"
FT                   /db_xref="GOA:C5DHS6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHS6"
FT                   /protein_id="CAR23337.1"
FT                   /translation="MGTHSHGNEEVDIPPNLQSKLNALLGHGAGVQLSKLHAEATDESS
FT                   ATSSADSLNLLLERQQQRQLNHPMHQEHIAASPAVAAATAAAAAVPPRKVKETTKISLE
FT                   YDPISKRKVLNTYEIIGELGHGQHGKVKLARDLVTKQLVAIKIVDRNGGKSNRFSFKKR
FT                   ASGSDKIKREIAIMKKCHHEHVVKLIEVLDDSTSRKIYLVLEYCSNGEVKWCPGDQLET
FT                   EARGPPLLTFQRAREIFRGVVLGLEYLHYQGIIHRDIKPANLLISGSGTVKISDFGVSF
FT                   AASNTEGGYGSLDELELAKTAGTPAFFAPEICLGHEASEKFSSGQPAERKGLMISHKID
FT                   IWAIGVTLHCLLFGMLPFFSEFELELFDKIINENLALKPYADMASNGVSQISCVEEYNA
FT                   AKDLLEKLLTKNPFERIDIPGIKRHPFVCWDFESTSDSASELSVDKLMEKLKFQRPQGE
FT                   EYQQISISAHELNNAVCGIGNKLKRSALESMNISQKSDNDSSRTLTNFDKNGNNSNDFH
FT                   DQFNDSIGDPIRFANSHIKTNTSAQASNGNLILSEGALMDPDNGEDGLSAREIFQQELQ
FT                   RFDSKRDSSAIVSLPVNSSFASLDSFYIDTYAGHQTAGETYSNSSSPLYERSSPTIFAR
FT                   PPPVYAGAKGASARLASYHNNPNASARNPHLNPRPIASSQLSYRSATIPSASNDRQIRP
FT                   QARAPAAIGIGPRQGSGGDGSSRAAVRSKIVPRSLHPSTSQPPASKALDGGYHNGFLHG
FT                   GDNESSRERFGNKPSAHVGPRRGNFFSNYDGSDEEDGYSTTSGTSSSYRNSGDSYSDEF
FT                   QSETESLPFEFGIDSEHGSTVSLRDLAPVVAVPSFTERPTRNEPGGPKDADADDELMLN
FT                   VGMSGHNRRQGSVSSASSSQRANRFKATNFPHSFAPPKFKTEIFEPIPEPKRYPSGSAS
FT                   TLTAENNGAILGTVMNFNQDTAEIAPDAEGFILDGNTDASVDVPVDVLNMIPELRASEV
FT                   SEPSNNAHSFRDFTGGASTNWRSSASKSNPGPLVLPSKNPVATTQQSTVKPVLNTHSQT
FT                   DNSRVTSKDLLQSVLTSSGSSRRPSMTPSRDNSRRETNTNSYVNHYEGKRETKYDSKTR
FT                   PGRKPTQNRGLEGRYRSKSISVGLLEEGRQAGKSS"
FT   gene            complement(<626004..>626624)
FT                   /locus_tag="KLTH0E06798g"
FT                   /old_locus_tag="KLTH-ORF9377"
FT   CDS_pept        complement(626004..626624)
FT                   /locus_tag="KLTH0E06798g"
FT                   /old_locus_tag="KLTH-ORF9377"
FT                   /product="KLTH0E06798p"
FT                   /note="similar to uniprot|P40080 Saccharomyces cerevisiae
FT                   YER128W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23338"
FT                   /db_xref="InterPro:IPR013640"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHS7"
FT                   /protein_id="CAR23338.1"
FT                   /translation="MQNQYTKRKVAPRDARSCLVCLKPTACVLYNASIQDWFHCCELHL
FT                   QDNPQFAKPVYPAGYQDALGQLAELKRTLDAQRVHGSGSWDTWVNKLISRKPKSENDKD
FT                   KEPGKEPSKDPDEEPGKGSDKEPSPAGDDAACAYQQALDRVARYRKNLRTYSLSQIMFE
FT                   SRLEAQKRAEALKQRRQREQEAYTNTDPDELQAKFAFPSVPRP"
FT   gene            complement(<626764..>627882)
FT                   /locus_tag="KLTH0E06820g"
FT                   /old_locus_tag="KLTH-ORF9373"
FT   CDS_pept        complement(626764..627882)
FT                   /locus_tag="KLTH0E06820g"
FT                   /old_locus_tag="KLTH-ORF9373"
FT                   /product="KLTH0E06820p"
FT                   /note="similar to uniprot|P40079 Saccharomyces cerevisiae
FT                   YER127W LCP5 Essential protein involved in maturation of
FT                   18S rRNA depletion leads to inhibited pre- rRNA processing
FT                   and reduced polysome levels localizes primarily to the
FT                   nucleolus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23339"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHS8"
FT                   /protein_id="CAR23339.1"
FT                   /translation="MSELGDVLREINASLAATSESLDSARRQEASAAHATGAARELSGG
FT                   RELEKVSLLTLKNASLLAYVNSLMVVVGEKLGRTDASAKSGRAQSVEHRVVLERGVRPL
FT                   EKKLAYQLDKLVRAYTRMEGEYEAAEKRALAAQDEAAAGRDSGDGASGDEAARGGRSRA
FT                   NADDDADEGSNSDDSDSDSETEAQAFRPNAAGLIGRSARDKHTAGAAPAAGTDDAPAEA
FT                   YKPPRISAALPPQHHFEDKFDAQQHRDRSGKNRMQAMEEYVREVSEQPDWEASVGANIV
FT                   DHGKGGVKTLRDTQREQRIKDYEEDNFTRVNVKGNKAERRRAKQKERAARANMLGGEDF
FT                   SIFNSKRRLEDSTSRSAAKRPRSAWDRAKNRL"
FT   gene            <628153..>628938
FT                   /locus_tag="KLTH0E06842g"
FT                   /old_locus_tag="KLTH-ORF9366"
FT   CDS_pept        628153..628938
FT                   /locus_tag="KLTH0E06842g"
FT                   /old_locus_tag="KLTH-ORF9366"
FT                   /product="KLTH0E06842p"
FT                   /note="highly similar to uniprot|P40078 Saccharomyces
FT                   cerevisiae YER126C NSA2 Constituent of 66S pre-ribosomal
FT                   particles involved in 60S ribosomal subunit biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23340"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="InterPro:IPR039411"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHS9"
FT                   /protein_id="CAR23340.1"
FT                   /translation="MPQNEYIEQHIKQHGRRLDHDERKRKREARESHKVAERAQKLTGW
FT                   KGKQFAKKRYAEKVAMRKKIKAHEESKAKGSGKPLEESGEALPTYLLEREQANSAKAIS
FT                   SSIKQKRLEKADKFSVPLPKVRGISEEEMFKVVKTGKSRSKSWKRMITKHTFVGDGFTR
FT                   RPVKTERIIRPSALRQKKANVTHPELGVTVFLPILAVKKNPQSPMYTQLGVLTKGTIIE
FT                   VNVSELGMVTSGGKVVWGKYAQITNEPDRDGCVNAVLLV"
FT   gene            <630263..>632461
FT                   /locus_tag="KLTH0E06864g"
FT                   /old_locus_tag="KLTH-ORF9356"
FT   CDS_pept        630263..632461
FT                   /locus_tag="KLTH0E06864g"
FT                   /old_locus_tag="KLTH-ORF9356"
FT                   /product="KLTH0E06864p"
FT                   /note="weakly similar to uniprot|P39016 Saccharomyces
FT                   cerevisiae YGL178W MPT5 Protein that specifically binds to
FT                   mRNAs encoding chromatin modifiers and spindle pole body
FT                   components has roles in longevity in maintenance of cell
FT                   wall integrity and in sensitivity to and recovery from
FT                   pheromone arrest"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23341"
FT                   /db_xref="GOA:C5DHT0"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHT0"
FT                   /protein_id="CAR23341.1"
FT                   /translation="MHQPQLSINSVQSLVEPTTPPLGQMTQRQNHQRTHSLDLSGFNQF
FT                   MQGNSPMMPLSLSPPTPPPPAAAAAASASASATTAGRPKLQSLPLISELDLLADGRGPR
FT                   APIPTGAPARTVSGSTTSSSASASAVRTHARSGSQPSALLLPNAGAAGAAGATGVPADL
FT                   SWTPLDELDYVKVATDQFGCRFLQKKLENPQECCAVRDLMYRHIKPYFLDLILDPFGNY
FT                   LIQKLCEYLTTDQKTQLVESIYPHVFQISINQYGTRSLQKVIDTVDTDAQVDLIISGFG
FT                   QNFTSIEQVVVLINDLNGNHVVQKCIFKFPPSKFGFIIDAIVDNNNIVKISTHKHGCCV
FT                   LQKLLSVCTLQQIFKISVKIVQFLRSLINDQFGNYIIQFLLDIKELDFYLLGEIYDKLS
FT                   GELCQLSCLKFSSNVVEKFIKKLFTILKLALSAAPPARNSAVSEDVVAIAMKILLNVID
FT                   VFTVNLNILIRDNYGNYALQTLLDVKNYTKLLQYPSNTYVHTSAQTLSFSHEFTVKVGN
FT                   LVVLTKEMLPSIKTTSYAKKIKLKVKAYAELTGLVFAEAPSSNKAATPGANANNHRRQH
FT                   ARHCSLPANAYRHRRNSSSISLSSGFPLPQPPQQQQHQPFGYANPLVNSSLFANANATQ
FT                   LGPHNFYSDPQRPFLYNQHPEASLPFNNSFGNAPSAAVPPNHFAYHDPRVLQMSGAQEN
FT                   NHNFAPTAKPLPSKPAETENLYARGGDFENVNYGNIFY"
FT   gene            complement(<632946..>634457)
FT                   /locus_tag="KLTH0E06886g"
FT                   /old_locus_tag="KLTH-ORF9350"
FT   CDS_pept        complement(632946..634457)
FT                   /locus_tag="KLTH0E06886g"
FT                   /old_locus_tag="KLTH-ORF9350"
FT                   /product="KLTH0E06886p"
FT                   /note="some similarities with uniprot|P46945 Saccharomyces
FT                   cerevisiae YGL176C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23342"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHT1"
FT                   /protein_id="CAR23342.1"
FT                   /translation="MANALNIPGFYFDPEKNRYFKVTTQSVTHADQKYGREKIRDDQEK
FT                   SRHKNEQAQICEIRGKRLHEVEFRLMNPLVRAFPEELAKYCLSDGGVNFDSYQALSNTY
FT                   AVFKHGEEIEDFEYVEKRGFWSDVTPTIGAVPQKAKFITLLPCSNAAIVVTNYLCVLLV
FT                   ELQGGARYIHRRDLAAGAESEVVAVHLRGNSLCIFGKPINQTDTAFIVINLSNEPPLLT
FT                   HTFHYSGRKHEILDAIANDSEQVFLAQKNVLVASTTSDRKTTAPRWHTLYKAKSDIMSL
FT                   EMDYTSSTFQSIPTRGWLGTRNGEVYQWKNSLENKNSSAKLIYPLRDLSVLSLKGINDD
FT                   YLLVSLVGKQAQVLYILPKKAHKLTSRRHPAVLSLRTTFRNFSKETEIIEASSDGRFVI
FT                   YGHVGDISSGGGFEVFSTLASDNLANKRHPDTVTPVYFPLRTMHQCFPPSTLDSVRSLL
FT                   RVELHDVQKGNLYFGQMSSKDGIAVSLLTEDFDTAGISMRNSRLL"
FT   gene            complement(<634745..>637120)
FT                   /locus_tag="KLTH0E06908g"
FT                   /old_locus_tag="KLTH-ORF9349"
FT   CDS_pept        complement(634745..637120)
FT                   /locus_tag="KLTH0E06908g"
FT                   /old_locus_tag="KLTH-ORF9349"
FT                   /product="KLTH0E06908p"
FT                   /note="highly similar to uniprot|P39940 Saccharomyces
FT                   cerevisiae YER125W RSP5 Ubiquitin-protein ligase involved
FT                   in ubiquitin-mediated protein degradation plays a role in
FT                   heat shock element (HSE)-mediated gene expression and
FT                   multivesicular body sorting contains a hect (homologous to
FT                   E6-AP carboxyl terminus) domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06908g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23343"
FT                   /db_xref="GOA:C5DHT2"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR024928"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHT2"
FT                   /protein_id="CAR23343.1"
FT                   /translation="MSKITVKLVAAESLYKRDVFRSPDPFSVLTIDGSQTKSTAAARKT
FT                   LNPYWNETFTFTGVNENGILTIQVFDQKKFKKKDQGFLGVVNVRIGDVLGHLDEDSINR
FT                   GARREETITRDLKRSNDGMAVSGRLILVLSTAPSGAHTSSHTASSSAQASDESRAHAST
FT                   HAASSNSTSTPAQTVANTLQSGTTSAPITAAAASSRQYSSFEDQYGRLPPGWERRTDNF
FT                   GRTYYVDHNTRTTTWKRPTLDQTETERGDQLNANTELERRQHRGRTLPGGGNSESGSSI
FT                   AVQSNTGSSTPTVNGTAAAALAATGATTSGLGELPPGWEQRFTPEGRAYFVDHNTRTTT
FT                   WVDPRRQQYIRTYGPANTTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDD
FT                   PRLPSSLDQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQEIMRQT
FT                   PEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSAHDNYTIQINPKS
FT                   GINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLHKKVVLQDMEGVDAEVYNS
FT                   LKWILENSIDGILDLTFSADDETFGEVVTVDLKPDGRNIEVTDENKKEYVELFTQWKTC
FT                   SRVQEQFKAFMDGFNELIPEDLVNVFDERELELLIGGIAEIDVEDWKKHTDYRGYQESD
FT                   ETVKWFWKAISEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQL
FT                   PKSHTCFNRVDLPPYGDYETLKQKLTLAVEETIGFGQE"
FT   gene            <637945..>639609
FT                   /locus_tag="KLTH0E06930g"
FT                   /old_locus_tag="KLTH-ORF9345"
FT   CDS_pept        637945..639609
FT                   /locus_tag="KLTH0E06930g"
FT                   /old_locus_tag="KLTH-ORF9345"
FT                   /product="KLTH0E06930p"
FT                   /note="similar to uniprot|P40077 Saccharomyces cerevisiae
FT                   YER124C DSE1 Daughter cell-specific protein may participate
FT                   in pathways regulating cell wall metabolism deletion
FT                   affects cell separation after division and sensitivity to
FT                   drugs targeted against the cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23344"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHT3"
FT                   /protein_id="CAR23344.1"
FT                   /translation="MPEEFYTPPGIFRQPAIHFRRDETKPRFPALNTHKKSWQNDTARM
FT                   KSPLLRKASGDMNDFYTTTQLRSEFWSLSQLSGTASFSTSLSSCDNVILTSNMGTKDNL
FT                   RMFKLSTINADYRESVRLTELQSISIPGKSVTASCLLPRSFTNSKQGPNHDRLLLAGQQ
FT                   DGVVNLISTSEFHGDAKIIKRFNHGKYLRSTQSDSLDSWLKAKRSTPIKQVIAWDSKGF
FT                   ASIINESLFIYDTNQHRLPLYLQSFDGLEAMDSNPYNNQLLALAGSRFGTSGLSLLDLR
FT                   SGCGYGNLYSPDPESSGHPGVSTNCIWLDEYTVANTIASSVKLWDIRTPGTKCIINGHK
FT                   GFVEALKYDSVNQRLFSSDDQGYTIAWDLKDLKNAKECHLATGLQSIGEKDVADVRQCG
FT                   NVVVIPDSLRSSTTTSSNDTLGSGISSFTFLDTLPDGSLLTLDSKEIGLHSINDVERPF
FT                   IPPRNPRRLLSKPELENPETDATLHEDYANSTWEDTSDATVEGDEFTTPKKGQLSPVLI
FT                   QEKLHKTQNPSIYSLKDLELSGSTIYNERIVHDGLIV"
FT   gene            complement(<639783..>641045)
FT                   /locus_tag="KLTH0E06952g"
FT                   /old_locus_tag="KLTH-ORF9344"
FT   CDS_pept        complement(639783..641045)
FT                   /locus_tag="KLTH0E06952g"
FT                   /old_locus_tag="KLTH-ORF9344"
FT                   /product="KLTH0E06952p"
FT                   /note="some similarities with uniprot|P39962 Saccharomyces
FT                   cerevisiae YER123W YCK3 plasma membrane- bound casein
FT                   kinase I homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23345"
FT                   /db_xref="GOA:C5DHT4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHT4"
FT                   /protein_id="CAR23345.1"
FT                   /translation="MSGRSQHIVGIHYAVGPKIGEGSFGVIFEGENVLNNSSSPVAIKF
FT                   EPRRTEAPQLRDEFRAYKILNGLEGIPKAYYFGQEGMHNVLIIDLLGPSLEDLFEWCGR
FT                   RFSVRTTCLLARQMIRRVQSIHERDLIYRDIKPDNFLVAEYQRKLPNGQLVKNCAASAH
FT                   GDSNMVYVVDFGMAKQYRDPKTKQHIPYKERKSLSGTARYMSINTHFGREQSRRDDLES
FT                   LGHVFFYFLRGFLPWQGLKVANTKLKYEKIGLTKQKVRPEDLLEPNIPSQFAAYLSYCR
FT                   SLRFEQEPDYDFLVSLMDQALQEQGYDDDEHYDWQDLNQGQGWNIGINRRANLHGYGNP
FT                   TPKTSQARKSAPRVHRDSFSKAQRLRSQMNNQAGNRDKGGNVVQAYDSMGNRRGNFSGR
FT                   QQNDADSIEEQGCFAKLCCWC"
FT   gene            <642495..>643370
FT                   /locus_tag="KLTH0E06974g"
FT                   /old_locus_tag="KLTH-ORF9340"
FT   CDS_pept        642495..643370
FT                   /locus_tag="KLTH0E06974g"
FT                   /old_locus_tag="KLTH-ORF9340"
FT                   /product="KLTH0E06974p"
FT                   /note="some similarities with uniprot|Q12432 Saccharomyces
FT                   cerevisiae YPR023C EAF3 Esa1p-associated factor
FT                   nonessential component of the NuA4 acetyltransferase
FT                   complex homologous to Drosophila dosage compensation
FT                   protein MSL3"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23346"
FT                   /db_xref="GOA:C5DHT5"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008676"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR025995"
FT                   /db_xref="InterPro:IPR026541"
FT                   /db_xref="InterPro:IPR038217"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHT5"
FT                   /protein_id="CAR23346.1"
FT                   /translation="MPLSVDDKCLAFHGPLLYAAKVLKVHDPSNGGDDDEEIPPHLKDQ
FT                   QCFYIHYRGWKSSWDEWVGHDRIREYTEENLELKKQLVQETKEASNAKKKAVSKPKKIE
FT                   AKKKRSAATALQEEALPTGPRITIHISHTLKSILVDDWERITKDKKLIELPCKSTVAEV
FT                   LNDYYEEASAKEISPVTQSQLKEYCDGIKLYFDCSLSAILLYRFERLQYANEAADGPAS
FT                   SIYGAIHLLRLLSSLPELVSLTAMDERGCDVVVQQTDKLLKWLTERKTLFEESNYINTS
FT                   SQYEGMALGM"
FT   gene            <644098..>646746
FT                   /locus_tag="KLTH0E06996g"
FT                   /old_locus_tag="KLTH-ORF9337"
FT   CDS_pept        644098..646746
FT                   /locus_tag="KLTH0E06996g"
FT                   /old_locus_tag="KLTH-ORF9337"
FT                   /product="KLTH0E06996p"
FT                   /note="similar to uniprot|Q12482 Saccharomyces cerevisiae
FT                   YPR021C AGC1 Mitochondrial transporter acts both as a
FT                   glutamate uniporter and as an aspartate- glutamate
FT                   exchanger involved in nitrogen metabolism ornithine
FT                   synthesis and the malate-aspartate NADH shuttle"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23347"
FT                   /db_xref="GOA:C5DHT6"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHT6"
FT                   /protein_id="CAR23347.1"
FT                   /translation="MELSNSITEKKNQQVEIFQKFATELKRGDSGDSSKLVLTFNDFID
FT                   LISSSRSLYSRFTDHSYNLNQIPDKAFGCIFFAVDENNKGYLTLNDWFHFNNLLECNNY
FT                   HLIILYEFFRKFDVANLKRKAASIENSSPSAINIANNPRIRPPNYGSKFLSFDSLYLDL
FT                   TQFKSTIKFLQECVDNEFITANNLFLNWDEFRWLKFYQSFPYGLREGSHINLNSLVTIL
FT                   QNDLKNEKLFMGFDRLSHTNHKNHSLVLNKNQLVYLLKVFYSHRISADVFNSLDLSNTK
FT                   MIKSNNNYINYNVFKDIFYLFQNFDLLNQVFMRYAKTHNFDDQDLRECYISKEDLTHFL
FT                   SVEYNKVNNITEFSPSQISLLFSIVANSKRNKLIEKSLNTHHEDSTIERFIQTDFCHGM
FT                   SPKNQELKEFNNNYREVIGGMSGELDTAKNRRQTTKAGLIDRILKSKETDETWLEFNLT
FT                   MEDFMKILNPNYLNDLVHQMEIRRIQSESLYTNFYFFPIFDSIYNFLLGSVAGCIGATA
FT                   VYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGVRGIYSGLGPQLVGVAPEKAIKLT
FT                   VNDYVRKMLMDSNNHLTLPLEILSGASAGACQVIFTNPLEIVKIRLQVRSEYAESISRS
FT                   QVNAFGIVKSLGLRGLYRGIGACLMRDVPFSAIYFPTYAHLKKDIFNYDPQDKNGRTRL
FT                   RTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETKYNGIWHAAKTILKEERFKS
FT                   FFKGGGARVLRSSPQFGFTLAAYEIFQNLFPLKHSEVNNTKQDDDTPIVTGMFSSFLES
FT                   LKKSSNQNVEITEFFGPSVDPYSSNYLNYYYKSCQVAKLFIDLDYNFAKFDFGVYSKFH
FT                   KFVKDAESPSK"
FT   gene            complement(<646863..>647951)
FT                   /locus_tag="KLTH0E07018g"
FT                   /old_locus_tag="KLTH-ORF9334"
FT   CDS_pept        complement(646863..647951)
FT                   /locus_tag="KLTH0E07018g"
FT                   /old_locus_tag="KLTH-ORF9334"
FT                   /product="KLTH0E07018p"
FT                   /note="weakly similar to uniprot|P46946 Saccharomyces
FT                   cerevisiae YGL175C SAE2 Protein with a role in accurate
FT                   meiotic and mitotic double-strand break repair
FT                   phosphorylated in response to DNA damage and required for
FT                   normal resistance to DNA-damaging agents"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23348"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHT7"
FT                   /protein_id="CAR23348.1"
FT                   /translation="MEATTRDSPNETELFKTIIEGWDLSQLLKLQVDLAKEIQRRVSGQ
FT                   QNQAADTATKTETQRAKIGGHQQLGQNQPELKYENERSDEFSLKNFTRKSLDKGDDEKA
FT                   TSEAKSSQIGPLDEVSIPGTLDMQVKEIDFSSPLKATDQPNATLQKFSPIKRPLAVISD
FT                   SEGEIEWSETENSDANFSGSKKQRGEASKLDFNTNPATKKPWIFEDFMANETSASSRKI
FT                   HSNYESAKVSKFRSAVGQPISNQKLVLHPDRGFEMVEESLREADKAFEGEVQFDNLRQR
FT                   SDSPPGFGRLDFPNTQESLIDRMKSREILYNKTKARFLEAVRSDLRPDERLFLFRNPSL
FT                   NEAVNSEDFQWNQSTLDIFSRE"
FT   gene            <648078..>648899
FT                   /locus_tag="KLTH0E07040g"
FT                   /old_locus_tag="KLTH-ORF9333"
FT   CDS_pept        648078..648899
FT                   /locus_tag="KLTH0E07040g"
FT                   /old_locus_tag="KLTH-ORF9333"
FT                   /product="KLTH0E07040p"
FT                   /note="weakly similar to uniprot|P46947 Saccharomyces
FT                   cerevisiae YGL174W BUD13 Protein involved in bud-site
FT                   selection diploid mutants display a unipolar budding
FT                   pattern instead of the wild-type bipolar pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23349"
FT                   /db_xref="InterPro:IPR018609"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHT8"
FT                   /protein_id="CAR23349.1"
FT                   /translation="MSLNEYLRKNYGSNKAKKEKKQKSKPTSNSSLKILDSSSDVMFDN
FT                   STGAINQRSADASTQTQKKNLWKNLSTNEVVARNPNAEMPSPDVTQEAPKMSSGALAGL
FT                   QTAAAVEEQIAAQELKQKKEAGLSRENKHTIHRDSKGRRIENYENFVSSKKRDQELEDQ
FT                   RRQREIRELNMGEVQKHALQRNPTEDAEKRDMDFMDPLDAFEMKNPKLVTRRSLLGRKL
FT                   YDKISPENRFGIEPGWRWDGVDRSNGFERKWFAKQLELNEKKAYAQSLGDT"
FT   gene            complement(<648999..>653489)
FT                   /locus_tag="KLTH0E07062g"
FT                   /old_locus_tag="KLTH-ORF9330"
FT   CDS_pept        complement(648999..653489)
FT                   /locus_tag="KLTH0E07062g"
FT                   /old_locus_tag="KLTH-ORF9330"
FT                   /product="KLTH0E07062p"
FT                   /note="similar to uniprot|P22147 Saccharomyces cerevisiae
FT                   YGL173C KEM1 5'-3' exonuclease involved in mRNA decay
FT                   evolutionarily conserved component of cytoplasmic
FT                   processing (P) bodies plays a role in microtubule-mediated
FT                   processes filamentous growth and ribosomal RNA maturation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23350"
FT                   /db_xref="GOA:C5DHT9"
FT                   /db_xref="InterPro:IPR004859"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR016494"
FT                   /db_xref="InterPro:IPR027073"
FT                   /db_xref="InterPro:IPR040486"
FT                   /db_xref="InterPro:IPR040992"
FT                   /db_xref="InterPro:IPR041106"
FT                   /db_xref="InterPro:IPR041385"
FT                   /db_xref="InterPro:IPR041412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHT9"
FT                   /protein_id="CAR23350.1"
FT                   /translation="MGIPKFFRYISERWPMISQLIDGTQIPEFDNLYLDMNSILHTCTH
FT                   ANDDDVKKRMSEEEVFSKIFAYIDHLFHTIGPKQTFYMAIDGVAPRAKMNQQRARRFRT
FT                   AMDAEKALEKAIRDGEEIPKGEPFDSNSITPGTEFMAKLTENLKYFIHDKISNDSAWSS
FT                   TSIILSGHEVPGEGEHKIMEYIRRMRAQPDYNANTRHCIYGLDADLIMLGLSTHDPHFA
FT                   LLREEVTFGRRQKAAPLEYQNFYLLHISMLREYLELEFREIADDLQFEYDFERILDDFI
FT                   LVMFVIGNDFLPNLPDLHLNKGAFPVLLQTFKEALKHTDGYINEQGTINLSRFQVWLQY
FT                   LSEFEMMNFEREDIDVEWFNKQLENISLEGERKRARVGKKLLLKQQKKIVGMIKPWLLK
FT                   TASHPLDVNNISEDQIPTLTLGDEIIKENLSFLKEVAFDLGLFVAHSQSKDNYFLQLDV
FT                   DGINPHESQEERDQRIMSLRKSIKKYEQAILVEDSEELEEEQKIYNERFEKWRDQYYRE
FT                   KLGFSYYDEDKLRELTETYVEGLQWVLFYYYRGCQSWSWYYKYHYAPRISDVYKGLNQS
FT                   IKFNLGKPFRPFQQLMAVLPERSKNLIPTVYRPLMYDPKSPIADFYPSEVELDKNGKTA
FT                   DWEAVVKLSFVDENRLIEAMAPYDEKLTPEEKRRNSFGTDLAFVFNPQVDDVYKSPLSG
FT                   IFSDIEHNHCTEREFVPDSMEGLDFLFGLPTGAKLGVEALAGFPTLKTLAFDNKLDYNG
FT                   CMIFQQPSRQQSMLLSIRDAYKAGNLTLDEVAKTHLGKVIYTRWPNLRESKLLSITDGK
FT                   TTFEASEYTDARGIHHIKISQKQTEEAERKLFNSQKSSMMRTYSINRGVILDNIRAIVK
FT                   VVPVNGLTRTIEGAYTKTFSPVEEYYPLQLVVEDVENKDERFMERPPLPIDEEFPQGSD
FT                   VIFLGDYAYGGKATIDGYSSPTRLKLTVEKSVTKSEPNVGKVRAKLDEKMIRYYPSFVV
FT                   AKKLQIHPLFLSRITSKFLVSGLKDKSVDFGLKIKFESRHEKVLGYARRNVRGWEYSDM
FT                   TVALLSEYKRNFPDLFSKLSDAGRDVPSISKLYPGVDANDLRKLIDDVSSWLKNVRQNF
FT                   VTVSLESDSLTKASMIAVEDAIEKYVTNPVDVSKKQLAKVPREAVLDPKESFSLLRTQK
FT                   FDLGDRVIYIQDSGKVPLFSKGTVVGYTTIGPKLSIQVLFDHEIVAGNNFGGRLRTKRG
FT                   LGLDSSFLLNLSNRQFIYHSKASKSAKETGKNNGKAPKKNSEKGGHAKSATPPTEDLKK
FT                   KQAHELLTHIQKKEPSSGNKENSDTNTSQGRDANKVNPQVGSQDDRVIANNIYNAVFNQ
FT                   FSGPGTAAPPQQFPHGLPYNAHASGAVPPQFVGNFAPPGYYPMPPQAGIPIMSPVMNGQ
FT                   GQQIPVNALGTQQVAELLKKRDGASPEMNFAAPNGENFEPADHNGHGLPSRGRGYSGRG
FT                   RGSGRGRGRGRGSGRGRGSFRGRGSDRSGVIAAEQ"
FT   gene            <653966..>655573
FT                   /locus_tag="KLTH0E07084g"
FT                   /old_locus_tag="KLTH-ORF9326"
FT   CDS_pept        653966..655573
FT                   /locus_tag="KLTH0E07084g"
FT                   /old_locus_tag="KLTH-ORF9326"
FT                   /product="KLTH0E07084p"
FT                   /note="weakly similar to uniprot|Q02199 Saccharomyces
FT                   cerevisiae YGL172W NUP49 Subunit of the Nsp1p-Nup57p-
FT                   Nup49p-Nic96p subcomplex of the nuclear pore complex (NPC)
FT                   required for nuclear export of ribosomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23351"
FT                   /db_xref="GOA:C5DHU0"
FT                   /db_xref="InterPro:IPR024864"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="InterPro:IPR039079"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHU0"
FT                   /protein_id="CAR23351.1"
FT                   /translation="MFNFGRAASASAANTSGSGGMFGQSSNAAPGGGLFGNSNNTQQQG
FT                   ISGFGQNNTTQSSSGGLFGQNNQQQQTGGLFGQNKPATGGLFGQSNQPTQQQGQTGGGL
FT                   FGQPNQQQQQQQQQPGGLFGQNSQPQQSGGGLFGQSGQQSQQTGGGLFGGSSSATTGTS
FT                   NGLFGQAGSSNTSNFGSNTNPTQGRGGLFGQNQNTSAGASGGLFGNKPAAPGGLFGSNN
FT                   AGSNTNGASSFGNNSASNTTGGLFGNKPAGSTSLFGNNTNNKTGLFGNNNSTNPSGSLF
FT                   GNKPATSSLFGGNNNGPSGLFGNQQPQPQLQSQPALQSLSQLPLTPMTRVVDLPPQIRQ
FT                   EIEQLDQYIQRQVAISQHLKADTEDHTGLIQSIPRDIKYLQTTHSLTHQSLAHDLRKIT
FT                   GIKEITDQNIADSQTFSIILQQLITPGNKISSLELDKFFQEKIQLYKSRLDEYFYVLSD
FT                   IESAVHGIERDMLGVTSTDGSQDTSKDNTSWKTGINAIVSTVLEEFELFMDMAERIAEL
FT                   HQKVKEVTGNYKNTLIKA"
FT   gene            <656129..>657211
FT                   /locus_tag="KLTH0E07106g"
FT                   /old_locus_tag="KLTH-ORF9321"
FT   CDS_pept        656129..657211
FT                   /locus_tag="KLTH0E07106g"
FT                   /old_locus_tag="KLTH-ORF9321"
FT                   /product="KLTH0E07106p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23352"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHU1"
FT                   /protein_id="CAR23352.1"
FT                   /translation="MPDMKKKSDKNDKIWNVVSFDRESRVQPQPQVSVELVTEEGLCDD
FT                   ILSNASSDESELPASPLKQSNTELSFGTLVGRNEDEDDFAAPERQEECSAPKTGSSLLR
FT                   AITTLKTWHVVVLTSSTTLFLTYVVQSFLYNQATELGNETATVPYFTDHGASYRNVDFV
FT                   LPFGDISENTSKFIVDFENRVAIPILAEVSPWQATKFQVNQKAACYWKGFKSFCNEHAE
FT                   TLSERFSGAGNALKNTLRRSGSLFAGRLGELAANFEPVKASASALGERLVQNYKDCDAY
FT                   YRNNFPMCGRYIRGKAHGLVGNTRSLPRRLGALKPTLGANLRKALSTSDRIVQKADLYV
FT                   LSRWNNTIEMLRFKKKNIIP"
FT   gene            complement(<657986..>660064)
FT                   /locus_tag="KLTH0E07128g"
FT                   /old_locus_tag="KLTH-ORF9318"
FT   CDS_pept        complement(657986..660064)
FT                   /locus_tag="KLTH0E07128g"
FT                   /old_locus_tag="KLTH-ORF9318"
FT                   /product="KLTH0E07128p"
FT                   /note="similar to uniprot|P32350 Saccharomyces cerevisiae
FT                   YLL019C KNS1 Nonessential putative protein kinase of
FT                   unknown cellular role member of the LAMMER family of
FT                   protein kinases which are serine/threonine kinases also
FT                   capable of phosphorylating tyrosine residues"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23353"
FT                   /db_xref="GOA:C5DHU2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHU2"
FT                   /protein_id="CAR23353.1"
FT                   /translation="MSQHAQVKRKRTRTLDAAPQAMGVASGVSPGMPQGMFLDNDADPV
FT                   IGEMLARQSALLQGNLIDTHFSDEPAPRALPQSTLGFHSFTDARDDTEQDDDLIFVKEQ
FT                   PVGGPSSSSAVALDQPQFDHHYTAKKFKKQRTISLPQLPYAKLLYEARGTVPHRQNDDD
FT                   LLHLSGSSTKTIDGNRAVTLNVVRSVSPLTSQDHAPVLKRMAAAPKISKLVPSRKKKKK
FT                   FFQTDKEGHYVFQQNDVFCNNRFIVKELLGQGTFGKVVQCVDTAPPVSPHVSDFQPFED
FT                   PFAESFEDSHFDLDYGHSQSNDSQPRLVAVKIIRAVDRYREAAKTELRVLKAIIENDST
FT                   GQYQCLLLRECFDYKNHICLVTDLFGKSVYDFMCNNGCPRFPGSHVQAISKQLIRSVCF
FT                   LHDLGIIHTDLKPENVLLCDESYVGKPLSPQTYSSLSPRRKSACGGERRFLTNPEVKLI
FT                   DFGSAVFHNEFHPAIISTRHYRAPEIVLGLGWSFPCDIWSIGCVLVELVTGESLYPIHE
FT                   NLEHMAMMQRFNGRPFPPKIVENMFYKADRKLGNMSPDLNSTVIKHFDRDTLALQWPER
FT                   NKKGEIITKERSMKRILTSCDRLDKYILQKVRQDYGDWLTINWDLSPEDNWALLESKYD
FT                   EQVLDREVFLFWYWFLDLCKKMFEFDPTKRITAREAIGHEWFNYGILDEGIASFGKV"
FT   gene            complement(<661556..>662872)
FT                   /locus_tag="KLTH0E07150g"
FT                   /old_locus_tag="KLTH-ORF9306"
FT   CDS_pept        complement(661556..662872)
FT                   /locus_tag="KLTH0E07150g"
FT                   /old_locus_tag="KLTH-ORF9306"
FT                   /product="KLTH0E07150p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23354"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHU3"
FT                   /protein_id="CAR23354.1"
FT                   /translation="MLGGWSLDRSFEQKATGAVSSSGHAEDTGRRPQTPRFRGLTTATT
FT                   TATTITGTSSTSTSLERVPPAAAHLSPTTPARTTPAPATPAPVRCYTIPPLAMHIAHGL
FT                   SPFREDETLAVFREDDDDLDSSSAGGSTAWRLPDFADDYYTDQGIAAHTPTSLPATRHA
FT                   PPAHAPMLDMDSLAFGEHGFDSKHPAAPPPRYACPTPPLSELASRMQNRTPTPTLTPTA
FT                   KQRSCRNFWSVDGDRALLRAMLHHEHLLAVARKSRPRSRYWQTISETLAARFGMHRNKR
FT                   QCRDRFNLIYWKAVRDSHQDLSADSKLAGLMRECMRRFYIDKDNNLMLRPQAPSPATPV
FT                   THTGAPAGANAVAAAMPASPVPKPQLELLAQLQSQVLQLTHRMDDLHRALDAHRALVHQ
FT                   LEQSPDAWPHADEPSVGVAAHGYQERCAGRIFGLNDQIW"
FT   gene            <664317..>665540
FT                   /locus_tag="KLTH0E07172g"
FT                   /old_locus_tag="KLTH-ORF9297"
FT   CDS_pept        664317..665540
FT                   /locus_tag="KLTH0E07172g"
FT                   /old_locus_tag="KLTH-ORF9297"
FT                   /product="KLTH0E07172p"
FT                   /note="similar to uniprot|P48236 Saccharomyces cerevisiae
FT                   YGR149W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23355"
FT                   /db_xref="GOA:C5DHU4"
FT                   /db_xref="InterPro:IPR021261"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHU4"
FT                   /protein_id="CAR23355.1"
FT                   /translation="MSDIPDTLDTDSDEGSEPMKVTLANWVEFLDPLSFTAQSQYLPRK
FT                   YLTRARRRLKSARPRQKLNQLKTTAQDLTPQLEDFKRRTIERLHSLDRPLESLFFHNSS
FT                   RLEKWFYPFTLFHIFAIGFIIGKYPSWFHVYYTGMLVLLMPVRFYTYYKTNNHYYMADL
FT                   CYYVNLMVLLFVWVWPDSVHLYQSCFAFTFGTLSFAVITWRNSLVIHSVDKITSCFIHI
FT                   MPPLTMYTIHHGLGEDLKRARFPAASLAGSKKWNLKYNIFWTSLYYLLWQSAYHYFITL
FT                   RKSSKIKSGQRATSFEYLTTHQFKNFWAAKLPEPWPMFFYILFQYCYQLGTMMLCGIWF
FT                   NYRGAAGAFLTFIYLCAAKNGATYYIDYYGKKFEKEVAKLKSEVEDLQQQLSQKANSSS
FT                   NNYSGVLE"
FT   gene            complement(<665709..>668324)
FT                   /locus_tag="KLTH0E07194g"
FT                   /old_locus_tag="KLTH-ORF9292"
FT   CDS_pept        complement(665709..668324)
FT                   /locus_tag="KLTH0E07194g"
FT                   /old_locus_tag="KLTH-ORF9292"
FT                   /product="KLTH0E07194p"
FT                   /note="similar to uniprot|P48237 Saccharomyces cerevisiae
FT                   YGR150C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23356"
FT                   /db_xref="GOA:C5DHU5"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DHU5"
FT                   /protein_id="CAR23356.1"
FT                   /translation="MLGRRLAGAKPQSGALFKRFVVIPASSKARRRRRDVGGIRKNVSV
FT                   EELELDKALDLRDPKELEFKLRQLREFTKNLATQIRVADDLVKKEAAQKELGNKSKEED
FT                   TADAASVILGTHNHHDRYQRRSLLQGEDLSSIILSVSHQVKKLLPEAILKRINDDELVL
FT                   RSLINHRNSDWNAIISKLDQSPEKLDGVSQRALKNYILSKAKNLSLGSIRKADAMLLSN
FT                   INHDLTKFNTSMYEFLFYNLSNLKPSQDPSSKYNNEVYTVMESLLDRYDEAQKVIAGKN
FT                   VAIEAQEGIMPKVEMNQFILNCCIKFASKLLDVSKMNRFLTKFNRDYHILPNKENYTVI
FT                   AQFYTKLGLHDKAWDIFATMKFLSADHKPDAKTYTCMLSLCNKEKNYAKAIDLFNEMID
FT                   LKVDPTPETLNALVKTLATVSGDPVASEGKAESLRLLAWKYLHQNEDLVNLRSGNFEDT
FT                   ILAMMSLCAYDGDAGLARALYFKYITTRFKSNFESWRMRQGDHSSVDYKKVWASTLNPF
FT                   LFNYLMLAYANYSPGKLPLLLGFEQGAVTRRNLINNVDYLYKFQNDEAGPRAKLPMLPL
FT                   ADISEPSQILLESRAVWQFNLEFGGLCDLRISPLGSSKVLKDLAASAESIEDFSFQVLH
FT                   QIALWKTQIVNHNALNPKSIMTYLTIPLKLGEKKEFLLRMSEFSYEQQTFEQHISSLYM
FT                   NTKQQLLTARPGSSTHLTHSEIKKQPSSQTSFNEESSLAFLSSMKHKIIRNSSIYELTM
FT                   KAAIRFQDQALATKAWESRGSYRKTLAFQNLPVAERTKKDAAFASLMVDFFTQQQMYTD
FT                   AMGIIMASQRHISWRYPMVKRLHRKLVELEDTRSIKILMEIVNKRSKSDSSAEAVTSLG
FT                   "
FT   gene            <668587..>668985
FT                   /locus_tag="KLTH0E07216g"
FT                   /old_locus_tag="KLTH-ORF9288"
FT   CDS_pept        668587..668985
FT                   /locus_tag="KLTH0E07216g"
FT                   /old_locus_tag="KLTH-ORF9288"
FT                   /product="KLTH0E07216p"
FT                   /note="similar to uniprot|P53188 Saccharomyces cerevisiae
FT                   YGL029W CGR1 Coiled-coil protein that may contribute to
FT                   compartmentalization of nucleolar constituents expression
FT                   is growth-regulated"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07216g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23357"
FT                   /db_xref="GOA:C5DHU6"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHU6"
FT                   /protein_id="CAR23357.1"
FT                   /translation="MSKNEKTEAADSAQTQTAEEKVPVKGANVSGRAWKVDKGQFRVSS
FT                   RAIKNKKLTSWELKRQKALEDKQFKQKLKELREEKDQIRKAKIQALKERREKSEEKERY
FT                   ERLATKMHAKKVDRLRRREKRNKALKER"
FT   gene            complement(<669179..>669271)
FT                   /locus_tag="KLTH0E07238r"
FT                   /old_locus_tag="Klth0E.tPhe.GAA.27"
FT   tRNA            complement(join(669179..669214,669235..669271))
FT                   /locus_tag="KLTH0E07238r"
FT                   /old_locus_tag="Klth0E.tPhe.GAA.27"
FT                   /note="tRNA-Phe (GAA) cove"
FT   gene            <669667..>670659
FT                   /locus_tag="KLTH0E07260g"
FT                   /old_locus_tag="KLTH-ORF9286"
FT   CDS_pept        669667..670659
FT                   /locus_tag="KLTH0E07260g"
FT                   /old_locus_tag="KLTH-ORF9286"
FT                   /product="KLTH0E07260p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23358"
FT                   /db_xref="GOA:C5DHU7"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHU7"
FT                   /protein_id="CAR23358.1"
FT                   /translation="MKAPVNSKVIRTNEGHLLELMDEDVQSVNAFKTRLKFSREKRDRS
FT                   DDIDEVTASKHQKPNQTQSSGDVLTVSEDDFRQYHQAKSRVRDFYRDQHEKQTMAYNLQ
FT                   ARVNFKTKTRARMTIWEALCKLSMLIDDSDPDTELSQIDHALQTAEAIRSDGKPRWMQL
FT                   VGLIHDLGKILYFFDSEGQWDVVGDTFPMGCYFADEIIFREFFDGNPDTKHPIYSTKLG
FT                   IYEKNCGLSSVMISWGHDEYMYYIAKSQSTLNEKALAMIRYHSFYPWHREGAYRYLMSD
FT                   EDYEMLREVQEFNKYDLYSKSLKKYDIEELKPYYLELIDEFFPTKHVEF"
FT   gene            complement(<670823..>672571)
FT                   /locus_tag="KLTH0E07282g"
FT                   /old_locus_tag="KLTH-ORF9284"
FT   CDS_pept        complement(670823..672571)
FT                   /locus_tag="KLTH0E07282g"
FT                   /old_locus_tag="KLTH-ORF9284"
FT                   /product="KLTH0E07282p"
FT                   /note="similar to uniprot|P53189 Saccharomyces cerevisiae
FT                   YGL028C SCW11 Cell wall protein with similarity to
FT                   glucanases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07282g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23359"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHU8"
FT                   /protein_id="CAR23359.1"
FT                   /translation="MISTRLGSLFILCCVLLTKHMSVALPVLKQLPKRQIVTRMHTAST
FT                   TNTVTDFYSTTTEIEVAPTVEFIISGDQTFTSTLPRADGSTPTGSPLTTIIISASVNRQ
FT                   VDVASQPSSGCATTIKTGTPRGTLTVSAIQTSEAASNLENANSQQQPSTWSASAAVSTE
FT                   IQSTSGNAVSSSVQDNAYSASVVNSSGPAVSSSNELTTSTSGTEQVSSSATSESTATFA
FT                   APSNEQTTIGSSEQITLASSTAQPTVSTSSSQFSSSLATSSPPASSPATSSPEASSPAT
FT                   SSPAISSTTSLTTTSSSTTSVSVSTASATSSGDLTCAPTALAYSPYNNDNSCKDSDSVY
FT                   KDLTLIKSKGVSQIRLYGTDCNSLETVTSAAKTLGLTINQGLWISPSGVDSIDDAVQDI
FT                   ISYGQSNGWDVFDILTIGNEAILNGYCSVSDLLAKISSVRSKFENAGFGGKFTTSEPPV
FT                   TFQNNPDLCTKANIDFIGINSHPYFDVNSSADSAGTFVKGQLEMIQELCGTQNVVVTET
FT                   GYPSAGIQNGGNNPSIENQIKAVQNILNEMNQDVTVLSTYNDYWKDPGSYGIEQSFGII
FT                   QLLPSA"
FT   gene            complement(<673288..>675702)
FT                   /locus_tag="KLTH0E07304g"
FT                   /old_locus_tag="KLTH-ORF9282"
FT   CDS_pept        complement(673288..675702)
FT                   /locus_tag="KLTH0E07304g"
FT                   /old_locus_tag="KLTH-ORF9282"
FT                   /product="KLTH0E07304p"
FT                   /note="similar to uniprot|P53008 Saccharomyces cerevisiae
FT                   YGL027C CWH41 Processing alpha glucosidase I involved in
FT                   assembly of cell wall beta 1 6 glucan and asparagine-
FT                   linked protein glycosylation ER type II integral membrane
FT                   N-glycoprotein disruption leads to a K1 killer toxin-
FT                   resistant phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07304g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23360"
FT                   /db_xref="GOA:C5DHU9"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR031335"
FT                   /db_xref="InterPro:IPR031631"
FT                   /db_xref="InterPro:IPR038518"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHU9"
FT                   /protein_id="CAR23360.1"
FT                   /translation="MLLRLLVVFALTLFEAHAETQGLFSDDVEEFERSTNQSLLWAPYR
FT                   SNCYFGVRPRFINENPLMMGLMWFDASHAQGISSLRHFVEQNDRLEKYGYELYDPRIGG
FT                   KEAIIDRENNLNLTIHFVKSKDGENWAVRVSGSPLDSSKLSASSLVVYLSQNGPGGRLE
FT                   SEHGKTSTEKRIELKGSAPELGDYEITIEDISGQHYKRGPALGPDIDGSKTSHMSLTVP
FT                   GDQVWKARDIFQSLLTDSIQNIITSGIPMDALSIPSALMIRNIHNFPPGNFHFVQKTFD
FT                   LAEPFEFDIIFNNKASRQPIGSSAEVSNLISWSTNELKARFDSKFDIKDSSLKQFAQET
FT                   LANLLGGIGYFHGTQLVDRSTEFDEEQFNKIELRAPREEGPIQLFSSVPSRAFFPRGFY
FT                   WDEGFHMLQVMEYDFDLVLEILQSWFLLIEDDSGWVGRELILGSEARSKVPEEFQVQNP
FT                   NIANPPTLLLCFSEMLTRAQEFQDSIAGGAEESSITPSSTEELLKRPELLMSFAEKVYP
FT                   KLLKHYEWWTGSQRGFTEEYSEVLQDGFHPNEAFRWVGRTFTHCLPSGLDDYPRAQPPD
FT                   VAELHLDALSWAGIMSRSMKQIADVLNMADEVDKFSKIEQNIIENLDTIHWNADQKCYC
FT                   DVTIDDDFDELRRFVCHEGYVTLLPFALKLVPRDSDKLQHYVELMGDTDKLFSDFGVLS
FT                   LSKQDEYFETGEAYWRGPVWINMNYLLLDSLLYYFQGGGENQDTATAERARAVYSDLRK
FT                   NLIANMHRVWSEKGYVYENYNQRTGNGSGVQHFTGWSALIVNIMGRLPVTL"
FT   gene            complement(<676064..>678766)
FT                   /locus_tag="KLTH0E07326g"
FT                   /old_locus_tag="KLTH-ORF9281"
FT   CDS_pept        complement(676064..678766)
FT                   /locus_tag="KLTH0E07326g"
FT                   /old_locus_tag="KLTH-ORF9281"
FT                   /product="KLTH0E07326p"
FT                   /note="weakly similar to uniprot|P32786 Saccharomyces
FT                   cerevisiae YBL014C RRN6 involved in the transcription of
FT                   35S rRNA genes by RNA polymerase I member of yeast Pol I
FT                   core factor (CF) also composed of Rrn11p Rrn7p and TATA-
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23361"
FT                   /db_xref="InterPro:IPR019350"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHV0"
FT                   /protein_id="CAR23361.1"
FT                   /translation="MERIQILPFKKNVGVQLGVGIRNSALYLPSTSLQGHKGENWLYGG
FT                   DTGDQQIPILELDVKSQEPLVDFRSETQDLTNATDDTGTTHESDITSDLSDSEFNSSRI
FT                   YQFGPEALGSSDLDSPGLINLFRNVNLSSEPGYEAKSDTPIAAQEYVPRNVLNSVEGSG
FT                   VRANNAGVQGNSHDYWNPAQASDGSKPPLHSIDPTDLESVAIGLVHTTADLRMNKDARH
FT                   VISYSSGDTGSVLNLALLMQSDAPGLCCSSELLSINLNSRVKNIKFPTLSPSFGRSSDT
FT                   LAALTENGLTVLRIKSIDDHTGKLAAEAPISLGFSSLEDFPFADVSFNPWDINEFAIID
FT                   VKGNWCIGTRIKRGARESRLRLSSNKRGTLYDPEELSSWRRLEWGSEYFRLIAVSRGRL
FT                   VEIDLNNRSQLEIIQAKSWSSLRDYKRIDEQFSLITTSKEVIFVNLRSSNIERILSWKH
FT                   DLNPDDTTLKSEVCRIVKSSDKEHFFVFIYSRSTTQVWLHFFYRNGSAFQSTGDSSLLE
FT                   FGPLQGGFSTLIISQLDHSKTVSSEENSDHVHLFAAARDATSNVIWKYAILAREFRSKV
FT                   TGGQPTMTLLNEDVSDVQVGSKQDFVGLHPFLPIPSAGHDMTKDIEAFQQYGYQISEGM
FT                   NKQLGQWTIGLDGESLSNQCKSVALDDLATPIGYIESMEEFGSLLQQFKDHYKDHDVWF
FT                   ADMPTLSTALLKEPVVDLGVLYNKLLQCWDFGVEGEECITRDILKGIVMKNTGICSVSA
FT                   LSSMITLAYEQLGQESQNLIDVWDKPDPIEEDNTVPQQYSSLFQNHSQASQIPPSIKSS
FT                   QHSPPKARKLRGRSPRVSSQSVSQPVPSTSNASGNTPHTLKTHASNVLPDTMTPAFTLS
FT                   SASQHVPTLSQSQNSQRQRKKKKRLGGFG"
FT   gene            complement(<679054..>681183)
FT                   /locus_tag="KLTH0E07348g"
FT                   /old_locus_tag="KLTH-ORF9278"
FT   CDS_pept        complement(679054..681183)
FT                   /locus_tag="KLTH0E07348g"
FT                   /old_locus_tag="KLTH-ORF9278"
FT                   /product="KLTH0E07348p"
FT                   /note="highly similar to uniprot|P00931 Saccharomyces
FT                   cerevisiae YGL026C TRP5 tryptophan synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07348g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23362"
FT                   /db_xref="GOA:C5DHV1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHV1"
FT                   /protein_id="CAR23362.1"
FT                   /translation="MAELLRRTFANAKSENRNALVTFMTAGYPRVEDTIPILKGFQDGG
FT                   VDVIELGMPFSDPIADGPTIQVANTVALQNGVTMTQTLDMVRQARAEGVTVPIILMGYY
FT                   NPILSYGEQKFIEDAAEAGASGFIIVDLPPEEAIKVRNFVDDKGLSLIPLVAPSTTDQR
FT                   LELLAQIATSFIYVVSRMGTTGAQTSVADDLTELVERVRKYTKDIPLAVGFGVSTREHF
FT                   TTVGSVSDGVVIGSKIIKLIEEAKEDERYITAKQYVEGILAGKKHKNLSVNEFKALQTE
FT                   SINAGKKNAAKAADFSEVHKFKATFGDFGGQYVPEALHACLRELEQGFESAVADPIFWK
FT                   EFRDLYSYIGRPSSLHRAERLSEYCGGAQIWLKREDLNHTGSHKINNALAQVLIAKRLG
FT                   KKKIIAETGAGQHGVATATACAKFGMECTVFMGAEDVRRQALNVFRMRILGAKVVAVTN
FT                   GTKTLRDATSEAFRFWVSNLKTTHYVVGSAIGPHPYPILVRTFQSVIGNETKEQFAKLN
FT                   DGKLPDAIVACVGGGSNSTGMFSPFEKDTSVKFLGVEAGGDGVDTKFHSATLTAGRPGV
FT                   FHGVKTYVLQDVDGQVHDTHSVSAGLDYPGVGPELASWKASGRATFIAATDAQALEGFK
FT                   LLSQLEGIIPALESSHAVYGAVQLAKTMDKNQNIIINVSGRGDKDVQSVAEVLPKLGPQ
FT                   IGWDLRFEEDPTAQL"
FT   gene            complement(<681382..>682440)
FT                   /locus_tag="KLTH0E07370g"
FT                   /old_locus_tag="KLTH-ORF9276"
FT   CDS_pept        complement(681382..682440)
FT                   /locus_tag="KLTH0E07370g"
FT                   /old_locus_tag="KLTH-ORF9276"
FT                   /product="KLTH0E07370p"
FT                   /note="weakly similar to uniprot|P40356 Saccharomyces
FT                   cerevisiae YGL025C PGD1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23363"
FT                   /db_xref="GOA:C5DHV2"
FT                   /db_xref="InterPro:IPR020998"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHV2"
FT                   /protein_id="CAR23363.1"
FT                   /translation="MADKEGGEVSKGLKEFDFGNLHEKLESEDGYKDSVKQEIQSVQDS
FT                   IQPMRLRFNELLNMLAIIDQETEVSNQEKFLSIRAKIVEFVSELQAFSSSYGRLQPLFD
FT                   NIQQQPKGGKTSIKFTPLERLRHLSDASLGNQAKSASGGSPPAAAVASVPTTTKQPKSS
FT                   TNTPTSNAATPSATFNAAAKKSRKSRSKKNSLPTGLGGHPVATAASPAAVAAAAAAVST
FT                   NPGVAMGSNPGIQQQFTPSTNPTQILSSMSPMNMMSSPMNIMSPANNVNMAYTGPTKPP
FT                   VPSHRHMPSSSQQMNMNGITPANILNMSMMEQANQPHLTTAPAPQPPNQLDMNNLDLNN
FT                   LDLSNLNMDFLQ"
FT   gene            complement(<682562..>683455)
FT                   /locus_tag="KLTH0E07392g"
FT                   /old_locus_tag="KLTH-ORF9275"
FT   CDS_pept        complement(682562..683455)
FT                   /locus_tag="KLTH0E07392g"
FT                   /old_locus_tag="KLTH-ORF9275"
FT                   /product="KLTH0E07392p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23364"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHV3"
FT                   /protein_id="CAR23364.1"
FT                   /translation="MSELERLAKRRLKFSEDARQQILGDHLKDRSLLSRSQRPNGAINR
FT                   LQRDHQARKELLDSIEAIERTHESSDQIEHGLRKLREVIVGAGDTDWRNLEFTQFACRV
FT                   YQKSVWFYCSRQEATKCYPILNFFVERLAPFAPRELATQISACCAIYISHVDNNISEFF
FT                   EVLDEIELDSHYLQICVALSLIYCVQDQPMSTWFRIVSQIPPHSLLRDFIVALPAFKVL
FT                   KSRTLKLLSKCYRQLSVTFISQHWFHHLYPELEPDLEQRWDVEITTNNAHIVMFKCPKS
FT                   KQSSFIGSPSTTSLKT"
FT   gene            <683534..>684667
FT                   /locus_tag="KLTH0E07414g"
FT                   /old_locus_tag="KLTH-ORF9272"
FT   CDS_pept        683534..684667
FT                   /locus_tag="KLTH0E07414g"
FT                   /old_locus_tag="KLTH-ORF9272"
FT                   /product="KLTH0E07414p"
FT                   /note="similar to uniprot|P32785 Saccharomyces cerevisiae
FT                   YBL013W FMT1 Methionyl-tRNA formyltransferase catalyzes the
FT                   formylation of initiator Met-tRNA in mitochondria potential
FT                   Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07414g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23365"
FT                   /db_xref="GOA:C5DHV4"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHV4"
FT                   /protein_id="CAR23365.1"
FT                   /translation="MQRTIRAHARQARIRRYSDKASRNLNVLFFGSDRFSVHSLHALRQ
FT                   LREENPGLIHKLQVVARPAKKCGRNLSETREAPIVKASSQIGLPPPINCDSTKEMLGPV
FT                   MKTIKEGGFNMIIAVSFGKLISHELIAQVPYTLNVHPSLLPQYKGSSPIQHTLLNGDEY
FT                   TGVSIQTLHPEKFDHGNIIAQTAPLKVSKLLEMQACQYETDPTIPPKVARLMDSLGSVG
FT                   GRLLVHVLQDRLYETNHVASPQYPASYAPKITTSMRQVQWQSDSSCRALRKFDSLGPLY
FT                   SFKQVYKKNSQVPHFKRVIFHHLAPAFDCDTSSRTSGEFEFDFAQNCLLIPFVDGKFLK
FT                   CTSIQFEGHKIETPDQFMKSLRKRCGPLSEKRVFCES"
FT   gene            complement(<684770..>684841)
FT                   /locus_tag="KLTH0E07436r"
FT                   /old_locus_tag="Klth0E.tAsp.GTC.26"
FT   tRNA            complement(684770..684841)
FT                   /locus_tag="KLTH0E07436r"
FT                   /old_locus_tag="Klth0E.tAsp.GTC.26"
FT                   /note="tRNA-Asp (GTC) cove score=69.96"
FT   gene            <685283..>687403
FT                   /locus_tag="KLTH0E07458g"
FT                   /old_locus_tag="KLTH-ORF9270"
FT   CDS_pept        685283..687403
FT                   /locus_tag="KLTH0E07458g"
FT                   /old_locus_tag="KLTH-ORF9270"
FT                   /product="KLTH0E07458p"
FT                   /note="similar to uniprot|P32784 Saccharomyces cerevisiae
FT                   YBL011W SCT1 High copy suppressor of choline- transport
FT                   mutants"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07458g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23366"
FT                   /db_xref="GOA:C5DHV5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHV5"
FT                   /protein_id="CAR23366.1"
FT                   /translation="MSEGLASQELESVSKTADSRANQEKDAYAYEEAPAYRKFVYDVFL
FT                   WLLSNIFDCFFREIRSRGRYKIPTQGPVIFVAAPHANQFIDPVILMGQVKKAVNKRISF
FT                   LVAEKSLTRKAVGTFARCAMSIGVGRAQDNLRPAPGKIRVSEENPRKIIGQGTKFTNGF
FT                   TPQGLIGLPKSLGNATIESIESDTVLYLRKEFKQNKPEVRQLLVKGTSFKYAPKVDQKK
FT                   VYERVFEHLAHDQCVGIFPEGGSHDRTDLLPLKAGVAIMALGCMSKNPDVNVKIVPCGM
FT                   NYFHPHKFRSRAVVEFGNPIEISPELVQKYQQSETNRDAVRELLDTISDGLKAVTVTCP
FT                   DYETLMVVQAARRLYAGQLSAKLPLSLVIEMNRRLVKGYQTYREDPRIQELKEYVLKYN
FT                   ANLRHFNIPDHQVESAKINFAKNFGLLIFRSLRLLFSLILALPGIIMFSPIFIIAKIIS
FT                   QNKARQALAASTVKIKANDVIATWKILIGMGLAPLLYSVWSGLLTYYFRHSITRNKFVS
FT                   FAGIYVLCSIVTYSALIIGDNGMDVFKSLRPLYLSVTTPGILKDLQKERRGLEQKITEI
FT                   INTLGPELYPGFDGTSLSDKYRYGLTSYDEEEEDRKTSELKRRRLLRKRKESGKQKARR
FT                   SPESEAESDALSMLNSDNSLSNIPIFSNVDRRSGSVSSMTSLSSGFEIVEDMTKPDELS
FT                   GKIAHAVREKRE"
FT   gene            complement(<687623..>689224)
FT                   /locus_tag="KLTH0E07480g"
FT                   /old_locus_tag="KLTH-ORF9268"
FT   CDS_pept        complement(687623..689224)
FT                   /locus_tag="KLTH0E07480g"
FT                   /old_locus_tag="KLTH-ORF9268"
FT                   /product="KLTH0E07480p"
FT                   /note="weakly similar to uniprot|P53191 Saccharomyces
FT                   cerevisiae YGL023C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23367"
FT                   /db_xref="GOA:C5DHV6"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHV6"
FT                   /protein_id="CAR23367.1"
FT                   /translation="MSTAPVQKRYREPMSSVHSQGSDVAPTGASNKTGAPPGNGMGSAT
FT                   RTSSNNSNKSTITFEKQKVMPRTRTQSVPSVLSSISLRSMMGKHQDEPVETPAHGACVG
FT                   IPASQQIQSPAIASSQKKTGSMHNNEVIGQRLPFTNDKRRQPEPAEHSKAGARTSRNGG
FT                   GPTPGYLFKPGYRTTDPGSIGSHAISEQIQEDTSQESDDDAAQQKKLTTDALRRLSALK
FT                   GPSSAAGDTPLPVASPRPEVREDCDNIGTPEVLTHIQFGGKNIILDSSIPNKRGSIAPV
FT                   KPPLDMLPATLESSSKPKSKRPLRQINAPKKPLYTPAVLRDISETNITNAELNSPGPPI
FT                   LASQNQGTHTSRSSVRSIRSTSSSIISDYTKKLSSLWAKNPAYANAAEITPPTKTHWVS
FT                   DSKRHACHYCHKIFTFWERKHHCRHCGDIFCSQHVRHWLYLDKDARFVIGGAGVGALSK
FT                   ICDGCLQEYDKLVREGPSSSAANAQTTNETPKSTTPVAGIDATLNQKDLVDQEGKRGRM
FT                   DSIVGSVPADWNWSSF"
FT   gene            <689680..>691872
FT                   /locus_tag="KLTH0E07502g"
FT                   /old_locus_tag="KLTH-ORF9264"
FT   CDS_pept        689680..691872
FT                   /locus_tag="KLTH0E07502g"
FT                   /old_locus_tag="KLTH-ORF9264"
FT                   /product="KLTH0E07502p"
FT                   /note="highly similar to uniprot|P39007 Saccharomyces
FT                   cerevisiae YGL022W STT3 Subunit of the
FT                   oligosaccharyltransferase complex of the ER lumen which
FT                   catalyzes asparagine-linked glycosylation of newly
FT                   synthesized proteins forms a subcomplex with Ost3p and
FT                   Ost4p and is directly involved in catalysis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23368"
FT                   /db_xref="GOA:C5DHV7"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHV7"
FT                   /protein_id="CAR23368.1"
FT                   /translation="MATSCTQKHLIRWIQLLLKCTIFLSLTAAAVSSRLFSVIRFESII
FT                   HEFDPWFNFRATKYLVNNGFYKFLNWFDDRTWYPLGRVTGGTLYPGLMATSAAVWHGLR
FT                   KIGLPIDIRNVCVLFAPAFSGVTAWATYHLTSEIKDSGAGLLAAAFIAIAPGYISRSVA
FT                   GSYDNEAIAITLLMVTFMFWIKAMKTGSIMHSTFAALFYFYMVSAWGGYVFITNLIPLH
FT                   VFILILMGRYSTRLYSAYSTWYAIGTLASMQIPFVGFLPIRSNDHMAALGVFGLMQVVA
FT                   LGSYVKSQVSWQKFQTVMVVSLVFLLALGISALFALTYFGFIAPWTGRFYSLWDTNYAK
FT                   IHIPIIASVSEHQPTAWPAFFFDTQFLIWLFPAGVFLLFLDLKDEHVFVIAYSVLCSYF
FT                   AGVMVRLMLTLTPIICVCAAVAISKLFDVYADFSYFFSSSSAEKPNLSKRDRIMTLVTK
FT                   LTVCGSFLAYLVLFVHHCTWVTSNAYSSPSVVLPSRNPDGSPALIDDFREAYYWLRMNT
FT                   AEDAKVASWWDYGYQIGGMADRTTLVDNNTWNNTHIAIVGKAMSSPQEKAYDILKAHDV
FT                   DYVLVIFGGLIGFSGDDINKFLWMVRISEGIWPDEIKERDYFTPSGEYRMDAQASQTMK
FT                   DSLLYKLSYHRFPTLFNGVEGIDRLRGQNIRQVDIGNLDYFEEVFTSENWIVRLYKLKE
FT                   LDAMGRDLHTKGEFDRGSSRGIKKRVAKKPLLDVRV"
FT   gene            complement(<691969..>692691)
FT                   /locus_tag="KLTH0E07524g"
FT                   /old_locus_tag="KLTH-ORF9261"
FT   CDS_pept        complement(691969..692691)
FT                   /locus_tag="KLTH0E07524g"
FT                   /old_locus_tag="KLTH-ORF9261"
FT                   /product="KLTH0E07524p"
FT                   /note="weakly similar to uniprot|P32788 Saccharomyces
FT                   cerevisiae YBL010C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23369"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHV8"
FT                   /protein_id="CAR23369.1"
FT                   /translation="MSDSDSDSDFGDFAGVPEEESPVPEILSPVEQLDRALGQREEIQY
FT                   VNQPHSLDELIKGERPRVVYEHLVLLETQLRPFSWRNSKLRSLLLQTLQIADEPELPKA
FT                   HKPLDSFLYSQLEPRLGEEGLDYAAFLSRVCGDKFSANNKSPVQKIESLEAKDLEQLDT
FT                   EALRRTHDELLDAVLAVCQEIGGTAAVRSELEADKSMYEGLVTNLVGHTQRLRRDEIAD
FT                   FNKKHRRGSKYGKFKWVR"
FT   gene            <692912..>694801
FT                   /locus_tag="KLTH0E07546g"
FT                   /old_locus_tag="KLTH-ORF9260"
FT   CDS_pept        692912..694801
FT                   /locus_tag="KLTH0E07546g"
FT                   /old_locus_tag="KLTH-ORF9260"
FT                   /product="KLTH0E07546p"
FT                   /note="some similarities with uniprot|P32789 Saccharomyces
FT                   cerevisiae YBL009W haspin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23370"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHV9"
FT                   /protein_id="CAR23370.1"
FT                   /translation="MMGQVQNQKREVMELEGWYEEDSEVLTSGKFIALEVSDHEDDYNS
FT                   SNDSPSEEEQQELKQTPTRSQTRDRYSREGSGSRQSPAHKVARTPEIAELPPASAGSAT
FT                   ASSKSGKRWSMLSNNSKKRWSSLSFTSDERRRSPSTSSIKRRSVISTTSDDKRTATPDL
FT                   SRRVSTSTSSVHSSIPNLKRSSTSNSLRQMFGKIALQDDQKENKTTIKRFLGKMSPRRT
FT                   TRSSLGTLDPNMYSSLPQRNSYADNSSIISSNSMASTASSRWKFWKKTPDMGSFESSPS
FT                   YSSASLKTRLSQSSLKQKSSHSSLNKLTSHHRNSVTSESISLPMPDQVSRDKLRTKLRS
FT                   STSILSINSTVATEEFDEFQISQLLKLCEQSQILPVEQLVPEWNSLQKLSKHVYRGEES
FT                   VFKVLPLAQDDFTHSKHLRIKELELLRLFNGTPGFTQMCVCHLALVENDPTLICELKYA
FT                   GKSLAHVRINSWAAALNIWWQCAVIIYAAETKFQFEHRDLQFEHVLVDASGNVTLCDYK
FT                   LARASQGSVVYYTRLDHPLFFQGRGDYRYEVYNTMRHWCADSWARYDPRNNLLWLHYLG
FT                   VKLIESMNDVPHDGQYSELLKLIAQVNPNRRRKALFRRSDQILNCGDVLRLRR"
FT   gene            complement(<694903..>695490)
FT                   /locus_tag="KLTH0E07568g"
FT                   /old_locus_tag="KLTH-ORF9255"
FT   CDS_pept        complement(694903..695490)
FT                   /locus_tag="KLTH0E07568g"
FT                   /old_locus_tag="KLTH-ORF9255"
FT                   /product="KLTH0E07568p"
FT                   /note="weakly similar to uniprot|P53192 Saccharomyces
FT                   cerevisiae YGL020C MDM39 Protein involved in determination
FT                   of mitochondrial structure"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23371"
FT                   /db_xref="GOA:C5DHW0"
FT                   /db_xref="InterPro:IPR027538"
FT                   /db_xref="InterPro:IPR028945"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DHW0"
FT                   /protein_id="CAR23371.1"
FT                   /translation="MVNSTILVTVVLVLALRALQWCSGYQHKFIDMIWCKPVALKLQGL
FT                   IKKRRELHLAQQSTSAQDEYAKWTKLNRQIAQLDTQVKQTQEQLVENRKVGEKNLGKLR
FT                   LVFFTAPLLVLRFWKGKLPVYALPSGMFPRVVESVLSQGWAAAALAPVRFVWASGTVKP
FT                   MQVETPVCLAIWLWALSRVLDTSEFVVRSLCM"
FT   gene            <695652..>696404
FT                   /locus_tag="KLTH0E07590g"
FT                   /old_locus_tag="KLTH-ORF9254"
FT   CDS_pept        695652..696404
FT                   /locus_tag="KLTH0E07590g"
FT                   /old_locus_tag="KLTH-ORF9254"
FT                   /product="KLTH0E07590p"
FT                   /note="similar to uniprot|P43639 Saccharomyces cerevisiae
FT                   YGL019W CKB1 beta (38kDa) subunit of protein kinase CK2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23372"
FT                   /db_xref="GOA:C5DHW1"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR035991"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHW1"
FT                   /protein_id="CAR23372.1"
FT                   /translation="MSEYIGDNSRTGSSEESGTFDEWIPSFCARFGHEYFCQVPTEFIE
FT                   DDFNMTGLGQEVPHYRKALDLILDLEAMSDEEGQDSEEPVSRSIVEHAAEQLYGLVHAR
FT                   YILTKPGLQAMAEKFDHKEFGTCPRYYCGGMQMLPCGLTDTLGKLTVRLYCPSCQDLYL
FT                   PQSSRHLCLEGAFWGTSFPGVFLKHFKELEDYVDRKNKETYELRVFGFRIADEAPSGTR
FT                   MRWLRQYPKTSEEQLELQDCEFQIPKVQ"
FT   gene            complement(<696467..>697027)
FT                   /locus_tag="KLTH0E07612g"
FT                   /old_locus_tag="KLTH-ORF9253"
FT   CDS_pept        complement(696467..697027)
FT                   /locus_tag="KLTH0E07612g"
FT                   /old_locus_tag="KLTH-ORF9253"
FT                   /product="KLTH0E07612p"
FT                   /note="similar to uniprot|P53193 Saccharomyces cerevisiae
FT                   YGL018C JAC1 Molecular chaperone involved with partner
FT                   Ssq1p in assembly of Fe/S clusters and in mitochondrial
FT                   iron metabolism contains a J domain typical to J-type
FT                   chaperones localizes to the mitochondrial matrix"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23373"
FT                   /db_xref="GOA:C5DHW2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHW2"
FT                   /protein_id="CAR23373.1"
FT                   /translation="MLRIVCKRLYSSRSVFQQFPRTFRSRIWSWNVDLRGLRKEYRDLQ
FT                   ALEHPDMNANSDSSRSSELNHAYQTLKQPLLRAQYILETQAGLDLRNEQTSREIAQQDP
FT                   ELLMRVLDVHEQLESLSSEQDVKVIARENRERMNVIEQTLGEAFAQHDWDRAAQLTVEL
FT                   RYWTSLDRAVKEWEPGKRLELNH"
FT   gene            <697160..>698794
FT                   /locus_tag="KLTH0E07634g"
FT                   /old_locus_tag="KLTH-ORF9251"
FT   CDS_pept        697160..698794
FT                   /locus_tag="KLTH0E07634g"
FT                   /old_locus_tag="KLTH-ORF9251"
FT                   /product="KLTH0E07634p"
FT                   /note="similar to uniprot|P16639 Saccharomyces cerevisiae
FT                   YGL017W ATE1 Arginyl-tRNA-protein transferase catalyzes
FT                   post-translational conjugation of arginine to the amino
FT                   termini of acceptor proteins which are then subject to
FT                   degradation via the N-end rule pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23374"
FT                   /db_xref="GOA:C5DHW3"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHW3"
FT                   /protein_id="CAR23374.1"
FT                   /translation="MELSDRLIISKPLYFTEPNEKCGYCSGKKANKCDYFATESWHKFH
FT                   ALDADSLQFNNCTLGLQVELMPVDVYDELCNLGFRRSGNFLYKADMLRNCCRLYTIRTT
FT                   PEKCQMSKEFKSCITRFRKRIGAQRSELPKGQDRKGKFDYIDEIVQAEKVSEKFQARFE
FT                   PATFSTEKYQLFVKYQENVHGDFNNSVKAFKRFLCESPFPEDVVLGTRQEWEQLNNWRD
FT                   MQPGETLLRVGPAHECYYFEGRLIALAVTDFLPSGISSVYFIWDPDFPKWSLGKLSALR
FT                   ELSVLSKINRKYYYLGYYIDDCPKMKYKRKYGGDILDVCNNEYVPLERVAPLIEHGKFF
FT                   VLGSPDAADEDHHNDFDDDEEDDDHKSEEELEDRAVSEMPLDDVPRLNLEKPNINIVDF
FT                   IYGEKGGAVLSANEAADKLSDTGIEYTPTILHDLYKLKPIGGWTTSPEPEEHYEECDGD
FT                   VPGYTNEIYHLPNVVPGLLPLWQILHIVQSGEIRLLNNKLMLYNTRTGQIRLVKDFEAE
FT                   SKRTKRVICNVIRMIGLKNTAKSLIII"
FT   gene            <699240..>702146
FT                   /locus_tag="KLTH0E07656g"
FT                   /old_locus_tag="KLTH-ORF9249"
FT   CDS_pept        699240..702146
FT                   /locus_tag="KLTH0E07656g"
FT                   /old_locus_tag="KLTH-ORF9249"
FT                   /product="KLTH0E07656p"
FT                   /note="similar to uniprot|P32767 Saccharomyces cerevisiae
FT                   YGL016W KAP122 Karyopherin beta responsible for import of
FT                   the Toa1p-Toa2p complex into the nucleus binds to
FT                   nucleoporins Nup1p and Nup2p may play a role in regulation
FT                   of pleiotropic drug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23375"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHW4"
FT                   /protein_id="CAR23375.1"
FT                   /translation="MLHLSRLTSIFVGDPAQNRSVLVVIKKLMSNAAQVFFRLNSGDGG
FT                   STPTTWKNPLETFVLLVSQPDVYSSASDDLFTHMLAQGVPYDDLIHFISSSDTLNILLL
FT                   LFSEVIIEDLLKYQTSKLGASNLHNVVRETLYISSMSIINFNLQKLVAAFQSRTNTGPN
FT                   VAENIFRCVNIWINYAIMVRTRSQGQIDLSETFENLIQLLCLYDSDQGFPYSETVVSIL
FT                   AEIFANDPTMLSFELRASIEEIFLGVRRGSGGTSGGHTWMLHFMNHLVVNQSFEELKEL
FT                   ALCVVDFLQVSNLDVCNKLFTQSANTDSVNMDQYIKVLLQMTNFTLAPVLEEFFSVRMV
FT                   DFWLDLCDGYNNLVRETLKPNTPIIASDLFGQVVQIYLPKVSLINKQRIIQEGEEESLL
FT                   HEFDDFRGAVLDLMESMWSVLGNEKLTDILIGSVAQVSPKSAEDLFQIEAMCFCLNKLL
FT                   SDMTLSESPGICATFGANENFLPNVLLLIQTSCQQKSPANGKEAQILSCDFVKTGSSIL
FT                   ATVADYLKQNDKNLRDCMDVLFSSLETCSNADQVDTKFELLLTKCITSICETSRSELTS
FT                   YLPTFTKIQHAMLQKSSKVSDFSKQGFTRCLGYIIQTYTSDGPESQAQYILQVIDTIKT
FT                   EVTNSQEDRTQVLCLLNCLSELGSALIQPEEPEDPAYLAQLAQFQDFWQNDPLRLRVVI
FT                   LDLLESVLAQHGRDSEFVEAACLIMGKKLTLPDDEPHFLSFSMQELMEFLLRRCATCEP
FT                   LTGLPYIIYLLEKVVNHHRASLTPQDFDFMLTKFFLGQHRDAVASDPDLTQNMISFVNS
FT                   VMDTRPGLAVHCDHWATFVLPEFMRYLSSKERFTISAVTKFWTKVINNKKYSRHDEITI
FT                   REQVLALGPQLTLQTTGALLSSQRSDLSYYSDLLRVLIARYPLQSKQWLSHTLPQLCEN
FT                   HRAHQLLVEKLFVTRGSRAAADAVLEWWLSCNGLPRLT"
FT   gene            <702610..>704088
FT                   /locus_tag="KLTH0E07678g"
FT                   /old_locus_tag="KLTH-ORF9246"
FT   CDS_pept        702610..704088
FT                   /locus_tag="KLTH0E07678g"
FT                   /old_locus_tag="KLTH-ORF9246"
FT                   /product="KLTH0E07678p"
FT                   /note="similar to uniprot|P53090 Saccharomyces cerevisiae
FT                   YGL202W ARO8 Aromatic aminotransferase expression is
FT                   regulated by general control of amino acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07678g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23376"
FT                   /db_xref="GOA:C5DHW5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHW5"
FT                   /protein_id="CAR23376.1"
FT                   /translation="MTAEKELLACNFSHLFSDETRRRKSSPIKTTMAYFQDPNIVFLGA
FT                   GMPPSELFPLESITIEMPKPPFTSAAGKRADCLKGTIMKEHEDLVFENDVPLARALQYG
FT                   NSRGQKELLAFLKEHVSLFHRILYKDWDIITTTGSTQGWDASLRIFCNKGDTVLLEDYT
FT                   YSSSVEAADAQGLNCVPMPLDGEGIVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNP
FT                   TGCTLSDNRKPHIYRLAQQYDIIIIEDDPYYFLQMDPYVSEDARLETAEASTMSQATFM
FT                   NSLNRSFLELDTDGRVVRLESVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGF
FT                   AQTILSGILNRWGQDGYIDWLMRIRRQYTGKRNTCLDNCYKYLPAEIVSVPPVTAGMFF
FT                   MVFIDAEKHPEFHNTFKGDVLLLENHIYQKCVSAGVLITCSSWFKVNDPKPSCGKSADN
FT                   TLAFRGTFASVEPEAMARGLQIFGETLKQEFKLV"
FT   gene            <705358..>707778
FT                   /locus_tag="KLTH0E07700g"
FT                   /old_locus_tag="KLTH-ORF9242"
FT   CDS_pept        705358..707778
FT                   /locus_tag="KLTH0E07700g"
FT                   /old_locus_tag="KLTH-ORF9242"
FT                   /product="KLTH0E07700p"
FT                   /note="similar to uniprot|P32479 Saccharomyces cerevisiae
FT                   YBL008W HIR1 Non-essential transcriptional corepressor
FT                   involved in the cell cycle-regulated transcription of
FT                   histone H2A H2B H3 and H4 genes contributes to nucleosome
FT                   formation heterochromatic gene silencing and formation of
FT                   functional kinetochores"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23377"
FT                   /db_xref="GOA:C5DHW6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011494"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019015"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR031120"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHW6"
FT                   /protein_id="CAR23377.1"
FT                   /translation="MATSGKEPDESLRKPLASMSRHTGSVTVVRFSPDGNFLASGSDDR
FT                   ILLIWERDEEQKQPIFGSENDREHWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSV
FT                   IVWNGSTFEKIKRFDVHQSLVKGVIFDPANKYFATASDDRTVRIFRYHKAGDMNFSIEH
FT                   VVSEPFKGSPITTYFRRLSWSPDGQHIAAPNATNGPVSSVSIISRGSWDTSVTLIGHDS
FT                   PTEVVRFNPRLFQVLAKKSKTAEEGKDGQDQDQDPDKTDADKTDADKTDTAADKDNQEN
FT                   SEPKESLEEKVDSVIATAGQDKTLVVWSTGRARPIFVAYDITNKSITDMVWNPEGNILF
FT                   LTSLDGSIIAVIFEKNELGEAVPIEKNVEQLHRYGVDKNSFEFPESVKQLELEDEAQKL
FT                   QTKTTEPEKVIAPAFQNPEVQPKPSAPFLPGTAQKPNVLAIKRKEQPSKNDEAGLQTGK
FT                   KPNKTPIKGQNGHLNETVLKNGRKRVAPTLISSGYSPTKPTDDNIVPIKASSPSLKLAD
FT                   SEDMFQKVKHKLARQSFPVPRLGIHSLIMGVRERGVDKYYRDEESSQRDREEQTTDLDT
FT                   IPQVDHVMRLNAKTTPDRVWAEEANTRYIENPSLLSDADVILVEFGTLDDLHIMEIRNG
FT                   VERALQFDREALHEHPTKILGYHKGKRQIDIYIPEVVICAVGIPKCKCWALATADGTIY
FT                   VYTSFGQHKLPKIALGHKVIKMAAVDSYLVVLTESGLVYCWDIEKELCVHKEIPVLPIL
FT                   CDSPVESNRVRVHKKIVNINLEVQSRDLLVSFINPQETFRWSSNLGCWVLSVS"
FT   gene            <708205..>710556
FT                   /locus_tag="KLTH0E07722g"
FT                   /old_locus_tag="KLTH-ORF9239"
FT   CDS_pept        708205..710556
FT                   /locus_tag="KLTH0E07722g"
FT                   /old_locus_tag="KLTH-ORF9239"
FT                   /product="KLTH0E07722p"
FT                   /note="highly similar to uniprot|P07264 Saccharomyces
FT                   cerevisiae YGL009C LEU1 Isopropylmalate isomerase catalyzes
FT                   the second step in the leucine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23378"
FT                   /db_xref="GOA:C5DHW7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR012235"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHW7"
FT                   /protein_id="CAR23378.1"
FT                   /translation="MTYTPSKGPKTLYDKVFDAHVVHKDESGSYLLYIDRHLVHEVTSP
FT                   QAFEGLKDADRKVRRRDCTLATVDHNIPTWSRKNFKSPETFIKEADSLLQVQTLQQNVK
FT                   DFDVPFFGMTDARQGIVHIIGPEQGFTLPGTTVVCGDSHTSTHGAFGSLAFGIGTSEVE
FT                   HVLATQTIIQAKSKNMRIFVEGKLSPGVTSKDLILHVIGVIGTAGGTGCVIEFAGEAVE
FT                   ELSMEARMSICNMAIEAGARAGMIKPDQITFDYVKGRPLAPKEQEWEKAVAYWNTLHTD
FT                   EGAQFDYDIKIKSKDIIPTITWGTSPQDALPITASVPDPTNVSDPIKKSMMEGALKYMG
FT                   LKPNTPLKEISIDKVFIGSCTNARIEDLRAAAAVVKGHKKAESVKLAMVVPGSGLVKQQ
FT                   AEKEGLDRVFEEAGFEWREAGCSMCLGMNPDILDPEERCASTSNRNFEGRQGARSRTHL
FT                   MSPAMAAAAGIEGRFVDIREFQYKDNDVPKVSIEQETEDKALQDAVYEHEKQPLPEGES
FT                   VQEQKDDEVKDIPATNHTIHESPIKNGKASSAPAGMEPFLTVSGVAAPVDKANVDTDAI
FT                   IPKQFLKTIKRTGLKKGLFYEWRFTKDENGNEVSLNYILDTEPYAKSKILVVTGDNFGC
FT                   GSSREHAPWALKDFGIKSIIAPSFGDIFYNNSFKNGLLPIRLPQEVILEKLYPVAQSAG
FT                   SLVIDLPNQQILDSNNNVLVEHFDVEDFRKHCLVNGLDDIGITLQKEELISKYEAKRKV
FT                   EFSFLEGGSGGVRPIVGSKKSPYGNTAQEW"
FT   gene            complement(<710793..>714542)
FT                   /locus_tag="KLTH0E07744g"
FT                   /old_locus_tag="KLTH-ORF9235"
FT   CDS_pept        complement(710793..714542)
FT                   /locus_tag="KLTH0E07744g"
FT                   /old_locus_tag="KLTH-ORF9235"
FT                   /product="KLTH0E07744p"
FT                   /note="similar to uniprot|P32790 Saccharomyces cerevisiae
FT                   YBL007C SLA1 Cytoskeletal protein binding protein required
FT                   for assembly of the cortical actin cytoskeleton contains 3
FT                   SH3 domains interacts with proteins regulating actin
FT                   dynamics and with proteins required for endocytosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23379"
FT                   /db_xref="GOA:C5DHW8"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007131"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR029922"
FT                   /db_xref="InterPro:IPR035800"
FT                   /db_xref="InterPro:IPR035821"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038159"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHW8"
FT                   /protein_id="CAR23379.1"
FT                   /translation="MTAFLGIYKAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVK
FT                   KRVIGSDAEEPVGLVPNNYIEEADILYTAKAVYDYPEVQNPEEELAFSENDSFDVFDDR
FT                   DSDWILCRSQKTGEFGFVPGNYIEVTGSSVAAGQGTSASVAPAPAPAASAPALDASSFP
FT                   PPPQHMSRASIQPSSNTALPPTPPESPQAEDIPPPRPARPEVEDEEYAPPKPTRPTNTE
FT                   STPDRRRSAYSGSYGDDDEVEDLDLQETARSESKTGSFNTWDISEVDGRKKRKAKIAIG
FT                   RDTIFFTPSKGTPQQWPIQDLMTYDNEKKHIFFEFTNPYLNLEIHTGSTDVANEIMAVL
FT                   GEVKGAYHASGLREVEAASKAPAKSKKASSKSSNRKQGKVVYDFIGESGDELTITAGQI
FT                   VNILDDKKSKDWWMCELPETGKKGVVPAQFVEPINQLSFMAGSLKGLRKSSRSGTPTAS
FT                   KDWKQDDDQEVSKKSSARKRASSFLHKKKDGEKSLSKKHKDFPDSSKTRIWVDRSGTFR
FT                   VEAEFIGCVDGKIHLHKANGVKIAVAADKLCQEDLELVERMTGMSLDKYKPKNTTSNSS
FT                   SSARDKERDRRRRLKEQEDRERELEQRERDRKLREQELIELRRARDLLDKERENLRASQ
FT                   ERELPPIKPPRPNTATASSSERMTPKSASKPEYDWFEFFLNCGVDVNNCQRYTINFERE
FT                   QIAEEILPDIQPSLLRTLGLREGDIIRVMKYLDQKFGRQSSVNSNATGGLFSEPDGSLK
FT                   VSQTGIAANSTGALSSNLLPQQPNAQASNPRDDDAWTVKPAAKLETKSPHQTSEFTGSM
FT                   QDLLDLQPLEPKRTANAAPQPNIKDLEAVKTGASKPDTAIQPEKTGASLVPLDPFKTGG
FT                   HNLLPMATGGFVMVPVSTGGLVPLQRTGGMFMPQTTFGMQPTGTVLPVQKTGSGLIPVN
FT                   TGGLLPQTTFGLQGSSSMMPLNRTGGTLPLQQGQMTGSLLPQTTSLSTMGLQRTGGTAM
FT                   VPQTTFGMNPNPMPLSLTGGASMSLQRTGGGMPFSMQATGITGGMPQTSFGNQITGGAN
FT                   IGSQTGFGSQFTGGPSIMPSTTFTGQATGGANLIPSTSFGNQFTGGVNIMPQQTTGVYG
FT                   GIPQPAMGSAQTGGFGTMPQNSFNMGSQMSGQRTGGMVAPYLAPTQTGGFQPQSQFGLG
FT                   LQRTGGLNSYPQTSFSTGGPMQQPLGAVNTGGINQLNGMFQNTSISQPTLQSQPTGFGF
FT                   GNGPQPYQKQANLHNASADNPFGF"
FT   gene            complement(<714842..>715351)
FT                   /locus_tag="KLTH0E07766g"
FT                   /old_locus_tag="KLTH-ORF9230"
FT   CDS_pept        complement(714842..715351)
FT                   /locus_tag="KLTH0E07766g"
FT                   /old_locus_tag="KLTH-ORF9230"
FT                   /product="KLTH0E07766p"
FT                   /note="similar to uniprot|P25338 Saccharomyces cerevisiae
FT                   YGL010W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23380"
FT                   /db_xref="GOA:C5DHW9"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHW9"
FT                   /protein_id="CAR23380.1"
FT                   /translation="MGNLFDLCSQLAFYKSYHSDRVNVLIHAIFVPTILYSSLVMLYEI
FT                   KTINGWTAAHLIVGIFSSYYMVLDAKAGALASAIMGCTTHGISNGYLHISVKAALALFS
FT                   AGWISQFIGHGVFEHRKPALLDNLAQSLITAPFLILFELLFRMGFYKELQAELIIRVRE
FT                   RRSHLQ"
FT   gene            <715745..>716485
FT                   /locus_tag="KLTH0E07788g"
FT                   /old_locus_tag="KLTH-ORF9229"
FT   CDS_pept        715745..716485
FT                   /locus_tag="KLTH0E07788g"
FT                   /old_locus_tag="KLTH-ORF9229"
FT                   /product="KLTH0E07788p"
FT                   /note="highly similar to uniprot|P21243 Saccharomyces
FT                   cerevisiae YGL011C SCL1 Proteasome subunit YC7alpha/Y8
FT                   (protease yscE subunit 7)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23381"
FT                   /db_xref="GOA:C5DHX0"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR034642"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHX0"
FT                   /protein_id="CAR23381.1"
FT                   /translation="MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCC
FT                   VVINQKKVPDKLLDPSTMSYLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGY
FT                   DMPADVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKAT
FT                   ATGPKQQELTSALEKYFKKRKSDCVNEDSYEKVVELGITHMIDALGTEFSKKDLEIGVA
FT                   LKDKFFCLTPDQIEERLVAIAEQD"
FT   gene            complement(<716624..>717226)
FT                   /locus_tag="KLTH0E07810g"
FT                   /old_locus_tag="KLTH-ORF9227"
FT   CDS_pept        complement(716624..717226)
FT                   /locus_tag="KLTH0E07810g"
FT                   /old_locus_tag="KLTH-ORF9227"
FT                   /product="KLTH0E07810p"
FT                   /note="weakly similar to uniprot|P38210 Saccharomyces
FT                   cerevisiae YBL006C LDB7 Protein of unknown function null
FT                   mutant shows a reduced affinity for the alcian blue dye
FT                   suggesting a decreased net negative charge of the cell
FT                   surface"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23382"
FT                   /db_xref="GOA:C5DHX1"
FT                   /db_xref="InterPro:IPR013895"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHX1"
FT                   /protein_id="CAR23382.1"
FT                   /translation="MAQYDLGYYDTISGLSALECSHKVTLSQGQLLELCTKDSNAREDR
FT                   DNTKGTTEEKDRKDKRRTPVHGYLSKTDPNITLSSTYELNHTLLGGHVPRATLEALSST
FT                   DFAQYFQKVIDFEKALQTHNYFAAQNVNTVPTVPSSPASSLTPSTPVPASQVENTRRPR
FT                   SQQSDGVKKVILCKLCKARFSGPRRFTNMKKHMCMRA"
FT   gene            complement(<717500..>718894)
FT                   /locus_tag="KLTH0E07832g"
FT                   /old_locus_tag="KLTH-ORF9226"
FT   CDS_pept        complement(717500..718894)
FT                   /locus_tag="KLTH0E07832g"
FT                   /old_locus_tag="KLTH-ORF9226"
FT                   /product="KLTH0E07832p"
FT                   /note="similar to uniprot|P25340 Saccharomyces cerevisiae
FT                   YGL012W ERG4 C-24(28) sterol reductase catalyzes the final
FT                   step in ergosterol biosynthesis mutants are viable but lack
FT                   ergosterol"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23383"
FT                   /db_xref="GOA:C5DHX2"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHX2"
FT                   /protein_id="CAR23383.1"
FT                   /translation="MSSKNNKGEKAPVNFLPQGKILKPEEIEYEFGGPIGVTAMMLGFP
FT                   ALMYYMWICAEFYGGKVALPGPNESWPQFLAHLWQLCVEHAVPSRYSWTIFFTFWAAQI
FT                   VFYYTLPGVWTEGQPLTHLKNKQLPYFCNAMWTFYTSVSIVLVLHATGIFKLYTILDNF
FT                   GEIMTCAIICGFAFSIGLYLYTLFVSGDYHRMTGNHIYDMFMGAPLNPRWGVLDLKMFF
FT                   EVRLPWFTLFFLTLGAALKQYESYGYVTPQLGVVLLAHWLYANACAKGEELIVPTWDMA
FT                   YEKFGFMLIFWNIAGVPYTYCHCTLYLYYHDPSEYNWSWYYNLSLYVVLLIAYYFFDTA
FT                   NAQKNAFRKAMAGDTRVRKTFPFLPKQILKNPKYMVTKNGSYLLIDGWYKLARKIHYTA
FT                   DWTQSLIWALSCGFNSFFPWFFPIFFFITLVHRALRDQAKCKKKYGEDWDKYCKECPYL
FT                   FIPYVL"
FT   gene            <719642..>722458
FT                   /locus_tag="KLTH0E07854g"
FT                   /old_locus_tag="KLTH-ORF9221"
FT   CDS_pept        719642..722458
FT                   /locus_tag="KLTH0E07854g"
FT                   /old_locus_tag="KLTH-ORF9221"
FT                   /product="KLTH0E07854p"
FT                   /note="weakly similar to uniprot|P12383 Saccharomyces
FT                   cerevisiae YGL013C PDR1 Zinc cluster protein that is a
FT                   master regulator involved in recruiting other zinc cluster
FT                   proteins to pleiotropic drug response elements (PDREs) to
FT                   fine tune the regulation of multidrug resistance genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23384"
FT                   /db_xref="GOA:C5DHX3"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHX3"
FT                   /protein_id="CAR23384.1"
FT                   /translation="MPETEILASGVIKKKRSKVSRACNNCRRRKIKCTGANPCLNCQTY
FT                   KCECTYNLQSPPTIGTGDFSLNTRGVPLKTAASGISAPKPTIAAKAPVGFIPCDSVPPV
FT                   CTSSSSLDADSTSVPQAKIFAGLPNGLYEDDSEILKQLSRLSEALKALKCMPPSARMTG
FT                   AIQNIQDQIDDIQTSWRPAVRMNATNSVSEATTSLETRLMINKYTDNVSLTRFSTIQPS
FT                   PVLSQSNFLNQQPVVDDTFGLYSPGLLLSVRGIGYLFKNFFNPGAKMAREYKTTLYMML
FT                   RFFDTCFYHLDLAAKSWLSPIETYYELISKPFNSKAQSIKDLIDEIPGSLIAKSKEAFP
FT                   EFPQPSNIDEKLPMFHWLIRLSETVSFEPNPEYFGSANQSCDPPSIENYLRCTEILFIL
FT                   TFEYLHTTIHTPFGDLDFLESLLILMKHQYWVGEYHFFFQIISMAVGYAQNLGIHRWEF
FT                   YVGIDEELAERRRSMWWKCYCWDKNYAIRTGKQAVINDNSVNCLLPRFFRNLGFLDKDD
FT                   FLKRVTLLKGTIGGSVLDIAEYFATAISILMGDFFSNVLYNNVYTDFRNQAKPPSFREK
FT                   LMFDLIEDVRKFIERFEASQQHAQGLSEYITKCETSNDLPSSDMFSCDRNVSYKAAAIV
FT                   VYSHFVLSVCLVSVEHLFARLKTGNFPVRISEALGKNRGRVSTSWRFVMTMMSRSSIHL
FT                   MWRIMIPGSILFLTVLSDLFTQCNGRVIEDVILVLRVSRNFDSVGPTDDCCNDMINKSR
FT                   IIRQLMKCRTFFLIMVRISLQLFMRTSHISVVDMLNLIAQQDITLVATAEAILNGTNKN
FT                   FKQCFLAMERSSVHLNIERSLEQEQALINSQSAANLEIGDQFPAPKVEDFGPSFSTLKS
FT                   RESEGNERVPGSTVKQGTFAPSSPTMNFNLGSLDDFLNYGEDDLYNKLWSDINTEFPDF
FT                   LQQDSMQQ"
FT   gene            complement(<722528..>724660)
FT                   /locus_tag="KLTH0E07876g"
FT                   /old_locus_tag="KLTH-ORF9218"
FT   CDS_pept        complement(722528..724660)
FT                   /locus_tag="KLTH0E07876g"
FT                   /old_locus_tag="KLTH-ORF9218"
FT                   /product="KLTH0E07876p"
FT                   /note="similar to uniprot|P25339 Saccharomyces cerevisiae
FT                   YGL014W PUF4 member of the PUF protein family YGL014W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23385"
FT                   /db_xref="GOA:C5DHX4"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHX4"
FT                   /protein_id="CAR23385.1"
FT                   /translation="MSEQQPQVDAQVSETINSALDQLHLDDLSGSSHPSEQPATAASPS
FT                   ANGSFPPPPMMGMGFMHYPHMMHLPHSPGFFHAPGATDPFTADPTADLASADAAVFSVQ
FT                   QGMPHTTTGPGAASNAGPAPALDIGFSGIDPLWSSSDQGLNADYPFIAPKLPDSSNASR
FT                   RQTFPAVSGTELIHDASGVRTQSISLERIDPDLSASKEPGDSDADISQKSAANASYSAA
FT                   AYPYGGPLVQPNPVLSGHNPPGTAPGYGIPSPFHAYGFSSPFQSFSPVPGTPLAPQSAN
FT                   MNSSTTEALGKEGGAQENPASPRSASSQPLAPWMYGNHPFGPMVPIAHHQMMPPPGNNN
FT                   ARLHPASHHNNRHPMHSRKHKGSNNQKPYHRKGEDPAKYANAKLDDYIGNILSLCKDQH
FT                   GCRFLQRQLDIGGCNAANSIYLETRDYVVELMTDSFGNYLIQKLLERVTDDQRLELVRS
FT                   SAQSFVYIALDPHGTRALQKLVECISTEEEAGIVVDSLRGSIVELSRDLNGNHVVQKCL
FT                   QKLKPEDFQFIFDAAIESCVKIATHRHGCCVLQRCLDHGSKEQFQQLCEEIIAHVDELA
FT                   TDPFGNYVVQYILTKQTERSASEYTNRIVNILKPKIIELSLHKFGSNVVEKVLRTPVVS
FT                   ELMITELLNRSGDSKIDQLLHDGYGNYVLQTALDIARENNKYLYQRLSDTLKPLLVGPV
FT                   RNTPHGRRIMGILEFE"
FT   gene            <725950..>727152
FT                   /locus_tag="KLTH0E07898g"
FT                   /old_locus_tag="KLTH-ORF9213"
FT   CDS_pept        725950..727152
FT                   /locus_tag="KLTH0E07898g"
FT                   /old_locus_tag="KLTH-ORF9213"
FT                   /product="KLTH0E07898p"
FT                   /note="highly similar to uniprot|Q03558 Saccharomyces
FT                   cerevisiae YHR179W OYE2 Widely conserved NADPH
FT                   oxidoreductase containing flavin mononucleotide (FMN)
FT                   homologous to Oye3p with slight differences in ligand
FT                   binding and catalytic properties may be involved in sterol
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23386"
FT                   /db_xref="GOA:C5DHX5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHX5"
FT                   /protein_id="CAR23386.1"
FT                   /translation="MTFVKDLKPIALQDTKLFEPIQIGDTTVEHRAVMCPLTRMRAHHP
FT                   GNVPNKDWALEYYDQRSKAPGTMIITEGTFPSPQCGGYDNAPGIWSKEQIEQWKKIFAK
FT                   IHENKSFAWVQLWVLGRQAPCDTLKRDGLRYDSASDEVYMDDASEKKAIECDNRQHGIT
FT                   KEEIKQYVKDYVQAAKNSIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRA
FT                   RFVLEVVDAVVDAIGEKKVGIRFSPYGTFGNMSGASDPGLIAQYAYVVGELEKRAKAGK
FT                   RLAYIHLVEPRVTNLSLTEGQGWYKEGSNDFVYSIWKGPVIRAGNYALDPSAARDDVQK
FT                   NDRTLIGYGRLFISNPDLVQRLKEGLPLNKYDRDTFYAMTDKGYIDYPTYAEATKVAAS
FT                   Q"
FT   gene            <728285..>729487
FT                   /locus_tag="KLTH0E07920g"
FT                   /old_locus_tag="KLTH-ORF9209"
FT   CDS_pept        728285..729487
FT                   /locus_tag="KLTH0E07920g"
FT                   /old_locus_tag="KLTH-ORF9209"
FT                   /product="KLTH0E07920p"
FT                   /note="highly similar to uniprot|Q03558 Saccharomyces
FT                   cerevisiae YHR179W OYE2 Widely conserved NADPH
FT                   oxidoreductase containing flavin mononucleotide (FMN)
FT                   homologous to Oye3p with slight differences in ligand
FT                   binding and catalytic properties may be involved in sterol
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23387"
FT                   /db_xref="GOA:C5DHX6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHX6"
FT                   /protein_id="CAR23387.1"
FT                   /translation="MTFVKDLKPIALQDTKLFEPIQIGDTTVEHRAVMCPLTRMRAHHP
FT                   GNVPNKDWALEYYDQRSKAPGTMIITEGTFPSPQCGGYDNAPGIWSKEQIEQWKKIFAK
FT                   IHENKSFAWVQLWVLGRQAFPDTLKRDGLRYDSASDEVYMDDASEKKAIECDNRQHGIT
FT                   KEEIKQYVKDYVQAAKNSIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRA
FT                   RFVLEVVDAVVDAIGEKKVGIRFSPYGTFGTMSGASDPGLIAQYAYVVGELEKRAKAGK
FT                   RLAYIHLVEPRVTNPFFTEGQGWYKEGSNDFVYSIWKGPVIRAGNYALDPRAARDDVQK
FT                   NDRTLIGYGRLFISNPDLVQRLKEGLPLNKYDRDTFYAMTDKGYVDYPTYAEATKVAAS
FT                   Q"
FT   gene            complement(<730431..>733136)
FT                   /locus_tag="KLTH0E07942g"
FT                   /old_locus_tag="KLTH-ORF9204"
FT   CDS_pept        complement(730431..733136)
FT                   /locus_tag="KLTH0E07942g"
FT                   /old_locus_tag="KLTH-ORF9204"
FT                   /product="KLTH0E07942p"
FT                   /note="highly similar to uniprot|P05030 Saccharomyces
FT                   cerevisiae YGL008C PMA1 Plasma membrane H -ATPase pumps
FT                   protons out of the cell major regulator of cytoplasmic pH
FT                   part of the P2 subgroup of cation-transporting ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23388"
FT                   /db_xref="GOA:C5DHX7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHX7"
FT                   /protein_id="CAR23388.1"
FT                   /translation="MSAATTEPTKEKPVQPVESDEEDDDIDALIDELQSNHNLDEEDEE
FT                   DDVKVAAGEARPVPEELLQTDPSYGLTSDEVTKRRKRYGLNQMAEESESLIVKFLGFFI
FT                   GPIQFVMEAAAILAAGLEDWVDFGVILGLLFLNAAVGFIQEYQAGSIVDELKKSLANSA
FT                   VVIRDGNLVEIPANEVVPGDIMQLEDGTVICADGRLVTEECFLQIDQSAITGESLAVDK
FT                   HYGDTTFSSSTVKRGEGFMIVTATGDNTFVGRAAALVNQASGDQGHFTEVLNGIGTILL
FT                   VLVIVTLLLVWTACFYRTVRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQ
FT                   AIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLMLTACLAASRKK
FT                   KGLDAIDKAFLKSLAQYPRAKNALTKYKVLDFHPFDPVSKKVTAVVESPEGERIICVKG
FT                   APLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMD
FT                   PPRDDTAQTVNEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMP
FT                   GSELADFVENADGFAEVFPQHKYAVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVE
FT                   GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIA
FT                   ILNNSLDIDLIVFIAIFADVATLAIAYDNAPFDQKPVKWNLPRLWGMSIILGVILAVGT
FT                   WLTLTFMFVPKGGIIQNFGSIDGVLFLQISLTENWLIFITRAVGPFWSSIPSWQLSGAV
FT                   FIVDIIATMFCLFGWWSQNWNDIVTVVRVWVFSFGVFCVLGGAYYLMSGSVAFDRLMNG
FT                   KPMKEKPPTRSVEDFLVAMQRVSTQHEKGN"
FT   gene            <735214..>736338
FT                   /locus_tag="KLTH0E07964g"
FT                   /old_locus_tag="KLTH-ORF9193"
FT   CDS_pept        735214..736338
FT                   /locus_tag="KLTH0E07964g"
FT                   /old_locus_tag="KLTH-ORF9193"
FT                   /product="KLTH0E07964p"
FT                   /note="similar to uniprot|P25377 Saccharomyces cerevisiae
FT                   YCR105W ADH7 NADPH-dependent cinnamyl alcohol dehydrogenase
FT                   family member with broad substrate specificity may be
FT                   involved in fusel alcohol synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23389"
FT                   /db_xref="GOA:C5DHX8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHX8"
FT                   /protein_id="CAR23389.1"
FT                   /translation="MTYPEQFQGFAISDPKDWATPKLTSFQPKNFGPRDVDIEVECCGI
FT                   CASELFALKNDWTHEPLACLSSKYGPKTQVVGHEVVGKVVAVGPEVSLCKVGDRVGLGA
FT                   QASACMQCSRCQSSNEQYCAQSIGTYCNPYPDGYVSQGGYASHVRAHEQFCFPIPPEIP
FT                   SELVAPLQCGGLTVFSPIKRNIQGKKNPRVAIIGIGGLGHMAIMISKALGAEVSAVSRG
FT                   YSKRDDALKMGADHFIATSEPNWNAGLDDTFDLILNCASSTSSLDLNALLPCLKVNCNF
FT                   VSVGLPHIDEDFKVKPFSFFHNGCNIGSSKLGSREEAIELMQLAVKHNFRPWVETIKVS
FT                   EAGVSEGLTRLDKGDVRYRFTLTGFHDFFGTGKQ"
FT   gene            complement(<736516..>736599)
FT                   /locus_tag="KLTH0E07986r"
FT                   /old_locus_tag="Klth0E.tAla.TGC.25"
FT   tRNA            complement(join(736516..736551,736563..736599))
FT                   /locus_tag="KLTH0E07986r"
FT                   /old_locus_tag="Klth0E.tAla.TGC.25"
FT                   /note="tRNA-Ala (TGC) cove"
FT   gene            complement(<737128..>737209)
FT                   /locus_tag="KLTH0E08008r"
FT                   /old_locus_tag="Klth0E.tSer.AGA.24"
FT   tRNA            complement(737128..737209)
FT                   /locus_tag="KLTH0E08008r"
FT                   /old_locus_tag="Klth0E.tSer.AGA.24"
FT                   /note="tRNA-Ser (AGA) cove score=80.04"
FT   gene            complement(<737680..>738540)
FT                   /locus_tag="KLTH0E08030g"
FT                   /old_locus_tag="KLTH-ORF9187"
FT   CDS_pept        complement(737680..738540)
FT                   /locus_tag="KLTH0E08030g"
FT                   /old_locus_tag="KLTH-ORF9187"
FT                   /product="KLTH0E08030p"
FT                   /note="similar to uniprot|P39707 Saccharomyces cerevisiae
FT                   YAR008W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23390"
FT                   /db_xref="GOA:C5DHX9"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016690"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHX9"
FT                   /protein_id="CAR23390.1"
FT                   /translation="MVGSKVAIVLLQRDGEAGTPLVFDIASIEKLRSIGVAGILTGTLP
FT                   SATQQNAFLSVPLRLMAEEALWLVEKQLGYLVHGGGVVHTAAEAVKAEDMKEARNELER
FT                   SFEAQREFKRQQHLEKLRRLGVKAENSSGTETDYSRLLESSLFIETCDSSALISQRQRE
FT                   FDKPEIQARLAQQLRTGCKCKGDFHVYKALREQGYFLSPGSRFGGRFIAYPGDPLRYHS
FT                   HMTVQPAMDYRRDPLDLLQVVSGGRLGTGVKKLWVVGGVKDDYDSTDAESGRVSFFSVE
FT                   WAGFG"
FT   gene            <739063..>742779
FT                   /locus_tag="KLTH0E08052g"
FT                   /old_locus_tag="KLTH-ORF9184"
FT   CDS_pept        739063..742779
FT                   /locus_tag="KLTH0E08052g"
FT                   /old_locus_tag="KLTH-ORF9184"
FT                   /product="KLTH0E08052p"
FT                   /note="similar to uniprot|P38929 Saccharomyces cerevisiae
FT                   YGL006W PMC1 May be involved in depleting cytosol of Ca2
FT                   ions putative vacuolar Ca2 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23391"
FT                   /db_xref="GOA:C5DHY0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHY0"
FT                   /protein_id="CAR23391.1"
FT                   /translation="MGEQSPSSKVDDASEHADSIKFRSSEFKLKPDQLAELHDPKSMAA
FT                   FVNLFDEDPNNLYTFLGTDKGSGLNIADEDVTETERYKIYGDNRIPQRKPKSFLELAWE
FT                   AFQDRIMILLTVAAVISFALGLYETLGQPPEYDSEGKEITKVDWVEGVAIMIAVLVVIL
FT                   VGSANDYQKELQFSKLNNKKNDREIIVLRNGDEHLISIHDILVGDIIVLQTGDVVPADC
FT                   VLVKGSCECDESALTGESQTIKKASIDVACSKYKHLSANDAAIDIGVRAAEKVPDPMLI
FT                   SGSKLLSGLGRAVVTSVGVNSVHGRTLMSLKVENETTPLQERLDSLANSISVYGSVAAL
FT                   ILFIVLFIRFLVNLKKGGHLSGLSPAQKGSRFMNIFIVAITIIVVAVPEGLPLAVTLAL
FT                   AFATTRMAKDGNLVRVLRACETMGSGTAVCSDKTGTLTENRMTVVKGFLGTTHFDETEE
FT                   TSEVVEPEDHIISKDCPQATKKDLLVNITLNSTAFENKDDDEGMESNENPFHKPRKTLF
FT                   PWSRNNRKERHTTANELIENAPDQDREPFIGSKTETALLSFARKHLDMQDLQNYREHPE
FT                   NLDVAEVVQVIPFESVRKWGGVVLKYNDGTYRFFIKGAAELILKRCKQKRTSDGKSGSI
FT                   SEEDFESASRTITGLAADALRAISLAHRDFLNCQSWPPEELQDPADPSLALPDRLFGDE
FT                   VSFLGSHTDPSGVPKEGLVLDAIVGIQDPLRKGVRVAVEQCQKAGVTVRMVTGDNILTA
FT                   TAIARNCSILQGGFADDPDSSMEGPKFRKLATKERRRIVPKLRVLARSSPEDKRILVET
FT                   LKEMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIK
FT                   WGRCVSTSIKKFIQFQLTVNITAVVLTFVSAVASAEETSVLTAVQLLWVNLIMDTLAAL
FT                   ALATDKPDENILDRKPRGREAPLITVSTWKMILGQSTLQLIVTFVLHFAGKQIFFPHKA
FT                   HITGHEQQQLNAMTFNTFVWLQFFKLIVTRKLDEADGISNVRDRITASNLNFFQDLFRN
FT                   YYFLVIILLIGGFQVLIMFVGGAAFSIAKQTGAMWATAIICGMLSLPVGVIIRIIPDEW
FT                   VLKVFPSRFVKMILYVLGFKFLRKSGNKNEEEESLLDSNSDAKLVGSTAFERAKTEMLA
FT                   FKDHVGLDNNHLNPFQAYKKWRHSSSSSAGSDSEESHYYIASATMVPTLVGGAVGGFSH
FT                   ITMKDGPSDKKAS"
FT   gene            complement(<742927..>743691)
FT                   /locus_tag="KLTH0E08074g"
FT                   /old_locus_tag="KLTH-ORF9179"
FT   CDS_pept        complement(742927..743691)
FT                   /locus_tag="KLTH0E08074g"
FT                   /old_locus_tag="KLTH-ORF9179"
FT                   /product="KLTH0E08074p"
FT                   /note="similar to uniprot|P53195 Saccharomyces cerevisiae
FT                   YGL005C COG7 Component of the conserved oligomeric Golgi
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23392"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHY1"
FT                   /protein_id="CAR23392.1"
FT                   /translation="MCTEDELLKMFFDEEFVPHAYLDILLSAENMPISELQSISTTLLS
FT                   KLDLYTDCLTRELGSTIDKLRKPTELLSFSTSYSQAEGTTKLEYYLETLGNSVKNLKDD
FT                   IAGVNKQLTEIKKNNQESTKTVVDIKDLKTVKTNLQKVLNCFEQLRSIVIISAEITDKS
FT                   QPQELISVSSFKSSLKVLGDIIVSSFKESSETELSSVQNEELLKKVGYFADLKPVFKDL
FT                   TKYYSLYGAFIDRIKHEADIYIQGKDIDPSFA"
FT   gene            complement(<743809..>745041)
FT                   /locus_tag="KLTH0E08096g"
FT                   /old_locus_tag="KLTH-ORF9178"
FT   CDS_pept        complement(743809..745041)
FT                   /locus_tag="KLTH0E08096g"
FT                   /old_locus_tag="KLTH-ORF9178"
FT                   /product="KLTH0E08096p"
FT                   /note="similar to uniprot|P53196 Saccharomyces cerevisiae
FT                   YGL004C RPN14 Putative non-ATPase subunit of the 19S
FT                   regulatory particle of the 26S proteasome localized to the
FT                   cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23393"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHY2"
FT                   /protein_id="CAR23393.1"
FT                   /translation="MSPLINYNIQPDFVDCIRDVQNGVLAEDSFYVNVEPSAYEVDEFR
FT                   VKVKLQEEVLVFDAGTGNSFKQTGRRTFEARLGSHHCKFQTAHDNYSSAAELGSPDFTS
FT                   VDVFQKDGTCLYAIGNTAGEVSVHDSQREQIQILKGHKAEITDVKFFPSGQVVLSSSMD
FT                   MQLKVWSVLDGSNPRTLKGHKGSITTSAIVDRGRNVLSGSKDGTVKLWECGSGEAIHTF
FT                   ARSSNRTDAINAMVLLGHATTASDDKHLEFGTTGKIVLAGHESGTISCHDLYSKEQLLE
FT                   LPNQFMSACWSLTSNSQCSTSSTESPLFLYAGYANGVLAQWDLRMPSKAIDSICWNQGS
FT                   PVTALHFQSQRLFASSDLDSSAAFHVDLDSGTIQNPTFLVSQETKISAYAPLDDQQRTL
FT                   AVGSGGLCAVY"
FT   gene            <745621..>747495
FT                   /locus_tag="KLTH0E08118g"
FT                   /old_locus_tag="KLTH-ORF9177"
FT   CDS_pept        745621..747495
FT                   /locus_tag="KLTH0E08118g"
FT                   /old_locus_tag="KLTH-ORF9177"
FT                   /product="KLTH0E08118p"
FT                   /note="similar to uniprot|P22336 Saccharomyces cerevisiae
FT                   YAR007C RFA1 Subunit of heterotrimeric Replication Factor A
FT                   (RF-A) which is a highly conserved single-stranded DNA
FT                   binding protein involved in DNA replication repair and
FT                   recombination"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23394"
FT                   /db_xref="GOA:C5DHY3"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004591"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013955"
FT                   /db_xref="InterPro:IPR031657"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHY3"
FT                   /protein_id="CAR23394.1"
FT                   /translation="MSDTNLTQGELRGIFTTEEKYHNATGGIYQCVRTRKNDPSNHANR
FT                   KNLIVVSDGMHRVKALLRNEAVQKAQDAELHSGDIFRLTRGEPAIVKEKKKYVLLIDDL
FT                   EIIQSRAEIQNPNCELIDNYLIAHPDEVFSSEESAPAQGSSFTGRQQQPQQPQAQNFQK
FT                   PQQYAPQAQQNYNNSNNFSSSQKSRPIFAIEQLSPYQNMWTIKARVSFKGDIKTWSNQR
FT                   GEGKLFNVNLLDNSGEIRATTFSENVDKFYNLLQEGKVYYVSKARIQPSKPQFSNLAHP
FT                   YELQLDRDTVVEECFDDVDVPKMNFSFVKLNTMESQEANSIVDVIGIIRTVNPPFEITS
FT                   KAGKRFDRRDIILVDDSGYSVNVGLWGQQALEFNLPEGSVVAIKGGRVTDFNGKGLSMG
FT                   FNSTMHPSPEVPEAYAIKGWYDSVGRNAQFHSLKQEPGAGGGNAARFIANRISIAKAQA
FT                   DNLGMSERGDYFSIKAAVSYLRVDNLAYPACANENCNKKVIEEPDGTWRCEKCDANHPE
FT                   PQFRYMLTVSVLDETGQIWLTLFNEQAEQLLGVDANSMVKYKESDPSKFARITQKIQMN
FT                   QYDFRVRARADNYNDETRIRYTAANVHNLRFGAEAEFLAEELGKVFLN"
FT   gene            <747649..>749547
FT                   /locus_tag="KLTH0E08140g"
FT                   /old_locus_tag="KLTH-ORF9174"
FT   CDS_pept        747649..749547
FT                   /locus_tag="KLTH0E08140g"
FT                   /old_locus_tag="KLTH-ORF9174"
FT                   /product="KLTH0E08140p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23395"
FT                   /db_xref="GOA:C5DHY4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHY4"
FT                   /protein_id="CAR23395.1"
FT                   /translation="MKVIKRRRSIKSCKYCYEHKLKCNKQSPCNNCARLGITNFCVYGF
FT                   KKDEVDAKPLSSTETFKPKDQVLKTSSTHPKTKPYYPYLSGANAEEVLSNRHQAHKNPT
FT                   DACMKRNEVTNFNKFDVKCMSVEEVASLIPPSQASTFLVVDVYFHKIHPIIPVLDREEV
FT                   FRQIEEVYSQIRLQRTICVSSSITVFAILFSVAYSNVAEGQIPDLLLCEKYFSAFQALL
FT                   NINCFPYRPSLNAVQGLLVTSFVVDPNMVETLGISATLLRHAQQIGVHKLKVPSGSTRN
FT                   EIVRTLWHFLLYFEGSSSVVAGLPFLSSQQLFNLVNLPKEGDALEPSHAAFANGRFHIN
FT                   NMFRKIMSYKDEGIVPAGSSMLETKREANSLNDKVEGLCKIIEETNHEHAIYFVSTLRI
FT                   FLLRAHLRFKALVTEKKKAAQVRPEKKQNVRFFNDAVGKVLNSGSSMDGETAELSIILL
FT                   SYTLRRLVSSSCTKFSWYSKGSTVMQYLFILVKDIYQSPEMAYDFSRPDFEVPIVLSQD
FT                   ILECSIADPVYFKVALVEELLKLLEMKLVPLWSDEDLNIFRLVRCIKERVWELNSFMIE
FT                   TNRHRFQPIYACSLFQHCAANLESMNSFNFEECMKQWELDKITFDSERILNCLSDF"
FT   gene            complement(<749584..>751254)
FT                   /locus_tag="KLTH0E08162g"
FT                   /old_locus_tag="KLTH-ORF9173"
FT   CDS_pept        complement(749584..751254)
FT                   /locus_tag="KLTH0E08162g"
FT                   /old_locus_tag="KLTH-ORF9173"
FT                   /product="KLTH0E08162p"
FT                   /note="similar to uniprot|P53197 Saccharomyces cerevisiae
FT                   YGL003C CDH1 CDC20 homolog 1 protein required for Clb2 and
FT                   Ase1 degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23396"
FT                   /db_xref="GOA:C5DHY5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR033010"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHY5"
FT                   /protein_id="CAR23396.1"
FT                   /translation="MSEEMRNPFISNTPSSSPAKSRVQSGNRITKRDTSSSSSLTSVNS
FT                   SPLRRPRSSNGGYTDRFLPNRTNMDLKSVISIGSSQLPRLVPSDSDNHLEVRREQEAHE
FT                   TFDAVLKNELFGEKLCEASNENEDSIERIKYTATFPYREPSTPPRSQEASGRDALLSPS
FT                   PSSPATPRRLTFENHSKPSSSSMRGASLLTYCEKKASRPSAASLLQSQYSSSASPVRPD
FT                   SKKLLLSPSKKVRQISKIPFRVLDAPSLADDFYYDLVDWSSADMLAVALGKSIFLTNNN
FT                   TNEVAQLAKTDDDYTSLSWVGAGSHLAVGQANGLVKIFDVEKKRCIRTIPGHIDRVACL
FT                   SWNNHILTSGSRDRRILHRDVRTPEPCFEEIRTHKQEVCGLKWNVDENQLASGGNDNVV
FT                   FVYDGTSRKPILTLAEHTAAVKAMAWSPHRRGVLATGGGTADKRLKIWNVRTSTKLHDV
FT                   DTASQVCNMIWSRNTNEIITSHGYSKYNLTLWDGVNAEPIAILKGHSFRVLHMTLSADG
FT                   TTIVSGAGDETLRYWKLFDKPRPQAHAASALLSTFNQLR"
FT   gene            complement(<751459..>752772)
FT                   /locus_tag="KLTH0E08184g"
FT                   /old_locus_tag="KLTH-ORF9170"
FT   CDS_pept        complement(751459..752772)
FT                   /locus_tag="KLTH0E08184g"
FT                   /old_locus_tag="KLTH-ORF9170"
FT                   /product="KLTH0E08184p"
FT                   /note="similar to uniprot|P39706 Saccharomyces cerevisiae
FT                   YAR003W SWD1 Subunit of the COMPASS complex which
FT                   methylates histone H3 on lysine 4 and is required in
FT                   transcriptional silencing near telomeres"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23397"
FT                   /db_xref="GOA:C5DHY6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037850"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHY6"
FT                   /protein_id="CAR23397.1"
FT                   /translation="MANLLLQDPFSVLKEYPERLTQTFETPFHTCCVQFSYAGDYLAMG
FT                   CSNGAVMIYDMDTTKPIAMLGGTSGAHVRSIQSIAWSRSGRYVLTSSRDWFVKLWDMKT
FT                   PGEPFRQVKFGSSPWTCQWTFLSEWKCVVTVYEETHAFVVDFAEDVPHARELLASTELQ
FT                   EPEEEGDQKERDYGYTLVVCSHPKHTSVIITGTSKGWLKAYLVDGEKTELVCSYRFAPT
FT                   NAKHIIMSQSGDRMAINSSDRTIRQYLVTVSDDLKEINFTLEHKYQDVINKLQWNSIFF
FT                   SSNSAEYLVASTHGSSAHDLYLWETSTGTLVRVLEGTDEELLDIDWNFYNMCIASNGLE
FT                   TGNVYIWSLVISPKWSALAPDFEEVEENIEYREKEDEFDQVGQLEQQQEMDQAEEVRID
FT                   LRCRERYDVRGNEIAVDRFVVPLDYESILVLKNWHKNG"
FT   gene            <752883..>753542
FT                   /locus_tag="KLTH0E08206g"
FT                   /old_locus_tag="KLTH-ORF9169"
FT   CDS_pept        752883..753542
FT                   /locus_tag="KLTH0E08206g"
FT                   /old_locus_tag="KLTH-ORF9169"
FT                   /product="KLTH0E08206p"
FT                   /note="similar to uniprot|Q05359 Saccharomyces cerevisiae
FT                   YAR002C-A ERP1 Protein that forms a heterotrimeric complex
FT                   with Erp2p Emp24p and Erv25p member along with Emp24p and
FT                   Erv25p of the p24 family involved in ER to Golgi transport
FT                   and localized to COPII-coated vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23398"
FT                   /db_xref="GOA:C5DHY7"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHY7"
FT                   /protein_id="CAR23398.1"
FT                   /translation="MKLFTCLLQLSALLLLTPFANAFYYYSSGGERRCFHKELPKNTLL
FT                   QGKYSVQTYDDKAKAYVTPSRDQLSVVVEVEEIFDDNHRVMNQKLAAQSEFTFNAHDSG
FT                   EHKICIQPQSTGWLAKVKTKVDIEFQTGSDASLDSKGKNTMQSLQSKIKVLNDRVEEIR
FT                   REQELVREREAMFRDVSESANSRAMWWTVFQVVVLAGTCAWQLRHLRTFFVKQKIL"
FT   gene            complement(<753687..>755018)
FT                   /locus_tag="KLTH0E08228g"
FT                   /old_locus_tag="KLTH-ORF9168"
FT   CDS_pept        complement(753687..755018)
FT                   /locus_tag="KLTH0E08228g"
FT                   /old_locus_tag="KLTH-ORF9168"
FT                   /product="KLTH0E08228p"
FT                   /note="weakly similar to uniprot|P39705 Saccharomyces
FT                   cerevisiae YAR002W NUP60 Subunit of the nuclear pore
FT                   complex (NPC) functions to anchor Nup2p to the NPC in a
FT                   dynamic process that is controlled by the nucleoplasmic
FT                   concentration of Gsp1p-GTP potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23399"
FT                   /db_xref="GOA:C5DHY8"
FT                   /db_xref="InterPro:IPR034432"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHY8"
FT                   /protein_id="CAR23399.1"
FT                   /translation="MNAKLEPNSNDNNLGDTEEAKLPNLTLAQFFREKGDEPLSEIEYE
FT                   GVLSLIKRSKSASLVEDTQNALMAGNNSSELSSAVLKPSSVREASLKAPSFRPKYDEFA
FT                   STANTSLRSVVSAGSRKSRVFDYSSLPSPYRSCSYRHSTTDAILAQKNTAGLESSGADA
FT                   FSTSSDKMSNTASALISLLDSREAKSEASGLANPYSTRVSEFKRYRRDPESDRFVPHTP
FT                   SKANGASSPAHSIALSEIQNNENKEAETTEKPTNQQFTKYRPAKASSLRTTVSAKKSPG
FT                   AESSKPLGSVPHLQETDAPVVPKSSFGFSYPALAMSFDKSSRNANSANSTGKMAAGVSE
FT                   EGTETKPASSMNTKTTPSFNFSQQLGARKANSPAQTSLAAFAKESDQSSARKANEGQSS
FT                   RELQSAFSNNEPLQFDFSAPPASGIDPASIDEELVQKSRNIYVF"
FT   gene            complement(<755415..>755524)
FT                   /locus_tag="KLTH0E08250r"
FT                   /old_locus_tag="Klth0E.tPro.TGG.23"
FT   tRNA            complement(join(755415..755450,755489..755524))
FT                   /locus_tag="KLTH0E08250r"
FT                   /old_locus_tag="Klth0E.tPro.TGG.23"
FT                   /note="tRNA-Pro (TGG) cove"
FT   gene            complement(<756153..>759689)
FT                   /locus_tag="KLTH0E08272g"
FT                   /old_locus_tag="KLTH.mRNA.133CO.m"
FT   CDS_pept        complement(join(756153..759562,759623..759689))
FT                   /locus_tag="KLTH0E08272g"
FT                   /old_locus_tag="KLTH.mRNA.133CO.m"
FT                   /product="KLTH0E08272p"
FT                   /note="similar to uniprot|P34111 Saccharomyces cerevisiae
FT                   YAL001C TFC3 Largest of six subunits of the RNA polymerase
FT                   III transcription initiation factor complex (TFIIIC); part
FT                   of the TauB domain of TFIIIC that binds DNA at the BoxB
FT                   promoter sites of tRNA and similar genes; cooperates with
FT                   Tfc6p in DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08272g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23400"
FT                   /db_xref="InterPro:IPR007309"
FT                   /db_xref="InterPro:IPR035625"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHY9"
FT                   /protein_id="CAR23400.1"
FT                   /translation="MALLAPDELVQRLCEEIAYNGGKITLGGFWDLVTELTNKPDERMK
FT                   LFILRCFDSHPETAITKEGEVLEVSNYNDFYEDVQGVKCTISEDRLYMFLTGYRKKECL
FT                   VGGLAFDLLVEIAKTKEKGINTMDLAQVTSQDPRSITGRIKKLGNLVSGVQTIYKGHVV
FT                   KNLKFFRFVDGKEPSKSYTSMRDSLPKIVDVVKNSKNGVRQLIDLKRELKFDKDKRLSK
FT                   SFIAAISSLDEMGYLKKVLVVSPSSPTVKIRCVKFLRDYVPEDRSANDFEDETDGGEDT
FT                   DGKPTAESVMGEEDDENEIYGNENATQALQERNLVVEDEMKPERRTFLLNRFFPFQNQT
FT                   FALVDNHGKTGLSSMQAVNLISGSDYKRSFTKCSEYYIETVGKDDDVGNGFGLVRAYDF
FT                   EGKKKFYRLFTKSHFQNMVSAQRPESEGVFRPLKGQHATLQELSLKNFSPLSNTIRFIH
FT                   TEGSDRFFWNGDLKVPANQNAAPRGRKRKQLKTEVNDNGTVKKVKQEIQGALEGPLDEG
FT                   SRPGATSSLEKAGVTVSEGGEAEKQKAILNIGGFSAGSLKSLQRQRAILEAVKRNGGVT
FT                   FFRDQFFDDVTKLMESKTTLDKKTIRGDVELLRATQKLVLKVDQSSGRRLMCLPNVSSE
FT                   EISKFLVNEKDSKKSYFRDVIQNTDIYFFDQTQRDRFHRGKKSAERIKNFEHRSNSGRR
FT                   TKASRPSKKPVKKLNAGLDDSSTNRQSLVENNMAQYKSGDSVHSPRYNVGTKAGVRALI
FT                   MSAVITKSLRGQIMWDLITKLFPNNSISNLKKQWTARRIRMGHGGWKGLLEKWRKVIVD
FT                   AMKDERVTMEDVEQLELPKLVELWENSDQERSKQSITLFKSHEENLRNLTIVKEPSSSA
FT                   CANNPDQSSMVQRETGLLRKCYTYVARDKELSFPVDDELRAIIRSILIDKSARDLEGIK
FT                   LLERFSRDEVDKTILEMAKEKQVLFIGQSKLQLSDSVLDFLNKKGDDAFLKSAVNYRAQ
FT                   LFIFLNDQKGVLLNEEIKNHAALVLIDLMNSNKIGIAEVPLLPQEIQMHYSTRKYEVGA
FT                   LTPPLLITKTTVELPFKGHGPIPVGEPHSRIWVDSEGCIRKEIWRKVVALVLQEICFNP
FT                   GITLRRLAGKNSQLLSMSEISEVITWCMKEKLVSKLAFEGLNIEGSWYSAF"
FT   gene            <759878..>760701
FT                   /locus_tag="KLTH0E08294g"
FT                   /old_locus_tag="Klth0E.mRNA.cn.323.p"
FT   CDS_pept        join(759878..759894,759951..760701)
FT                   /locus_tag="KLTH0E08294g"
FT                   /old_locus_tag="Klth0E.mRNA.cn.323.p"
FT                   /product="KLTH0E08294p"
FT                   /note="similar to uniprot|P53200 Saccharomyces cerevisiae
FT                   YGR001C Protein with similarity to methyltransferase family
FT                   members; required for replication of Brome mosaic virus in
FT                   S. cerevisiae, which is a model system for studying
FT                   replication of positive-strand RNA viruses in their natural
FT                   hosts"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23401"
FT                   /db_xref="GOA:C5DHZ0"
FT                   /db_xref="InterPro:IPR019369"
FT                   /db_xref="InterPro:IPR041370"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHZ0"
FT                   /protein_id="CAR23401.1"
FT                   /translation="MEDVELSLSPEALKALLEFQQEEEEREKKLKSLYADAEKKFEEVK
FT                   AQEGMRVFKEDWQLSQFWYDEETANNLAQALLEGANENTVIAILSAPSVYVAISKMSPS
FT                   CVPTKHIYLFEYDKRFEVLAGSEHFCFYDYTNPLEFPASLDGKVHRILIDPPFLNKPCQ
FT                   TKCKLQLQVLHLTSVLTFHQVGVTANKLLAKANDCGEQERRIMISTGERMAEVVSETYP
FT                   GTRKTTFTPSHANGLSNEFECYANFEWRGWKFK"
FT   misc_feature    complement(760921..761047)
FT                   /locus_tag="KLTH0E08316s"
FT                   /old_locus_tag="centromere.klth0E"
FT                   /note="Centromere Klth0E"
FT   gene            <761420..>762475
FT                   /locus_tag="KLTH0E08338g"
FT                   /old_locus_tag="KLTH-ORF9159"
FT   CDS_pept        761420..762475
FT                   /locus_tag="KLTH0E08338g"
FT                   /old_locus_tag="KLTH-ORF9159"
FT                   /product="KLTH0E08338p"
FT                   /note="highly similar to uniprot|P53199 Saccharomyces
FT                   cerevisiae YGL001C ERG26 C-3 sterol dehydrogenase catalyzes
FT                   the second of three steps required to remove two C-4 methyl
FT                   groups from an intermediate in ergosterol biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23402"
FT                   /db_xref="GOA:C5DHZ1"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHZ1"
FT                   /protein_id="CAR23402.1"
FT                   /translation="MASEGQLSVLLVGGAGFLGLHLIEKFYNVSPRPKIHVFDVRPLPE
FT                   KLSKQFTFKAADITTHIGDLTSEADVTLALQSSGANVLVHSASPMHGCSQEIYEKVNVQ
FT                   GTRNLLSVSQKLGVRAFVYTSSAGVIFNGQDIHNGDETWPIPEVPMDGYNETKAIAEDM
FT                   VLKANNRSQDFLTIALRPAGIFGPGDRQLVPGLRSVAKLGQSKFQIGDNNNLFDWTYVG
FT                   NVADAHVLAANKLLDPSSSSVVSGETFFITNDSPAYFWALARTVWKADGHIDKYNIVLN
FT                   RPLAIFAGYLSQFFSKLTGKEPGLTPFRVKIVCAYRYHNISKAKRLLGYKPLVDIEEGI
FT                   AKTLQWMDESS"
FT   gene            complement(<762740..>766468)
FT                   /locus_tag="KLTH0E08360g"
FT                   /old_locus_tag="KLTH-ORF9158"
FT   CDS_pept        complement(762740..766468)
FT                   /locus_tag="KLTH0E08360g"
FT                   /old_locus_tag="KLTH-ORF9158"
FT                   /product="KLTH0E08360p"
FT                   /note="similar to uniprot|P39702 Saccharomyces cerevisiae
FT                   YAL002W VPS8 involved in vacuolar protein sorting required
FT                   for localization and trafficking of the CPY sorting
FT                   receptor Vps8p is a membrane-associated hydrophilic protein
FT                   which contains a C-terminal cysteine- rich region that
FT                   conforms to the H2 variant of the RING finger Zn2 binding
FT                   motif."
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23403"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR025941"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHZ2"
FT                   /protein_id="CAR23403.1"
FT                   /translation="MDVKPRKDCSFLETRAQGLVNRDGLSYEPNENDLLNAFNLFEDFN
FT                   KYNITPVLWSPLEKIYPLLTPFGCPTVVYPALSYVAIGTSRGNVAIFSHKQFLQVVLAP
FT                   GDDCPVSKITRICASVDGTHIAAGLQSGDVVIWNLNGKSRSDGTNRSPRELHPILHIPD
FT                   HRPHEVTGLGFMSERHTAIIVSDNSGSISCHSAFRNHIWQLAYNTTDILTLRLKPNEAF
FT                   ATATYPGSFELAFSDIQPMALLSHTHISLISQTNSEVCFHEETPIGSYRHAQTTWSACG
FT                   TKLCYIKGKTLGLMRFKRCLPSSKLETDLHAEWHGQEMLKNVEWLTEDSIAVLTESKKF
FT                   IMFSSRQDLSVFETVDFQPINVLNPSETGFACFEKQVFVLSSYCPQIGSFLSWSDIVLR
FT                   FVQKQAFLSALKSVAYFLVTENLPTDVLGLQKSLALRRKQLAQPLRNLSIASVRHFLVH
FT                   NDQDVKPGAFIDLIMTILATFALVFEDEKESSVFIEQVLELVAKPFQPRFLEVILKLVL
FT                   REEIRILTPSVSRELLKYSSKQKSANTVADLVLKLDTSSLDINLAVKVCQKLGLASEII
FT                   YLWISSSRDCISPLVDLLLKLSNQTDKCQLIPSDTVVPDQLLFNYVSFIMTGREFPIGV
FT                   QIFPPSLAFDLKLQMCFLLFNGAIVDWPPNSGTKLYTMEKHVNEPVFPYMDLLLKKNCC
FT                   RCLAMLHEILEDSFFDDDSIPHIFPQNENEFRLRVSRQFVIDLLLDKIKESSLLDERVS
FT                   IAIFITRNLPKYPQFIRLSNHVLLDLVLILCSEYSSSLFEDAQRSLESLFAIYDSIEVR
FT                   KFIPSLKKKRFHRPLFLIYKHQGAFAHMLELCANSDQADVCANSLLDILKFGLENSLHD
FT                   KAKKQSLYGAIKANFKTIIEQDVSTVIEVFDEYDTDLHNNILDVHDQQIQYSYLRKYFQ
FT                   FASALQSLNFELFCQYVVLLCDLNYSDELCRVLTEASLSSVQCQKAYEILQEHANMQGS
FT                   VVIQRRMNDFEGVIESIVRFLGRKSINKACGRIDDQFSAYGDFAIETCLMAGREESKVC
FT                   WTKFLIFLLTHYGSLNRGQSEAYALMIQRVLESLSKLTAFDTDRDTKRLIGSVLTETLE
FT                   SQEVILSKVQELAPLFESVLNSFEVEEHILHKILQILNRSSSSVINQYDEILQNGWSIK
FT                   YNDCEICGKKIWGVGISSTVFTEWEVGAVHADKSMSNPEKQGSQAFVVFSCHHGFHTRC
FT                   LENLGQHFGAYKCLLCP"
FT   gene            complement(<766667..>767622)
FT                   /locus_tag="KLTH0E08382g"
FT   CDS_pept        complement(join(766667..767213,767543..767622))
FT                   /locus_tag="KLTH0E08382g"
FT                   /product="KLTH0E08382p"
FT                   /note="highly similar to uniprot|P32471 Saccharomyces
FT                   cerevisiae YAL003W EFB1 Translation elongation factor 1
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23404"
FT                   /db_xref="GOA:C5DHZ3"
FT                   /db_xref="InterPro:IPR001326"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR018940"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHZ3"
FT                   /protein_id="CAR23404.1"
FT                   /translation="MSFTDFSKIETLKELNTFLADKSYIEGTSASQADVSVYKAFQQAY
FT                   PDFARWFNHIAVKSGQFDSLPAAKAPAAPAEAEDDDDDVDLFGSSDEEVDEEAEKLKAK
FT                   RLAEYNAKKAAKPKPAAKSIVTLDVKPWDDETDLEEMLAGVKSIEMDGLVWGAHQWIPL
FT                   GFGIKKLQINLVVEDAKVSLEDLQVAIEEDEDHVQSTDIAAMSKL"
FT   gene            complement(<767306..>767415)
FT                   /gene="SNR18"
FT                   /locus_tag="KLTH0E08404r"
FT                   /old_locus_tag="Klth0E_snoRNA_208"
FT   ncRNA           complement(767306..767415)
FT                   /gene="SNR18"
FT                   /locus_tag="KLTH0E08404r"
FT                   /old_locus_tag="Klth0E_snoRNA_208"
FT                   /product="snR18"
FT                   /note="C/D snoRNA intronic SNR18 (U18 RNA)"
FT                   /ncRNA_class="snoRNA"
FT   gene            <768206..>769288
FT                   /locus_tag="KLTH0E08426g"
FT                   /old_locus_tag="KLTH-ORF9150"
FT   CDS_pept        768206..769288
FT                   /locus_tag="KLTH0E08426g"
FT                   /old_locus_tag="KLTH-ORF9150"
FT                   /product="KLTH0E08426p"
FT                   /note="similar to uniprot|Q06168 Saccharomyces cerevisiae
FT                   YLR321C SFH1 Involved in chromatin modeling cell cycle
FT                   progression homolog of Snf5p member of the chromatin
FT                   remodeling complex RSC"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23405"
FT                   /db_xref="GOA:C5DHZ4"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="InterPro:IPR017393"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHZ4"
FT                   /protein_id="CAR23405.1"
FT                   /translation="MSQQLLPQAFLTNFHNRIRNENVPFFITAQPSRGHKRAKVVNYAE
FT                   FETDLLEEFVEDDAKDLNGKEEENGKPMVSAEDLANENALPDLDSQDDPTNILKYPRIR
FT                   ETFLQSRIATPYKVSIAPQDVAQPMPIIIPIRLNVEHNGHKIIDFFTWNLNDHSLTPEQ
FT                   FAAIYCQDLDFPVTSVVHSQISSSISEQLQEYSTLASVTVPDLHVIINLTCNLDSKMYE
FT                   DNFEWDLNDQNLTPEQFANSVVQDLGLTREFAPAIAHALHESLLRVKKDWLEGHISPDQ
FT                   VANGAAFGYLSGIRLDVDALGVSWCPKVEVLSQWEIEKREIEKERNLRRLKRESAKVED
FT                   RSSRRSRKRRVDDLETTLRL"
FT   gene            complement(<769865..>770836)
FT                   /locus_tag="KLTH0E08448g"
FT                   /old_locus_tag="KLTH-ORF9148"
FT   CDS_pept        complement(769865..770836)
FT                   /locus_tag="KLTH0E08448g"
FT                   /old_locus_tag="KLTH-ORF9148"
FT                   /product="KLTH0E08448p"
FT                   /note="similar to uniprot|Q9URQ3 Saccharomyces cerevisiae
FT                   YLR316C TAD3 tRNA-specific adenosine-34 deaminase subunit
FT                   Tad3p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23406"
FT                   /db_xref="GOA:C5DHZ5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHZ5"
FT                   /protein_id="CAR23406.1"
FT                   /translation="MVKKKQNPLRINYQEGIIEEKLWQIRDRANINEPKLVNVWTVDIK
FT                   IGESRSFVDFIRQSVQKMEPVTFQHIKRIKKCDENNECLTVIVCSHFMIKEKDDFMHFM
FT                   QEAPFSFQNVKGSSVVPQNGPPTKSLSMEWSNLYWPLVWRGNPNDQILNSYVFDMNFIE
FT                   ATLKQISELSLAEQASGKQAAVVSAFVNPKNNEVIFVSDHRHVCSPLDHSIMRGIRSVA
FT                   ELEHQKKQDHTNKGESETYLCLDFDVYTTHEPCSMCSMALIHSRIKRCIYLTPMNKTGC
FT                   LESESGDGYCMHNNHSLNSKYEAFRWIGDEYPAAQIESNVCC"
FT   gene            <770949..>773513
FT                   /locus_tag="KLTH0E08470g"
FT                   /old_locus_tag="KLTH-ORF9145"
FT   CDS_pept        770949..773513
FT                   /locus_tag="KLTH0E08470g"
FT                   /old_locus_tag="KLTH-ORF9145"
FT                   /product="KLTH0E08470p"
FT                   /note="similar to uniprot|Q06163 Saccharomyces cerevisiae
FT                   YLR318W EST2 Reverse transcriptase subunit of the
FT                   telomerase holoenzyme essential for telomerase core
FT                   catalytic activity involved in other aspects of telomerase
FT                   assembly and function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23407"
FT                   /db_xref="GOA:C5DHZ6"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR003545"
FT                   /db_xref="InterPro:IPR021891"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHZ6"
FT                   /protein_id="CAR23407.1"
FT                   /translation="MKTLCEFIWRSAESSNDPQLSKHISEIWEKTDESFREATLHYFVT
FT                   ANCKCWDVPSIPTNDQSSVVDQCVAFLVRKKVFNNVITFGYRAADHSQVASLLHCQSTN
FT                   LNVTRLKRGIWKTVYGVLGNKRFVELMINHSIFEFGGTAYTQILGIVPREQEKLGSAQC
FT                   RSSNKAPEYLDSTLYLYKNKGNYSPSKAIPCSPEALWDQMFQIDWKDFELSHHSQLAGV
FT                   RQLLGQIIKNHQKIKYHHILNNICPRTDMQDDPNNNLCQTDIKLVSRFLVVIFEKTFPL
FT                   MFFGSRYNRSKILSKIRPLLKLKLHGRMPFSIITEGFRTSDVVWLGKCSKTDPRAALLL
FT                   QDLITQLVEWVFRRFIPSVISSVFHCCEVSATREIVFFRFDVWKAMADPFLCAYVRDNL
FT                   KKKSECCCHEAAWKMNHGCLRLVPKKKKKQFRVIFVPLRGCKTEKIAQHEEFIRKTIKP
FT                   AICVLQFLASETSPLAKKLSSPSDIPSSICLFKETLKKTYGCVPKLYFIKFDIESCYDS
FT                   IPACKAVKVLEKRLANHSEFFIRSQSYFDPVKRTLKRFSTINAQSTPCEGGVAIDKVQT
FT                   VHFTKHEILTIIKSEIEKSAIIHEGECYTRKKGIFQGTSLSAAIVDLFYSDLMENETVF
FT                   SKRNRSESLVLRLADDFLVISISKSYIESVERTVCAGFQEYNAYSNQDKILTHASPRRN
FT                   EYVRFCAMDLNLQSLEVLKHTETLSTTCAFSSSTRTLYHNLSSNFKKVLSNDLIDPNLN
FT                   SSDTILKQVFFACINVAESFCLSYVGNPAPLHGFIGFIRKLAEIAEVSCERAFPNQGIS
FT                   SDARKAVFSVFVNFLKDKNMNVQNTSRAIQALLQLTKTINSK"
FT   gene            complement(<773530..>775734)
FT                   /locus_tag="KLTH0E08492g"
FT                   /old_locus_tag="KLTH-ORF9142"
FT   CDS_pept        complement(773530..775734)
FT                   /locus_tag="KLTH0E08492g"
FT                   /old_locus_tag="KLTH-ORF9142"
FT                   /product="KLTH0E08492p"
FT                   /note="similar to uniprot|P41697 Saccharomyces cerevisiae
FT                   YLR319C BUD6 Actin- and formin-interacting protein involved
FT                   in actin cable nucleation and polarized cell growth
FT                   isolated as bipolar budding mutant potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23408"
FT                   /db_xref="GOA:C5DHZ7"
FT                   /db_xref="InterPro:IPR005613"
FT                   /db_xref="InterPro:IPR022782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHZ7"
FT                   /protein_id="CAR23408.1"
FT                   /translation="MILLCVTGTRHNNTEKRLMSAASGVPNQAATRPSAHPTMKSPKGS
FT                   SSVETSVTKLLMSTKHLLQSLTHWSKGLANERNVSDAYVQLGNDFKLLTKQFSHAGLEV
FT                   SDLGDVPSNLRQVLEVALREQPSEKTLDKYLPRIREIVVTLLEKLKVKQSMLKGMRQTN
FT                   QSLSSRNSRSSSAVSVVSGRTTPSNREVDRSASSSACASPHRSPAATSTPHKLEKQLSI
FT                   SNSRTAEEPNAALAQLKNSDTLQRRASKRFSAYHIAKLTHQSASEAAAMVTPPHSIEGS
FT                   SKEAEGSYSMVEKNDNEPALLNSVQPTPQEPENRLVNVFLKLDGKVKKCTLDLPTSFTS
FT                   LRLLFVERFTYTPGSSNFPEIYIKEPAYKEYYELEASQLDKIKDGSVLSLQSIENSKCS
FT                   TATMSFDRLCEEFEKGLKNHQAAIFAEIQSLRNSEPHSASLSSSQRKSSSCSSAEIEDI
FT                   RRQLSILNQIHNAKQKSLEENVTNILEKVAKFKSLSFNSSTTTNRVYMEKSHMKLSEVS
FT                   DNLLGKVDDLQDVIEALRKDVAVRGSKPSRKKLDGVRTELEEAQANLDRMQEYLSIEKP
FT                   NWKKIWESELEKVCEEQQFLTLQEELALDFKEDLEKVRETFGLVKMCCEEKEKNPKKNH
FT                   NPILPIAKPGTFNQLREAVLSEVQSLHPDHEERLEAIEKAEKLRMREKGYRDNSAFEDE
FT                   LGSFVVNNNFKKSGGIDEIEKLRRQKDEDNIRATFRPSNF"
FT   gene            <775783..>780129
FT                   /locus_tag="KLTH0E08514g"
FT                   /old_locus_tag="KLTH-ORF9140"
FT   CDS_pept        775783..780129
FT                   /locus_tag="KLTH0E08514g"
FT                   /old_locus_tag="KLTH-ORF9140"
FT                   /product="KLTH0E08514p"
FT                   /note="weakly similar to uniprot|Q06164 Saccharomyces
FT                   cerevisiae YLR320W MMS22 Protein involved in resistance to
FT                   ionizing radiation acts with Mms1p in a repair pathway that
FT                   may be involved in resolving replication intermediates or
FT                   preventing the damage caused by blocked replication forks"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23409"
FT                   /db_xref="GOA:C5DHZ8"
FT                   /db_xref="InterPro:IPR019021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHZ8"
FT                   /protein_id="CAR23409.1"
FT                   /translation="MDEDTNLTYIADSEAEPDEYLLWKPARPINYGEDGQIDQHNNDSG
FT                   PMPEPLAFQQTEGSDARYQSPIQRVRSLRKRTAIQKKPYSLDRIKHRHLLRGFGISNED
FT                   ELPSSLQDHRDLQYNDEASQGGYFMNDDKSETECQNVESFEVISSEHQRFNSNSNGVVT
FT                   SEAQSRLKEERIPENSAVKTATPANHSIIYRGRQVNVNSGFRGILPKVAWTKALNDSRQ
FT                   SKRQLPKQERRSGKGVAKRKKQKVNQRQDDSLFGDLFIADDNFSAEDNLPHNIVDLSDS
FT                   PEEKPELISKYLDSRYSEAYAFDDLSEPDVEGPDNFGGLDGPSTISADSKRSKRSKRPR
FT                   QPSTSKLDKSGDILQRESTYSVSSGDSSSAEEWDDHTIDTMLRARTRKTGGSTKAAKSQ
FT                   RVKRPYEIVANRRITYRRSGTMTANPQHNESHYSIENGKPGAFPKYRRPPHQKLIEFPG
FT                   KAKISRRPEELDWYREQHAISSTYPSWQKNSASKSTLSSGNQNLNSLVSRAGKLFFETA
FT                   IEQESDRFTLVPSSKKKSSTINLEAAHSPKNPDNKPNSDVQVFDAIIFDSLIHPPDTIH
FT                   FTLSEKAFKISRFDTNFENSLSEVFNHLIEVGAIDTEVTIMNSSLVAVLYHLNKPGLWE
FT                   LVNEFHNKFRSKVNLLRSRAKAIHFYQISVCQVMLLEIAGYSSVSRLLASEVTKKIIDH
FT                   TVSFFRLLSKCYNLVANSNLMEQCYILLAKVVEKTLLKSELWDKLRNTLFPPKVALILV
FT                   KYFPTRETFWEIVELGHTFESVVDWFKFVHFSVGACGWEISHRLILVIYNFFKTRKFQD
FT                   FEEEEDRWSEYPIFSQNELKQSRRTAFNSFLGLLASVRLPMKIIERITPLGQIISLQSP
FT                   GLLANRINLLLVLADQAPTSFEIKLEDLCYPYLHENSADPVSPVMLDLILKGFISILQI
FT                   NSKKNLPLRARFISLIWQSVLKRHEARIEKAWLNFLRSLCSIFYKLKKSESVILKALHP
FT                   ILMSTLPNKKNQRDGVGLIKLFEDNLQKLEPAWVARNLHQILASSAGDSERIFSFYFNI
FT                   TEYLASRKVITWWSVLKYNNFNHSDDYKLLFYTRAIEKCDDSTFLQIRHVLFQTVTDLL
FT                   LQRSDVPFIKFIRSISKRDRLFKINPELPFTASHLEIITKVLTGFKRSNDRIVLKVVIC
FT                   KLKELLLGHPEKKPLISEVTKFLNKEYVDLVKNDPDFLFLKNQFNISDEETQKSIFREA
FT                   LSMRKDDIERSLHIEREILRIGSRGQNLEHFLGMLESSMGTGLYVNDFLFLSQLLEANA
FT                   FSEGLERTSTQWFVLSNLILMINNILKQNFCQVSSEDFFGLYHLHYWICRAFSLKEFEL
FT                   DAISDKSVFLREACVLQTRTLLMSSGFLEHNSLLSLSEEFLTKPRPTRFEPKAALTGPV
FT                   HSLLKEYGPFIMSLAPSREDIQAFQGDVATQLSKLSFLVKSKVSRG"
FT   gene            complement(<780265..>781641)
FT                   /locus_tag="KLTH0E08536g"
FT                   /old_locus_tag="KLTH-ORF9136"
FT   CDS_pept        complement(780265..781641)
FT                   /locus_tag="KLTH0E08536g"
FT                   /old_locus_tag="KLTH-ORF9136"
FT                   /product="KLTH0E08536p"
FT                   /note="similar to uniprot|P53201 Saccharomyces cerevisiae
FT                   YGR002C SWC4 Protein of unknown function component of the
FT                   Swr1p complex that incorporates Htz1p into chromatin
FT                   component of the NuA4 histone acetyltransferase complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23410"
FT                   /db_xref="GOA:C5DHZ9"
FT                   /db_xref="InterPro:IPR027109"
FT                   /db_xref="InterPro:IPR032563"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHZ9"
FT                   /protein_id="CAR23410.1"
FT                   /translation="MASSDIFDVLNIQNPRTSNPGSSAGTPVPSRTPKPQVTGIQRELY
FT                   NLLGDNTPPVAVQKGSKFKDKLRAIAKPSPWTLAEYEVKPSVKLLHWVKGSKELVEQQP
FT                   QKSSFSKYNTKLTIPAFSEEEYLSFMGYTTPGSNPLKEWDYEEVQHLFDLCRKYDLRWF
FT                   IIQDRYEGKLFGTLEDLKDAFYTVCHRYFLAKEPANPLVASLNFSKEKELERKRYLQRL
FT                   LSRSAAEIAEEEALIVESKKFEMAAKKTLSERETLLRLLDSPNSDKPVSQFLTSQGMTQ
FT                   LYNSLLSDKSRKRKHDQVVPENPWMKQQQQFAQQKQHMQHLQELKSSNSHIQNQVKKTK
FT                   KQKQEMQIAVKRKADSEYAEQLLQNFTAEERKSLGVQCHGEKLPPGAFLRSSKISTFKA
FT                   ATQSKVAATLQELGLPTRPAMPTMEVINRHEMLLSRITNLLDLKKQLDKLEAEKDIRKP
FT                   "
FT   gene            <781814..>783994
FT                   /locus_tag="KLTH0E08558g"
FT                   /old_locus_tag="KLTH-ORF9134"
FT   CDS_pept        781814..783994
FT                   /locus_tag="KLTH0E08558g"
FT                   /old_locus_tag="KLTH-ORF9134"
FT                   /product="KLTH0E08558p"
FT                   /note="similar to uniprot|P53202 Saccharomyces cerevisiae
FT                   YGR003W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08558g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23411"
FT                   /db_xref="GOA:C5DI00"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI00"
FT                   /protein_id="CAR23411.1"
FT                   /translation="MFKIKIRAPEGLGSGQPQTFESSWGILDHAIDAIYDNQVNTLSFE
FT                   LLYHTVYSMVLRKQGNELYSNLRKAVEEKLFKARGAIAGPDPELLCDFLRVWEKQCDCL
FT                   RLVSDFTMYLDRVYCKENRVPYVYDLGLELFRDTIMFPLKREIHDLLIQQINEARLGGP
FT                   HIDFEQLKKVVDVMETLRDVDDTYFVHEFEPFLIRETECFYRNFARNNIGNAVLYIQKI
FT                   KTQLDIESGLDCQFLNKDTSAKILKVAEEIVIAENTSFVLSDGLPQILTERDYSTLKLL
FT                   FQLYHNPKDKSGLLKHMSQCMIKEAMLIEEDNTLKKKGQVAVKWTTEVMQLKESFEKVF
FT                   ATIGEDSANIYNTINESFSTFLNQNGKKTAEYLAIYIDSFLRSSATTDNIDQKWLENTV
FT                   SMFKLLREKDVFEKVYKQQLSKRLLQQRSCLKTEKLVITKMKEEMGIAFTSKLEGMFKD
FT                   IIVSQGYKAKFEQSYGSPFDFEVNVLTPPCWPFQLTALEPEAELPPTLERLKLDFENFY
FT                   IKNHSGRSLRWAYHLGSMEIGFHFSKSYHEITMPVYAALIFALFENQEELTAEEIGDLT
FT                   KIPDHELLRHLLTISVAPKTRLLKKQPFNKTVLPTDRFQVNHAFQAPTVKVKVLAVLPK
FT                   SDANVHHNTRIDESMQDLLKERKGCIDAAIVRALKSLKAASSQSLYECVESDLSNRFTV
FT                   TATLFDESIERLIEREYIQRDPDDPSLCRYLP"
FT   gene            complement(<784018..>784770)
FT                   /locus_tag="KLTH0E08580g"
FT                   /old_locus_tag="KLTH-ORF9133"
FT   CDS_pept        complement(784018..784770)
FT                   /locus_tag="KLTH0E08580g"
FT                   /old_locus_tag="KLTH-ORF9133"
FT                   /product="KLTH0E08580p"
FT                   /note="similar to uniprot|P53769 Saccharomyces cerevisiae
FT                   YLR323C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23412"
FT                   /db_xref="GOA:C5DI01"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039971"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI01"
FT                   /protein_id="CAR23412.1"
FT                   /translation="MFKKRAIKCDQASSKRQKFTEDDVTETPVCSKNTRTTESLAYQAG
FT                   PSSLQNKITNNDENPKKDTLKRSRSISPPQETSIPSSKPEDFGQTEASHEHRAMSPIEP
FT                   ASKSVGAISALGPDKKHPNLRTTLYMDYQPDICKDYKQTGYCGYGDSCKFLHARDDFKS
FT                   GWKLNQDWKLEPTEEESKELEKIPFKCLICKGDYKNPVMTKCKHYFCNSCFIARTKKTT
FT                   KCAVCNDDTYGVAKTAKGLQQILKNQGG"
FT   gene            <784893..>786461
FT                   /locus_tag="KLTH0E08602g"
FT                   /old_locus_tag="KLTH-ORF9129"
FT   CDS_pept        784893..786461
FT                   /locus_tag="KLTH0E08602g"
FT                   /old_locus_tag="KLTH-ORF9129"
FT                   /product="KLTH0E08602p"
FT                   /note="similar to uniprot|Q06169 Saccharomyces cerevisiae
FT                   YLR324W PEX30 Peroxisomal integral membrane protein
FT                   involved in negative regulation of peroxisome number
FT                   partially functionally redundant with Pex31p genetic
FT                   interactions suggest action at a step downstream of steps
FT                   mediated by Pex28p and Pex29p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23413"
FT                   /db_xref="GOA:C5DI02"
FT                   /db_xref="InterPro:IPR006614"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI02"
FT                   /protein_id="CAR23413.1"
FT                   /translation="MSEHPKERETRARFVEEPTARLGGKTNKVLRSALKNRGKKALGES
FT                   EQEEVESSPLLTSTPPTVSKALVRLYPYLIITDKVLSIITWTNDDIWPSVLVVVGYITS
FT                   VLYFQNILKYFGHLVLVGILGCYSLLDMFVEESIKDRPTLDDIVHIITCVNAKADLLLS
FT                   PIAVLTGNDVKRLLFTTIFLSPLYVIITLFIFPPRRLLLFGGVYLLTYHSAWSRVSRKL
FT                   LWKFKLVRLLVFYITGLDLSGVNKNQGIFAAVQSKVKKMSSTRGISEEGKPIRFTYVLY
FT                   ENQRKWLGIGWTSNMLSYERAPWSDEFINEAPSPENFRLPEENMGMTWRWVDRTWRLDL
FT                   TNDGAIQLPSSRPKTSAQPNSDEGFIYYDNTWKKPSTEDSFSKYTRRRRWIRTAELLRG
FT                   DVLDVGGIMSSASAVDPTPQNVTVAGDTAKPEGTEPPSTILENVKELESFRRKVSFNDT
FT                   EDVHIIPSDEKTRAPQLAVTDEDEENEAEGEASGITERSSARDLNVDPPPTSPPGAAVE
FT                   TKKHV"
FT   gene            complement(<786589..>786825)
FT                   /locus_tag="KLTH0E08624g"
FT                   /old_locus_tag="KLTH.mRNA.139SC.m"
FT   CDS_pept        complement(786589..786825)
FT                   /locus_tag="KLTH0E08624g"
FT                   /old_locus_tag="KLTH.mRNA.139SC.m"
FT                   /product="KLTH0E08624p"
FT                   /note="highly similar to uniprot|P49167 Saccharomyces
FT                   cerevisiae YLR325C RPL38 Protein component of the large
FT                   (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23414"
FT                   /db_xref="GOA:C5DI03"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="InterPro:IPR038464"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI03"
FT                   /protein_id="CAR23414.1"
FT                   /translation="MAREITDIKEFLELARRADVKTATVKINKKLNKSGKAFRQTKFKV
FT                   RGSRYLYTLIVNDAGKAKKLIQSLPPTLKVNKL"
FT   gene            complement(<787085..>788233)
FT                   /locus_tag="KLTH0E08646g"
FT                   /old_locus_tag="KLTH-ORF9126"
FT   CDS_pept        complement(787085..788233)
FT                   /locus_tag="KLTH0E08646g"
FT                   /old_locus_tag="KLTH-ORF9126"
FT                   /product="KLTH0E08646p"
FT                   /note="similar to uniprot|P41896 Saccharomyces cerevisiae
FT                   YGR005C TFG2 transcription initiation factor TFIIF middle
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23415"
FT                   /db_xref="GOA:C5DI04"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040450"
FT                   /db_xref="InterPro:IPR040504"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI04"
FT                   /protein_id="CAR23415.1"
FT                   /translation="MSAPAEPKKSGNESGDEYLSQDEEVFDGNDIENNETRIYEESLDL
FT                   DLTNSGRQVWLVRLPKFLAEKWRHKSNLNGQELGKIRIDKNTQAIQMVLNENDNDQIPH
FT                   QYDLELTKKLVENEYIFTEQNLKKYQQRERELAADPEKQKAAFLRRQEREEEMRKKQQQ
FT                   LKRRNNRRRFQNRVMTDRDGRDRYIPYVKTIPKKTAIVGTVCHECHVIPSMSDPNYHKI
FT                   VEQRRQIVRSVHKPTVTVLDQTPGVTMSNAGMSMRSDNSNFLKVGREKAKNNIRAIRMP
FT                   KKELLDFLFKLFDEYDYWSLKGLKERTKQPEVYLKECLDQVAILVKKGPYALKYTLKTE
FT                   YKRLKEAERAARLGELAKDDENPEDDQPNPDEDEEVEMEDVL"
FT   gene            <788363..>789160
FT                   /locus_tag="KLTH0E08668g"
FT                   /old_locus_tag="KLTH-ORF9123"
FT   CDS_pept        788363..789160
FT                   /locus_tag="KLTH0E08668g"
FT                   /old_locus_tag="KLTH-ORF9123"
FT                   /product="KLTH0E08668p"
FT                   /note="weakly similar to uniprot|P33411 Saccharomyces
FT                   cerevisiae YGR006W PRP18 Splicing factor involved in the
FT                   positioning of the 3' splice site during the second
FT                   catalytic step of splicing recruited to the spliceosome by
FT                   Slu7p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08668g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23416"
FT                   /db_xref="GOA:C5DI05"
FT                   /db_xref="InterPro:IPR004098"
FT                   /db_xref="InterPro:IPR039979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI05"
FT                   /protein_id="CAR23416.1"
FT                   /translation="MDYANLLKAEIAKKQKAIASSNRPSETPWLTQQQDEGDGLESKML
FT                   RSTEAQDNQEQKPPLEHDVREVFREQGKSKETDSKSAASASRLRTRPGRIAKVLADERK
FT                   LDTAISATEIGDVEQEAHLSLKCNLYIHLLLQLWQEECYKPELILETKKALYPLVLKLR
FT                   KRRLSSEFLTSLATILFHTQQHQFPQATQSYMKLSIGNVAWPIGVTSVGIHARSAHERI
FT                   QGKDKIANVMLDEHTRLWITSVKRLITFAEALERRKKSQHANE"
FT   gene            <789261..>790081
FT                   /locus_tag="KLTH0E08690g"
FT                   /old_locus_tag="Klth0E.mRNA.gf.448.p"
FT   CDS_pept        join(789261..789360,789429..790081)
FT                   /locus_tag="KLTH0E08690g"
FT                   /old_locus_tag="Klth0E.mRNA.gf.448.p"
FT                   /product="KLTH0E08690p"
FT                   /note="similar to uniprot|Q06170 Saccharomyces cerevisiae
FT                   YLR326W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23417"
FT                   /db_xref="GOA:C5DI06"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI06"
FT                   /protein_id="CAR23417.1"
FT                   /translation="MSSWVQGFVQGLAQDYATDKWNGYAEVKFQPTRDPFYEKTANGKT
FT                   RRRKLPDYCSQREKKLWKKLQNRAWKDDRCLCGCLWVNWGLGLAPVLSIIPTIGPIIMY
FT                   MVHSKLISMADKELSLPADMIAKLHGNIMLDLLISLPPLLGTLLAWLNACSTRNCALIY
FT                   NYMAKNATKKHNAMVQQEQLYTSPAGVPPPGPAAYQKTNAYRPEYQGNRPAPPPPATRA
FT                   VSPGARTQQAAQMPPQQISSRPAPRAAW"
FT   gene            <790185..>791213
FT                   /locus_tag="KLTH0E08712g"
FT                   /old_locus_tag="KLTH-ORF9117"
FT   CDS_pept        790185..791213
FT                   /locus_tag="KLTH0E08712g"
FT                   /old_locus_tag="KLTH-ORF9117"
FT                   /product="KLTH0E08712p"
FT                   /note="similar to uniprot|P33412 YGR007W Saccharomyces
FT                   cerevisiae MUQ1 Choline phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23418"
FT                   /db_xref="GOA:C5DI07"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR041723"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI07"
FT                   /protein_id="CAR23418.1"
FT                   /translation="MSALAALNCVVNPQLKMENDRHRLWIDGCFDFTHHGHAGAILQAR
FT                   RLIPPGTESGALLCGVHNDEDILFNKGGKPVMNEQERYEHTRSNRWCSEIVKDAPYVTQ
FT                   PDVLDAHRCKFVVHGDDITTDANGEDCYQQMKDMGRFLVVKRTEGVSTTDIIQRILTGA
FT                   RAGAQEARSESSWQDTAGAEEQLKKYAAGLDGHAPWCYVFDGLISKSKIIVEGGYALDS
FT                   TQLVYIEGDFDLFHVGHIEQLKGLRERHGQDARIIVGVRTTQDCFMTLMERALSVLSCR
FT                   YVDGLVLDPESQPCVDVTYNLDAAELRRGDFSYLDKAVIVGRVLAEREHYVARNRKKGV
FT                   CA"
FT   gene            complement(<791406..>791666)
FT                   /locus_tag="KLTH0E08734g"
FT                   /old_locus_tag="KLTH-ORF9112"
FT   CDS_pept        complement(791406..791666)
FT                   /locus_tag="KLTH0E08734g"
FT                   /old_locus_tag="KLTH-ORF9112"
FT                   /product="KLTH0E08734p"
FT                   /note="similar to uniprot|Q06177 Saccharomyces cerevisiae
FT                   YLR327C RBF9 Hypothetical ORF and YGR008C uniprot|P16965
FT                   Saccharomyces cerevisiae YGR008C STF2 ATPase stabilizing
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23419"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI08"
FT                   /protein_id="CAR23419.1"
FT                   /translation="MTRTNKWTVHEDKAESHYFTHNGNYGNSPNGVKKHGSGKANWGRP
FT                   GDEIEDLIQAGEVPPVFHKQRRGSNNQSHESKFGQVQNFHE"
FT   gene            <793960..>795327
FT                   /locus_tag="KLTH0E08756g"
FT                   /old_locus_tag="KLTH-ORF9106"
FT   CDS_pept        793960..795327
FT                   /locus_tag="KLTH0E08756g"
FT                   /old_locus_tag="KLTH-ORF9106"
FT                   /product="KLTH0E08756p"
FT                   /note="highly similar to uniprot|Q06178 Saccharomyces
FT                   cerevisiae YLR328W NMA1 Nicotinic acid mononucleotide
FT                   adenylyltransferase involved in NAD( ) salvage pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23420"
FT                   /db_xref="GOA:C5DI09"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI09"
FT                   /protein_id="CAR23420.1"
FT                   /translation="MDPTKAPDFEPPSENRTPNPPLAPQSTIPKSGPIMPYVLADYNAS
FT                   IDAPIHPRTYKKHSKAGRHVSTAHHSSIPLKQPELQPPSHETSDEDERAQDDHPAPSPA
FT                   LSAGPGSNPDHDSYFDNDAATISGSHYRRNSSRTSLAQQFTHQMNLFDGDSPFHNMSLK
FT                   DEEPKEEHIGSRIHKYQIADLEEVPHGVVRQAATLDQYCFPSHRLQKELRNPNKLPLVV
FT                   VACGSFSPITYLHLRMFEMALDAISEQTRFEVVGGYYSPVSDNYKKPGLAPSHHRVRMC
FT                   ELACERTSSWLMVDAWESLQPTYTRTAKVLDHFNDEINVKRGGIATSFGARVGVKIMLL
FT                   AGGDLIESMGEPNVWADSDLHHILGNYGCLIVERTGSDVRSFLLSHDIMYEHRRNVLVI
FT                   KQLIYNDISSTKVRLFIRRGMSVQYLLPNSVIRYIQEHGLYVNQTEPVKQVMGNKE"
FT   gene            complement(<795841..>798462)
FT                   /locus_tag="KLTH0E08778g"
FT                   /old_locus_tag="KLTH-ORF9103"
FT   CDS_pept        complement(795841..798462)
FT                   /locus_tag="KLTH0E08778g"
FT                   /old_locus_tag="KLTH-ORF9103"
FT                   /product="KLTH0E08778p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23421"
FT                   /db_xref="GOA:C5DI10"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI10"
FT                   /protein_id="CAR23421.1"
FT                   /translation="MNSEKSAYRVRKPRTSRACEVCHDRKVRCDANIRVPCTSCQTFGL
FT                   VCRLRDVKKVKRGKKVGGAAGGAEAGLKAEDDAEVGAHPSAGADGCAPGHGHGHGPGQG
FT                   AGQGRENEEEQTVKETVSNGMPYGDEYLRGRGVEPGVFFDAEREDRDRVYVYFGSSSFL
FT                   SMLTGSSFPDGSNFASAQKLRSALPLSGEGSPRVANLEMLRITGAFLLPSKQICDELVD
FT                   LYFRYIHPLMPIMNQTEFRKAYAANTCSIFLLQAILCVAVKLSRNPLLMDKNGSTDLAS
FT                   NIFYQRAKSLYDGRYEENEVCLLQGMMLLSKQAFNEKNTIHMPMYFIKNAVTIAQTYGL
FT                   HRSADFHPTLTANEKRARKLIWWILYVIDTLVSISIGRPQAINLDDCDVPVLTHDDFVF
FT                   EGEAPEHSMPVDHMDCIISTVQIAEIMSRISRELNRPAAAHCDAKFLIQHFDLLLQRWR
FT                   NNLPESLTYHSNAEIFTKHSIPKAFVNALYYKTLCLLHKSNIHDMVRASDEQYLSAGIA
FT                   FQAAHSLSLVGQILLDRDELGYCYAGHAYCFFEAMTIFVHHMYDSSSIFSEIALKCYHV
FT                   LEQVLLKLGQQWNSCALLGEVLFSFSKKPEYIRRLVKSFKSKISNEKSPAIPIEVPSPA
FT                   RSIEIDRQRPSPTSVGSWSSPIQGINAVDNKSPNSAYKQLRYAARPVFPVIPKNPRIVS
FT                   PSQHSPKNPNPQVPFIQAATNPQPPPIQGPPPPWAHDFNFTTTDLSQVGPHHKSFDPHQ
FT                   LFPDVSQPLPADFHFNSNLEAELDTAPGPLYEGVEDEDQTEPPSSTSENPPTDLVQSSG
FT                   DKTPAQLTEIRDRQPVQKTSIPLPPGFWDSIQVNFNFFTPPENVNFQWPAADSRGSDDP
FT                   RE"
FT   gene            <800464..>801639
FT                   /locus_tag="KLTH0E08800g"
FT                   /old_locus_tag="KLTH-ORF9082"
FT   CDS_pept        800464..801639
FT                   /locus_tag="KLTH0E08800g"
FT                   /old_locus_tag="KLTH-ORF9082"
FT                   /product="KLTH0E08800p"
FT                   /note="similar to uniprot|P53206 Saccharomyces cerevisiae
FT                   YGR012W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23422"
FT                   /db_xref="GOA:C5DI11"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI11"
FT                   /protein_id="CAR23422.1"
FT                   /translation="MDTRGVSWSNVAAVSTAAVAVAALYRAATASKTLTELAPPRRGVE
FT                   DLIGNTPVIKIKSLSKATGCEVYAKMELCNPGGSAKDRVALGIVRAAERQGLLRPGFPD
FT                   VVFEGTSGSTGISIATICNALGYRAHISLPDDTSAEKLALLESLGAQINKVRPAGIVDP
FT                   EQYVNAAQRACNQLNQSGDGSHRGVFADQFENDANWRVHYQGTGPEIYRQLDGRIDAFI
FT                   AGCGTGGTIAGVARFLKEKLGGRLRVVLADPQGSGFYNRVKFGVMYDRVEQEGTRRRHQ
FT                   VDTIVEGIGLNRITHNFSQGEPYIDDAERVTDGQAVRMAKFLSVNDGLFIGSSTAINAV
FT                   AAVKVAESLPPGSRIVIIACDSGSRHLSKFWKEALCVDNETTLREVLAGSQ"
FT   gene            <801917..>803599
FT                   /locus_tag="KLTH0E08822g"
FT                   /old_locus_tag="KLTH-ORF9078"
FT   CDS_pept        801917..803599
FT                   /locus_tag="KLTH0E08822g"
FT                   /old_locus_tag="KLTH-ORF9078"
FT                   /product="KLTH0E08822p"
FT                   /note="weakly similar to uniprot|P53207 Saccharomyces
FT                   cerevisiae YGR013W SNU71 associated with U1 snRNP (no
FT                   counterpart in mammalian U1 snRNP contains few SR- RE- and
FT                   RD-dipeptides U1 snRNP protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23423"
FT                   /db_xref="GOA:C5DI12"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI12"
FT                   /protein_id="CAR23423.1"
FT                   /translation="MDPMIYVCPSAYLSSQNTDRWHSETFKPGFVPILRSDLLRFRDVL
FT                   DQVVSRVNQQKASNVYQTSDEKEAEDPASEGKGPAGEVLQDKTSQGKYQELKQFLPISI
FT                   TQQLCTVSIGELQGEVSVSELELFVRRLEELTEKRAGVRDSVECWSFIKGLNTFSLFLR
FT                   SSGLEHLKTVTHYWTELLARWPKEENNAVTQLHIEENTARFVGDQKSDPPSLRTEDLDE
FT                   DSEQLSGYFKELKDRSSVPKEDATSTDYNVDVSTLSDLPRSSLDQLCKDIVHFRTRVLT
FT                   IEKEKRAKEQYEENRRMGQHMMRMFDQIRRSKGSAKPAGEEDDNEGEAQGQNFGDAEDD
FT                   GEDDWSVEKRNREKAEKDADKKYAELLEHYTSRVEPRLKSLEQQVDREAAYERSIEQER
FT                   ALYLKELLHHAYSPYYDHHRSFKEAEQHQDDEDRRLTAQLIPRAAELGAEEEHPAAEAE
FT                   TGKFKLEIRKTQAGPEKDVLPQEDAALSELLARLRKSSVIQDSVVEFLGELDDDLVDYV
FT                   IEHIREHRSKSALLQELKETFDEDAQTIVDRVWQMFEDNAPAA"
FT   gene            <804120..>808682
FT                   /locus_tag="KLTH0E08844g"
FT                   /old_locus_tag="KLTH-ORF9073"
FT   CDS_pept        804120..808682
FT                   /locus_tag="KLTH0E08844g"
FT                   /old_locus_tag="KLTH-ORF9073"
FT                   /product="KLTH0E08844p"
FT                   /note="some similarities with uniprot|P32334 Saccharomyces
FT                   cerevisiae YGR014W MSB2 Mucin family member at the head of
FT                   the Cdc42p- and MAP kinase-dependent filamentous growth
FT                   signaling pathway also functions as an osmosensor in
FT                   parallel to the Sho1p-mediated pathway potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23424"
FT                   /db_xref="GOA:C5DI13"
FT                   /db_xref="InterPro:IPR039295"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI13"
FT                   /protein_id="CAR23424.1"
FT                   /translation="MMILSMRKLALGALLVAGARADGWTDLLSKLRDNGASGSDSGSAT
FT                   ATSVSAALSTSPQATPSSSPVSSSIAAARSTSSAPAYSANSPLSSDNAPSTRPTTQLED
FT                   TTSHHSHSSYSPSDTQLTSYITSAQWTTSESSSLDPVSPTSERVTSTAAQSSAEQSSEL
FT                   TSSSSSDHPSLTSAWVAGTTSETPKIETHSSSNTVSQSSHTSLTSTSTSNDATKTTSST
FT                   EGFFSSVAQAFAESSQQSETTSSDAKTSNQNEGTTSQSATAISQSQSATSQSASTTSQS
FT                   ETATSQRAATTSPSEATSSEGQYTPSQSEITTSESENTASNSETSTRQSSTTSPSESAA
FT                   SSSSTTISSRTTAGQEVKSSSSIVTLSETTSDTQSTESSKVLTLSTETNHEDTTSSLTG
FT                   TSTPSVEPTISSTEATTSVSTTSSARSTSDLSTATSETSSEDSATSISSLNTEESTAAP
FT                   SSTNDPVESTQPRTSSLSTDTSTSLQYESTALYDSATSSAFRDSEPQSISSPVSTNPTS
FT                   TVMSEGPATSFAISTSSETPEAQYSSAPAASQFTATGSVLTSTFPTEVSSTAEEVQYTT
FT                   EISESSETTNFPTSTGSSSDTVFLDVSTTFGSVVSSETSYLYTGSSHQTSPESSPEPTS
FT                   EPTSTDYQYTTSGSQDTSEQIPQTSPAPSEATISVSSTPQYTTETTPMTSASGYGASSA
FT                   ITPESTSEGAFSSEPTLTSSQAPVTESTQISSWAQDLSSAPLSLADAATSSPQWSAEPA
FT                   LSSTDFPASTVSSSAADIPTSTAFGTSSGPWQTSQWDTAAASSSTEYPLESSATTVSSG
FT                   SSESPLPGSYMTSATSSDAEGSSESVYSSSNYSPGMVSTTSQWVPPTLSSSSDYSTSAE
FT                   QSSGSFSVTDQPSVSDTPSSSVWSPSTDSTASQDLFRTSSYNSELSSEATTLSSGYTAS
FT                   SSSIFSAQTSETFSSEYGVTSTPPKSLPSSQYSVSSSQLSSDTTLVVSLSSELASSVFS
FT                   EFSSGVSTGSAVLSTPSSTSTLYASSSEAVLSSQPSEGSTLSLPSSSLGASSSSPLSSY
FT                   IVTSNPVSTLSPAPTSDSFATSSQASASSDQYVSNATPSSFIGATTTLDTLSNSEDVSS
FT                   ASTDEPTNVVSSSAPNGELGSVTQPDANSVPMTMPTTAVLTSPYPEQVSATSAAPVEPP
FT                   ISSTFVPTSTSNWLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPE
FT                   GYTLITIGFKQALNYPFVVTNAVTSAQIFAYLPETLNFPFDDAFSDITVARLGPLKVSN
FT                   RDYLLTIAEVYFPSAQVENLQTLIQNDESKFYAKNATKNLLAAFVDATIPLTGLVEEEG
FT                   STSSGSSQSSGASSNVSTSSEGESEDGGKSGYRNSGTLGSSYYKSSTFTKQGGRSKLVG
FT                   LIVGVVCGALVYIALMVITFRFIIKKMQLKASNPNLDETSSVGSASASGSLPYGNEKVA
FT                   DDQASITPSAKINNWMQQNHYDDLAAGNNLDNASSNEKPSALKISRPIATENSLGWNDV
FT                   "
FT   gene            complement(<808794..>809726)
FT                   /locus_tag="KLTH0E08866g"
FT                   /old_locus_tag="KLTH-ORF9067"
FT   CDS_pept        complement(808794..809726)
FT                   /locus_tag="KLTH0E08866g"
FT                   /old_locus_tag="KLTH-ORF9067"
FT                   /product="KLTH0E08866p"
FT                   /note="similar to uniprot|P53208 Saccharomyces cerevisiae
FT                   YGR015C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23425"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI14"
FT                   /protein_id="CAR23425.1"
FT                   /translation="MPIKRLVHEKLPYKPVVDLAYTHFKSPDFNTQRPPVVTLHGLFGS
FT                   GKTFGSVGRKLSKDLGTEVYNLDLRNHGKSEIAKPYDYLTMARDVAKFLEDKIGPQKPV
FT                   SLVGFSMGGKVGLLTSLSKAVNVHKCVSIDMPPYNVDDLGTDVDQNYGKILEFCNKKIK
FT                   VEKGSKGWKDKVIKIFREVPTNKNAGAALYFSQGFTQLPVNNKPFDQARDLDPYIDYKA
FT                   PLLEMTDLLDQIKSWPDEVVLSREGYRIRSDTPVLFMKGLKSPMIKSTYEKLGHIFPNY
FT                   EVQEFDTGHVLITEAPDEFYKSCSAFLSA"
FT   gene            <809947..>810522
FT                   /locus_tag="KLTH0E08888g"
FT                   /old_locus_tag="KLTH-ORF9065"
FT   CDS_pept        809947..810522
FT                   /locus_tag="KLTH0E08888g"
FT                   /old_locus_tag="KLTH-ORF9065"
FT                   /product="KLTH0E08888p"
FT                   /note="weakly similar to uniprot|P53209 Saccharomyces
FT                   cerevisiae YGR016W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23426"
FT                   /db_xref="GOA:C5DI15"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI15"
FT                   /protein_id="CAR23426.1"
FT                   /translation="MSRVRKFNRGVLSKIHSDSDTDEDIPLHPLDIEEQEELISKLEFR
FT                   NVSSNNYNIQLLSVAYVVCCGVFLSLVMKVQKIRGDTSMNKRLLLYSVNSIICSLLNLR
FT                   YDLTKDFALSRAVKVRITSRKINIINCILLLLLTWEVTGKVDKILLQLLFHVPLLLFSL
FT                   SVVSKKWICDLDEELNGLRGLKYKFKSA"
FT   repeat_region   811672..811914
FT                   /locus_tag="KLTH0E08910t"
FT                   /old_locus_tag="Klth0E.LTR.3"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <811979..>812093
FT                   /locus_tag="KLTH0E08932r"
FT                   /old_locus_tag="Klth0E.tLeu.CAA.13"
FT   tRNA            join(811979..812016,812050..812093)
FT                   /locus_tag="KLTH0E08932r"
FT                   /old_locus_tag="Klth0E.tLeu.CAA.13"
FT                   /note="tRNA-Leu (CAA) cove"
FT   gene            <812397..>814322
FT                   /locus_tag="KLTH0E08954g"
FT                   /old_locus_tag="KLTH-ORF9062"
FT   CDS_pept        812397..814322
FT                   /locus_tag="KLTH0E08954g"
FT                   /old_locus_tag="KLTH-ORF9062"
FT                   /product="KLTH0E08954p"
FT                   /note="similar to uniprot|P54074 Saccharomyces cerevisiae
FT                   YMR119W ASI1 Putative integral membrane E3 ubiquitin ligase
FT                   genetic interactions suggest a role in negative regulation
FT                   of amino acid uptake"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23427"
FT                   /db_xref="GOA:C5DI16"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI16"
FT                   /protein_id="CAR23427.1"
FT                   /translation="MTDLNDTTLGHFSYLNNTRAALIDENMFLAPFINYPYKIARSFYS
FT                   AVLSQYKSQTGVSLATNSAHLGASTLVETAGYFFSNYAIGCFVTAMVLNRIVAMASLRS
FT                   NSQVARLPLWSRFIFHACAILALGYNVILTLRPFADEKPLVDIHNYFGITYGVICLSHC
FT                   IETFVTTTTNLKPMEEFDYSIFELSMHFYALTRSNPRPEDFIPDCLMALLGRLIIHSVE
FT                   LTNKRNRRLLLSTILNMGHLVYLGQRVYTLGTGSLPLLVRYRHFPKLLALFCTAVSLAC
FT                   YALACIARLNPFSSNDEAHDISDLQFHSFMNNWYATLNCTGEEEFTSTLIKLAIMICNP
FT                   EQAKRFGLHRELSQLRQPGEVHKSFFVSGYNSKWQSIPQEAITDGAAKQGRTVWQRKVT
FT                   AVRDLLVAVFQRLKATFGKAPTGHANESFSEEHKKNLNDFVSERNYIKFLSLAPDLNAN
FT                   RIQSNDLKYLLPEDDFSADYLASDDEGSEELLEEFGSEDEESELGDVPLTDLIVPPNSS
FT                   MPAQMGNTNDLKWFYSMWSILSCELQHNKRLTRSQYSELNEPGILHEVMMERIAETGSS
FT                   NEAKEKSERDMTCVVCKTNTRNIVLWPCKCFALCEECRVSLGLRGFKTCICCRTDVRGY
FT                   SKINAV"
FT   gene            complement(<814709..>814993)
FT                   /locus_tag="KLTH0E08976g"
FT                   /old_locus_tag="KLTH-ORF9058"
FT   CDS_pept        complement(814709..814993)
FT                   /locus_tag="KLTH0E08976g"
FT                   /old_locus_tag="KLTH-ORF9058"
FT                   /product="KLTH0E08976p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23428"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI17"
FT                   /protein_id="CAR23428.1"
FT                   /translation="MSAVWFYPNDNWSIGPTQRLGIYRGTAPKATELNWEANPRRSNHP
FT                   KNSRSHAELDLSTRRRGCFCLIRYTRLRQQPLTCCSSPHDSDPAEAEEK"
FT   gene            complement(<815169..>816944)
FT                   /locus_tag="KLTH0E08998g"
FT                   /old_locus_tag="KLTH-ORF9057"
FT   CDS_pept        complement(815169..816944)
FT                   /locus_tag="KLTH0E08998g"
FT                   /old_locus_tag="KLTH-ORF9057"
FT                   /product="KLTH0E08998p"
FT                   /note="highly similar to uniprot|P38009 Saccharomyces
FT                   cerevisiae YMR120C ADE17 Enzyme of 'de novo' purine
FT                   biosynthesis containing both 5-aminoimidazole-4-
FT                   carboxamide ribonucleotide transformylase and inosine
FT                   monophosphate cyclohydrolase activities isozyme of Ade16p
FT                   ade16 ade17 mutants require adenine and histidine"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23429"
FT                   /db_xref="GOA:C5DI18"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024050"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI18"
FT                   /protein_id="CAR23429.1"
FT                   /translation="MTAYNKTAILSVYDKTGLLDLAKGLSENNVHILASGGTARMVREA
FT                   GFNVEDVSSITHAPEMLGGRVKTLHPAVHGGILARNLDSDEKDLKEQNIEKVDFVVCNL
FT                   YPFKETVAKVGVSIPEAVEEIDIGGVTLLRAAAKNHSRVAILSDPKDYPQFLQELSKGE
FT                   VSQDLKNRLALKAFEHTADYDAAISDFFRKQYSENKAQLPLRYGANPHQKPAQAFVSQQ
FT                   EELPFRVLCGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVGIPLSDV
FT                   EKQIYFVADIENLSPLACAYARARGADRMSSFGDFIALSNIVDVPTAKIISREVSDGVI
FT                   APGFEPEALELLSKKKGGKYCILQIDPNFAPEALESRQVYGVTLQQKRNDAIINKSSFK
FT                   EIVSANKKITEQAVIDLTVATIALKYTQSNSVCYAKNGMVVGLGAGQQSRIHCTRLAGD
FT                   KADNWWLRQHPRVLAFKWAKGVKRPEKSNAIDLFVTGQIPTEEPEKSEYESKFAEIPTP
FT                   LTAEERKEWMGKLSNVALSSDAFFPFPDNVYRAVRSGVKYIAAPSGSVMDKAVFGAADS
FT                   FDLVYVENPIRLFHH"
FT   gene            complement(<818579..>819193)
FT                   /locus_tag="KLTH0E09020g"
FT                   /old_locus_tag="KLTH-ORF9050"
FT   CDS_pept        complement(818579..819193)
FT                   /locus_tag="KLTH0E09020g"
FT                   /old_locus_tag="KLTH-ORF9050"
FT                   /product="KLTH0E09020p"
FT                   /note="highly similar to uniprot|P54780 Saccharomyces
FT                   cerevisiae RPL15B and to uniprot|P05748 Saccharomyces
FT                   cerevisiae YLR029C RPL15A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23430"
FT                   /db_xref="GOA:C5DI19"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR024794"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI19"
FT                   /protein_id="CAR23430.1"
FT                   /translation="MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKTVIHRASRPSRP
FT                   DKARRMGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNQLKYQRALRATAEE
FT                   RVGRRAANLRVLNSYWVNQDSTYKYFEVILLDPSHKAIRRDARYNWICNPVHKHREARG
FT                   LTSTGKKSRGINKGHLFHNTQAGRRKTWKRQNTLSLWRYRK"
FT   gene            <820687..>821139
FT                   /locus_tag="KLTH0E09042g"
FT                   /old_locus_tag="KLTH-ORF9047"
FT   CDS_pept        820687..821139
FT                   /locus_tag="KLTH0E09042g"
FT                   /old_locus_tag="KLTH-ORF9047"
FT                   /product="KLTH0E09042p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09042g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23431"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI20"
FT                   /protein_id="CAR23431.1"
FT                   /translation="MSAMGMEIQVDTSSSSTGRGSVSYAFMGAGGSSGTSVSVLTLDQS
FT                   RMLSTTAYSSSFRFSPSGAPPTYKTPSSAAPSSGVTSSAAASLLSSSFAGFTLSTSSVP
FT                   LSSASAAGQRNTTNDSSAQNGAGSCSRANWKLGAALSLLALGGVML"
FT   gene            <821861..>822340
FT                   /locus_tag="KLTH0E09064g"
FT                   /old_locus_tag="KLTH-ORF9044"
FT   CDS_pept        821861..822340
FT                   /locus_tag="KLTH0E09064g"
FT                   /old_locus_tag="KLTH-ORF9044"
FT                   /product="KLTH0E09064p"
FT                   /note="some similarities with uniprot|Q3E842 Saccharomyces
FT                   cerevisiae YMR122W-A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09064g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23432"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI21"
FT                   /protein_id="CAR23432.1"
FT                   /translation="MAKPYIRARFAHLLKSYLEVSNIIDHRSCVSTHHFSHQTPKMASS
FT                   STSAVSTNTNLVSAAAVAASSVSASASSGASSAKSSASSAASSVKSSVTSGASSVSSSA
FT                   SKSASSSKSSSSSSASSSSSSGSNAITAVANPLSWKYGAVIGATMLGSFILGSGI"
FT   gene            <822703..>823062
FT                   /locus_tag="KLTH0E09086g"
FT                   /old_locus_tag="KLTH-ORF9040"
FT   CDS_pept        822703..823062
FT                   /locus_tag="KLTH0E09086g"
FT                   /old_locus_tag="KLTH-ORF9040"
FT                   /product="KLTH0E09086p"
FT                   /note="similar to uniprot|Q03880 Saccharomyces cerevisiae
FT                   YMR123W PKR1 Protein of unknown function overproduction
FT                   confers resistance to Pichia farinosa killer toxin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23433"
FT                   /db_xref="GOA:C5DI22"
FT                   /db_xref="InterPro:IPR013945"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI22"
FT                   /protein_id="CAR23433.1"
FT                   /translation="MANFFEELWRSIFTPGASPQLIVATHVSFFLLTACLSWLIFWTKN
FT                   IHFIMLLIISTLLWGTVTWFISELKSAQMKDNEELVKSQEKKTDGAKPQEESEKSQPKG
FT                   QSSAVQTKKAKSRKL"
FT   gene            <823623..>826409
FT                   /locus_tag="KLTH0E09108g"
FT                   /old_locus_tag="KLTH-ORF9037"
FT   CDS_pept        823623..826409
FT                   /locus_tag="KLTH0E09108g"
FT                   /old_locus_tag="KLTH-ORF9037"
FT                   /product="KLTH0E09108p"
FT                   /note="some similarities with uniprot|P39523 Saccharomyces
FT                   cerevisiae YMR124W Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery cytoplasm bud and bud neck"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23434"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI23"
FT                   /protein_id="CAR23434.1"
FT                   /translation="MNTGPQNLVRKEPNRAQLRSQLLNNDLGTIDLAQERPINQAAPSQ
FT                   YPMAPAYNNAYQPQQPQYGQPPFQPGRASYVQQGYQAADQRRPSLQSQSAGGKRSLQSN
FT                   AISGLFKMRNGRSKAKDSDEEDDTFMTDGDSSILTFSDISSLRNNGGHKYGFGGAMDDT
FT                   SPIIPTLITKGHEKMNNIEYRKHLAAQKKMTMNALSKQNKPMHQVPPQGGPRTMSLQHS
FT                   YNPYNAQAPPRDNFNQGPPYARANSMMSGPPPQMRYPNARGTPPPPGAGAPRTMSLTTN
FT                   RRNMANPQGGFRPQAAAFAARPTSPYIGGQPPMPYQGPRPSNMMVAPGGGYPIQDIKPA
FT                   APLPNENVTPHSSSSLVSSNSLASHRPSSQTPDSQNIDDPSTVSNLLSGSAQKLPRESP
FT                   LKSEVNNTGKLNIIKLSDPQQALRDKEQFLQERERLIAEKEEELRVKEREAQEQKTRSA
FT                   TVEKQPPLNTYNTVSEQSPKFKLSRQRSDPQVTQPNSGRIGRRSQVQSMATFESSLSND
FT                   SPVKKKDDKTGLYMLDNATEGNAYFTASDLLNEEASRLHENLSDVTITRDETKPEKTAS
FT                   SSAGALNKGQDESEGKTAGMGKARKFFKRLSSSGAKSTNSVTNSRKSSMSSVRRVSSSE
FT                   SVIADRRASPEGKKSWSVKSDNTKRRSFHSLFSNSSIGLNSTEPLKPHTGLTNIEEKRG
FT                   RDDADASKEQGVYQESAGPTSPVKPLRFDNANKRSDSNSEKSEDEADRTLEANSHDEEN
FT                   VGNEFVFDNSVSRPYKQTYSSESELEAASELNPKSKLRTISISGSQTSILNEQGTLMNE
FT                   INLLSKELAESIARESRLEQQLAGKGKDSKENEALSITDFETELRKKSTKIVELIQQLN
FT                   DERLRRYIAEEQIMLQEHGAKPSSVDLIHKIQIQNQQIVAKDEEISKLKEQLQRTQT"
FT   gene            <826606..>829439
FT                   /locus_tag="KLTH0E09130g"
FT                   /old_locus_tag="Klth0E.mRNA.683.p"
FT   CDS_pept        join(826606..826630,826876..829439)
FT                   /locus_tag="KLTH0E09130g"
FT                   /old_locus_tag="Klth0E.mRNA.683.p"
FT                   /product="KLTH0E09130p"
FT                   /note="similar to uniprot|P34160 Saccharomyces cerevisiae
FT                   YMR125W STO1 Large subunit of the nuclear mRNA cap-binding
FT                   protein complex interacts with Npl3p to carry poly(A) mRNA
FT                   from the nucleus to the cytoplasm also involved in mRNA
FT                   degradation in the nucleus orthologous to mammalian CBP80"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23435"
FT                   /db_xref="GOA:C5DI24"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR015172"
FT                   /db_xref="InterPro:IPR015174"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027159"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI24"
FT                   /protein_id="CAR23435.1"
FT                   /translation="MSGVKRRRNFDDDDGYRDFRPRMPKRQRVPPVVQLCKEMMPDIRT
FT                   LGETVKAFEEDIKFLSEAIVNEFGNEEYFRDALLKTFYAVVVEQPHKQPAIALLVMVVN
FT                   ASNPVAGKSILNHFFSKLQQWCDNSIDDGFQVTSNETGPWNKVKLLLRFLSLLSPMILE
FT                   DELLSLYKKLFELSVGLNNSEPDKRNPLSEAIYSNTLLNVPYLFFFRRENESLRQKVSK
FT                   LISEVEVQYTMKKTDLSLVQEYNKNFPYEPIQWIQAVLPNVKRVLANDLQQLAELFPDY
FT                   SHLLKEQAGDQGFNDPLTLPSVDQLKPFSGLDRGLGSVDGMWRVPRYSFRVYLANEIGE
FT                   FETVVPFTTYAGMLFKDIVIDIVESLEFNRKEVAKQVITLDLFFKPGIFTEPGQSIAQL
FT                   VALHEENPIITTYKIEDLAIEKILSMIFKLPNVSHPSAYFYTLLVEICQNSPKAIAPVF
FT                   GRAFRFFYHNLDALDFELKLRYLDWFSIQMSNFNFSWKWNEWEGDALKFGETFFNPKVT
FT                   FMKNLIKKELRLTSNKSDVEDSLTDVFRPFTDSSFVPSQDLYEYYQSFFKGYEISEDQI
FT                   KDNSLFFTESSLPFSDLVQQIVNYFHKQPLDRNISELVSILEKMKVDNETIVVDFNRLA
FT                   VTTLVQVLVFSGNRSISHANKYIGDARTELLEILGKIEASQEQKERWIVEAIIRYWNCN
FT                   SQNGYLIADTCKNFDLISSKSILDFSFLDDKGRNWGLVDATSIESTFRVLSELSSRRDT
FT                   SVETFIFVFERLVEIASNVVEELGLSVDSELSASMADPDEMQDESADLQKLDCSWKYEG
FT                   CMGFVKSVLRKYADEYASALEKLDSIINERVTHQQTKRTLQGWCRELSEL"
FT   gene            complement(<829561..>830628)
FT                   /locus_tag="KLTH0E09152g"
FT                   /old_locus_tag="KLTH-ORF9030"
FT   CDS_pept        complement(829561..830628)
FT                   /locus_tag="KLTH0E09152g"
FT                   /old_locus_tag="KLTH-ORF9030"
FT                   /product="KLTH0E09152p"
FT                   /note="similar to uniprot|Q04216 Saccharomyces cerevisiae
FT                   YMR126C DLT1 Protein of unknown function deletion causes
FT                   sensitivity to thermal stress"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23436"
FT                   /db_xref="GOA:C5DI25"
FT                   /db_xref="InterPro:IPR038869"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DI25"
FT                   /protein_id="CAR23436.1"
FT                   /translation="MNGDEKLGIWLYRTSLVVLVLFFVGFSVVVPIDAMAQASRSTNDA
FT                   LNTFIVVGAFVAFGVLSIIIAVGRVLVQRSCLQDIPKGYLPITPEDMPHQPSRSMILEQ
FT                   MDRSHKLAVLLKKPKEPVTHDGLARPDSDDHGLPPLLNYEDSIKIITSRLKYQGVFSNL
FT                   VKLDSDTGDTFATIARSMSAQNKLSSSEAAEYIKLYEAIRFSGKEITKEQFLQFMDRSI
FT                   FFLDSLISTGSIEPRSHRAGDGQKNYSFPPTRAQNTLTTPLQQYVTDYADNESVDTTNI
FT                   IFPRSPDYALESSSALHYLTTTNTSSTVARKVTPSSYRKDFSGLNETASEEAFRGNNHL
FT                   KLNDNESYDSVVKRC"
FT   gene            <830858..>834304
FT                   /locus_tag="KLTH0E09174g"
FT                   /old_locus_tag="KLTH-ORF9028"
FT   CDS_pept        830858..834304
FT                   /locus_tag="KLTH0E09174g"
FT                   /old_locus_tag="KLTH-ORF9028"
FT                   /product="KLTH0E09174p"
FT                   /note="similar to uniprot|P32849 Saccharomyces cerevisiae
FT                   YLR032W RAD5 Single-stranded DNA-dependent ATPase involved
FT                   in postreplication repair contains RING finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09174g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23437"
FT                   /db_xref="GOA:C5DI26"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI26"
FT                   /protein_id="CAR23437.1"
FT                   /translation="MSKDGDMVIKGAEKPEKRRFFNEDLEEDGDGANDTTGDGVLQNDL
FT                   SNQNSFLFGGASDTPGVEESMNEIEEIKDVIPNLTDSQANDLLQKAGTSSDKRERIASA
FT                   VEIYFENHGPQSKPTEPKQSRPSPQPGSAFKLTKISAPLSPTPAKRIRDYGARLFKKHK
FT                   PTVRWRRFIGSMQVSALATRPTVKPLKYGSELKILRTSSDALGKLYYANGRKKASMANY
FT                   VRLVDENLNREVGRVPEDVAMILFPLVDSDELDFEATMIYCNNRRLSVGDSFIVQLDCF
FT                   LTSVMFENYSTLTRNTPVLNKRTFSQNVVESEEELRLKSRRLALISLFDQVQLRTISEN
FT                   DSLDSSFDEPAEVVDLDNESDSGGETAKNVDIRSIQPSQIQDDVLNVNQLKSLYKSTLS
FT                   MESSKFLPETSPSVESFQLELRRYQKQGLTWMLRREREFDLVSDTASSEEVDGDMMNPL
FT                   WKKFRWPKDLSWASQKQTRIELHSQHSVDCFYANLHTGEFSQAKPVIKSMLKGGILADE
FT                   MGLGKTISTLAMILTVPHDRGYHERKPSEQQEKLDADISILGSQRVEHSKPYAFKTTLV
FT                   VVPMSLLSQWQQEFEKSVSNPELHCEIYYGGNTSSLRTLLTKNKSPPIVLLTTYGTVQH
FT                   EWSRLMNKNTGYMESDTTGLFSVEFFRIVIDEGHTIRNRNTRTSKSLMDLESSRRWILT
FT                   GTPIINRLDDLFSLIKFMRLEPWSQVGYWKTFVSDPFEKKNYKSAFDVVSSILEPVILR
FT                   RTKVMRGVDGKRLVELPPKEVIIEKVSFNKSEDTLYQYFLNRAENSVKEGLDRGDLLKK
FT                   YSTILVHILRLRQVCCHSDLLGSLDENDEDLTENKMLTEPVKIDEKLANATSSSDISQE
FT                   ELDAIISLVQTKFPDEEQFKKLECSICTSEPIEPIMQVVFTECGHTFCELCILEYIRFQ
FT                   SERKQEVKCPNCRQAIDSKKLLTLENDSNKIKIVHYNGGSKSSKITSLVKSLKRLQDVS
FT                   SGEQVVVFSQFSSFLDIMQRELSASFSSSVAQIYKFDGRLSMKERSRVLHDFATKDLSK
FT                   LKILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRIHRIGQVNDVKVVRFIME
FT                   HSIEEKMLRIQERKRTLGEAVDADEDERRKRRIEEIQMLFE"
FT   gene            complement(<834381..>835325)
FT                   /locus_tag="KLTH0E09196g"
FT                   /old_locus_tag="KLTH-ORF9024"
FT   CDS_pept        complement(834381..835325)
FT                   /locus_tag="KLTH0E09196g"
FT                   /old_locus_tag="KLTH-ORF9024"
FT                   /product="KLTH0E09196p"
FT                   /note="similar to uniprot|P40963 Saccharomyces cerevisiae
FT                   YMR127C SAS2 Histone acetyltransferase (HAT) catalytic
FT                   subunit of the SAS complex (Sas2p-Sas4p-Sas5p) which
FT                   acetylates free histones and nucleosomes and regulates
FT                   transcriptional silencing member of the
FT                   MYSTacetyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23438"
FT                   /db_xref="GOA:C5DI27"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040706"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI27"
FT                   /protein_id="CAR23438.1"
FT                   /translation="MGNKTVAAEDENLYGILKEPNIGKVQLGLEKMFPTRYGNAAYFAA
FT                   GTQSLGIRDSVDTPRRTTTSGVGATDFWLDTLYVCEFCFKYTDEEVALRRHVSCCRYRT
FT                   KPPGRIQYMSPEYTIRKVRGSKHPLFCQCLCLFTKLFLDNKSMYFKTDHYDFFIIYQSS
FT                   TKEPMGFFSKDLISYQKNNLACVLTLPPYQRKGIGSLLVDFSYKLSIRDGLISGPERPL
FT                   SPFGLVSYLKYWSSQICWQLLEGDLSGSGRTSLDAISRATGIRIGDILLTLRSLNCLTK
FT                   DYDVSLSVLRAWAKDNYSYRNSLVRDEYLVLDN"
FT   gene            <835647..>839408
FT                   /locus_tag="KLTH0E09218g"
FT                   /old_locus_tag="KLTH-ORF9023"
FT   CDS_pept        835647..839408
FT                   /locus_tag="KLTH0E09218g"
FT                   /old_locus_tag="KLTH-ORF9023"
FT                   /product="KLTH0E09218p"
FT                   /note="similar to uniprot|Q04217 Saccharomyces cerevisiae
FT                   YMR128W ECM16 Essential DEAH-box ATP-dependent RNA helicase
FT                   specific to the U3 snoRNP predominantly nucleolar in
FT                   distribution required for 18S rRNA synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09218g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23439"
FT                   /db_xref="GOA:C5DI28"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI28"
FT                   /protein_id="CAR23439.1"
FT                   /translation="MGTYRKRFNEKARAGQMAKLKELKRVRNKQFLRHLDDGAGETEKA
FT                   APQKKDSNAEVIEPMDDEEKELKKRKLEELFKPQESKISRIKKKRLDKFIEHQLKREEK
FT                   KVIIEKLQDYKIDTSILTSSKNLGHGRQTKKEEFEEALKLERLGRSNDRVKNILYEEHQ
FT                   TKNWEEDHAENSDMGSNNEEEGTFRDTEGLEKSSSFVDNRPAKYGGSGFGLGFQNVKVV
FT                   NKAKPASKKRYNWRQRLEIEDARKHSKEEELDFESSSSDEAEYSEAEFSDESESDNKSG
FT                   SDLEASVSEDEEPGEASNLSESESGNSSELEEPTSKAASDFKDWAANEIKRIEGRDGPL
FT                   ETPQPSFKYQKIIRSEDLDDGLQDDSAPINENSTRKAFFVNVTRPDDIQKARMQLPVFG
FT                   EEHKIMEAIHHNDVVVICGETGSGKTTQVPQFLYESGYGNPDSVESPGIVGVTQPRRVA
FT                   AVSMSKRVSQELGDHQQSVSYQIRFDSTVSDKTKIKFMTDGVLLREMMNDFMLTKYSAI
FT                   VIDEAHERNINTDILIGLLSRCVNLRAKRNQENPQLVKKLKLIIMSATLRVSDFSENQT
FT                   LFPSPPPVLKVEARQYPVSVHFNKRTAFNYTEEAFRKTCKIHQRLPPGAILVFMTGQQE
FT                   ITHMVKRLRKEFPFPKATRGYKEMDMKDTTMKVNPKNADVEAEEIDFSINLNDEHTDEG
FT                   ADDYEEQSSDEEGFEETLEEGQTKSDPLYVLPLYSLLSTKEQMKVFQDPPEGSRLCVVA
FT                   TNVAETSLTIPNVRYVVDCGRSKERVFNESNGVQSFEVGWVSKASADQRSGRAGRTGPG
FT                   HCYRLYSSAVYENDFEQFSKPEILRMPVESVVLQMKSMAIHNILNFPFPTPPDRGFLSK
FT                   AMKLLQYLGALDQSENVTEEGRKMSLFPLSPRFSKMLLVGDEQNCLPYVVSIVSALSVG
FT                   DPFLSENEVCINTGDSEDGEGPRDNEDQAQSLNQQLASRYHKSQAKFSRLDKYSDVFKL
FT                   LSAVSSLDFIKKEERIRFMESNFLRPKIMEEIKKLRQQILYIVKSNTSRENIAVNVSEE
FT                   DLKCGIPSETQKKLLKQMVCAGFVDQVAIRADFLAPEECKITNRTALSNIPYIAVLAPK
FT                   VPGDISHNFVYIHPSSILNGIGEEPPKFLVYHSLHLNQRTEKSKTRIKPLCDIKSTPLA
FT                   NIARKGSLISFSKPLSGQGLRAIDLSPTERYCYVTPRFGATVDSDLKVGWDLNPIAVHQ
FT                   KKQAGRWVVDRFITSKNYNAASVKKTQV"
FT   gene            <839763..>841409
FT                   /locus_tag="KLTH0E09240g"
FT                   /old_locus_tag="Klth0E.mRNA.734.p"
FT   CDS_pept        join(839763..839809,839906..841409)
FT                   /locus_tag="KLTH0E09240g"
FT                   /old_locus_tag="Klth0E.mRNA.734.p"
FT                   /product="KLTH0E09240p"
FT                   /note="similar to uniprot|Q07979 Saccharomyces cerevisiae
FT                   YLR033W RSC58 Remodels the structure of chromatin complex
FT                   58KDa subunit; Chromatin Remodeling Complex subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23440"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI29"
FT                   /protein_id="CAR23440.1"
FT                   /translation="MDHTVVFNNLQSVLQAASSKCKVIDEKFPSKFFEKDPARIFESYK
FT                   KFLKPKLDGEGNVKNKDNLPVTTIAEKFSKNEYVKRPGAFYRLHHDIKLVCTLLIHFYP
FT                   QGTRTYQMVDKFYKFATELLLRECYRYGISMVEESEEQYSDEKTLFNKQVSRDFIKISV
FT                   GYSVPYAESYYISSGGLDLFSSTISKSQLDHRVTEPPNSSFVSNKIVPQAGNEIAPKLG
FT                   FVAANVSNIPDPTLPPSEMMTKFLHPNWYALPTTVWLEYGDFKSWAPSFNESGTVLDAA
FT                   RRGTIWLEKTGYTSLWKLKNKHKDTLTREDSEEASNKETNNESTESVSAGTEALKHNDI
FT                   AQPIGVSKESSPQKNVESEQNVGNTSNGASSIEIDEHQADDKETGENNPVSSPISSGSL
FT                   KIKLENLYEWSPGNNISDEEIQVITEGNAHKLVTQTLLELKEMKRKRVKSKKVSKPAAK
FT                   EMELYYRAQRLLREVMLAKKVESVPQITAKSFPVLQANYMGSVPVVRTIQTRKKKYKK"
FT   gene            complement(<841503..>842918)
FT                   /locus_tag="KLTH0E09262g"
FT                   /old_locus_tag="KLTH-ORF9016"
FT   CDS_pept        complement(841503..842918)
FT                   /locus_tag="KLTH0E09262g"
FT                   /old_locus_tag="KLTH-ORF9016"
FT                   /product="KLTH0E09262p"
FT                   /note="highly similar to uniprot|Q12078 Saccharomyces
FT                   cerevisiae YLR034C SMF3 Putative metal transporter Nramp
FT                   homolog homolog of SMF1 and SMF2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09262g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23441"
FT                   /db_xref="GOA:C5DI30"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI30"
FT                   /protein_id="CAR23441.1"
FT                   /translation="MGASNVLQIVRKFASFVGPGVMISVAYMDPGNYSTSVSGGAQFRY
FT                   KLLFAIFVSNIFAVILQCLCVKLGTVTGLDLAENCRRHLPRKLNLVIYFFAELAIIATD
FT                   LAEVVGTAVALQILFKIPLLWGVLLTVLDVLAILIFYRPEEHSMKQVRFFEMFVTTLVS
FT                   ATVICFLLELFKISVPHKAELFKGFLPSKIVFENEQAMFISLGILGATVMPHSLYLGSS
FT                   LVKPRLNEYDLKKYGKLGSSPSVSAIKYTLNYSYAELIISLFIIATFVNSAILIVAAAS
FT                   LYGQPEADDADLTSIYNLLTYYISPAAGLIFAFAMLFSGQSAGVICTMAGQIVSEGFLK
FT                   WTLKPWVTRLVTRLIAIIPCFLVTIFLGDRGISDMLNLSQVILSLILPIVSAPLIYFTS
FT                   NSKIMTVIDSNDELDMSGEPNESTALNGSGAARVNYANGRLLTMVSSLVWIIISSLNCY
FT                   LVISFMCGAEVHF"
FT   gene            <843354..>847163
FT                   /locus_tag="KLTH0E09284g"
FT                   /old_locus_tag="KLTH-ORF9012"
FT   CDS_pept        843354..847163
FT                   /locus_tag="KLTH0E09284g"
FT                   /old_locus_tag="KLTH-ORF9012"
FT                   /product="KLTH0E09284p"
FT                   /note="similar to uniprot|P39685 Saccharomyces cerevisiae
FT                   YMR129W POM152 Nuclear pore membrane glycoprotein may be
FT                   involved in duplication of nuclear pores and nuclear pore
FT                   complexes during S-phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23442"
FT                   /db_xref="GOA:C5DI31"
FT                   /db_xref="InterPro:IPR037701"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI31"
FT                   /protein_id="CAR23442.1"
FT                   /translation="MDFRHRFNDEKPSSARLRERSSSFARTAWHDSTHEMSASRKDDLP
FT                   LISTEVLDIPSQRALVVAVFAIIQAYKLYDLILLKSGLPVAGVLLTSSRFNFISKYLVI
FT                   DSLFLYFLPGLKIPKLTFRPVAVLLQIMAVTATTVFLSNEQNFPLLTFLVSAWTKFNAK
FT                   ELSLTGGSVSQRKLVDPASHFKGAHTIKILPENTAMLNPFHDSFCINLDGTSVDDIHIP
FT                   LRINSTSELDFVQLEYHSLDSPAKELLNFTKKQLVEVPRSHELFQRDRASHHNSIRYFL
FT                   LPVEEIGLYKVKQVIDSKKFHLRLYKSEVIIPHCPWGVIAGLGNFDRCVGDSNKVSIEV
FT                   HGVPPMELEYTRSLNGESSKFVDSSLQPEYFDSPLMFNQKAYTAENLADLKWARSYPVT
FT                   INLEALLKDDGVHSYTLQRVVDGFGNKMDFSGLSSSLLEKYGLSYSFKVHDLPKATLDS
FT                   KFDHNSPTKRSLEIKFESSRDWDDAVPYKAAIEVINDSEERSILEYELKKPVTEIPIDQ
FT                   PGTYRLESVGSKFCSGIVVDKSNILVTQPIPPRLEVKSTPILDQCVGQVGLNFDLTFTG
FT                   VPPFYYRTKIYKIEGKERKLHDAKKFTSQGTRNQFHYSPSSEGNYEIVFDQISNTLFTK
FT                   AIPLSPVEDYTFKTSMRVKPDAAISSHYATQLCLGSRSKVPVAFKGEPPFSLEYDILET
FT                   STNKRVTYSLNDINSFNYDLQTPVFDVGGDYILSLVSVKDTSGCLVGLSSSDARIEVRR
FT                   DVPSAGFNSFENHDVMLIKEGAFAELPLSLSGVAPFTVSYQHFDSKGEHMGTYDATFMS
FT                   SYKAGLKVEKEGTYKLMSVKDRSCLGKISESKEFSVAFLEKPGFKVLEHNKLSKHDDMV
FT                   FAKDDVCENFEETVDLVLSGSAPFVLSYELMSPSGQIASRSIQVATKFASIKLPNDRSG
FT                   QYTLTVKGVSDSHYTEKDLAKIGFTTLDVVVKQHVRPLPAIGFAEPGKTFRTCSADVDN
FT                   LSGLEKIALHVKSGRAPFSVSFSIYHESTSKTDYVTIDNVTKKNFDFSKLFKGLKLGTH
FT                   IVTMGKVVDANGCTSESGSDKNHILISITDVPRISLAEPNMEFCVGDYVAYQLSGLAPF
FT                   NIKYEFNGVPLKSKERTSQFVRLASEAGIISVLSLQDSASQCLVNFTRPGMEREFEALS
FT                   LVVHPIPSVTVSRGDYIVEDIHEGDQAEIIFSFEGTPPFSLTYVRTEEVDDKRGKKRPQ
FT                   IVETHKVEDIYSYEYRTFTSLQGRYEAIAISDAYCFAKNNAYFA"
FT   gene            <847722..>848345
FT                   /locus_tag="KLTH0E09306g"
FT                   /old_locus_tag="KLTH-ORF9009"
FT   CDS_pept        847722..848345
FT                   /locus_tag="KLTH0E09306g"
FT                   /old_locus_tag="KLTH-ORF9009"
FT                   /product="KLTH0E09306p"
FT                   /note="similar to uniprot|Q04223 Saccharomyces cerevisiae
FT                   YMR130W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23443"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI32"
FT                   /protein_id="CAR23443.1"
FT                   /translation="MVDEILHVFEGFGAYTVYPDLLELLELIQQEHSEVVLGVVSNTDP
FT                   IMYKLLENIGLKPYFKNHVYLSYDLELSKPDPVFFEAVLHDVVKQHPELLKNSTLEELK
FT                   TDCWHVGDEENNDLNCPASAGWNAVLLDRMNKYNHFSESFERAQRSLHQLYTDKIDNDS
FT                   GKSWQLSMKQVDAIQLSERRFVISNFRTLSQLLFPSTSNGPSSN"
FT   gene            complement(<848442..>848524)
FT                   /locus_tag="KLTH0E09328r"
FT                   /old_locus_tag="Klth0E.tAla.TGC.22"
FT   tRNA            complement(join(848442..848477,848489..848524))
FT                   /locus_tag="KLTH0E09328r"
FT                   /old_locus_tag="Klth0E.tAla.TGC.22"
FT                   /note="tRNA-Ala (TGC) cove"
FT   gene            complement(<849882..>850130)
FT                   /locus_tag="KLTH0E09350g"
FT                   /old_locus_tag="KLTH.mRNA.214CM.m"
FT   CDS_pept        complement(849882..850130)
FT                   /locus_tag="KLTH0E09350g"
FT                   /old_locus_tag="KLTH.mRNA.214CM.m"
FT                   /product="KLTH0E09350p"
FT                   /note="highly similar to uniprot|Q01519 Saccharomyces
FT                   cerevisiae YLR038C COX12 Subunit VIb of cytochrome c
FT                   oxidase which is the terminal member of the mitochondrial
FT                   inner membrane electron transport chain required for
FT                   assembly of fully active cytochrome c oxidase but not
FT                   required for activity after assembly"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23444"
FT                   /db_xref="GOA:C5DI33"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="InterPro:IPR036549"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI33"
FT                   /protein_id="CAR23444.1"
FT                   /translation="MSEKQESPLHTVGFDARFPNQNQTMHCWQSYVDYYKCINAKGEDF
FT                   APCKVFFRTFSSLCPLDWVERWDEQREKGTFPGDIKP"
FT   gene            complement(<850371..>853364)
FT                   /locus_tag="KLTH0E09372g"
FT                   /old_locus_tag="KLTH-ORF9003"
FT   CDS_pept        complement(850371..853364)
FT                   /locus_tag="KLTH0E09372g"
FT                   /old_locus_tag="KLTH-ORF9003"
FT                   /product="KLTH0E09372p"
FT                   /note="similar to uniprot|P40395 Saccharomyces cerevisiae
FT                   YLR039C RIC1 Subunit of a Golgi membrane exchange factor
FT                   (Ric1p-Rgp1p) that catalyzes nucleotide exchange on Ypt6p
FT                   involved in transcription of ribosomal protein genes and
FT                   ribosomal RNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23445"
FT                   /db_xref="GOA:C5DI34"
FT                   /db_xref="InterPro:IPR009771"
FT                   /db_xref="InterPro:IPR040096"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI34"
FT                   /protein_id="CAR23445.1"
FT                   /translation="MLIGPLKPPQFSRVPFAKPSENPGPANNEKTLQTVLLPHSNCMVV
FT                   LTTRQVLIYNYKPMALVATNLRSNESIEEYGENKSAFADAANSDLFSGIVPEAGPNYAG
FT                   LHQRKATFYVVSERNFVFVFQVLLGSSPATILKETGIPIVDIQSMDPYFGQELVDNSDE
FT                   SDALTVFDKFDVHKVIQNGYAVEKQQGFLHFLTGSSDNVDEIPIKRIELRLRIILKFEH
FT                   SILDFAGFREVNTEDNGDHKEYMLVLFPHGLQILELQNFKLKDTSLIKVTGGLKILQFR
FT                   DSLCVVSQSSEQITINRLNVREKIVYSDKLDFSAESSLINTFERGSALVLAFKKEIVSY
FT                   NFKDDKIIKRFKALSEINCFEHITEEANIILTKNGMSFLTEFYNCIFSTLDNDNNDNEL
FT                   DDFANFTSLTSLGGTLVCTSHDGRVAKWDLWVEASSPFCDMRHSKPFILLNDFNDIMLF
FT                   SPTPESSGNVPFQIIKLPTQTINNYVPLLRANGPVTMLAAYVSNKNILLIHNLISNEWH
FT                   SFPDMIVLEMSWLGSEYLLCYVLDEERNELLKCYHMPSQLGPIPDLSAQILWEYPIPSS
FT                   SILKSFHANTLSKYKLLKVTSKNADDSDIESMFKIAEIILQNSAGEIRVIDVISKVHAD
FT                   GSSKVKLFHQLPVQKLTESFEEAFDWVLAFNEGFLSYSLGSIVKWEKKGDSEEWSFETL
FT                   LENVERILDVVDAKAYFVQEESVVIFSLEDLWNNADPIARVAVNENDYPVAISYNAAII
FT                   HSVQFVFTRNLCKIVPHQTMYLDQVINHLLQKGAPSQDIDTRYHALNHYKFSLEKILSS
FT                   KVLTNEPLQSIVELIDYYDQGPKFSGRLEIISNCLRKIEVEHWDYLFKEIKLTPRDLLV
FT                   QCVEQDEAKVLGVLLMVFLNYDGGKRGGQPEVKPKSKPKRNKKNKNRGANTTHSNSGNA
FT                   STVSTILNDEELMVQVLKILVNAAASSTEPDQAREFWDLSFQLVRFIHALDNQNHSSLV
FT                   QDALKLIT"
FT   gene            complement(<853592..>855160)
FT                   /locus_tag="KLTH0E09394g"
FT                   /old_locus_tag="KLTH-ORF9001"
FT   CDS_pept        complement(853592..855160)
FT                   /locus_tag="KLTH0E09394g"
FT                   /old_locus_tag="KLTH-ORF9001"
FT                   /product="KLTH0E09394p"
FT                   /note="highly similar to uniprot|Q04225 Saccharomyces
FT                   cerevisiae YMR131C RRB1 RiboSome Assembly 2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09394g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23446"
FT                   /db_xref="GOA:C5DI35"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI35"
FT                   /protein_id="CAR23446.1"
FT                   /translation="MVKRSAQIEEVADTADDRVVSRKVGSSDLPPSASRDEGDIDMGEF
FT                   EDQYSDEFESDGEIIQMDGDEENEDEQDGDEDFMEKNQQKAQELVNQDQAAEQNQQNAE
FT                   QQLYLPHMSRPLGPDEVLEADPTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLL
FT                   LTTATQASKKKDNELLLLKMSQLAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDT
FT                   TNRLKVSPFASESPEKLTATMSENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRS
FT                   HGNVEGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQF
FT                   SRTEATVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDN
FT                   GSWGVWDLRQFSPNTAASTSPVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDL
FT                   SVEADDEEIKQQAAETRELQEIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGLNIW
FT                   KTISV"
FT   gene            complement(<855384..>855995)
FT                   /locus_tag="KLTH0E09416g"
FT                   /old_locus_tag="KLTH-ORF8997"
FT   CDS_pept        complement(855384..855995)
FT                   /locus_tag="KLTH0E09416g"
FT                   /old_locus_tag="KLTH-ORF8997"
FT                   /product="KLTH0E09416p"
FT                   /note="similar to uniprot|P40206 Saccharomyces cerevisiae
FT                   YMR132C JLP2 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09416g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23447"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="InterPro:IPR039730"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI36"
FT                   /protein_id="CAR23447.1"
FT                   /translation="MVYFYTAKSDEGCEYSIVVGKDKFENDLLIKYGYKDLNYYWFHAD
FT                   KYSSGHVYLKLFDGECDLRNVPKEVVRDCLQLCKSKSIQGNKLPQCTILATPWINLRKS
FT                   GYMKPGEVSFKSMKKINKLECYGRENQVLNRLDKTKVEVFDNVEELLHQAKKEKDPEFF
FT                   VNFISQNRELLAIQEQERKSAKKAKKQKSKTGPDFEVSGP"
FT   gene            <856237..>857586
FT                   /locus_tag="KLTH0E09438g"
FT                   /old_locus_tag="KLTH-ORF8996"
FT   CDS_pept        856237..857586
FT                   /locus_tag="KLTH0E09438g"
FT                   /old_locus_tag="KLTH-ORF8996"
FT                   /product="KLTH0E09438p"
FT                   /note="weakly similar to uniprot|P32841 Saccharomyces
FT                   cerevisiae YMR133W REC114 Protein involved in early stages
FT                   of meiotic recombination possibly involved in the
FT                   coordination of recombination and meiotic division
FT                   mutations lead to premature initiation of the first meiotic
FT                   division"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09438g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23448"
FT                   /db_xref="GOA:C5DI37"
FT                   /db_xref="InterPro:IPR004354"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI37"
FT                   /protein_id="CAR23448.1"
FT                   /translation="MFDTSVELRRYACYLEEIPAPQGLNSVRGPTNVDKWKHIKNSVKK
FT                   EFLIRQDNARKFTLQVLVDDVNMERIVVDFGSAVATSSVPGNVAQFSARFPSIMCKYLQ
FT                   VLDNRVVIRRFQMGFMALQDFDRCCNSLQQIGFMLKSASILRADEHFQSRTDSILSSQM
FT                   PAEISSLTPPSSQFHVQNSFSSSTKRPLDQDSPQAPISRENISNYRKDINQTNGNIQST
FT                   APLDTQTLIGNKVLSRESSSLQEFVKKPTESRVVSTANHFLNPQYLSKEVGDKASSSPR
FT                   NKPTREETHIPTKGPNLVASSRENTFKLYKKPLDQCVPINVSKSPHMLGEYIDVVSAQS
FT                   ERVAVPEGAPRSSSHQKIFETENQSESSGASVAKLPCSQSLIHPLQGLLGKEDLRQPLS
FT                   PTNGTLEREAIPTRPALTKDLLKERIKDQNFMQWVCQAFRSHFDYLISRT"
FT   gene            complement(<857811..>858581)
FT                   /locus_tag="KLTH0E09460g"
FT                   /old_locus_tag="KLTH-ORF8995"
FT   CDS_pept        complement(857811..858581)
FT                   /locus_tag="KLTH0E09460g"
FT                   /old_locus_tag="KLTH-ORF8995"
FT                   /product="KLTH0E09460p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09460g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23449"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI38"
FT                   /protein_id="CAR23449.1"
FT                   /translation="MHISLSTLLPLLPATALALSSLDESSAGAGSSDTTAAVAGLSEAA
FT                   AGISTASSVAEESGAAAEDSSATKEVDATGPATGVSYTGATAGVATGISSIAAATGLGD
FT                   NSLGNSTASIAESASGASTAMPSIETSLGSSSNSSSNSTGSYGNAGEGTSSTTILQPGS
FT                   SSALNSTSYGNSSSSTGSSSDSSGDSDYSPSGSANLNESAASGSSASGSASGSGASSTS
FT                   SGNSTGSGASSTGGANSYNVPVAAGLLAGALAFL"
FT   gene            <859339..>860070
FT                   /locus_tag="KLTH0E09482g"
FT                   /old_locus_tag="KLTH-ORF8992"
FT   CDS_pept        859339..860070
FT                   /locus_tag="KLTH0E09482g"
FT                   /old_locus_tag="KLTH-ORF8992"
FT                   /product="KLTH0E09482p"
FT                   /note="similar to uniprot|P40207 Saccharomyces cerevisiae
FT                   YMR134W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23450"
FT                   /db_xref="GOA:C5DI39"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI39"
FT                   /protein_id="CAR23450.1"
FT                   /translation="MWNRVVSHLSNLEDVAINYLRRFPCMAEYTYDPISARITLFLLVV
FT                   GTMAFINELYITIEMTFLQKETYAELNKAPLNVEDLRNHRMVMDDEFHGREWWDEKSGI
FT                   VIEEFESRERFFAKPVHVAHVYVECNIIDGETGSDLLSRPFQFHIEFSPEEYENEKRPE
FT                   FGCKLIVLRRKLYHFFKETELYQELVAHNSKKDESVRFTVSSGVKIYNAAKELLPTTID
FT                   DIQLCFLKIETGDSIRCDFVV"
FT   gene            complement(<860113..>861270)
FT                   /locus_tag="KLTH0E09504g"
FT                   /old_locus_tag="KLTH-ORF8991"
FT   CDS_pept        complement(860113..861270)
FT                   /locus_tag="KLTH0E09504g"
FT                   /old_locus_tag="KLTH-ORF8991"
FT                   /product="KLTH0E09504p"
FT                   /note="similar to uniprot|P40208 Saccharomyces cerevisiae
FT                   YMR135C GID8 Protein of unknown function involved in
FT                   proteasome-dependent catabolite inactivation of fructose-1
FT                   6-bisphosphatase contains LisH and CTLH domains like
FT                   Vid30p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23451"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI40"
FT                   /protein_id="CAR23451.1"
FT                   /translation="MTNSNGTYDRKAFTRQEWKEYVVDSGLSLDLNGNSSELRSGGDLQ
FT                   NKRSCSEPSIANLLLNYFVVMSYEESSIRMARELGYVRNNKDAELFNQVYKIRERAHVR
FT                   ELIKRGRILEAIELICSTFGAQVLENVKTESSTKPKAGEDDLHFKLLLLNLIEMIRKHH
FT                   QSGASPEESSGFILELIEYSQQKLAFKADSNKRYMKELELVMTLLLFPMESSSEGESSS
FT                   SLPKSLRNLYSLSLRTKIADLVNRKLLESMHAEILSSSNSAAFPDLIGFKTFHKGFSTY
FT                   NGLLNTKTKDSTDIEYTTTKLGDIKGGLDATPASKPWDTNAWKNTASLLKERDSESETK
FT                   PDDSVEASQQIQYEAKLNQVMKLWAWCENQLHNCGVGVPRVEGGV"
FT   gene            <861720..>862328
FT                   /locus_tag="KLTH0E09526g"
FT                   /old_locus_tag="KLTH-ORF8988"
FT   CDS_pept        861720..862328
FT                   /locus_tag="KLTH0E09526g"
FT                   /old_locus_tag="KLTH-ORF8988"
FT                   /product="KLTH0E09526p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09526g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23452"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI41"
FT                   /protein_id="CAR23452.1"
FT                   /translation="MRSQTWPARASALINYRSLGTHVNSVITRAVNCRLRTGAQQHRGE
FT                   PVSSAATLFLIVQSKYWLLENKLYFCRSGLSCSAFEARRIFEFLVLALECGLKNTYILH
FT                   ARSLSAPRPAFQFLVLTSLMLSYLMSLCKMLTLINFCKCGMDDSYKAPTLARLVAGVEL
FT                   NKPFPAEISQTIRWAFPRTLMLKLYHSFSLGARLDLRRL"
FT   gene            <862710..>864221
FT                   /locus_tag="KLTH0E09548g"
FT                   /old_locus_tag="KLTH-ORF8986"
FT   CDS_pept        862710..864221
FT                   /locus_tag="KLTH0E09548g"
FT                   /old_locus_tag="KLTH-ORF8986"
FT                   /product="KLTH0E09548p"
FT                   /note="weakly similar to uniprot|P40209 Saccharomyces
FT                   cerevisiae YMR136W GAT2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23453"
FT                   /db_xref="GOA:C5DI42"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI42"
FT                   /protein_id="CAR23453.1"
FT                   /translation="MSVATEKKSIYHTNEKAPEYASVSRPQFHAGSVCLTAYSPTQDQI
FT                   VREAKCMGKTSRQPTRQSVPSLASLLRVSPSPLDLHAGHKEASTPDSERTISRRSSFSN
FT                   TASRDQSMKARAINWPTEFQQEERAVDSRAPAYQYVSSQRPKLPTHGRKHSLDSLMTAA
FT                   QTLEREVQKSMLSIENLDRTYQAKILGIIELKNAISGNLENWPITKGALHIDRHQSCLV
FT                   DSLPLRSIEEMLQSSKKLVAEVTDLLAIKTRATPYTETAAPSNQSYTHQPQQQLILPSP
FT                   AEMLSCRQLGTDHHASRKLSFSKQPLKASATRVGDNKVWHQSHMPHFDQGLNSEKGETH
FT                   SSKEHSTHDQRPTQTAVHLTSKSPQRLRDKEQQAFRIEKPERLTTQIFALTKPSFDIPL
FT                   ESCMPRDLPETMECVHCSRKDTPEWRRGPYGNRTVCNACGLFYGKLVRRFGAHRANIMM
FT                   HYRRRTAPEDRRVPNAFFVPESFLKELHQDVTFEEVPVRTSLLSH"
FT   gene            complement(<864260..>866047)
FT                   /locus_tag="KLTH0E09570g"
FT                   /old_locus_tag="KLTH-ORF8984"
FT   CDS_pept        complement(864260..866047)
FT                   /locus_tag="KLTH0E09570g"
FT                   /old_locus_tag="KLTH-ORF8984"
FT                   /product="KLTH0E09570p"
FT                   /note="similar to uniprot|P30620 Saccharomyces cerevisiae
FT                   YMR137C PSO2 Required for a post-incision step in the
FT                   repair of DNA single and double-strand breaks that result
FT                   from interstrand crosslinks produced by a variety of mono-
FT                   and bi-functional psoralen derivatives induced by UV-
FT                   irradiation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23454"
FT                   /db_xref="InterPro:IPR011084"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI43"
FT                   /protein_id="CAR23454.1"
FT                   /translation="MQSNKRQRTLVDFDIPKTDSLVPRHVKKRQKSPIFIDLETESYHE
FT                   HILEENIAVKDEQQAVRNNLFVADEDQEDNSEAVEVISDVTKPSPKAQDLRLALSGNQN
FT                   DAKPKPVRKQKNSFTESLTTVGQKLVSVTEVGEEQQVLCPVCGIVLTKLEIHEREAHCD
FT                   HCIEKDAAPSKIRTGRRIPRLPEVKKVRFKNHVINVDGFNFQSDPSIHQYFLSHFHADH
FT                   YMGVKKSWDQGTIYCSKVTADLLIYKFKVPQDRIIALPAEVTIQISSNVSVICFDANHC
FT                   PGAFVFLFREFGGDNETVQWVLHTGDFRSNNDLITKIIEHTSGKPIDKVYLDTTYMYPS
FT                   YHFPLQKSVLDVTGEFAFKLRDVGLKKLFGDRQSSIMSFVSNSLRPRHLYKYVFVIGTY
FT                   TIGKEKLAIAIAERLQTKIFVARDTARHCIIQTYKDKFPEGMITHDITKACVHLVSLRT
FT                   LSSKETLQYYFKPISHIYEDMVAFAPTGWSFKNGGRFIKLHETLEQKIEHTVNLLKDST
FT                   VDNLDPSSIHKQYKRDVRFQVFQVPYSEHSSFKDLANFCVRLPWVKIIPTVNTHDDYMV
FT                   SQMREWFKAWKNVHGQRTA"
FT   gene            <866139..>866738
FT                   /locus_tag="KLTH0E09592g"
FT                   /old_locus_tag="KLTH-ORF8982"
FT   CDS_pept        866139..866738
FT                   /locus_tag="KLTH0E09592g"
FT                   /old_locus_tag="KLTH-ORF8982"
FT                   /product="KLTH0E09592p"
FT                   /note="similar to uniprot|P39110 Saccharomyces cerevisiae
FT                   YMR138W CIN4 GTP-binding protein involved in beta-tubulin
FT                   (Tub2p) folding isolated as mutant with increased
FT                   chromosome loss and sensitivity to benomyl"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23455"
FT                   /db_xref="GOA:C5DI44"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI44"
FT                   /protein_id="CAR23455.1"
FT                   /translation="MGLLTIIKKQKLKDREVRCLVLGLDNSGKSTVVDWALSTHKNKPR
FT                   QPVTPTVGFQIHTLPYQGHNIQIWDIGGQSTLRPYWDNYFDKTDVLLWIIDIAAAARVG
FT                   ESVSELEVILQNRDRLGYSCRIIVLLNKKDLVNKPTEAIDAMKRRLDEILKLENIPIEI
FT                   KATDALSGDGLEELLPSIIGHNKSFGGVVGAPAPLS"
FT   gene            <867211..>868224
FT                   /locus_tag="KLTH0E09614g"
FT                   /old_locus_tag="KLTH-ORF8980"
FT   CDS_pept        867211..868224
FT                   /locus_tag="KLTH0E09614g"
FT                   /old_locus_tag="KLTH-ORF8980"
FT                   /product="KLTH0E09614p"
FT                   /note="similar to uniprot|P32419 Saccharomyces cerevisiae
FT                   YDL078C MDH3 Cytoplasmic malate dehydrogenase catalyzes
FT                   interconversion of malate and oxaloacetate involved in the
FT                   glyoxylate cycle"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23456"
FT                   /db_xref="GOA:C5DI45"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI45"
FT                   /protein_id="CAR23456.1"
FT                   /translation="MTKVTVLGAAGGIGQPLSLLLKMSPYVSTLALYDLRLAPGVARDL
FT                   SHINTNSKCRGYGKDELADALKGANVVVIPAGVPRKPGMTRDDLFKINAGIVANLVSAT
FT                   AKYAPSARILVISNPVNSTVPVACETLKNLGQFKPGKVMGVTTLDVVRAHTFLSDALGA
FT                   DHYGREAMKSHVTVIGGHSGTTIVPIVTNAKVRSKLVNKRQYDAYIHRVQFGGDEVVEA
FT                   KQGAGSATLSMALAGFQFTNEVLRSIHLEKRAEPGPLPAFIYLPGVEGGKELQSKLGTN
FT                   IEYFAAPVQMLRGDVVRVDVDWVDGLSDEEKKAIKICLEELDKNVQKGKRFVQSKL"
FT   gene            <868703..>869083
FT                   /locus_tag="KLTH0E09636g"
FT                   /old_locus_tag="KLTH-ORF8975"
FT   CDS_pept        868703..869083
FT                   /locus_tag="KLTH0E09636g"
FT                   /old_locus_tag="KLTH-ORF8975"
FT                   /product="KLTH0E09636p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09636g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23457"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI46"
FT                   /protein_id="CAR23457.1"
FT                   /translation="MSELLRRITRQISPHHNPEGITWGKSRALLDQARQSTVAQVSKGC
FT                   QKDMLATALAAKLADEFKEEVVHVERAAADPPRPRKINSKRSERPEEIKPQDKRKSRAR
FT                   LTSSRVAELVQRASGTEEGMYA"
FT   gene            <869857..>870957
FT                   /locus_tag="KLTH0E09658g"
FT                   /old_locus_tag="KLTH-ORF8972"
FT   CDS_pept        869857..870957
FT                   /locus_tag="KLTH0E09658g"
FT                   /old_locus_tag="KLTH-ORF8972"
FT                   /product="KLTH0E09658p"
FT                   /note="highly similar to uniprot|P38615 Saccharomyces
FT                   cerevisiae YMR139W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23458"
FT                   /db_xref="GOA:C5DI47"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR039192"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI47"
FT                   /protein_id="CAR23458.1"
FT                   /translation="MEIQAITNSSIVHKQVFEGHSHAKQDREQDTITISYPATEVVGHG
FT                   SFGVVFTTQVRETGDRVAIKKVLQDRRFKNRELEVMKQLQHPQVVDLKYYFYETDPQGE
FT                   VYLNLILEFMPQSLYQRLRHFVSQRSNMPRIEIKLYMYQLAKCLNYLHKHAAVCHRDIK
FT                   PQNLLVDPETYALKLCDFGSAKQLKPSEPNVSYICSRYYRAPELIFGATNYTVQIDIWS
FT                   SGCVMAELILGQPMFPGESGIDQLVEIIKILGTPTKQEICSMNPNYMEHKFPQIRPIPL
FT                   AKVFKREDQETIQLLSDVLRYNPTERFTALQCLCSPYFDELRSTTDPELASVVSNLRLM
FT                   EFCDEYEFDTLTPEEAKVIKQRLQPS"
FT   gene            complement(<871598..>872680)
FT                   /locus_tag="KLTH0E09680g"
FT                   /old_locus_tag="KLTH-ORF8970"
FT   CDS_pept        complement(871598..872680)
FT                   /locus_tag="KLTH0E09680g"
FT                   /old_locus_tag="KLTH-ORF8970"
FT                   /product="KLTH0E09680p"
FT                   /note="similar to uniprot|P53183 Saccharomyces cerevisiae
FT                   YGL039W or uniprot|Q12068 Saccharomyces cerevisiae YOL151W
FT                   GRE2 NADPH-dependent methylglyoxal reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23459"
FT                   /db_xref="GOA:C5DI48"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI48"
FT                   /protein_id="CAR23459.1"
FT                   /translation="MDEKVLVTGCNGFIALHVLDVLLSEKYHVIGTARSQDKADQVKES
FT                   FKKLYPYAQLEVEIVPDITKSGAFNDVFKKYPDIQHVLHTASNFSFGHDQSTEEAYLIP
FT                   ATQGTKNILETSLTLGKKVKRFVITSSFASIMDFDHEGDANFIHTEATWNPTTWEKAKG
FT                   NELSAYIASKKLAEESAWTFMKKHESEVPFTLTTVCPPYVWGPQMFDSSVKRGVLNTSA
FT                   ELINQALKTTPDFKGPFDTPNGIGCDVRDVALLHVLPLRNEKLAGKRLFPVNGTGVKQH
FT                   NYKNARFNMQRVLDVLNKKFPELRGKISKGGIEDNEKALAAGFYYNNDETCKLTGIEFK
FT                   PLEVTIHDAAKQILEFGSSD"
FT   gene            <874177..>876000
FT                   /locus_tag="KLTH0E09702g"
FT                   /old_locus_tag="KLTH-ORF8965"
FT   CDS_pept        874177..876000
FT                   /locus_tag="KLTH0E09702g"
FT                   /old_locus_tag="KLTH-ORF8965"
FT                   /product="KLTH0E09702p"
FT                   /note="similar to uniprot|Q07471 Saccharomyces cerevisiae
FT                   YDL080C THI3 Probable decarboxylase required for expression
FT                   of enzymes involved in thiamine biosynthesis may have a
FT                   role in catabolism of amino acids to long-chain and complex
FT                   alcohols"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09702g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23460"
FT                   /db_xref="GOA:C5DI49"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI49"
FT                   /protein_id="CAR23460.1"
FT                   /translation="MCVNYAYECGLPPEIPLAQYMLHRLRQLGIATIFGVPGGFNVPLL
FT                   REICNVPQMKWAGNTNELNAAYAADGYSRIKHLACLVTTFGVGELSAVNGVAGSFAEHV
FT                   GLLHFVGMPPLAAQRRRLLLHHTLGNGNYKVFHRLGSDVTQYTSVLTDTETCSKEVDKC
FT                   ISIAFTKQRPVYLGVPTNISDTLVSSALLNIPLDLSAHEGNTEVQEDFVNAILSAMYKC
FT                   RSPAIVVDACVSRHNVVAEVRQLVELTQFPVFCTPMGKGAINEHHPRFGGTFVGSISPP
FT                   QVREVVDFSDFVLVVGALLSDFNSSSFHFAYKAKNTALLFSSYARLKNAMYPDLELKTA
FT                   LRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMSNVPLRQEWVWNQISNWFREGDIVITET
FT                   GTSAFGVNQSKFPNNTRCITQALWGSVGYSVGACLGASFAAREEGNNSRVILFVGDGAL
FT                   QLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLHRKSNAGYHDIQAWDNLKLLPLFGAL
FT                   DYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVLPPMDAPPALMDKWLVDDNDEEVGS
FT                   EDTNGWQSSKRIKLDSQPSVDSLASMDSLDI"
FT   gene            <876916..>879222
FT                   /locus_tag="KLTH0E09724g"
FT                   /old_locus_tag="KLTH-ORF8961"
FT   CDS_pept        876916..879222
FT                   /locus_tag="KLTH0E09724g"
FT                   /old_locus_tag="KLTH-ORF8961"
FT                   /product="KLTH0E09724p"
FT                   /note="weakly similar to uniprot|P41696 Saccharomyces
FT                   cerevisiae YOR113W AZF1 Zinc-finger transcription factor
FT                   involved in induction of CLN3 transcription in response to
FT                   glucose genetic and physical interactions indicate a
FT                   possible role in mitochondrial transcription or genome
FT                   maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23461"
FT                   /db_xref="GOA:C5DI50"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI50"
FT                   /protein_id="CAR23461.1"
FT                   /translation="MEKQESETNLQQRSTATMPPPPAPVGGGPGMPPRADSISMYTNFN
FT                   APRPSTDASLSSFLNITEGQNQNAGPGPSQSLQQSQQRPLNHLQQSQQQPQSQQAQAQQ
FT                   GSSQAPRPDFGPYSRGYSIISNFWPGSSSAGPNHGPPAPHEAGGQFTTTRRQSEQLEPF
FT                   MPRFKTPSFSSGRSGSNQMQQPPVPPPSGRGSDLLIPGSKRNSIFFGGTDPSDIDFFNP
FT                   GKRDSQVMMRPPHILPQRNSSSGILGIPRTGNSLNGTGTGDAGVPPPAGDSDLDAIFNQ
FT                   GLNSRKNSMKFSADDFDFDFKRRDSSLRGTLDNNAYVPSAPLIPNSAKPTGMNDLNAKK
FT                   NSGRDSPTHKAADEDVEARIHKHLTPMLQGDNNEATLKHEDDGSKKRRKVDEKPSTEKS
FT                   DSMKNLMNYLEPRDPLLVSDDGRPLLGATKVDQLMLMIQARKKGVTDRIPRSADGSLLL
FT                   EDAPSIIPPASELVGGVEKPKARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCE
FT                   YCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDG
FT                   CNKSFTQLGNMKAHQNRFHLQTLNELTQRLAEMDPNENIAPAEKELLDYFADLYKNSNR
FT                   GIKGRGKGNTRVAPAVIAPTMKTPQDAPTNQSLTKVRNQDASLVAAKALDPTKPLHPAS
FT                   HSDLTYNMCAPRNDGNAPIPQEPRSDPASTASVPETNEFTFALDQDMKVEPNASFHNNT
FT                   NGNSDVHFKNVSFHS"
FT   gene            <879520..>880329
FT                   /locus_tag="KLTH0E09746g"
FT                   /old_locus_tag="KLTH-ORF8958"
FT   CDS_pept        879520..880329
FT                   /locus_tag="KLTH0E09746g"
FT                   /old_locus_tag="KLTH-ORF8958"
FT                   /product="KLTH0E09746p"
FT                   /note="similar to uniprot|Q12219 Saccharomyces cerevisiae
FT                   YOR114W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09746g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23462"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI51"
FT                   /protein_id="CAR23462.1"
FT                   /translation="MRISLSLNAFVSPISVTSRKSFEKLDKTPSTVFQYYYQLQLKSLN
FT                   RSGLPADILEPVNTGHNSLRRYVRKEWESLSMSKKRVYHALYFHFIKLNYKELAPEEFA
FT                   KRLELPIPISSEYLLFRNKFKLEFDRIWKEQCKKDHHGRSRRIYLRTGPSNLLKASRTI
FT                   KGTESGFDYDSTRQFQEMCRQCRKVWRDKVTSDQKAQMVEILQKNRQEFKLKLEQEVKI
FT                   LDSLQNALQKYLAGPSAKISTALDFERPVTQSHHSVIALLLATGKKD"
FT   gene            complement(<880368..>881126)
FT                   /locus_tag="KLTH0E09768g"
FT                   /old_locus_tag="KLTH-ORF8957"
FT   CDS_pept        complement(880368..881126)
FT                   /locus_tag="KLTH0E09768g"
FT                   /old_locus_tag="KLTH-ORF8957"
FT                   /product="KLTH0E09768p"
FT                   /note="similar to uniprot|Q99394 Saccharomyces cerevisiae
FT                   YOR115C TRS33 Component of the targeting complex (TRAPP)
FT                   involved in ER to Golgi membrane traffic"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23463"
FT                   /db_xref="GOA:C5DI52"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR037992"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI52"
FT                   /protein_id="CAR23463.1"
FT                   /translation="MGDSGLASEVNEHQRLQLQFQLFQESLPKVDETIYRMLLNEAVPL
FT                   AISVEKSLTHHKEDATGQLEAELDSKLALESQQGDASHKLLKDYLAADQDQQTRIKTRL
FT                   ENIGFQLGQKLSQLLIFSNNPNLSFKDMDLLSVMKFVCRDVWKQVFGKQIDNLKTNHRG
FT                   TFYLLDYNYKPIEPFTLEEDLSDQEQKLIEPFLHVPCGMIRGVLASLGFEKEGQVTCQA
FT                   TLVDPPDSKQAGAGTFTKSVSFNVQVLVGR"
FT   gene            <881284..>883152
FT                   /locus_tag="KLTH0E09790g"
FT                   /old_locus_tag="KLTH-ORF8956"
FT   CDS_pept        881284..883152
FT                   /locus_tag="KLTH0E09790g"
FT                   /old_locus_tag="KLTH-ORF8956"
FT                   /product="KLTH0E09790p"
FT                   /note="similar to uniprot|P38822 Saccharomyces cerevisiae
FT                   YHR114W BZZ1 SH3 domain protein implicated in the
FT                   regulation of actin polymerization able to recruit actin
FT                   polymerization machinery through its SH3 domains
FT                   colocalizes with cortical actin patches and Las17p
FT                   interacts with type I myosins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23464"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="InterPro:IPR035459"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI53"
FT                   /protein_id="CAR23464.1"
FT                   /translation="MSSELSIGNEIKDGHKETYKWVLNNIKWLSELEAFYRDRAKLEKE
FT                   YSEKLTHLAKEYFGKKSASTVSLSVGDMPTTTPGSLEAASLVAWNEVLSQTEMISKDHN
FT                   QLSQEFEFQVADQIVALSKKCELLLTSINGFNTELTEKRDKAYSNLDKAKKTYDEKCVQ
FT                   MESARAKQTKTSSDKARRKADEREHEMNIAKNHYLITISQANRIKDKYYFQDVPEVLDL
FT                   LQDLHESRTRVMNSIWISAGAVEREMNKRIDSRLTTVDSVVSQNKANLDTTMFVKHNLK
FT                   EWKEPPDFQYVPSSVWHDDEHFVVPSNIELQDLKVRLAKAQQLYDQMNSFSQSEISGLS
FT                   SLNKQKKEIKAQENVDAQSLLALLTKYTNVVSSYTSHETFKVEAEVEIESIQNNVAEEH
FT                   DLNTEDIDLSNLRKKSGVFNRFKKSLTISSDKKSTHQDGGDAVSVLSSESKAKHHNRFS
FT                   LFKGRDRAQSSASGASEVTSSNMNSIQDSSEHNKNRVLFQYQKQDNDEVSVSPGNAISL
FT                   LTADSGSGWTRIKNDSTGEAGLVPTSYIEINEKPRSSAPRAPPPRKSGNAARTVKALFD
FT                   YEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLFPTNYCQ"
FT   gene            <883517..>885331
FT                   /locus_tag="KLTH0E09812g"
FT                   /old_locus_tag="KLTH-ORF8954"
FT   CDS_pept        883517..885331
FT                   /locus_tag="KLTH0E09812g"
FT                   /old_locus_tag="KLTH-ORF8954"
FT                   /product="KLTH0E09812p"
FT                   /note="similar to uniprot|P53925 Saccharomyces cerevisiae
FT                   YNL115C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09812g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23465"
FT                   /db_xref="GOA:C5DI54"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR019431"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI54"
FT                   /protein_id="CAR23465.1"
FT                   /translation="MSAAEPNHGVSSGERNNLTGQGAEDRQAQQGLPGTYGHRANENEP
FT                   LLRETQAKPSHRSIGQVPTDGHLPNEIEGSQGRQFKTRQKYRVFVQDSKIILNVLIFIN
FT                   LVWLITTFIMDYFFNIGFLHFSKRLTSFNDLCLIFVSIVANSVNLWSNRVGLYSTLDQG
FT                   LNVVLFFMTLFNLFLTLIIGYTRRRLGFVGAFTYIWAALTFFAGAVLDWYLYYYFKEFH
FT                   AAEEEIEESPSPSGSRHTMKEWVSIGARNFVKCAIFVFYVFFTLNTLLYTIDVGRVTRG
FT                   VKDVSAKASASYDAFHWVDKEHTYQLHITCYGDFSATDEDRQPVILFDHGSLDTAFLSA
FT                   TWIQELYHLNRVERYCTYERPGYGLSDSAPAPISIAMVADALSYALIKDAKIKGPFTTV
FT                   GYDIGGLFTQVFTAKNLDKVESMLLVESWHEDILLKNYLQRLLPPDNDSKDPDDISKLP
FT                   IEIKRHNGFKLWWQGIWSTLGIKLQTSWLLAHHGSKERILGRDMQYQGKFIRAKFLESV
FT                   TSSLLSYKDVLNSKEKLKDVKTSVASSNQLIKKSPQWGNWQRDITRISSKTQEWKILNG
FT                   GHEVYKFGSAKQELQDVLLRLIGDKDRY"
FT   gene            complement(<885503..>886942)
FT                   /locus_tag="KLTH0E09834g"
FT                   /old_locus_tag="KLTH-ORF8953"
FT   CDS_pept        complement(885503..886942)
FT                   /locus_tag="KLTH0E09834g"
FT                   /old_locus_tag="KLTH-ORF8953"
FT                   /product="KLTH0E09834p"
FT                   /note="some similarities with uniprot|P53924 Saccharomyces
FT                   cerevisiae YNL116W DMA2 Protein involved in regulating
FT                   spindle position and orientation functionally redundant
FT                   with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23466"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI55"
FT                   /protein_id="CAR23466.1"
FT                   /translation="MVVNISPRNSLSSRSRRGSTINNLLNSMGIRQGSNGPGMAPIPAG
FT                   SSGTTEPLNNNGDMAATGPSRATEPFNSATFARSNEGREDMAESNAIEELSSDDDEVNG
FT                   DRDRVLRDENGAPTAANMLGTTPFDQGIQNSSVPLSVNNLVSELPITLTLGQNDGPGGA
FT                   GQVSTLTPNESQMVPKHVRHFVYGNNQPEPALDLLGLELPRNAAIPEPVSEEVIQSRKD
FT                   KSGLFSLRLTPFLDQSASTNPGLYFEPIVRTAGPCSQLVIGRYTERVRESINRIPEHFH
FT                   PVVFKSKVVSRTHGCFKVDQQGNWYIRDVRSSSGTFLNHHRLAPASTMSKDTPIQDGDV
FT                   IQLGLDFRGGTEEIYRSVKMRVELNRSWKRRAMRFNREALQRLKNLQKMTSGLEEEDCS
FT                   ICLSKIKPCQAIFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASLDSDMDSD
FT                   ENDFEVLADDVKDIDMAQESE"
FT   gene            complement(<888231..>889949)
FT                   /locus_tag="KLTH0E09856g"
FT                   /old_locus_tag="KLTH-ORF8948"
FT   CDS_pept        complement(888231..889949)
FT                   /locus_tag="KLTH0E09856g"
FT                   /old_locus_tag="KLTH-ORF8948"
FT                   /product="KLTH0E09856p"
FT                   /note="highly similar to uniprot|P30952 Saccharomyces
FT                   cerevisiae YNL117W MLS1 Malate synthase enzyme of the
FT                   glyoxylate cycle involved in utilization of non-
FT                   fermentable carbon sources expression is subject to carbon
FT                   catabolite repression localizes in peroxisomes during
FT                   growth in oleic acid medium"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23467"
FT                   /db_xref="GOA:C5DI56"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI56"
FT                   /protein_id="CAR23467.1"
FT                   /translation="MLKRLQAYPYRCSYSAVFARHSLQVTQMLENVQVLVDVDSTPRFA
FT                   PSKTTVADILTPDALSFVVLLHRTFDERRRQLLRNRQEIQTKLDSGAYKFDFLSETRNI
FT                   RENPAWQGAVPAPGLAERHSEITGPPLRNMLVNALNAPVSTYMTDFEDSAAPTWDNCVY
FT                   GQVNLYDAIRDQVAFKTPRKEYTLRDSFASLPTVLVRPRGWHMEEKHVIVDGRPISASL
FT                   FDFGLYFFHNAHKLVEIGKGPYFYLPKMEHHLEARLWNDVFNVAQDYIGMSRGTVRATV
FT                   LIETLPAAFQMEEIIFELRAHSAGLNCGRWDYIFSVIKRLRNDPAHVLPDRDHVTMTAP
FT                   FMDAYVRRLIEICHRRGVHAMGGMAAQIPIKNDTAANDAAMAKVRADKERELAKGHDGS
FT                   WVAHPALSAICNEVFDKMGTANQIHSIPAANVAASDLLNTRIPNGAVTTAGIRQNLSIG
FT                   LQYMEAWLRGSGCVPINNLMEDAATAEVSRCQLYQWVKHGVKLQDTGEVVTADLTQRIL
FT                   EEQVAELSKKSPVGDANKFALAAKYFLPEIRGEKFSEFLTTLLYDEIVTAKTSRL"
FT   gene            <891051..>892604
FT                   /locus_tag="KLTH0E09878g"
FT                   /old_locus_tag="KLTH-ORF8940"
FT   CDS_pept        891051..892604
FT                   /locus_tag="KLTH0E09878g"
FT                   /old_locus_tag="KLTH-ORF8940"
FT                   /product="KLTH0E09878p"
FT                   /note="similar to uniprot|P50277 Saccharomyces cerevisiae
FT                   YNR058W BIO3 7 8-diamino-pelargonic acid aminotransferase
FT                   (DAPA) catalyzes the second step in the biotin biosynthesis
FT                   pathway BIO3 is in a cluster of 3 genes (BIO3 BIO4 and
FT                   BIO5) that mediate biotin synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09878g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23468"
FT                   /db_xref="GOA:C5DI57"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI57"
FT                   /protein_id="CAR23468.1"
FT                   /translation="MSACVPESSKNDYTDNSGTKNICPLECTQQASRSELWYIKALLVV
FT                   LYVCLLGDRQFTIKRCLSSCNNAIHRRKTEHNNLPMDSITEQDLEFDRRHIWHPYASIT
FT                   EPLKVYPVRSAEGVYLHLQDGRKIVDGMASWWCVQHGYNNPRLNAAAVNQLKTMSHVMF
FT                   GGIVHKPGIELCKKLVQMLPDPLECVVLADSGSISIDVGMKMALQYFNAKGKASKSKFL
FT                   AIERGFHGDAFGALSVCDPNNSMHHMYGGFVPQNLFCKAPEVYFHDSSQDVEKKVEELD
FT                   VAPFAKMIRENRESLAGVLMESIVQGAGGLRIYHPYFLKRVRELCTENDVLLILDEVAT
FT                   GFGRTGKLFAFEHSEIVPDIVCLGKALTGGYLTLSATVSTREVSEGICDGPAGRLMHGQ
FT                   TYMGNPLACAVANENLAILLEGKWKEQVRGIEAQLFRELAPLEKHRNVAEVRILGAIGI
FT                   VEVNLYPVKVEELQRRFVDMGAWIRPFNKWIYIYPIYTITPEELRVLVKAIASVLDELT
FT                   "
FT   gene            <892910..>893932
FT                   /locus_tag="KLTH0E09900g"
FT                   /old_locus_tag="KLTH-ORF8937"
FT   CDS_pept        892910..893932
FT                   /locus_tag="KLTH0E09900g"
FT                   /old_locus_tag="KLTH-ORF8937"
FT                   /product="KLTH0E09900p"
FT                   /note="similar to uniprot|P47181 Saccharomyces cerevisiae
FT                   YJR154W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23469"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI58"
FT                   /protein_id="CAR23469.1"
FT                   /translation="MATKNLHLVDVFEEDGRTYARIPKKTDTGVSKVSPKDFTVHNKSD
FT                   FTSIVKNLETYGLCIVKNHLTAEDCEIIKEELKPHYFREKSWNGSPFPRQTTVVARTVL
FT                   KSRTCLDKIATDDTFCDVSQRFLAESNMFWIGEGLRRGVSGIHLNSGIVYRVGPGAGDQ
FT                   MWHREDMVHHNVHPRRDRYHYGDDSHVGFAVALTKMTKENGATRAIAGSHLWGPLDGPG
FT                   DFDKGAEVYLEMDEGDAAFMLGGVYHAASANASTEERIAAFFFMNKSYLKQEENYHIDQ
FT                   DPPFFRNLPLKALTILGLHISEPFCGHVDYKSPAFLINPELEAGVRQEKYTEVLYPKYE
FT                   "
FT   gene            <894838..>898197
FT                   /locus_tag="KLTH0E09922g"
FT                   /old_locus_tag="KLTH-ORF8932"
FT   CDS_pept        894838..898197
FT                   /locus_tag="KLTH0E09922g"
FT                   /old_locus_tag="KLTH-ORF8932"
FT                   /product="KLTH0E09922p"
FT                   /note="weakly similar to uniprot|P07248 Saccharomyces
FT                   cerevisiae YDR216W ADR1 Positive transcriptional regulator
FT                   controls the expression of ADH2 peroxisomal protein genes
FT                   and genes required for ethanol glycerol and fatty acid
FT                   utilization"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09922g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23470"
FT                   /db_xref="GOA:C5DI59"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI59"
FT                   /protein_id="CAR23470.1"
FT                   /translation="MGSPPEALKAAAKNGGIITSSNNMNSKVNKKFEQLPQNLQYRGQT
FT                   PSGKPRLFVCEVCTRAFARHEHLIRHERQHTKEKPYHCGVCERKYGRRDLLLRHVIKMH
FT                   GGNCGDTVMPLGRKRKNAALTSTSAGLGPANADAGSDQARKKQHAFQRRASFSAQSAEK
FT                   YAGTQSPHKDGADMGRVAFSTPQLMPVDLTTAEEAPKKRAPGILEGTTFNLLDRESWIS
FT                   EMNALPMLEESSDSGDSPIAVSGIVSRSSDWSRKSSHGSPSAVTPAMAPRRRTSSGESR
FT                   SSGDLATGARTPVNELGTKRKAPAWKFEGSSLIVKSLFDSGPSKSWNPLDADTRVFSLF
FT                   GENCISSLKQPAGDNTHDLISRFNDFRFVPKSNLDTYALQSSAKWDKSEAVPNLSSLDP
FT                   ESILKASQLHETSIKQEPLENFDLSNNLDSRSGKFFGDESSFNGLEHPPLSNVTRGPPP
FT                   ISAGSSVGACHFFTEEIREMCIKTLNFYFENCSGLTAPEYKKKSGLGFPSCQELNTFAG
FT                   YFQDSFLVHYPFIHPHLLSLGLQDFKKYIHEGSLEHEQDDEALVCSNIVCLPLFIATIG
FT                   SLYKHGARAQTLDLYEKSRRALHVYLNTRKKQDEQSLDKPKSRGCLWLIQSLCLSVVFA
FT                   LFADSLERMNSEMVVKQVSALCSLLKSSLLPTASTPILEFDSPSKYIFYESAIRTVLMG
FT                   YKVCQFLKVFCNIDAPLFLTESQLNETVVPDSEQVWQCALFQDAPKKFQKQYTTNFEKF
FT                   YRSFAFSSVGMHLIPEFLCSAMLFYEFNNLLKNRSSVLFQIFLTKIDTKKLEMNLPQLD
FT                   PENRTSSILMDSAIDMRNSLTCMIFFCRVDPLFSQKAWNNAILELYDSFLTSKKTNVLT
FT                   NGSYGAITDFLVALNFSIKNISNLFKSADDVIEFNRSKLSVLNLEGYYYNFLVIIKFIL
FT                   DFEATPNFKLLCIYNELKKLANQLLIPKLASVYPLEFRRFRLNSTWPAEKNTSAAINMD
FT                   HLEKLINNVLVYSFNDANFLKMPEKPQKEFSFSSVRAPNALSQNGQGAHDVSSSLPTNS
FT                   IPRQSNIGQERKSEGFADRYHLSEKYVIVARCFFFYVFEKYAHAHFLEKLSLDFLALER
FT                   QLDQGSTTDEGL"
FT   gene            complement(<898345..>901746)
FT                   /locus_tag="KLTH0E09944g"
FT                   /old_locus_tag="KLTH-ORF8929"
FT   CDS_pept        complement(898345..901746)
FT                   /locus_tag="KLTH0E09944g"
FT                   /old_locus_tag="KLTH-ORF8929"
FT                   /product="KLTH0E09944p"
FT                   /note="weakly similar to uniprot|P14737 Saccharomyces
FT                   cerevisiae YDR217C RAD9 DNA damage-dependent checkpoint
FT                   protein required for cell-cycle arrest in G1/S intra-S and
FT                   G2/M transmits checkpoint signal by activating Rad53p and
FT                   Chk1p hyperphosphorylated by Mec1p and Tel1p potential
FT                   Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23471"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR013914"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI60"
FT                   /protein_id="CAR23471.1"
FT                   /translation="MDSDELEKERYRVINETPTIQRATRDLNETSDTAFKENNLSLRKR
FT                   DGATEKRDGKRQDATEGAIVAANNSEHTSGTSQNSGRNKNNVEEPRLGEEIVTPNLERV
FT                   KAFFKKSSANKLGSGIKIASSPDDTPQSQRLKSDPAARETPSGAIIQRLKDDQQKRFNR
FT                   SEFDFTTSEGNTLNKAHNIGSSPSVHYKTDAISPLSAANTSARFLSGTPLAHKNMLLQL
FT                   ETPQINSTSSEVKNGFVPRVGQIKGDIEIPATVASALKGEKKTVDTKPVHANGEEPLPS
FT                   PGGLSEGPTSQLFPTMDISTQPIHIEGDRSFPDTRFEGSETQVDVTFPIPSLTNGEQSR
FT                   DNIESPLVARFGTQKFTPAHWLSPEKDTQTQLVLSSQNVTPSSKERLSPGSKIRLGLPQ
FT                   NMSKLNEQGKCSSIGRGEGSPEIHSESSISTLSDSRVEEVDSEKRIKLRFSNVYEHNNE
FT                   TNTASDEDAFDEKVVYSDGENTQELPEVEDGFATEARNTGHKDSSIPSQKYRFQLSSTQ
FT                   ELSIEPKNISQISLEESQEIVKNRRHLRWRRNNKLHPVKLVETADQDFPSIEGSPPNKL
FT                   RKLTTCNDTEADNQEFSKKERVKEQKTMEEKKLSNFERWGSDTKSESQEHSPLPCNKIM
FT                   LDGAFLTKKDLLFDDAVWCHYDFNYIYYPGKVRGYNPSTKFVEVLFESGVSNFKEEDIH
FT                   YLDLMVGEIVIWDSKQYTVVALSRQSSDPCAIRCIRGYDTVHLKKRNKNGELGKRTLIK
FT                   PISSVTLTVDLWAKRPKIILSSEHQDRAHAFEDLRHPIRGRKNTTLVTPVTPSCEMTGL
FT                   PQEREHLERNNFSHPHLEREPNSADDLQKTAANQSTEKIFEKCLFILTGISDRRRRKLS
FT                   SMIKGEGGAISKTCFSSILEFEASGKIKSDIFDLSSLRFVCLITSKHSRSLKYLETLAL
FT                   GLPTLHYKFLEYCVYRKTLDIQSIFQFLLPSGESSRLLLDSSLKSGAIKSNNIFHFYSK
FT                   LISGASIEDQLNSRLPKMQEYDVIICGSSELDEFIHFIFHALGVRSVKALNFDFRENVF
FT                   STTEGPDDISSLVSKVSNHLEDAHRKLSKGLNILAYINLMDGKDGTSQHLTQNLKSLFD
FT                   SKENIHIEEKEWLIQTVINENTGHWA"
FT   gene            <902112..>903407
FT                   /locus_tag="KLTH0E09966g"
FT                   /old_locus_tag="KLTH-ORF8925"
FT   CDS_pept        902112..903407
FT                   /locus_tag="KLTH0E09966g"
FT                   /old_locus_tag="KLTH-ORF8925"
FT                   /product="KLTH0E09966p"
FT                   /note="weakly similar to uniprot|Q05955 Saccharomyces
FT                   cerevisiae YLR227C ADY4 Component of the meiotic outer
FT                   plaque a membrane-organizing center that assembles on the
FT                   cytoplasmic face of the spindle pole body during meiosis II
FT                   and triggers the formation of the prospore membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23472"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI61"
FT                   /protein_id="CAR23472.1"
FT                   /translation="MLGCPLECFHPLLDRCSRSRHILENKLERELITHPELDLEVEPRF
FT                   LVKSILRNKPYNREFLELKLKQVVWTKTMIAFFDYFDGEFGDAFFELRWILQFLHEVRK
FT                   FPGVLYSNLVLSLDYERSLSLLCSRSLIKSLQPPNSIRAKNGVQLKVNRLNIFEGLLTN
FT                   ILDCTEPSVLTCVDVVDYYMMDQLFTVLGEVERSIAFLKGTVCDAREHSKYQGFVIRAQ
FT                   RTHIDSMIRKYILASTFKLPGDPTFIKCFDGVLDGILLYGGIHICVILFFYKVKEFFQA
FT                   KHYALKQNKPPLEAPRPPCVAIIDGIILGLGQEIESRVTGEIQCPQVLVKADNHEILMV
FT                   DTVFEESENDHNHDITILLSAAKLKAKKKLRGGPQVHQKYVVSQWQIGLSWVSFWEVCY
FT                   TDNKGVVPHELQVRMKKVRELASSSMAETCQQ"
FT   gene            complement(<903764..>904918)
FT                   /locus_tag="KLTH0E09988g"
FT                   /old_locus_tag="KLTH-ORF8923"
FT   CDS_pept        complement(903764..904918)
FT                   /locus_tag="KLTH0E09988g"
FT                   /old_locus_tag="KLTH-ORF8923"
FT                   /product="KLTH0E09988p"
FT                   /note="similar to uniprot|Q05949 Saccharomyces cerevisiae
FT                   YLR226W BUR2 Cyclin for the Sgv1p (Bur1p) protein kinase
FT                   Sgv1p and Bur2p comprise a CDK-cyclin complex involved in
FT                   transcriptional regulation through its phosphorylation of
FT                   the carboxy-terminal domain of the largest subunit of RNA
FT                   polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E09988g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23473"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI62"
FT                   /protein_id="CAR23473.1"
FT                   /translation="MAQVGAKSPATTADGFNSRILWPDMIKTPDNKWVCTCKEIVDRLG
FT                   TDPHVAGELKRRMEKCLMYFYVMKKQLKLFDHTYTAACILFFRYWFVFGLPPALTDCIH
FT                   LSQALLVTACKTVENNRPIDVYVKGTCEFLLRDIPTSRGRQNIEKLRWELRDKLVGYEK
FT                   RILCQMGFDLNLHNPKELIEEIFSGFFRYNRDFQMSEGFTKVFPKIIQDARNFIIQAGT
FT                   QPVSLLCDGFTFTALSLVFCGLQYKKHVDSSFKFPKNFFTDRFPFRVTTQLFVELLTDY
FT                   RVLEENFFDLKSNKGGKLQVSLEEMESLLDEDPPSDETLVSDYSTYVYEDIKDGVVREE
FT                   LLKHIEARVNELTERTIAQSETTEKRTIDNLSSAENPNKKQKNK"
FT   gene            complement(<905166..>906518)
FT                   /locus_tag="KLTH0E10010g"
FT                   /old_locus_tag="KLTH-ORF8919"
FT   CDS_pept        complement(905166..906518)
FT                   /locus_tag="KLTH0E10010g"
FT                   /old_locus_tag="KLTH-ORF8919"
FT                   /product="KLTH0E10010p"
FT                   /note="weakly similar to uniprot|Q04922 Saccharomyces
FT                   cerevisiae YDR219C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10010g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23474"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI63"
FT                   /protein_id="CAR23474.1"
FT                   /translation="MSARDPRTATPSRSLTDLPLDVIMEILFYLPFEDLENVSKTCRTL
FT                   RVLSNESITYRRTVKDRCVASEWTKRLLFDFLHAIDKKDGLLGFISSERISIVNSLQEL
FT                   QSRFELGNRVPLLPPREMTPLQNSAASDENKVKVSETPCSESSGKQELKPNSFEIPKAR
FT                   LRTGKRDAASLDKEGMAYLQILQGFHRIATNSHKRFGRRNREFARRNPNQESAVPQTPD
FT                   KEPIASATLTPIQVQSLANEDTTAIDVLKSDENSPDSSHHSRTTSSIFSDTPRLSDLGW
FT                   SYSEEFKSLESNSDSECGSSDSSSSSKYLRQLQRSNRVSDKKNLYEKLNSRTRKEHEIT
FT                   NNKISEKGSSEKLRPGPTSSKGRAFSQGYLVELERCNTPAVRTQQTAAETTKVSQEFLS
FT                   RYQEHLVIGTKSSPEVPTQRRSKTKKLGHAPHRRKLIASVTEDNRICYEKL"
FT   gene            complement(<907638..>908537)
FT                   /locus_tag="KLTH0E10032g"
FT                   /old_locus_tag="KLTH-ORF8912"
FT   CDS_pept        complement(907638..908537)
FT                   /locus_tag="KLTH0E10032g"
FT                   /old_locus_tag="KLTH-ORF8912"
FT                   /product="KLTH0E10032p"
FT                   /note="weakly similar to uniprot|Q2JVJ5 Yellowstone A-
FT                   Prime CYA_1049 NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10032g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23475"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI64"
FT                   /protein_id="CAR23475.1"
FT                   /translation="MSLRPITKIAFIGATGRLGAPVAAELAKTFEVRAIVRSTDKAKSM
FT                   LPSNIEIIQGDLQDIPSLRAALDGMDAIYANLATETADLTLPFYEEREGVQNLMTAAQG
FT                   LDIQYIAKIGALGAYPPALKNIKDNMVPNIIRMEGHKIIAESGIPYTFFAPTHFMELLP
FT                   NMIDKGALQWIGNTEVKVYWISVADYARQVVRAFQNYSAMPEHCPVQGPEALSVQQAME
FT                   QFIQNYDPTLKIRVAPLWVIRVIGLFNSKMKFVAHLFAYFGNHEDPFYAEQTWKELGKP
FT                   TVTLEMFAKSLHQNRAAT"
FT   gene            <909503..>911500
FT                   /locus_tag="KLTH0E10054g"
FT                   /old_locus_tag="KLTH-ORF8910"
FT   CDS_pept        909503..911500
FT                   /locus_tag="KLTH0E10054g"
FT                   /old_locus_tag="KLTH-ORF8910"
FT                   /product="KLTH0E10054p"
FT                   /note="similar to uniprot|Q04924 Saccharomyces cerevisiae
FT                   YDR221W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10054g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23476"
FT                   /db_xref="GOA:C5DI65"
FT                   /db_xref="InterPro:IPR026874"
FT                   /db_xref="InterPro:IPR028146"
FT                   /db_xref="InterPro:IPR036607"
FT                   /db_xref="InterPro:IPR039794"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI65"
FT                   /protein_id="CAR23476.1"
FT                   /translation="MPALAYYAVALCCTFAGARQVNGVPGSLQHLYEPMQTDPTKWACL
FT                   GDPSIVLNYTQINDDFCDCPDGSDEPGTSACGALSRYYCENKGFAPKFVAGFKVNDGVC
FT                   DCCDCSDENENIRSALSSDNCSQLRAQFERALKEELNEQELGSQALKMLEREYGIYAEE
FT                   TPLEDKKGALRKAKSETGESKEALEACVNELAQAKETYKDTLQRENPLLLQLEEIDLQY
FT                   VTSVIHSLFAKAESTSRAREALVKILDDLRNGYNKNLNDEVVNRNVKTYTDYAPTEHEE
FT                   LNSSPSLDRTQREQINAYLNEELPDMFLRGSTHIPPAAIVGKFSMARTLIKVRAKQQKK
FT                   DKETLEFFTKIMDDVSQNYNVNFQDSSVKASVISYRDFLAKNPHLFEPLDIPSEFTEKM
FT                   NTLEELLNDVSTKILTPSAQSQGFLGVSFDDLAQKLRSFFGDQTNSLEQLKSAIVSLEQ
FT                   KCSTLRTEYRSQLQNFKLLESQVIENDSSSNSVNSETFKAMDELLSKLSPSCVEQKIDN
FT                   YIYQICLNQEDGVVFQREDKPAGNSVLIGRFAGFSFDAKSTWDRYMDDLRIKYSESDLV
FT                   SHLESDLDNFHTEWLVGNLPEKNSGLVVDYKQGDRCWNGPSRSARLYFECSDDFKLKSV
FT                   QEPTRCHYAFHLSGPLGCSTDFAYAAPDWF"
FT   gene            <911651..>912847
FT                   /locus_tag="KLTH0E10076g"
FT                   /old_locus_tag="KLTH-ORF8907"
FT   CDS_pept        911651..912847
FT                   /locus_tag="KLTH0E10076g"
FT                   /old_locus_tag="KLTH-ORF8907"
FT                   /product="KLTH0E10076p"
FT                   /note="similar to uniprot|Q04925 Saccharomyces cerevisiae
FT                   YDR222W Protein of unknown function green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm in
FT                   a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10076g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23477"
FT                   /db_xref="GOA:C5DI66"
FT                   /db_xref="InterPro:IPR013931"
FT                   /db_xref="InterPro:IPR033394"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI66"
FT                   /protein_id="CAR23477.1"
FT                   /translation="MGSSSHFTSIKSCSIDEQNHKPVNDVTDLKWQTIGSEKSADGMKH
FT                   TIPLLNPSHLLKKGADTTVETQTLYFADLISGNCGFVQLLYSNVLDNLYKSVQLNLKLF
FT                   SCQNEDKKSDLWETFKIEHISRFTEYRVESEHFVYELTPTDNEHEGFGKLVLVAKSLRS
FT                   HSGKLFDIDLSASFRNGFKVDPDGSSVYLDKHKKSRKIMRHVFVPKSTFSGSFKTEQGN
FT                   SPAQCVFDAVPSLFIEAVQGLSPNKAASRWNFACFLSRELGFVCMEFTTTANYGKTTVT
FT                   VSGLGSHEGVTAVYASSDPDPESHVVHLTSIRDNDSNWEYPSAIKVPVEGSSQCLEIDS
FT                   LRLVNRYDILSELPGVVRKIVQSIAGIKPYLYQYCQRASFRGQEGVAIVESTFITTHD"
FT   gene            <913351..>916224
FT                   /locus_tag="KLTH0E10098g"
FT                   /old_locus_tag="KLTH-ORF8902"
FT   CDS_pept        913351..916224
FT                   /locus_tag="KLTH0E10098g"
FT                   /old_locus_tag="KLTH-ORF8902"
FT                   /product="KLTH0E10098p"
FT                   /note="weakly similar to uniprot|P39520 Saccharomyces
FT                   cerevisiae YLR223C IFH1 Essential protein with a highly
FT                   acidic N-terminal domain IFH1 exhibits genetic interactions
FT                   with FHL1 overexpression interferes with silencing at
FT                   telomeres and HM loci potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10098g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23478"
FT                   /db_xref="GOA:C5DI67"
FT                   /db_xref="InterPro:IPR018837"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI67"
FT                   /protein_id="CAR23478.1"
FT                   /translation="MAGKSPRKGGMAAGKQPSNLKKLKNRNVGGKSAPVLSGTSLHARP
FT                   RRFSLLYSSDSSLSALSDLESHKKTGFKNPHLSKKSKRGVGNELGKRGKLISEAAISSG
FT                   SSSSSDYDAVNDETDSGSEDAIEDNDDDDGGNDDSSSGSSSSDDDVDFVKLSAERKKRA
FT                   MRAMSALKRGKSPKKSDVSNTPVLKAPSDKPDSDEEDSADEDSAVFSHKRHPEEKSDSE
FT                   STKEDASDEDLGEEVKESSSASGKALASKTAPVDQLNVPQISESEDSDYEIDHDAYIKS
FT                   IQFDEEDVVGLDTGLDTGEDDVPILDEEEQNIVLELENDDELSFEGSIHEEGEDPAENE
FT                   QEGDGEDFKDNSQLYNEFDDDDDDEIMSDFDEPFYEDPKFANLYYCAGSDQPLSLSTSL
FT                   PLILNDEKRRNLDKKQTKKREREELIRRRKLSRKLDKERRQKSAATDLGNEEYLFGVFF
FT                   RSDEEKPKESNLESPLRQLGSAAASEEDYSSEEEYENILLDIAHMPTDDESLDGIVDDD
FT                   EIDDDDDDDDDDDVSISDVFIDIDDLDPDSFYFQYESSDGGEAEGTKDTDKGDGNKLEG
FT                   PDDNSLVETVIYIDGESTDEDETLPPPNTRNKRIGSKAKEVVSANVVGLKPPKLGTWET
FT                   DNKPFSIIDGLSTKSLYPLVPEQQLLEQQQFQQQQLAVNESNGVSGEKEELTLNELLNM
FT                   SELDDEEGPANAGGDQLASEWYEKPKVPLSAFRNKGVDVNREEEYMLPVFSARKCPIGY
FT                   VGSERTRRKIDKMKELQKKKSEERKKLKKKKKLLKIKRERERLEKEKERNDAIVPSEDQ
FT                   MRIANGDSIGVPKIEEVSGTGEKNDLISDDTKDTAEGMDLDDINKLLNRTDSELVAHDG
FT                   NDIDLIGTEDADILATLTAPVDVDPVNDKYMTTGAVWRRRQSVVEAAAKNLRFTKSGLF
FT                   SESALADLEQIIGNSASSVIEFSDVLQ"
FT   gene            <916575..>919055
FT                   /locus_tag="KLTH0E10120g"
FT                   /old_locus_tag="KLTH-ORF8897"
FT   CDS_pept        916575..919055
FT                   /locus_tag="KLTH0E10120g"
FT                   /old_locus_tag="KLTH-ORF8897"
FT                   /product="KLTH0E10120p"
FT                   /note="highly similar to uniprot|Q05946 Saccharomyces
FT                   cerevisiae YLR222C UTP13 Nucleolar protein component of the
FT                   small subunit (SSU) processome containing the U3 snoRNA
FT                   that is involved in processing of pre-18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10120g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23479"
FT                   /db_xref="GOA:C5DI68"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013934"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI68"
FT                   /protein_id="CAR23479.1"
FT                   /translation="MDLKSSYSNSELRPFYAGSGAVASVSEDGRLLATSVIDEVNIIEL
FT                   APTKRVLHRIENDDEQEITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSSPV
FT                   YVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRLG
FT                   SGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVNLYQ
FT                   LGSTKKVKLVKTIPVHQQIEACGFIHDGEHQDLFYTAGGDAVYQILSLATASVIKKTNK
FT                   PIEELFIIGVLPILQGSKMYLVLSDQTLFLVDLEASFVEPDTAVVIESKIAGNHGTVAD
FT                   MRFVGPDLKFLALATNSPALRVIPAPDLNAKSIVSDETTAARDHAQDSRDCFPLEVELY
FT                   EGHTDLLNALDSSEDGKWLATCSKDHTVILWRYSSELEKFKAYAKFTGHAGPVTAVGLP
FT                   NVMRSAWPEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISP
FT                   NDSTFATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVW
FT                   SLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENR
FT                   IWALSVLHDGDEFVTADADGVFQFWKDCSEEQEKENLENHKRKVEQDQSLQNYMSQGDW
FT                   TNAFLLAMTLDHPMRLYRVLESASAQEDGSSDFVFNEELDNVISTLNNEQIILLMKRSR
FT                   DWNTNASKHAVAQKTIRCILLRHNIAALSDIPGIMNIIDAIIPYTQRHYSRLDGLVEQS
FT                   YILDYSLVEMDKFM"
FT   gene            <919203..>919778
FT                   /locus_tag="KLTH0E10142g"
FT                   /old_locus_tag="KLTH-ORF8896"
FT   CDS_pept        919203..919778
FT                   /locus_tag="KLTH0E10142g"
FT                   /old_locus_tag="KLTH-ORF8896"
FT                   /product="KLTH0E10142p"
FT                   /note="some similarities with uniprot|Q05942 Saccharomyces
FT                   cerevisiae YLR221C RSA3 Protein with a likely role in
FT                   ribosomal maturation required for accumulation of wild-
FT                   type levels of large (60S) ribosomal subunits binds to the
FT                   helicase Dbp6p in pre-60S ribosomal particles in the
FT                   nucleolus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10142g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23480"
FT                   /db_xref="InterPro:IPR028217"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI69"
FT                   /protein_id="CAR23480.1"
FT                   /translation="MSLEERNPARNSGKRTRRSKKRRTAESSDSESSSSSSSGSESEHE
FT                   QYEQNLPNNDGQLEISDVELSDVEEKDENTKSEVLGKETKKLLNQIPFTTTELSNGSAK
FT                   NINNIDLSKIQRTIEDAQEKVSLSKDEGQLKNAYLNLLFKHYGEDVNSLREAPDFTPKS
FT                   LVLIANVLKDGAHMFDIDTLRTVMESEQ"
FT   gene            complement(<919912..>920781)
FT                   /locus_tag="KLTH0E10164g"
FT                   /old_locus_tag="KLTH-ORF8893"
FT   CDS_pept        complement(919912..920781)
FT                   /locus_tag="KLTH0E10164g"
FT                   /old_locus_tag="KLTH-ORF8893"
FT                   /product="KLTH0E10164p"
FT                   /note="similar to uniprot|P47818 Saccharomyces cerevisiae
FT                   YLR220W CCC1 Functions in the homeostasis of both calcium
FT                   and manganese ions Possible transmembrane Ca2 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23481"
FT                   /db_xref="GOA:C5DI70"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI70"
FT                   /protein_id="CAR23481.1"
FT                   /translation="MSIVAIKNAVVNLVSKKSENAPLLSNDDNADTSYGSSSNTDEERG
FT                   KLEDKREERKGGIFGSVDPRLMSDLIIGLSDGLTVPFALTAGLSSLGDSKLVITGGFAE
FT                   LISGAISMGLGGYLGAKSESDYFHAEVKKEKRKFYNNMNLINHEIEDILLEINPEFSDE
FT                   TIISFIKDLQKSPELMVDFIIRYGRGLEEPADNRQTTSALTIGGGYFAGGFVPLIPYFF
FT                   VKEVGSGLIISIILMSITLFWFGYIKAAISMSDSCTVRKKIGEGFQMMAVGGIAAGAAW
FT                   FMVRVIDN"
FT   gene            complement(<921612..>922010)
FT                   /locus_tag="KLTH0E10186g"
FT                   /old_locus_tag="KLTH-ORF8891"
FT   CDS_pept        complement(921612..922010)
FT                   /locus_tag="KLTH0E10186g"
FT                   /old_locus_tag="KLTH-ORF8891"
FT                   /product="KLTH0E10186p"
FT                   /note="similar to uniprot|P02293 Saccharomyces cerevisiae
FT                   YDR224C HTB1 One of two nearly identical (see HTB2) histone
FT                   H2B subtypes required for chromatin assembly and chromosome
FT                   function Rad6p-Bre1p-Lge1p mediated ubiquitination
FT                   regulates transcriptional activation meiotic DSB formation
FT                   and H3 methylation and similar to YBL002W uniprot|P02294
FT                   Saccharomyces cerevisiae YBL002W HTB2 One of two nearly
FT                   identical (see HTB2) histone H2B subtypes required for
FT                   chromatin assembly and chromosome function;
FT                   Rad6p-Bre1p-Lge1p mediated ubiquitination regulates
FT                   transcriptional activation, meiotic DSB formation and H3
FT                   methylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10186g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23482"
FT                   /db_xref="GOA:C5DI71"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI71"
FT                   /protein_id="CAR23482.1"
FT                   /translation="MSAKAEKKPASKAPAEKKPAAKKTASSVDASKKRTKVRKETYSSY
FT                   IYKVLKQTHPDTGISQKSMSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVR
FT                   LILPGELAKHAVSEGTRAVTKYSSSTQA"
FT   gene            <922568..>922963
FT                   /locus_tag="KLTH0E10208g"
FT                   /old_locus_tag="KLTH-ORF8888"
FT   CDS_pept        922568..922963
FT                   /locus_tag="KLTH0E10208g"
FT                   /old_locus_tag="KLTH-ORF8888"
FT                   /product="KLTH0E10208p"
FT                   /note="similar to uniprot|P04911 Saccharomyces cerevisiae
FT                   YDR225W HTA1 One of two nearly identical (see also HTA2)
FT                   histone H2A subtypes core histone required for chromatin
FT                   assembly and chromosome function DNA damage- dependent
FT                   phosphorylation by Mec1p facilitates DNA repair acetylated
FT                   by Nat4p and similar to YBL003C uniprot|P04912
FT                   Saccharomyces cerevisiae YBL003C HTA2 One of two nearly
FT                   identical (see also HTA1) histone H2A subtypes; core
FT                   histone required for chromatin assembly and chromosome
FT                   function; DNA damage-dependent phosphorylation by Mec1p
FT                   facilitates DNA repair; acetylated by Nat4p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10208g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23483"
FT                   /db_xref="GOA:C5DI72"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI72"
FT                   /protein_id="CAR23483.1"
FT                   /translation="MSGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRVG
FT                   SGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIA
FT                   QGGVLPNIHQNLLPKKSGKPGKESQEL"
FT   gene            complement(<923078..>924721)
FT                   /locus_tag="KLTH0E10230g"
FT                   /old_locus_tag="KLTH-ORF8886"
FT   CDS_pept        complement(923078..924721)
FT                   /locus_tag="KLTH0E10230g"
FT                   /old_locus_tag="KLTH-ORF8886"
FT                   /product="KLTH0E10230p"
FT                   /note="weakly similar to uniprot|Q7LIF4 Saccharomyces
FT                   cerevisiae YLR219W MSC3 Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery msc3 mutants are defective in directing
FT                   meiotic recombination events to homologous chromatids
FT                   potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23484"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI73"
FT                   /protein_id="CAR23484.1"
FT                   /translation="MVLGIHRKPQKKPDLSRYDYHYQQKDSTGGGHALSAAAAGAAGRS
FT                   RSLVHPPARANHGVSGTPYTRSYSMRHPSSNGTSRRRPATNGALGSRTSSLLGSAGQTR
FT                   RAVSGPTTGSRTNSLASPSRSITVKTTEVRDPMGRTQSITRQTVRKINGYEYVETTTTS
FT                   TTTSPLGDAERHFDEFTSDFTHGETLEEEDNEDGDAENDEDGTEYSDAIDVLPSPPPQR
FT                   AQRQASPREAKPKRSALPRKALTEQEQYAKALAAAQRKVYGDRAEQKVAAGSMGPTGTS
FT                   GRKSRRVSSLRDPVVPSEPARHEGPAPGSTRRNTMRRSFSQVISPSRRTEAPADAPVPS
FT                   PQTQPQRRMNDDEIYAKALEIARKKFAADSMEEPREIPEAQSAQKPDLYQEAPVSTQQP
FT                   ASDAAQRGPPRSRVKSFFSKVAQFSQENYGYQDKKNEPVANASTQASRPAGTGSSAQAE
FT                   PQTSTLYSMDSNVSRRSMRGSASGPLQSSAVSSEPVRIAAATPPETEETVPAPQVMKAT
FT                   TANSSPAATGPVPTKQVKVGFFQRLFKRSR"
FT   gene            <925177..>925271
FT                   /locus_tag="KLTH0E10252r"
FT                   /old_locus_tag="Klth0E.tSer.CGA.14"
FT   tRNA            join(925177..925213,925227..925271)
FT                   /locus_tag="KLTH0E10252r"
FT                   /old_locus_tag="Klth0E.tSer.CGA.14"
FT                   /note="tRNA-Ser (CGA) cove"
FT   gene            <926587..>927270
FT                   /locus_tag="KLTH0E10274g"
FT                   /old_locus_tag="KLTH-ORF8878"
FT   CDS_pept        926587..927270
FT                   /locus_tag="KLTH0E10274g"
FT                   /old_locus_tag="KLTH-ORF8878"
FT                   /product="KLTH0E10274p"
FT                   /note="highly similar to uniprot|P07170 Saccharomyces
FT                   cerevisiae YDR226W ADK1 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23485"
FT                   /db_xref="GOA:C5DI74"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028587"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI74"
FT                   /protein_id="CAR23485.1"
FT                   /translation="MAQDLKHVPESIRMVLIGPPGSGKGTQAPNLKERFCACHLATGDM
FT                   LRSQVAQKTELGLEAKKIMDQGGLVSDEIMVSMIKHELITNPECKSGFILDGFPRTIPQ
FT                   AEKLDQMLAEQGRPLEKAVELKIDDELLVSRITGRLVHPSSGRSYHKLFNPPKEDMKDD
FT                   ITGEPLVQRSDDNADALKKRLGAYHEQTEPIVDFYKKTGIWSGVDASQSPQTVWTDILK
FT                   CLGKN"
FT   gene            <927506..>932128
FT                   /locus_tag="KLTH0E10296g"
FT                   /old_locus_tag="KLTH-ORF8874"
FT   CDS_pept        927506..932128
FT                   /locus_tag="KLTH0E10296g"
FT                   /old_locus_tag="KLTH-ORF8874"
FT                   /product="KLTH0E10296p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23486"
FT                   /db_xref="InterPro:IPR031556"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI75"
FT                   /protein_id="CAR23486.1"
FT                   /translation="MSKGDVSPKTGTPLSHHSQELPHPIDASKITLYKSTPTRRVNDEK
FT                   NSIGGPTLSPSASAGAYYGSNRLLSLLRIKNERTEGSAHSSDAAANEYPSTSAASSLTK
FT                   IIVEPTPGSKDDNAQSEGQLSNGFEKRSFHSQVSNWISNEDAKLDIYPKRASQKIDIPL
FT                   LSCNFSRTTPSTPSEKAKSGLNLLSTPLSGRTSAPKHAPSADPVPHSGQSSEPASNVVL
FT                   IPPQKSSSQTSVVQKSSSAPTIPAAEQSLIKAKTTTSAQTEPSQSHPERLLPSSALHKE
FT                   CSSRLTGPHSLIPGTVVVAAPNEGNSVSSNRASNAPSHNAILNFGELPEDAVRAAAMAT
FT                   PVKDGSNHDTQGVISAPSDAPLVLERQNTVSKSDRNLRPTTLNPPSRASSRQTGRASES
FT                   VSPNPRRRGKSFSAPKVPVIVQPISSSLTKAHLNGSIFTNGDKGAVLTHSPSQTKGPAS
FT                   HDAVEQNNMKVVLPVSREASHSQTPFSSFSKADDARQKSNANLSFNNSQNAVPVQERLT
FT                   LVGRNKEDLVRSPVDTRASNPQAQVFIGTSDTTGGSLPEIRSNELDEHHDVINSSKRKR
FT                   SPQDSQFEMHKKRKIDYEDASPILEASSNVNETFSNVTHTAASSVSGQKNENATVSPHS
FT                   DPSSGAANNNYLKTSTKQPLSRSLESVARERKSVGVASRGYKTSASNKRINGSAALKSS
FT                   DPAIVRLEVPVLVSSEGKVRGRRALAERDRGSVRKVPQSATGGEKALASEMKSPRRLRK
FT                   SAKNISNGKLRSLDNVRHTRTGAKIINPLKPLPEAVVSAQDPNEVEKKANHEVLPDTQP
FT                   TKDQKLENAPLLRSDDAQQVTSDKLSSEISDYLSDSFDPEGELLLAKRASNAKLHAEKN
FT                   KPQETAAASQILPYIANEAKPIHDPEACRKEIEKIVSRQVARKMASARKLGKQLIVSLT
FT                   QSGIVTHTPFGSGQNVTASNNICNINNYEVSPVLYLQHLSKRGRLEVSEFSQSKIPIMK
FT                   VTQSSIDASTKEKLKKACNGLLVFIDNYHYGSLTENQKVLVDQRLAFVKSALPKLGMRL
FT                   TDDMSSQVSIMIAVSEVQNMEDVNSVEATEAYGMQAWSYGYAVEFFKMLLGPEALPSPV
FT                   LKDKEEGASDNHAQQKTISKVASACTPSNEGDGKACEKEEVPYHENALRELVGELANCV
FT                   RSTTIDRAVLENCVREISSCVDFVVEEQLIGARLAEQFEAQNRLILAMSDELIQNQIKI
FT                   ASLHGRASSSEKDVDALNLKLSEERSKAENQLSELKSKLEESVREKQQVVPQQAVPQPV
FT                   VPKQVGEEPNRNVNQGSSPDIHVEEIQRAGVLDHRVVNDIGLIKNALNKRADRPILANS
FT                   GQEALTSSLTPRRLLSSDSVQDSSPRNNLSSAMLLPNPNVTGSSISTGWQGGLMRVLAA
FT                   LNNQQEAQHVAFRSENVLLREERDALRATLTGFDSILRGQQQRLSQLEEALLRERSKKR
FT                   SPFDARQMAAGSTRTSEIEEERNALKSRLVGYDNIMRDQQVKLSLLETALQREKLTRKA
FT                   LQARLQTFAHGLVSEDEAEA"
FT   gene            complement(<932380..>934125)
FT                   /locus_tag="KLTH0E10318g"
FT                   /old_locus_tag="KLTH-ORF8868"
FT   CDS_pept        complement(932380..934125)
FT                   /locus_tag="KLTH0E10318g"
FT                   /old_locus_tag="KLTH-ORF8868"
FT                   /product="KLTH0E10318p"
FT                   /note="some similarities with uniprot|P39081 Saccharomyces
FT                   cerevisiae YDR228C PCF11 mRNA 3' end processing factor
FT                   essential component of cleavage and polyadenylation factor
FT                   IA (CF IA) involved in pre-mRNA 3' end processing and in
FT                   transcription termination binds C- terminal domain of
FT                   largest subunit of RNA pol II (Rpo21p)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10318g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23487"
FT                   /db_xref="GOA:C5DI76"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR021605"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI76"
FT                   /protein_id="CAR23487.1"
FT                   /translation="MECDKIAKDFASILDELTCNSKPIISTLTKMAEENIGCAQQMVDA
FT                   IERRIERCVPNQKLYAFYVLDSICKNAGSPYTIYFSRNLAQLYKRTYLIVDNQTRSDLI
FT                   KMFKTWLMPSSSSMGDHLFGKEALDAIERFLVKASALHQKHVAAPTVPGLLREIDKLSL
FT                   LTRERAAQNPHDAKLKTKVVVLQQLKQELQREKMPPQALQQVQMQLRQIFAQEQQVLQQ
FT                   QHQQQQLQHQHQQQRLPRKALSTPPPQAPGATPAPRESEPVSLFGTPSLSSSFFPNASN
FT                   IQPPTSEPSQKASKVQALYDTLRAEGLVKPVPQQSVVTLDRILSQNHKESAQTTLPPLN
FT                   LLKDILGDVQSHFSTVGVDILNTPNLQLCQQTVIQDNPTVMQLRHLLYRYKPNKCSTCG
FT                   KRFGSSEEEKKQERDHLDWHFRINKRIKGTAGANGATAKNIQSRNWYLDDTQWQRFNDE
FT                   EIVSTTRSETDSVTLANLDASTASSSFSTSKFDAKSAPEKTEADLAKKYVTVPETHEDM
FT                   SFQCPICREVQSAVYNDDIGEWIWPNCIQSQGKYFHSTCFHEAVEETPQQALNQGLERL
FT                   KGLAG"
FT   gene            <934782..>935771
FT                   /locus_tag="KLTH0E10340g"
FT                   /old_locus_tag="KLTH-ORF8858"
FT   CDS_pept        934782..935771
FT                   /locus_tag="KLTH0E10340g"
FT                   /old_locus_tag="KLTH-ORF8858"
FT                   /product="KLTH0E10340p"
FT                   /note="highly similar to uniprot|P38988 Saccharomyces
FT                   cerevisiae YDL198C GGC1 Mitochondrial GTP/GDP transporter
FT                   essential for mitochondrial genome maintenance has a role
FT                   in mitochondrial iron transport member of the mitochondrial
FT                   carrier family (putative) mitochondrial carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23488"
FT                   /db_xref="GOA:C5DI77"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI77"
FT                   /protein_id="CAR23488.1"
FT                   /translation="MARVDPAGGERTKQGSSTEQRPPHSREQQARMSNDKKQSGTARVL
FT                   GSASAGILEIGVFHPVDTVSKRLMSNHSRIASAAQLNAVVFREHAGEALGKRLFTLFPG
FT                   LGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDAAFGEKTGKALRSATAGSLIGIGE
FT                   IVLLPLDVLKIKRQTNPEAFKGRGFLRILRDEGLGLYRGWGWTAARNAPGSFALFGGNA
FT                   FAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFRI
FT                   VRNTLKNEGATAFFKGLTPKLLTTGPKLVFSFALAQSLIPAFDKLLAQ"
FT   gene            complement(<935955..>936980)
FT                   /locus_tag="KLTH0E10362g"
FT                   /old_locus_tag="KLTH-ORF8851"
FT   CDS_pept        complement(935955..936980)
FT                   /locus_tag="KLTH0E10362g"
FT                   /old_locus_tag="KLTH-ORF8851"
FT                   /product="KLTH0E10362p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10362g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23489"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI78"
FT                   /protein_id="CAR23489.1"
FT                   /translation="MSRPPSAAMERRYSADARLDGDGDGCDALGGACAPPPAPPPAGAS
FT                   ASVGAGLVAASAPPVVGYEPVPVRALYSTPAHSYQVLAGHVPSHMPGHMPGQPQGHIHS
FT                   QSLHQFGAAASPASSASPGSVRRVGRRFWQPSEDIVLLDTVLAHRYEVPISPNVRHFWD
FT                   SVSRQLFQEHALQRNTRQCRDRFNLLYARGVRNAACNVEPENARDALILKVARVFHATD
FT                   QGHYRMSPGADTSTDTSMGPSAGILTAPAGATPQAGNSMDWNYMANSVSSLVASTRSLA
FT                   AEVRDLSERFTQLSQQVRYIQVRLACAPERSATGQFGAPDLPYDSQFHNPPAYPPPGGR
FT                   E"
FT   gene            <937342..>938157
FT                   /locus_tag="KLTH0E10384g"
FT   CDS_pept        937342..938157
FT                   /locus_tag="KLTH0E10384g"
FT                   /product="KLTH0E10384p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10384g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23490"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI79"
FT                   /protein_id="CAR23490.1"
FT                   /translation="MRKTFNEDECACPPPRASHASRCYRRLPVRTHFVTYAHRRWTHRN
FT                   CVTCSEGPRARRCTRKDAGLSAALLTTQLPLGATPATRSAAGANGADAGAGTGEASSTG
FT                   ADVLVFLRCLQQALEGPGRLYIIFPDLPKQMESRWKVDGRKEKRATGGTRADGAAAARV
FT                   EPSPSYRRDASSSVATGRRSGDAMEGKLKPRQTGGQRLGARRETEVQGCGGEQQVTRKS
FT                   RAQARAGRGRISARGEARAAGRRGVRPRPRDAHVTGECHMTSHMTATIT"
FT   gene            <938423..>940624
FT                   /locus_tag="KLTH0E10406g"
FT                   /old_locus_tag="KLTH-ORF8840"
FT   CDS_pept        938423..940624
FT                   /locus_tag="KLTH0E10406g"
FT                   /old_locus_tag="KLTH-ORF8840"
FT                   /product="KLTH0E10406p"
FT                   /note="weakly similar to uniprot|Q12407 Saccharomyces
FT                   cerevisiae YDL199C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10406g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23491"
FT                   /db_xref="GOA:C5DI80"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI80"
FT                   /protein_id="CAR23491.1"
FT                   /translation="MAQRERSVSPKSRGKSPPEIHAANASAQSFTEQHRGASLTSLPRK
FT                   KPEMYHYDVGGGAQAAAQAGAATAGAGMLYQDSKASVQAGAGPSAGPGDAAHAQAVPPG
FT                   YNQHLQVKDSYLTGRALLYFTSVFVSLGVFLFGYDQGVMSGIITGPLFKLYFDDPSRAA
FT                   IGNMVSILEVGALVSSLMVGRLGEKWGRRRTIRYGSFVFILGGLIQTSATRMLHLIIGR
FT                   VISGLGVGLLSTIVPIYQSEISPPHNRGKLACIEFTGNIVGYCSSVWVDYGCSYINNNA
FT                   AWRLPLFIQCVMGLGLFMGTFVIVETPRWLLNHDHDVEGLIVIADLHSDGDVQDRRAHD
FT                   EFQAIKETVLISRLEGEKKSYSYVFKRYRTRMLIAMSSQMFAQLNGINVISYYAPMVFE
FT                   QAGWVGRDAILMTGVNGIIYVLSTVLPWHLVDRWGRKPILLMGGMVMGLSLVSISAALY
FT                   VNIASTPTLVVVFVIVFNAFFGFSWGPIPWLYPVEIAPLSARSAMASASTATNWLCNWL
FT                   VGIMTPILQEKIKWRLYLIHAASCFLSFWCVLRVYPETAGLRLEDMSSVFDDRSSTFSF
FT                   HGSITGVDVDAGSRSATTAPANPSLARKPVAAQPSLLDSVHSGVAPPHPVAGQPDLAQN
FT                   PFVSHSSGQSVGSKRSIASANMLSADALEPPTLGQVLDFKREQIDSRNFKGLMRRGSET
FT                   VSLIYDKVKRLGKPNDASGEYGTLPDNERPAPAAPPCGN"
FT   gene            complement(<940734..>941585)
FT                   /locus_tag="KLTH0E10428g"
FT                   /old_locus_tag="KLTH-ORF8832"
FT   CDS_pept        complement(940734..941585)
FT                   /locus_tag="KLTH0E10428g"
FT                   /old_locus_tag="KLTH-ORF8832"
FT                   /product="KLTH0E10428p"
FT                   /note="highly similar to uniprot|Q12009 Saccharomyces
FT                   cerevisiae YDL201W TRM8 Subunit of a tRNA methyltransferase
FT                   complex composed of Trm8p and Trm82p that catalyzes
FT                   7-methylguanosine modification of tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23492"
FT                   /db_xref="GOA:C5DI81"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR025763"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI81"
FT                   /protein_id="CAR23492.1"
FT                   /translation="MKAGMSLDDPSSKRQAYRLKKEENRKELKHVKIDAKASSEKMDLP
FT                   RKRFYRQRAHSNPFSDHQLEYPLSPDEMDWDRLYPHFVDEATGAMTKEVTIADIGCGFG
FT                   GLLIDLSPAFADKLILGMEIRVQVTNYVEDRIIALRTNHAETNAYQNINVLRANSMKFL
FT                   PNFFHKAQLEKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLKEGGVVYTITDVLDLH
FT                   EWMVKHLEEHPLFERLSTEWEDQDECVEIMRNATEEGKKVERKKGAKYVACFTRLPTPE
FT                   IV"
FT   gene            complement(<942374..>943063)
FT                   /locus_tag="KLTH0E10450g"
FT                   /old_locus_tag="KLTH-ORF8829"
FT   CDS_pept        complement(942374..943063)
FT                   /locus_tag="KLTH0E10450g"
FT                   /old_locus_tag="KLTH-ORF8829"
FT                   /product="KLTH0E10450p"
FT                   /note="similar to uniprot|P36521 Saccharomyces cerevisiae
FT                   YDL202W MRPL11 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10450g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23493"
FT                   /db_xref="GOA:C5DI82"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI82"
FT                   /protein_id="CAR23493.1"
FT                   /translation="MLTQSLGLFPRIPSSSLLSRGLRFASTEARITVKPLNSRKTLLMD
FT                   TYKELMEKNPVVLFAHHNNLVKQEDAFFRSQIKELGGQMTVLRNQLFQVYLRNAHLPDP
FT                   CAPTPKAEQNRTHPLLPLFKGPTAAITFPETEPAKVAKLLKLLEKSSEKLFVVGAKVDG
FT                   GILDVPQLHQFKTLSSKPELQSQLLGLLHLLSGAGLVKTLEAGSHSLYLTLQSHHNNID
FT                   PENKKSD"
FT   gene            <944027..>945346
FT                   /locus_tag="KLTH0E10472g"
FT                   /old_locus_tag="KLTH-ORF8826"
FT   CDS_pept        944027..945346
FT                   /locus_tag="KLTH0E10472g"
FT                   /old_locus_tag="KLTH-ORF8826"
FT                   /product="KLTH0E10472p"
FT                   /note="similar to uniprot|Q04934 Saccharomyces cerevisiae
FT                   YDR229W IVY1 Phospholipid-binding protein that interacts
FT                   with both Ypt7p and Vps33p may partially counteract the
FT                   action of Vps33p and vice versa localizes to the rim of the
FT                   vacuole as cells approach stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23494"
FT                   /db_xref="GOA:C5DI83"
FT                   /db_xref="InterPro:IPR037470"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI83"
FT                   /protein_id="CAR23494.1"
FT                   /translation="MARAARNTHPQSPPASTYSSVMADQSSTIDNSQGSSDRYAPHLSE
FT                   FYSMVNEPRKKKNASGPSSQGASENVLESPIRSTANSSIFRIRRPSSLRSGFSSMTDLQ
FT                   PLVTSRDMTQTVDTMQQLLANVESYAQELVATSQRASMLALSLEQMARLKGCNDETADK
FT                   FLSSSGLFHLIANHQRIMSDCMTSSMVETLANRIDEFQFKRRVREARFKKEFYDEAKKL
FT                   KLQEKYNLQFSKRKTRNLLSYRENLANLQLQLDELESLKHRYYQDSSEMVEECCNDVLR
FT                   DMATVSRAQVEISENIARKGWSGGGLDDLMIDADDPFSKEGQNDDVDAEGESNMLNSPF
FT                   SHVNSRTATPRAEPLTSTPTRGEEDAGSATSVPSAQSSTQETCENSFSLPGPQVRHSES
FT                   KQENENTDTEDTDAPGIGKKLLDGLQDFKLENGSTPSLVG"
FT   gene            complement(<945467..>946021)
FT                   /locus_tag="KLTH0E10494g"
FT                   /old_locus_tag="KLTH-ORF8822"
FT   CDS_pept        complement(945467..946021)
FT                   /locus_tag="KLTH0E10494g"
FT                   /old_locus_tag="KLTH-ORF8822"
FT                   /product="KLTH0E10494p"
FT                   /note="similar to uniprot|Q04935 Saccharomyces cerevisiae
FT                   YDR231C COX20 Mitochondrial inner membrane protein required
FT                   for proteolytic processing of Cox2p and its assembly into
FT                   cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23495"
FT                   /db_xref="GOA:C5DI84"
FT                   /db_xref="InterPro:IPR022533"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI84"
FT                   /protein_id="CAR23495.1"
FT                   /translation="MVWPFSRRQNGSQDREPEAGPEINSKASGKKYLLEDTKPRFANES
FT                   QSQYANAQEQATLRKAWETVDWQDFSFERLVRIPCFRDAGMTGFTSMFVLGSVMFLYHK
FT                   NPSKAANWSVGGLMLGSIVGWEQCRLRRKNSFHTAQMAKSTVAAKEKPMLHTPVNDDRV
FT                   KKEWEGHTSASTAKKPWYKFW"
FT   gene            <946506..>948404
FT                   /locus_tag="KLTH0E10516g"
FT                   /old_locus_tag="KLTH-ORF8820"
FT   CDS_pept        946506..948404
FT                   /locus_tag="KLTH0E10516g"
FT                   /old_locus_tag="KLTH-ORF8820"
FT                   /product="KLTH0E10516p"
FT                   /note="similar to uniprot|Q07622 Saccharomyces cerevisiae
FT                   YDL203C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10516g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23496"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI85"
FT                   /protein_id="CAR23496.1"
FT                   /translation="MAGTSKQYLYDTHINMYPPSRGGMSAQRNIANSPSRIVPYPVEDI
FT                   QQPMSPVALQSAAATSPATSTHTLVGSKRSPPPPNVRYDQPFTFQNGEQNLGGTPPPDL
FT                   VSGLRRFDSATANNSSTDTFQSASDVSAPPPATATAMPPPPYEETENQQFLREKLYRTA
FT                   SDLSSGESGQEAGSRKPLQNQPLQNQHLQNQPLPEAQGSQYRTLDQGTPRKAERALPRE
FT                   LQRDLSQYSDEALYFYRVYQVTVDDSPNFTPKVQMKWCETLLTYSFNTEFVSNYNINSN
FT                   KLKPRLTPEEALKNQKIILEHALKVLTKLITLQYGPALYLMATLYSHQPYLDIKIQAVI
FT                   VRNDAKALDYYTRAAALNESEACYRAGVCYEYQRGTPTELDKAQCLQKAVYFFDRGATQ
FT                   CGNTACMYKLAMLLLHGVNEKYSAQAVLQQDVKAAMHWFKKAAAESAPTNGAVGSPQAM
FT                   YELAKIYERDGLQPALQERLEAAGISRDATRALQYYHRCATLCSYPLAQWRLGQCYEFG
FT                   QLNLPVAANKSIAWYAKAAMAQPRGNPMAMMALSGWYLTGATGVLKPNNREAYNWARKA
FT                   CQAADGKLARAEYALAFYSENGIGCTPSLAEAREHYERAAAAGHAKARDRLRAGDL"
FT   gene            <948937..>950628
FT                   /locus_tag="KLTH0E10538g"
FT                   /old_locus_tag="KLTH-ORF8812"
FT   CDS_pept        948937..950628
FT                   /locus_tag="KLTH0E10538g"
FT                   /old_locus_tag="KLTH-ORF8812"
FT                   /product="KLTH0E10538p"
FT                   /note="similar to uniprot|P09950 Saccharomyces cerevisiae
FT                   YDR232W HEM1 5-aminolevulinate synthase catalyzes the first
FT                   step in the heme biosynthetic pathway an N-terminal signal
FT                   sequence is required for localization to the mitochondrial
FT                   matrix expression is regulated by Hap2p- Hap3p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10538g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23497"
FT                   /db_xref="GOA:C5DI86"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI86"
FT                   /protein_id="CAR23497.1"
FT                   /translation="MDSIARQSAKLCPFVSRATSSLRNVQTLQQGNISAMAQRCPFMGQ
FT                   AMQKAHLTTSAAAGAAAAAPAAQEASRAAGKDQSSVMADRATQEAKFDYEGLFEQDLQK
FT                   KRLDKSYRFFNNINRLAKEFPMAHRQQEEDKVTVWCSNDYLALSKNQQVVDVMKRTLDK
FT                   YGAGAGGTRNIAGHNQHALRLEAEVAALHKKEGALVFSSCFVANDAVISLLGQKLKDLV
FT                   IFSDELNHASMIVGIKHASTTKHIFKHNDLEHLEELLAMYPKSTPKLIAFESVYSMSGS
FT                   VADINKICDLAEKYGALTFLDEVHAVGLYGPHGAGVAEHCDFESHRSSGIASPAHQTVM
FT                   DRVDMITGTLGKSFGTVGGYVAGSLRLIDWLRSYAPGFIFTTSLPPSVMAGAAEAIRYQ
FT                   RSHLDLRQAQQRHTAYVKQGLADLDIPVIPNPSHIVPVLVGNPDLARQASEILMDKHRI
FT                   YVQAINFPTVARGTERLRITPTPGHTDDLSDILLDAVDDVFNTLQLPRVKDWKRQGGLL
FT                   GVGQSDYMAEPNLWTEDQLQLSNDDLHPNVREPIIDQLEVSSGIRY"
FT   gene            complement(<951130..>952062)
FT                   /locus_tag="KLTH0E10560g"
FT                   /old_locus_tag="KLTH-ORF8808"
FT   CDS_pept        complement(951130..952062)
FT                   /locus_tag="KLTH0E10560g"
FT                   /old_locus_tag="KLTH-ORF8808"
FT                   /product="KLTH0E10560p"
FT                   /note="similar to uniprot|Q04947 Saccharomyces cerevisiae
FT                   YDR233C RTN1 reticulon gene member of the RTNLA (reticulon-
FT                   like A) subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10560g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23498"
FT                   /db_xref="GOA:C5DI87"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI87"
FT                   /protein_id="CAR23498.1"
FT                   /translation="MSSNELLYWRNPVETGKVFGGILVSLLVMKKVNLITCLLKVMYTI
FT                   MLTTASVEFLSKLFLGQGMVTKYGLQSCPDAVGFLKPRIEAALNAIPPRQAQLRKLVMA
FT                   QSPKCTFKAAGILYVLHKLFSVVSLWTALFVGTILTFSLPLIYKSYQKEIDATVAQGVE
FT                   AGKQHASALQSTVCEKASPYVKQLDEKLGPVSGFVKSKLPATRVGGSNITAESTTTKLA
FT                   ADVPFEKPAPAKTSASAFPAATSHIPTETPLASADAASAPATAKTSSADFPSVPSTDFS
FT                   KIQATEQINETVKDATTGISHSTDPLKEL"
FT   gene            <953799..>955862
FT                   /locus_tag="KLTH0E10582g"
FT                   /old_locus_tag="KLTH-ORF8801"
FT   CDS_pept        953799..955862
FT                   /locus_tag="KLTH0E10582g"
FT                   /old_locus_tag="KLTH-ORF8801"
FT                   /product="KLTH0E10582p"
FT                   /note="highly similar to uniprot|P49367 Saccharomyces
FT                   cerevisiae YDR234W LYS4 Homoaconitase catalyzes the
FT                   conversion of homocitrate to homoisocitrate which is a step
FT                   in the lysine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10582g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23499"
FT                   /db_xref="GOA:C5DI88"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004418"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR039386"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI88"
FT                   /protein_id="CAR23499.1"
FT                   /translation="MLRFARTFSSSRHVLRGQNMTEKIVQAYAVGLAEGKKVGSGDYVS
FT                   IQPAHCMSHDNSWPVALKFMGLGASKIRNPRQIVNTLDHDVQNNTEKNLTKYKNIENFA
FT                   KKHGVDFYPAGRGIGHQIMIEEGYAFPLNLTVASDSHSNTYGGIGCLGTPVVRTDAAAI
FT                   WATGQTWWQIPPVAQVELKGELPHGISGKDIIVALCGIFNNDQVLNHAIEFTGDSLEKI
FT                   PVDYRLTIANMTTEWGALSGLFPVDKTLINWYNNRLHKVGPNHPRINQQRIDDLVEKSK
FT                   SLKADNDATYAKKLVIDLNTLTHYVSGPNSVKVSATVQDLSQQNIKVNKAYLVSCTNSR
FT                   LSDLEAAAHVVCPTGDLNKVNKVAPGVEFFIAAASSEVERDAKASGAWEKLLRAGCKTL
FT                   PAGCGPCIGLGTGLLEPGEVGISATNRNFKGRMGSKDALAYLASPSVVTASALLGKIGS
FT                   PAEVLREQEPSFSGVKASVEDTQSQAKEGATASDKGPVEMLEGFPSVITGELVLCDADN
FT                   INTDGIYPGKYTYQDDVTREKMAQVCMENYDAEFQTKVNAGDIVISGYNFGTGSSREQA
FT                   ATALLAKGIDLVVSGSFGNIFSRNSINNALLTLEIPALIEMLRAKYRDAPKELTRRTGW
FT                   FLKWDLPNSTVIATEGSLDGPVVLEQKVGELGKNLQEIIVKGGLEGWVKSQL"
FT   gene            <956536..>957546
FT                   /locus_tag="KLTH0E10604g"
FT                   /old_locus_tag="KLTH-ORF8796"
FT   CDS_pept        956536..957546
FT                   /locus_tag="KLTH0E10604g"
FT                   /old_locus_tag="KLTH-ORF8796"
FT                   /product="KLTH0E10604p"
FT                   /note="similar to uniprot|P28789 Saccharomyces cerevisiae
FT                   YDL205C HEM3 Phorphobilinogen deaminase catalyzes the
FT                   conversion of 4-porphobilinogen to hydroxymethylbilane the
FT                   third step in the heme biosynthetic pathway localizes to
FT                   both the cytoplasm and nucleus expression is regulated by
FT                   Hap2p-Hap3p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10604g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23500"
FT                   /db_xref="GOA:C5DI89"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI89"
FT                   /protein_id="CAR23500.1"
FT                   /translation="MTEEHSAKSEHQIVRIGGRKSKLAVIQSHEVKDLIEREFSQYSCT
FT                   VRALKTLGDQVQSKPLYSFGGKAVWTKELEDLLYEKDKEKRIDLIVHSLKDMPTLLPDG
FT                   FLVGAIIKRVDPTDCIIMAKESPYKTLDDLPDGSVVGTSSIRRSAQLKRKYPKLVFESV
FT                   RGNIETRLSKLDDPITPFSCIVLATAGLLRVKLAHRITQRLDSSVMYHAVGQGALGIEI
FT                   RSDDPWIAGILQKINDKETAICCFAERSLMRTLEGGCSVPIGVESNYDDTTKQLCLKAV
FT                   VVSVDGTEAVEDEYTMTIEDMRQDAIICGQQLAHKMIKNGAKDILDRINLDKIDQ"
FT   gene            <957868..>959472
FT                   /locus_tag="KLTH0E10626g"
FT                   /old_locus_tag="KLTH-ORF8795"
FT   CDS_pept        957868..959472
FT                   /locus_tag="KLTH0E10626g"
FT                   /old_locus_tag="KLTH-ORF8795"
FT                   /product="KLTH0E10626p"
FT                   /note="similar to uniprot|Q03776 Saccharomyces cerevisiae
FT                   YDR235W PRP42 U1 snRNP protein involved in splicing
FT                   required for U1 snRNP biogenesis contains multiple
FT                   tetriatricopeptide repeats"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10626g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23501"
FT                   /db_xref="GOA:C5DI90"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI90"
FT                   /protein_id="CAR23501.1"
FT                   /translation="MDESLDEVLGENYGKLSLKVSQSPLAFGHWEELINYLLEKAGPLN
FT                   KALSGQLIQLIRQTYKSMLTYLPYLENYSIDYALFEYKLGNIKEMHEAFTAALQKHNNY
FT                   SLLIWIEYLKACNEVVIDNKKLFRKYELAESFIGLHFYSGEFWEMYLEQVRMRCSTPNR
FT                   YILILRKVIELPIYSYSRFYAMWLSAIDDVKDVKQLATMVPEQDLKKKAKIDVRASGRK
FT                   GPQLQETKKLLKRYTKEMYMVVQHRVLEFYNLFEINLRTQYYTSAETLINYNEITTWLR
FT                   YLDYSINNGINQLTQINFQRALIPLAHYEMIWLKYASWLVQHQDFVSAKTVLLQGLRIS
FT                   HKKAKIIERLSTIMLKIGHYSELIQLYNEIQNVYGEKIEELDDYELFFDYFLFTAFLEK
FT                   SINDNFKAGCVRSHIDPLKLALKRLSYGENKRGQVELLHAVCQMYSRFSHETLENKIFR
FT                   PIINQDWSFYLNNGMFWFEYCHSVWFDPSSSYLEKRRNIVNNIIPLAVKQEPKATKGVV
FT                   KFCEMYLPEDLKLCNKT"
FT   gene            complement(<959492..>961513)
FT                   /locus_tag="KLTH0E10648g"
FT                   /old_locus_tag="KLTH-ORF8794"
FT   CDS_pept        complement(959492..961513)
FT                   /locus_tag="KLTH0E10648g"
FT                   /old_locus_tag="KLTH-ORF8794"
FT                   /product="KLTH0E10648p"
FT                   /note="weakly similar to uniprot|Q12424 Saccharomyces
FT                   cerevisiae YDL206W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10648g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23502"
FT                   /db_xref="GOA:C5DI91"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI91"
FT                   /protein_id="CAR23502.1"
FT                   /translation="MALWRRRLAIGCFYLAQVVCITAGLRYDTYWSILVAPWVLGYSFT
FT                   ALGLITSDFLTPNLSIISKQVLHISDRVSGMTLLALGNSIPDITSTYQSMRSGATPLAL
FT                   GELLGAVVFLLTVVVGAMPFVRTIEFANLDPERELDPLIPTEGSATLCYNRTRFMKDLV
FT                   LFAVLIFLSLFFLYDGKLVFWECVLMVCVYVGYVIFQLYFEADEPVPSVLVPPEANEAI
FT                   ISSSETDQHLNSRDETQFLQELEHRKANLSCKIRRRLRSNYSIYMKMPLNDILNVWDNE
FT                   SAFQPPTTHPKLTKCVSHQDLRAQLNIIKPSSPDHNQQPIGSRGWDEGQSVSDTDQGLL
FT                   KPPIRTNSRSVSADYLLYLDNHLQSSDNSLMGSISSNEQIDADANEPLPLKSEQELLEI
FT                   QEKPIIQSVLYNYWYNEKACHGWAEILTLLVITPVLLILRILIPSPDNLFGHRQNRGKI
FT                   TCIQVFVAPLLIDYFITDSWHLFDVLIIIATALLFYYLRSREMHGFVIRFVSILAFLLS
FT                   VSTISFIVKNVVEVLRRSAAALNVSEAMLGLTIFAWGNSVGDLATTVTFTKMGVLDVAL
FT                   GACFGGPLLYFLFGIGLDGMLVILLKKSHHEGSIWLRHIDFEVSALLIVSCLTLLAAFA
FT                   VYLIVIPLNNWRVDKNVGIILLVLYAVATALNIYFELY"
FT   gene            complement(<961638..>962192)
FT                   /locus_tag="KLTH0E10670g"
FT                   /old_locus_tag="KLTH-ORF8791"
FT   CDS_pept        complement(961638..962192)
FT                   /locus_tag="KLTH0E10670g"
FT                   /old_locus_tag="KLTH-ORF8791"
FT                   /product="KLTH0E10670p"
FT                   /note="similar to uniprot|Q03778 Saccharomyces cerevisiae
FT                   YDR236C FMN1 Riboflavin kinase phosphorylates riboflavin to
FT                   form riboflavin monophosphate (FMN) which is a necessary
FT                   cofactor for many enzymes localizes to microsomes and to
FT                   the mitochondrial inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10670g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23503"
FT                   /db_xref="GOA:C5DI92"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI92"
FT                   /protein_id="CAR23503.1"
FT                   /translation="MPRTADVPIPDFPQNPYPITTEFCDIVCGFGRGSSELGVPTANVL
FT                   FEQVPKVVESLPLGVFFGFARLVQAKKGSKRTLRRPDGSHVDFNFGQSLSDEEMQVWPV
FT                   VLSIGLNPFYQNDTKTVELHIIHKFGHDFYGAKVKFNILGYIRPELDYTTKEALIKDIK
FT                   TDIKIATNTLAKPGYKAYNKL"
FT   gene            complement(<962373..>963941)
FT                   /locus_tag="KLTH0E10692g"
FT                   /old_locus_tag="KLTH-ORF8789"
FT   CDS_pept        complement(962373..963941)
FT                   /locus_tag="KLTH0E10692g"
FT                   /old_locus_tag="KLTH-ORF8789"
FT                   /product="KLTH0E10692p"
FT                   /note="some similarities with uniprot|Q12315 Saccharomyces
FT                   cerevisiae YDL207W GLE1 Cytoplasmic nucleoporin required
FT                   for polyadenylated RNA export but not for protein import
FT                   component of Nup82p nuclear pore subcomplex contains a
FT                   nuclear export signal"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10692g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23504"
FT                   /db_xref="GOA:C5DI93"
FT                   /db_xref="InterPro:IPR012476"
FT                   /db_xref="InterPro:IPR038506"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI93"
FT                   /protein_id="CAR23504.1"
FT                   /translation="MRFNYEELCNIDSPEWHDEDEYTVIGGDDEHVPQLRLPRHVKRDT
FT                   VPSDSIGVLDSGLAELMNELDLGSKIPGPSRLKPGIWRKRTKSLSKSESKPFNPTPARH
FT                   SYEPEMFLNLRESLAKSILMKLETLERDNAERVQEVKNEKERIRMEQQRIEEEQKRKAE
FT                   EQARIRREEAEKLRQRAEMERKQQLEEQKRKEAERKRLEEERRKQEAAEKELKAQEEAK
FT                   KVFGLTNFSKVEDFFKHYKHRIKAIKSEIVEPVKKDTSLKSILSKHKRKINPKFGQLTN
FT                   SEQHLATIFSELSSLVDETKANQLGYQWILNFIAKALVSQAETEVRVKPESALPLGKLA
FT                   LNLLARYPELLDFLMARFVKKCPLVIGFTCNINSEEGRYKMGWKRAQNDTWEEETSYDE
FT                   RMGGITTLFSVITRLPLPLEIISSQAHPLPIVHSWQMLARIANTHTDLLTNTHFVVLGS
FT                   WWDAAAAQFVQAYGNQARKLMSLLTNDLTNAVAERKYVGAARLRILSEDYETSGTLKSF
FT                   PEMNA"
FT   gene            <964199..>965068
FT                   /locus_tag="KLTH0E10714g"
FT                   /old_locus_tag="KLTH-ORF8785"
FT   CDS_pept        964199..965068
FT                   /locus_tag="KLTH0E10714g"
FT                   /old_locus_tag="KLTH-ORF8785"
FT                   /product="KLTH0E10714p"
FT                   /note="highly similar to uniprot|P36519 Saccharomyces
FT                   cerevisiae YDR237W MRPL7 Mitochondrial ribosomal protein of
FT                   the large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10714g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23505"
FT                   /db_xref="GOA:C5DI94"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI94"
FT                   /protein_id="CAR23505.1"
FT                   /translation="MRFIRGFSTTRSTCKSACSLVKPVHHLVKIDKSKLSPRFEELKYA
FT                   KNDIRSPGFKPVATHQDRVVDHYHNTLQPDLLLINYSHKAQVERGAKKREWDNSSPYHL
FT                   NRQLRKPKGSAAQLPDIHPIKWHNIPSLESVVINCYAKESKENQLLPITAALQLQQITG
FT                   CKPQPVYARTDVPSWKVRRGTRMGAKVELKGRPMSQFLSTLTEIVLPRIREYKGISNRS
FT                   GNRFGGLSFGLTSEDVRFFPEIESNQDLWPKTFGLHVNINTTAQNDVQARTLVSGFAFP
FT                   FHGPERTK"
FT   gene            complement(<965155..>968076)
FT                   /locus_tag="KLTH0E10736g"
FT                   /old_locus_tag="KLTH-ORF8783"
FT   CDS_pept        complement(965155..968076)
FT                   /locus_tag="KLTH0E10736g"
FT                   /old_locus_tag="KLTH-ORF8783"
FT                   /product="KLTH0E10736p"
FT                   /note="highly similar to uniprot|P41810 Saccharomyces
FT                   cerevisiae YDR238C SEC26 Involved in endoplasmic-to-Golgi
FT                   protein trafficking encodes a subunit of yeast coatomer"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10736g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23506"
FT                   /db_xref="GOA:C5DI95"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011710"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016460"
FT                   /db_xref="InterPro:IPR029446"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI95"
FT                   /protein_id="CAR23506.1"
FT                   /translation="MSATLNQSAYTLVYDPSPSFVGYTNQELQRSLEKGSDEEKISTMK
FT                   RILVMMLDGNPLPEMLMHVIRFVMPSKNKQLKKLLYFYWEIVPKLDSEGKLKQEMILVC
FT                   NAIQHDLQHPNEYIRGNTLRFLTKLREADLLEQMVPAVRSCLEYRHAYIRKYAILAVYS
FT                   IYKVSEHLIPDACEIMDSFLVAETDPVCKRNAFLGLADLDREAALNYLQENIASIESLD
FT                   SLLQDAFIEFIRKDAIQTPTLKPQYVDLLQDLLAATTSHEVIFEASLALSVLTNDPREL
FT                   SEVATKLIDLAVKESDNNVKLIVLERIQDVHKRVPGFLEELTLDILRVLSAQDLDVRSK
FT                   ALDIALELVSSRNVDDVVKLLKKELQITIANAHNDEKAIEYRQLLIKNIHKVAIRFVEV
FT                   SADVVSLFLEFIGELSSSAASDVIAFIKQVIEKYPQLRKEILQHLIGALPYVSSAKAYR
FT                   GALWILGEYSLDAEDIQSTWKHIRSSVGELPIVQSELRQMEGESSDELPSSEQQSAPSG
FT                   PVVLPDGTYATESAFAADAGKSLTKEERDSRPPLRRFILNGDFYTTSVLATTIVKCALR
FT                   FERTSKDEAILNALKAEAMLILVSILRAGQSSLVEKKIDEDSSERIMIALSILMDGTHI
FT                   QESPEGKRLLELAYLEATKSSFESKVASAERKSAKESASALARTAEPIDKAISFRQFAS
FT                   VDIQNTPVDTINEDLERAISGDSSASQGLASVTSKLKKIVPLTGFSDPVYAEAYITNHQ
FT                   FDVVLDVLLVNQTTETLRNLHVQFATLGDLKIIDSPPSTNVIAHGFHKLTVTVKVSSAD
FT                   TGVIFGNIIYDGGHGEDARYVIMNDIHVDIMDYIKPAKTDDATFRKMWNAFEWENKITV
FT                   KSKLPTLHAYLDELIKGMRMGILTPEEALGEEGCRFLSCNLYSKSTFGEDALANLCIEK
FT                   DPTSHEITGHVRIRSKGQGLALSLGDRVALVARQMNKIKLDRV"
FT   gene            complement(<968291..>970429)
FT                   /locus_tag="KLTH0E10758g"
FT                   /old_locus_tag="KLTH-ORF8781"
FT   CDS_pept        complement(968291..970429)
FT                   /locus_tag="KLTH0E10758g"
FT                   /old_locus_tag="KLTH-ORF8781"
FT                   /product="KLTH0E10758p"
FT                   /note="weakly similar to uniprot|Q03780 Saccharomyces
FT                   cerevisiae YDR239C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10758g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23507"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI96"
FT                   /protein_id="CAR23507.1"
FT                   /translation="MSEHKARRNSFFFFSSSSKNEPKRGIQVGSLKPLDKYPLKHSQPK
FT                   PHSETETIIQKPLVSSGTRSDKKGETDRQPSIPSSGYRPARSSKMPLDAENQLSNMRRP
FT                   PPPPVDLKNTEPQSNKGTNTAEGKAAKTLRSEEPYNEDDISYQGHKRNKSELDQLMDEL
FT                   DHFEAQRRRNMEDDNSFEADAINHDIQTRNYAASDLDTDLESPIIDVKSLKLTDSRPHS
FT                   IRSTRSDHSLMQPNETNKPHLESSGDDQFSFADSQAESVREVDYVPFVNDESEEQMYPS
FT                   FGYSQDSQSSDAARSQRVRDYYRKLSEKKTQSSFDDDHSIGEKPRQLRVVNDHKPNFLM
FT                   HDESSNTEEESICYSAEEISPLPLKDASTAPAAVPASTAFSDPAIGTFEAKLSPNESRP
FT                   ASTPRSNSGDDINLGSAESASSTPTRTHNDNSAAFNSGTPTRTGTEKSVRLVSSYVEEL
FT                   RLKYFPTSNTLQPPPDLPFSLKTKNNLEQPQNIKVRIRTSSRQIGIKHGKAKQKLLSLE
FT                   TAKEEDSSVHGGLLADDDQQISTKVDHTREFRNLLGKNNGEPNQQGHVGASSESDDEEL
FT                   YLQNIPGDEAYDSDDVMAPLREKRGHSGITFDEDAQATGLNSGNNGRVGRSDTVTSYFT
FT                   RKTNRRRTGTLDMDYNYIPPIKNPSETEGALSRQYAEHNSDDGSSDDALSVQTSNSAYY
FT                   KHVYNGGLHITNKDPELD"
FT   gene            complement(<970692..>972044)
FT                   /locus_tag="KLTH0E10780g"
FT                   /old_locus_tag="KLTH-ORF8780"
FT   CDS_pept        complement(970692..972044)
FT                   /locus_tag="KLTH0E10780g"
FT                   /old_locus_tag="KLTH-ORF8780"
FT                   /product="KLTH0E10780p"
FT                   /note="weakly similar to uniprot|Q03782 Saccharomyces
FT                   cerevisiae YDR240C SNU56 U1 snRNP protein serine-rich has
FT                   no counterpart in mammalian U1 snRNP"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10780g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23508"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI97"
FT                   /protein_id="CAR23508.1"
FT                   /translation="MGVKKRPFSGGQGSRSNTKKPDVHESSSLLSIAEAVSQRNTNVTK
FT                   VIKKSQIFVSLTALEAKQLSRCKLEELANNQSLQLIEKEGNVSYLDFSNFSSLQLALVL
FT                   CSIFGIKSKQWLGKSTSDSRSIPRNIPLRGSFYIHKTCKVPRDHPESLKCGISVSRVVD
FT                   ITNFVEVSIDIYGATSFIEGLTRFASFLKFQKSENWVKSEFYEGLRNKWLVSEMSIAAV
FT                   PFLERGLLVNNNEIAKTNSALIEKTRKSLEGFAQDLIKNNNETPMEKRDESEAQGLTST
FT                   SISERKSSSNTSRYSVSTHDSATRSTKAGSGRTLDPQSRSLNSNFLTQEQITDYCKATI
FT                   QASIEAVKSKSPYQIIKTYIKCPRVYYVDLLYEHLNRLRSETNCNIVVLNLNNVHESTS
FT                   WFGSLKVSKFTSVSSIPHPSTVRVVSIGGIGEHNVKSLQLLLKLFEENPAA"
FT   gene            complement(<972349..>972798)
FT                   /locus_tag="KLTH0E10802g"
FT                   /old_locus_tag="KLTH-ORF8777"
FT   CDS_pept        complement(972349..972798)
FT                   /locus_tag="KLTH0E10802g"
FT                   /old_locus_tag="KLTH-ORF8777"
FT                   /product="KLTH0E10802p"
FT                   /note="similar to uniprot|P32495 Saccharomyces cerevisiae
FT                   YDL208W NHP2 Nuclear protein related to mammalian high
FT                   mobility group (HMG) proteins essential for function of
FT                   H/ACA-type snoRNPs which are involved in 18S rRNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10802g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23509"
FT                   /db_xref="GOA:C5DI98"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI98"
FT                   /protein_id="CAR23509.1"
FT                   /translation="MAKDKSATSEDNYEARLPAVLTFAKPLASKKLNKKVLKTVKKASK
FT                   AKNVKRGVKEVVKALRKGDKGLVVIAGDISPPDVISHLPVLCEDQSVPYIFVPSKQDLG
FT                   SAGATKRPTSVVFVVPGSSKKKDGKAKEEEYKEAFDDVVKEVKSL"
FT   gene            <973337..>975079
FT                   /locus_tag="KLTH0E10824g"
FT                   /old_locus_tag="KLTH-ORF8775"
FT   CDS_pept        973337..975079
FT                   /locus_tag="KLTH0E10824g"
FT                   /old_locus_tag="KLTH-ORF8775"
FT                   /product="KLTH0E10824p"
FT                   /note="similar to uniprot|Q05924 Saccharomyces cerevisiae
FT                   YLR361C DCR2 Protein involved in cell cycle regulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10824g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23510"
FT                   /db_xref="GOA:C5DI99"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5DI99"
FT                   /protein_id="CAR23510.1"
FT                   /translation="MRGVPKRYVRFFSYFALVVLSAVFIFTWFQTHHNALAKGFPLQPG
FT                   ELKRPIEFAGNNKEAVNILKAWYPDERFIVGMGMYTCVHLTKYLELCPRHVGGHTLATK
FT                   ALRTVIKKDINHSKGFKIVGFSNYLTYDSVTAAQLTELLSDTDARAAAVTAVAPSAEHL
FT                   VPDSSRLPLEYTVITEKSLTESDFVTEISVLFGEDCVDPRPAWRLSKEWRLEHSKVPCY
FT                   LTLRTRDSDPHGKKFPTLSASLENPFKIVQLADLHYSVGEGRCRDEFPKHENCIADPKT
FT                   LAFVEKVLDTEKPQLVVFTGDQIMGSECVQDSVTALLKVVDPIIKRQIPYAMVWGNHDD
FT                   EGSLDRWEISKLVQSLPLSLFKIGDHDTNDNSFGVGNYVHYIYGEDGNPLSALYFLDAH
FT                   KYSPNAKAYPGYDWIKEEQWNFFDGYKDAFVDQKASLSMAFFHIPLPEYLNVDSSSSPG
FT                   TQNPLIGNFKEGVTAPKYNSKGIATLRELGVKVTSVGHDHCNDYCLLEDSQSPAINERI
FT                   WLCFGGAAGEGGYGGYGGTERRIRVYQLDFSKRSIVTWKVLNSSPEAPFDHQTLVSAGV
FT                   PLIA"
FT   gene            <975499..>975587
FT                   /locus_tag="KLTH0E10846r"
FT                   /old_locus_tag="Klth0E.tTyr.GTA.15"
FT   tRNA            join(975499..975537,975552..975587)
FT                   /locus_tag="KLTH0E10846r"
FT                   /old_locus_tag="Klth0E.tTyr.GTA.15"
FT                   /note="tRNA-Tyr (GTA) cove"
FT   gene            <975831..>976856
FT                   /locus_tag="KLTH0E10868g"
FT                   /old_locus_tag="KLTH-ORF8772"
FT   CDS_pept        975831..976856
FT                   /locus_tag="KLTH0E10868g"
FT                   /old_locus_tag="KLTH-ORF8772"
FT                   /product="KLTH0E10868p"
FT                   /note="similar to uniprot|Q12046 Saccharomyces cerevisiae
FT                   YDL209C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10868g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23511"
FT                   /db_xref="GOA:C5DIA0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR032297"
FT                   /db_xref="InterPro:IPR034181"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="InterPro:IPR039173"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIA0"
FT                   /protein_id="CAR23511.1"
FT                   /translation="MVASKAWAERSAPVQISEAELPSSIPPQTGLTFNVWYNKWSQGNS
FT                   GQSRFVSPYRLDVDLHQGNTKGDKARQPFFCLYFCKGMCCMGKRCEYLHHVPDTEDIAR
FT                   LSLRSDVMDCFGREKHSHYREDMGGVGSFQKKNRTLYVGGITGALNNQQLKASQIENRL
FT                   RFSFGKLGPLERIRYVENKNCAFIKYKHQASAEFAKETMSNQTLLTPSDKEWVNRREGT
FT                   GLLVKWANDDPNPEAQRREKEQQDMESLQVMVDLLKKDSSEKRQPAPAESPSNKRLLES
FT                   SAEQESLNGDSIFGRLSNAKLSKLKRVKIEENLSKDSVEIDKQGCGQTPLVNYYSSDDD
FT                   E"
FT   gene            complement(<976948..>978717)
FT                   /locus_tag="KLTH0E10890g"
FT                   /old_locus_tag="KLTH-ORF8771"
FT   CDS_pept        complement(976948..978717)
FT                   /locus_tag="KLTH0E10890g"
FT                   /old_locus_tag="KLTH-ORF8771"
FT                   /product="KLTH0E10890p"
FT                   /note="similar to uniprot|P23394 Saccharomyces cerevisiae
FT                   YDR243C PRP28 RNA helicase in the DEAD-box family involved
FT                   in RNA isomerization at the 5' splice site"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23512"
FT                   /db_xref="GOA:C5DIA1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIA1"
FT                   /protein_id="CAR23512.1"
FT                   /translation="MSHFTYLEANVPHAKDQMRRPVDINKLISREGKRPSETAFGRPVY
FT                   LNKKKRIEAAADKEVHEIPKAAEDIQWIKAEKAKANEEPRTLGASNRGAGTKSGAYAQK
FT                   NRSKFRFDWSAEDDTTGEDAPVVSRKVRDAARKSPESLEEIYMGKHWSQKALEEMSERD
FT                   WRILREDYHIETKGGSIRHPLRNWTETNSIPTEIVGIIETKLKYLEPTPIQRATIPNVL
FT                   NGRDFVGVAATGSGKTLAFLIPPLCQLNNTPPLNDITKMDGPSALILAPTRELAQQIEA
FT                   EANKVVKFLHRPTKVVSLVGGHSVEEISYSLSHGCDILVATPGRLIDCLESNILVLQQV
FT                   RTLILDEADRMIDFGFEDQLTTILARTESVKGRQTMMFTATMSSTIERIANGYLNKPAY
FT                   VRVGSQDTKAQIKQVVQYLPSEEQRFSRLCRDVLPRFRSPIMIFINYKRTADWLAAKFS
FT                   SETRYRVTTLHGSKSQEQREHSLNLLRSGKADIMIATDVAGRGIDIPNVSLVVNFQMCT
FT                   SFEGYIHRIGRTGRAGKSGCALTFLTERDEPKVVEELFHYVKTTDTEGINDVEPAVRQK
FT                   FNLGRNELQPIVH"
FT   gene            <980341..>981681
FT                   /locus_tag="KLTH0E10912g"
FT                   /old_locus_tag="KLTH-ORF8769"
FT   CDS_pept        980341..981681
FT                   /locus_tag="KLTH0E10912g"
FT                   /old_locus_tag="KLTH-ORF8769"
FT                   /product="KLTH0E10912p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23513"
FT                   /db_xref="GOA:C5DIA2"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIA2"
FT                   /protein_id="CAR23513.1"
FT                   /translation="MGIFLERSRENLGSAIRDLRIAMSTSTGFSSGVLSDNNANGSATA
FT                   VATPKRAIDTNGNVFNVPDYSIKDILSAIPKECYKRDTLWSLHYVARDVAAIAVIGYVG
FT                   TNYIPVWFPDSSLLRAAAYSLQSFLIGLFGFGLWILAHECGHSAFSDSPAVNDTVGWVL
FT                   HSWWMVPYFSWKFSHSKHHKATGHMTRDMVFVPYTKEEYLETKNKSLLSEVVEEAPAVT
FT                   LFNLIAQQLGGLQLYLATNATGQPYPGVPKFFKSHYWPTSPVFDAKDFWYIILSDIGIA
FT                   STLTINYMWYRAYGAHVVLINWFLPWLWVNHWLVFVTFLQHTDPTMPHYDAEEWTFAKG
FT                   AAATIDRDFGFIGQHIFHDIIETHVLHHYCSRIPFYNARKATAAIKEVMGQHYRYESEN
FT                   MWKSLWKVARSCQFVESSENNGVYMFRNTNKVGVAPHKGPSSNVPLE"
FT   gene            <981831..>983537
FT                   /locus_tag="KLTH0E10934g"
FT                   /old_locus_tag="KLTH-ORF8765"
FT   CDS_pept        981831..983537
FT                   /locus_tag="KLTH0E10934g"
FT                   /old_locus_tag="KLTH-ORF8765"
FT                   /product="KLTH0E10934p"
FT                   /note="similar to uniprot|P35056 Saccharomyces cerevisiae
FT                   YDR244W PEX5 Essential for import of proteins with SKL-
FT                   like import signal into peroxisomal matrix 69-kDa protein
FT                   containing tetratricopeptide repeat (TPR)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10934g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23514"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIA3"
FT                   /protein_id="CAR23514.1"
FT                   /translation="MSADCSVGSNPLASLNKHAQQDRSLHHGGGLRLNNEAAQRFKSQD
FT                   SVVSDASRARMEAFMDQEHMDHPMMLKGPRPMLSRPLQESSQQARESWGKQFSSSPALS
FT                   MNQSPELHSPTSQVPSIAYQKGLPAGNTEGSQVMRARVVGPRYGPGLASGMFNPMSHQT
FT                   AQQPVYRHSSPQSHMSMNQESWDEQFKELEKEVSEKLALHEEEVKPQAAAAEQDVVEDQ
FT                   YQAEFQEVWDNLQEESQIPDAGGDVETDWQREYQQYISGRPSDTTQYRFETENQYLHNS
FT                   NAYEIGCILMENGAKLSEAALAFEAAVQEDPSHVDAWLKLGMVQTQNEMEYNGIGALEE
FT                   CLRLDPRNLDGMVTLAISYINEGYDVSAFKMLNKWLETKYPDMVAPNEALEKSTDRYSM
FT                   NQAITLRFLQVVNKLPQVDASLQLGLGILFYSNDDYDKTVDCFRAALAVKPDDELMWNR
FT                   LGASLANSNRSEEAIQAYRKALQLKPTFVRARCNLAVSCMNMGCFKEAAEYLLTALSMH
FT                   EVEGILPSETPASSNLIETLKRAFIGMERRDLLEEVRPNMDLAPFRNEFNF"
FT   gene            <983664..>984677
FT                   /locus_tag="KLTH0E10956g"
FT                   /old_locus_tag="KLTH-ORF8764"
FT   CDS_pept        983664..984677
FT                   /locus_tag="KLTH0E10956g"
FT                   /old_locus_tag="KLTH-ORF8764"
FT                   /product="KLTH0E10956p"
FT                   /note="similar to uniprot|P50108 Saccharomyces cerevisiae
FT                   YDR245W MNN10 Subunit of a Golgi mannosyltransferase
FT                   complex also containing Anp1p Mnn9p Mnn11p and Hoc1p that
FT                   mediates elongation of the polysaccharide mannan backbone
FT                   membrane protein of the mannosyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10956g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23515"
FT                   /db_xref="GOA:C5DIA4"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIA4"
FT                   /protein_id="CAR23515.1"
FT                   /translation="MSSSMPYDPSFEDEKKRQYSYKHRSFLDRVGATIAQHKRAVLGIF
FT                   CAFFVLFWFGSSRFTLWSKDPKIVLILAVNDGGGVHKWKGEQEWAIERISIQNKRAYAK
FT                   RHGYGLTLKDMRTARRYSHEYREGWQKVEVLRQTMREFPKAEWFWWLDLETLIMEPQIS
FT                   LEEHIFKRLDSLSYRMLDKFNPLDLPLDIPYVDYSQPPELLITQDCGGFNLGSFLVKNS
FT                   KWAHLLLDVWWDPVCYEQKHMMWEHREQDALEALYANQPWIREKTAFLPLRSVNAFPPG
FT                   ACSEFSDDPRYFYSEEDRDFVVNMAGCAFGRDCWGEMQRYGSLLESHNQKWWRRFY"
FT   gene            <984997..>988311
FT                   /locus_tag="KLTH0E10978g"
FT                   /old_locus_tag="KLTH-ORF8763"
FT   CDS_pept        984997..988311
FT                   /locus_tag="KLTH0E10978g"
FT                   /old_locus_tag="KLTH-ORF8763"
FT                   /product="KLTH0E10978p"
FT                   /note="some similarities with uniprot|P09547 Saccharomyces
FT                   cerevisiae YPL016W SWI1 Global transcription activator that
FT                   acts in complex with Snf2p Snf5p Snf6p and Swi3p to assist
FT                   gene-specific activators involved in the regulation of
FT                   expression of many genes including ADH1 ADH2 GAL1 HO INO1
FT                   and SUC2 Zinc-finger transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E10978g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23516"
FT                   /db_xref="GOA:C5DIA5"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR036431"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIA5"
FT                   /protein_id="CAR23516.1"
FT                   /translation="MDNQYIGGQESQEQDEYLNFLDPRPLQENTNALTPQVILARSTMS
FT                   NAASPNVQSVSPASMFSPMAQSQPMPTASPQQVLNAGTTPQQVLTQAASSQQVKNQAPT
FT                   PQAILSNHNTPQIQEQQLNNSNATPNNAFADRAAMFVALQQRQQQQRQKLQMMQQAAPR
FT                   ASSPQSALHQRPSVGSQSQPSPVGPVPQAQGGSGTNMPPMQQRQAIQNLDPEVQRRVSG
FT                   ELNNKQYELFMKSLLESCKRRNAPLHALPEIQGRRVNLFVLYMMVQKLGGGESVTRFQQ
FT                   WPMLVQKLQLPQDSSQQLATLYYHILLPYEQYLASPEGIKETQSKRIFLQQFLQELLKK
FT                   ILGSNPNIQPDVPTGVPPNIQASPQVNMQTNIQTNDSSISGYSTPNSTEMQEPNKVRKP
FT                   RKPKVKKKSKKDLEREMKYQQEQLQRQHQLQQEQQSKLIAEQRFKQQQEQLRLQQQQAL
FT                   RQNLEYQKLPKVYKRSFARNYVPFTRPIETSNGYDIRAISQIGEKIDANKPVFLFAPEL
FT                   GTINLHALSLSLLSDCLSEINVALNILLVTSADAVLKISLERFEGLIDSLTILGCRILN
FT                   KLCLPSISSFDQGSGYLEEYDVGNMLDQNTTYSQATAALEAIHRKTVNEKNDTEGFKIK
FT                   VDSLTGVDLEQAMLTPEQTPLDPTGFERREEEVETKESFQNEWDYLPEPLWVSDNLEGC
FT                   TLNVPSYLSSLRDVRDEIDTIFTKVNERGAENPQLLLVDQLSTISMILRNLSFNETNTS
FT                   PIANNVPFKRFLTDLMWALLLHSDRFVFHRKRLNFKKDIIITLANIAHIFKLENHVSAC
FT                   LLLLLIISLGEKNTELGQEESLKFPENSVQLSKYQSFGVDVLAKILSLGYPNRFLIKCV
FT                   LLQQFEPDSQSQVVETCQKLIELYGSIATQPLGNLSLLNDIFASLISIIPFQQLNMSPT
FT                   LIEDASPTISQSITALLSLVRLIKKEDMPCTASNLPLLWLTSEENIGSSLRRLSEALSN
FT                   IGIHTNNNLSHLKLLFNSISTKSLQLVCLLIEKSLELAAQNDNAEGGATYLAAAKELNG
FT                   IPNLLPSEPNAFSLLTNPMADFGVATGMGTLYRLRNQLIATDFQQCVDADVHDANK"
FT   gene            complement(<988370..>991429)
FT                   /locus_tag="KLTH0E11000g"
FT                   /old_locus_tag="KLTH-ORF8761"
FT   CDS_pept        complement(988370..991429)
FT                   /locus_tag="KLTH0E11000g"
FT                   /old_locus_tag="KLTH-ORF8761"
FT                   /product="KLTH0E11000p"
FT                   /note="similar to uniprot|P06777 Saccharomyces cerevisiae
FT                   YPL022W RAD1 Single-stranded DNA endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11000g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23517"
FT                   /db_xref="GOA:C5DIA6"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR006167"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIA6"
FT                   /protein_id="CAR23517.1"
FT                   /translation="MSLFIRDESDEEDLVLELSRHEEDRSKQIDDASNGEMLYPLLPDD
FT                   GDSHMRPNIEEIRPVDIQLSLPLPFQQMIVEDLLVSEDSLLILGKGLGIEPIVANLLHV
FT                   LATPTRINGQDKRSLVLLLNASEEDNEKILEELLELAWSGTEEDGQRPFSVVTADLLTV
FT                   DQRRRLYLHGGIVSVTSRILIVDLLSGIIHPNKITGLVILHVENLHNYSNESFIAEMYR
FT                   SVNRWGFIKAVSDEPEAFMTEFSPLKRKLKDLRLKRTLLWPRFHVEVSSSLNVRNENKV
FT                   IEVKVSLTNSMSQIQFGLFECLKKCIDELNRKNPTLSLESWNADNCLHPNFFRSLYSVL
FT                   TPNWHRISFESKQLVKDIGTLKKLLHALVSYDAVDFYEIIQVILDANKPSVSRKYSESP
FT                   WLMAEESQAVLSYAKKRVFSDGNYELEELPKWEQLTSILDDIAVEQAKLGSSLGPTLIM
FT                   CSEDRTCRQLRKIIGYSNRKEGARRFMLNKLRAYMNRRDLLKKTAEDIQEESRKEGTSA
FT                   ELSVSRSFAKEEVASKRRRTRGAASVAAVTRLKRATSNGGEDIESVMSVDDIEQHISQI
FT                   IEDTDEGLIGDQEIDNLAQNFDEDNELLLTEETNIDTSELEPMIKNENTWAYGQNNFEY
FT                   IDRGDQIVIEKFYNRANDVLLQELLPSHIIMYEPDLAFIRRVEMFKALHKDWPLKVYFM
FT                   YYGDSFEEQSHLIAIKKEKDAFTRLIREHSGLAQHFEADEDLSRYKNLAQRKLLLNQSL
FT                   RNSRLAGGQKGYDAVTGDVVVVDMREFRAPLPGLLYRYGVKVIPCMLTIGDYILSPQIC
FT                   VERKSISDLIGSFKNGRLNDQCKKMSRYYEYPTLLIEFDDGDSFSLEPFSEKRYNSASS
FT                   TSHPIGSKLMQDEIQMQLAQLIMKFPSLRILWSSSPLQTVNLILDLKLGREQPDPTTCV
FT                   EIGVNRKSSGAKDKTNHSNEKFKELLSIPGLSNVDYYTIIRRVKRFTNLQKLSVDQITD
FT                   LVNDKNLAERIWHYVQTENEEKDNDIMLEE"
FT   gene            <991530..>993512
FT                   /locus_tag="KLTH0E11022g"
FT                   /old_locus_tag="KLTH-ORF8758"
FT   CDS_pept        991530..993512
FT                   /locus_tag="KLTH0E11022g"
FT                   /old_locus_tag="KLTH-ORF8758"
FT                   /product="KLTH0E11022p"
FT                   /note="similar to uniprot|P46151 Saccharomyces cerevisiae
FT                   YPL023C MET12 Isozyme of methylenetetrahydrofolate
FT                   reductase catalyzes the reduction of 5 10-
FT                   methylenetetrahydrofolate to 5- methyltetrahydrofolate in
FT                   the methionine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11022g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23518"
FT                   /db_xref="GOA:C5DIA7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIA7"
FT                   /protein_id="CAR23518.1"
FT                   /translation="MHAPRKLNKCGQGTALKLIMSTIKQRYESTDGPFISLEFFPPKTK
FT                   LGKQNLTARMTRMTALNPLFITITWGAGGTTAKKTLELATVAQRELNVPVCMHLTCTNT
FT                   NKEIIDEALKLAHEADIRNILALRGDPPVGEEWETPSESSEFQHAVDLVRYIKEKYNDD
FT                   FCVGVAAYPEGHCEGEADGVAQDPRRDLGFLKEKVDAGADFVITQLFYDVEKFLSFEQM
FT                   FRNEVSADIPLFPGLMPINSYLLFNRAAKLSHASIPQAIRDRLPQEYHSDDNKVRAIGV
FT                   DILVEMVEEIYKRTEGRIKGIHFYTLNLEKAIAQIVTKSPSLSKILEEDKEDDLVEGVG
FT                   EIALVDGNTLEEDENVKKRRRQSSHNDDLTCNRVLLDEAGKSIASGRESSGAPSRKVVI
FT                   SISQGSGALGKDATWDEFTNGRFGDSRSPAFGEIDGYGPSLKVSSKKAYEIWGQPSSTD
FT                   DIKTLFIRYLEGSLEALPWSDLGLSAETALIQEELIQLNERGYLSLASQPATNSTPSTD
FT                   KIFGWGPPGGYVYQKSFVEMFVHKQQWELEIKPKLEPLGSKVSYYVGDSAETFYTNLDS
FT                   SCSSVVTWGVFPNSEVLQTTIVEEESFKAWRDEAFSIWLEWSKLFPRNSRSNTLLKQMH
FT                   RDYYLVSIVHHDFSDCDALWDLLLA"
FT   gene            complement(<993574..>994401)
FT                   /locus_tag="KLTH0E11044g"
FT                   /old_locus_tag="KLTH-ORF8756"
FT   CDS_pept        complement(993574..994401)
FT                   /locus_tag="KLTH0E11044g"
FT                   /old_locus_tag="KLTH-ORF8756"
FT                   /product="KLTH0E11044p"
FT                   /note="similar to uniprot|Q02685 Saccharomyces cerevisiae
FT                   YPL024W RMI1 Protein of unknown function GFP tagged protein
FT                   localizes to the cytoplasm and nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11044g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23519"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="InterPro:IPR042470"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIA8"
FT                   /protein_id="CAR23519.1"
FT                   /translation="MFLQEGECLFSETSSHITLQAKTISQGSREKHHWRFRFCSAMSNN
FT                   LLIADITQPVNISPSNSSTNERVKLMTDAYNNPVWSDRDIGDQKMVKVQEPLLFQVCMV
FT                   ENIWRSKLSQLDDLKVRIDPRNQRIDRLSTSKKAPNAAQAGRTSGNQLITAMDVDSDVP
FT                   ADLTQSAPDKSMFKLTLQDKSGAMYFAINLSPLNFLKNDGNSCILGSKAVILPGAVFNR
FT                   GAFLLRDNNVVFMGGIIKQWNDGRDYKLVEYLESELQSQGLSAQSRKRKTPAS"
FT   gene            <994414..>994989
FT                   /locus_tag="KLTH0E11066g"
FT                   /old_locus_tag="KLTH-ORF8754"
FT   CDS_pept        994414..994989
FT                   /locus_tag="KLTH0E11066g"
FT                   /old_locus_tag="KLTH-ORF8754"
FT                   /product="KLTH0E11066p"
FT                   /note="similar to uniprot|Q03784 Saccharomyces cerevisiae
FT                   YDR246W TRS23 Component of the targeting complex (TRAPP)
FT                   involved in ER to Golgi membrane traffic"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11066g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23520"
FT                   /db_xref="GOA:C5DIA9"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIA9"
FT                   /protein_id="CAR23520.1"
FT                   /translation="MAIQTILVINKSGGLVYQRDFIKTGAKLSSNEYLILAGTLQGVVA
FT                   IASQVTPKALQISAKTGSKTANEPSQLIPYVGSLGAPAQNLSDMGSFMGQDFFNESFPS
FT                   WNQSGLKHVTTDQLSMFLYQTLTGLKFVAISTQSTTNAMAVSIAENLLRKAYCLYADYV
FT                   MKNPFHDPEMPIKCELFDTHLAELVGQL"
FT   gene            <995403..>996608
FT                   /locus_tag="KLTH0E11088g"
FT                   /old_locus_tag="KLTH-ORF8752"
FT   CDS_pept        995403..996608
FT                   /locus_tag="KLTH0E11088g"
FT                   /old_locus_tag="KLTH-ORF8752"
FT                   /product="KLTH0E11088p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11088g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23521"
FT                   /db_xref="GOA:C5DIB0"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIB0"
FT                   /protein_id="CAR23521.1"
FT                   /translation="MKLRTVCSALWAASLAAANPISRKESNATASVSSYSQTASIADAA
FT                   STTDTIFSVPQGRYGALFKPKVMVVNMYYKEEDAWIRNLDLMHNISVPLLSPEYPYVHS
FT                   NDNFTIMSVTTGEGEINAATTIAALCMSPLLDLTETYFLISGIGGGSPQHTTIGSVTFA
FT                   KYAVQVGLQYQIDSREIPANWTYGYVNFKTSQPNVYPATVYGTEIFELNENLMNRAMHL
FT                   ASNVTLQNGTTGNVSFRQRYNASMAAYGAPKLVACDTATSDVYWSGEILEHAMSDFVTT
FT                   ISNKTATYCSTQQEDNASLESFLRAAKHGLVDYNRIVLTRGISDFDRAPNGLNATEFFF
FT                   GGKNLQGGATATFTNLYLAGLPFVQDVVANWDTLYKENNFMPKNYIGDYFETLGGVKNF
FT                   GL"
FT   gene            <997486..>998847
FT                   /locus_tag="KLTH0E11110g"
FT                   /old_locus_tag="KLTH-ORF8740"
FT   CDS_pept        997486..998847
FT                   /locus_tag="KLTH0E11110g"
FT                   /old_locus_tag="KLTH-ORF8740"
FT                   /product="KLTH0E11110p"
FT                   /note="similar to uniprot|Q12505 Saccharomyces cerevisiae
FT                   YPL026C SKS1 multicopy suppressor of snf3 and grr1 mutants
FT                   serine/threonine protein kinase homologous to Ran1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23522"
FT                   /db_xref="GOA:C5DIB1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIB1"
FT                   /protein_id="CAR23522.1"
FT                   /translation="MLTNCQINNFKLNRQIGSGAYGLVFHAVDVITENEYAIKAVVKNP
FT                   AAGATPEIKRSTMLQTQLYYYFKSFQNRLFLPSIDLDSIRGLSEEQLERAPHFREIAMQ
FT                   LRVHAHPNVVTVHQVLESPLATFLVMDYYSRDLFTSIVDDQHFAGSGQLVKKVFLQLCS
FT                   VLQHCHARGVYHCDIKPENILLDAEDNALLCDFGLSTLAERLPANACVGSSYYMAPERI
FT                   SCPSSVQAAGAADDAGAASAPALFPTMAGDVWSLGVILINLTCIRNPWLKAHQLEDNTF
FT                   GYFVRDPHVLFKILPVSQQLFDILMDILRLNPAERAPLSEIMDRVADCTSFTTSGPLSK
FT                   VEPLSQYERQQFLITQKGLSIRQMLHHFHTDDESYKHVSPEEDETEFTSEDECYRQLSS
FT                   VDTTPTGSVDVDQTSRAKRSNDAVLPSEFKVRYLTTNMSTITNYSSHSRWLPQY"
FT   gene            complement(<999078..>999644)
FT                   /locus_tag="KLTH0E11132g"
FT                   /old_locus_tag="KLTH-ORF8734"
FT   CDS_pept        complement(999078..999644)
FT                   /locus_tag="KLTH0E11132g"
FT                   /old_locus_tag="KLTH-ORF8734"
FT                   /product="KLTH0E11132p"
FT                   /note="similar to uniprot|Q03786 Saccharomyces cerevisiae
FT                   YDR248C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23523"
FT                   /db_xref="GOA:C5DIB2"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIB2"
FT                   /protein_id="CAR23523.1"
FT                   /translation="MTVSTSKPKVIVLAGTAGTGKSTIAAKLVEVYQSKHPDVEFLEGD
FT                   SIHPPENIAKMSHGIPLTDEDRWGWLSKVGELSSDSAQKHSGLAIVTCSSLKKKYRDYI
FT                   RDENPGTNFHFLFLYGDRLLILDRANKREGHFMKANMINSQFSDLELPKADEKDAAVVD
FT                   VDGKDVQQVLDECVAALATFANPSQ"
FT   gene            complement(<999926..>1001116)
FT                   /locus_tag="KLTH0E11154g"
FT                   /old_locus_tag="KLTH-ORF8733"
FT   CDS_pept        complement(999926..1001116)
FT                   /locus_tag="KLTH0E11154g"
FT                   /old_locus_tag="KLTH-ORF8733"
FT                   /product="KLTH0E11154p"
FT                   /note="highly similar to uniprot|P41338 Saccharomyces
FT                   cerevisiae YPL028W ERG10 Acetyl-CoA C-acetyltransferase
FT                   (acetoacetyl-CoA thiolase) cytosolic enzyme that transfers
FT                   an acetyl group from one acetyl-CoA molecule to another
FT                   forming acetoacetyl-CoA involved in the first step in
FT                   mevalonate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23524"
FT                   /db_xref="GOA:C5DIB3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIB3"
FT                   /protein_id="CAR23524.1"
FT                   /translation="MSDKVYIVAAARTPIGCFLGGLTSKTYVDLGSTAVAGALAQVPEI
FT                   KPNDVEEIFFGNVLSANVGQAPARQVALASGLGKHIVATTVNKVCASGMKAIICGAQTI
FT                   KCGNADIVVAGGAESMTNAPYYMPAARGGAKFGPSTLVDGIQRDGLNDAYDNQAMGVHA
FT                   EKCARDYQITREQQDEYAIGSYQKAQKAQAEGKFDREIVPVTIKGFRGKPDTYVQKDEE
FT                   PSKLNVEKLKSARTVFQKENGTVTAPNASPINDGGAAVVLVSERKLKELGLKPLALIKG
FT                   WGEAAHEPEDFTWAPSLAIPKAIKHAGVQLDEIDYFEFNEAFSVVGIANPKILGIPLEK
FT                   VNPYGGAVAIGHPLGCSGARIVVTLISVLTQENAKLGAAGICNGGGGASSIIIERV"
FT   gene            complement(<1001391..>1003625)
FT                   /locus_tag="KLTH0E11176g"
FT                   /old_locus_tag="KLTH-ORF8731"
FT   CDS_pept        complement(1001391..1003625)
FT                   /locus_tag="KLTH0E11176g"
FT                   /old_locus_tag="KLTH-ORF8731"
FT                   /product="KLTH0E11176p"
FT                   /note="similar to uniprot|P32580 Saccharomyces cerevisiae
FT                   YPL029W SUV3 ATP-dependent RNA helicase component of the
FT                   mitochondrial degradosome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23525"
FT                   /db_xref="GOA:C5DIB4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIB4"
FT                   /protein_id="CAR23525.1"
FT                   /translation="MGLLRLRQFSLKGLTAHFAASYRVYHQAAGWKKLERTEAPWGKPS
FT                   FIHLPPNERKNPNYISLAFAKKVDNIYTQDQEFKRCLDSSLRWVFDNKLKAFKTPENEA
FT                   KCFAWLRLREHLYVQLRDNVIDKRIASYSGSISDSFLPSSPSNLVAQLVNCDKVADNQW
FT                   RAILNQETFGRYEKFNHILSKIYDFILHQEILPATIPITSSVNKTEDVDISNPAEWFPE
FT                   ARKWRRKIIMHIGSTNSGKTYRALQRLKQCDRGYYAGPLRLLAREVYERFKNEQIKCNL
FT                   LTGEEVIEELDEMGNPAGLTSGTVEMVPLSQKFDVVVLDEIQMMGDPDRGWAWTNALLG
FT                   SIAREVHLCGEKSALPLVQKITKMTGDELIVNEYERLGELRIEENALKDGLKGLRKGDC
FT                   VVAFSKKRILDLKLQIEKQTDLKVAVVYGSLPPETRIQQANMFNSGEYDVLVASDAVGM
FT                   GLNLSIERVIFTTHMKFNGQEMMELTSSNVKQIGGRAGRFKVSRTPANSVDGGKKASVG
FT                   LVTGVDTKVLAAVKSGMEAPIEYLQSAVVWPTDEICGKLMTHFPPGTQVSELLQTLAAD
FT                   VEKRSAKLFTLSDLKNRLNSISLFEHMEGIPFFEKLRLSNAPVKDFPTVKKAYVQFCRT
FT                   IEQRQTKSLLSYPFSFSILDPRYINSDKYSLEHYESLHNIIMLYFWLSNRYPNYFIDQQ
FT                   SARELKDMCEMIIFEKLDRLKRNPYMRGASTTGASHRSSRGFKPTSVRRK"
FT   gene            complement(<1003858..>1005456)
FT                   /locus_tag="KLTH0E11198g"
FT                   /old_locus_tag="KLTH-ORF8730"
FT   CDS_pept        complement(1003858..1005456)
FT                   /locus_tag="KLTH0E11198g"
FT                   /old_locus_tag="KLTH-ORF8730"
FT                   /product="KLTH0E11198p"
FT                   /note="similar to uniprot|Q2XN15 Saccharomyces cerevisiae
FT                   YPL030W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23526"
FT                   /db_xref="GOA:C5DIB5"
FT                   /db_xref="InterPro:IPR011671"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIB5"
FT                   /protein_id="CAR23526.1"
FT                   /translation="MQKPLEFGALEPSLLGHEWHCMYRTVEPVDFRKSHFETAMLNVIR
FT                   HPNINSTVILRADMLREWEFDFVNGREIKFQEEVHNVTDPDTQVINIDDFSVRDVAVAS
FT                   NLGLAKKMAMVRRIIPRNPYKDAIINQTCLVLNSTENSETSLIVYTPHLDSKELCPFYI
FT                   PHVKAVAILLHQSQLSVHYIPFTDPDVPEIQDESERVVRTARRLLQTALKHSHGVKLGY
FT                   EKKVAHDVVVDKVLFQDRYIALKKKYSRFLVDNWAESTDPTKHVFEDIAIAAFLIELWV
FT                   KTYGEKFKDNVQFRDLGCGNGVLCYLLICEGIKGMGIDARQRKSWKIYPPEVQKCLKEQ
FT                   VIIPSVLLRPHPEVKKRAPELQHNGRFFPIKIQDKIAPATVVYSSEDLLKSPSVNVTEF
FT                   PRDTFLIGNHSDELTCWIPLLGYPFVVIPCCSHNFSGQRIRYGVRKGHARNGNSTYAGL
FT                   VDRVEAVATRVGWDIAKEMLRIPSTRNAAIVGTNNPDLAQWPTQEVYDTILEDGGADGW
FT                   IENTMALTKKSPRAH"
FT   gene            <1005953..>1006931
FT                   /locus_tag="KLTH0E11220g"
FT   CDS_pept        join(1005953..1005969,1006040..1006931)
FT                   /locus_tag="KLTH0E11220g"
FT                   /product="KLTH0E11220p"
FT                   /note="highly similar to uniprot|P17157 Saccharomyces
FT                   cerevisiae YPL031C PHO85 Cyclin-dependent kinase with ten
FT                   cyclin partners involved in environmental stress response
FT                   in phosphate-rich conditions Pho85p-Pho80p complex
FT                   phosphorylates Pho4p which in turn represses PHO5"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23527"
FT                   /db_xref="GOA:C5DIB6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIB6"
FT                   /protein_id="CAR23527.1"
FT                   /translation="MASSSQFKQLEKLGNGTYATVYKGLNKTTGIYVALKEVKLDSEEG
FT                   TPSTAVREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYG
FT                   FEMSLVKYFEWQLLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVN
FT                   TFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGRPLFPGTNDEEQLKLIF
FT                   ETMGTPTERTWPGVSTLPKYNPRLPQHLPKDLGALLQSQTREKMELTLIDLLYGLLQLN
FT                   PDRRLSAKQALNHPWFAEYYQ"
FT   gene            complement(<1006981..>1008075)
FT                   /locus_tag="KLTH0E11242g"
FT                   /old_locus_tag="KLTH-ORF8727"
FT   CDS_pept        complement(1006981..1008075)
FT                   /locus_tag="KLTH0E11242g"
FT                   /old_locus_tag="KLTH-ORF8727"
FT                   /product="KLTH0E11242p"
FT                   /note="weakly similar to uniprot|Q03787 Saccharomyces
FT                   cerevisiae YDR249C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23528"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIB7"
FT                   /protein_id="CAR23528.1"
FT                   /translation="MGYVTAGYPSRPHKRVKKQERRVYYDRKRLKVNEIDERRDLQLRD
FT                   RLRGPASLQLLPTDVLERIFTLAGRENSMPVLNRFFQRCLRPTRYLVSRFILENYTQDL
FT                   NSLLPRDSPVLLVLLDVTFRNGTLLQFLNENPQFLDCVHDAVVSPDQADELSRERRILL
FT                   EQGRLEDINALHWQTEMHPESNKPMREFPAAFYQRPALFFENEISKRPVTYNQLLLRLQ
FT                   SSYAIQQPAWVCDLLIEWFFLENENFDINHLFHAVNLVLHLSVNDRPRFEDVSPLTKLI
FT                   TYMYLDVTDHLLQLLLCENLEDVGLIRERKVKIVNKFIRKFYRGSTELLSTDELWMTVH
FT                   EVKDRRLVESISDYGGKPSFNVVK"
FT   gene            <1008309..>1010897
FT                   /locus_tag="KLTH0E11264g"
FT                   /old_locus_tag="KLTH-ORF8726"
FT   CDS_pept        1008309..1010897
FT                   /locus_tag="KLTH0E11264g"
FT                   /old_locus_tag="KLTH-ORF8726"
FT                   /product="KLTH0E11264p"
FT                   /note="similar to uniprot|Q03088 Saccharomyces cerevisiae
FT                   YPL032C SVL3 Protein of unknown function mutant phenotype
FT                   suggests a potential role in vacuolar function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery cytoplasm bud and bud neck"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23529"
FT                   /db_xref="GOA:C5DIB8"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIB8"
FT                   /protein_id="CAR23529.1"
FT                   /translation="MSSLRVLAVGNNCNVMLYAWRIQQSKSVKLVHVGDTESGDITIET
FT                   SQYGNERFRFPSHYADVKQLVSGKQAETFDLVIMSAASLQEMSSLAAQLNPMLTPNTKI
FT                   LVESTGFVHLEPFVKMSIEFSQLKVFSVMTDIDFRQIGPSHYRQYNAHGPSTFYLGESG
FT                   VKSSVSSTSDGKYPKESIALLETFKRLFMKLFPQDQVDDCNHSYLDFLSQQWKLALPRI
FT                   CFDPLLILLENSRPQELNDQILAKPLISGLVTEIITVTKTMGAKLPAGFDNENDLLIHW
FT                   LKTNGNEIPQLAFHFLRRTAPLNTDMLLLQPILLADDYGIKTPYLEFLYSMMCQYQKLN
FT                   SGESKWFCRSDVPTELMRKVSKLEGESGELKAALKAAHEALEGTKRRYADGLGVKAEQE
FT                   NHMKSEIANLQRHIAKLNSDLKEEQQKVVVANSQRQQFQKEQTPVNTIPSEPNYTTTGT
FT                   PIIPDLEDLAAYGVQYDATPPHSKPEAKSPEMQVAAPENPPTSQDENQTLLRERELELH
FT                   KKELELQEKELELQRRAAARPRPTKFHSGPPSTMPHMQSAPNGHAPRKPSVPQLTGRNS
FT                   RQMHGAAPVVSPGLVDPVSSLHNGNSTASMMQQPMHMPGGPHAHHPHQFKTTSRKNRRS
FT                   NMPNLRHASSVDVLSMSGSGTAPPGAANLSGVTNSGTKLNSMVGSGPPPVVLNRFQNGS
FT                   GLQMNNSTNAHTPVSGPAFALGGPANQQRQVSTSTVIAEGHPNANTSTHSVVHNPVAQI
FT                   VVNGTSSGSSTSNGSTPIMAVNDNANVSHPPALSMMQPGEVTNGQPNGYSNGYSNGHTS
FT                   GLSNGHSDDLGNDDGASPSSEFDISSVDTGRKKSKFGLFGKKDKKKKGKK"
FT   gene            complement(<1011171..>1011244)
FT                   /locus_tag="KLTH0E11286r"
FT                   /old_locus_tag="Klth0E.tIle.AAT.21"
FT   tRNA            complement(1011171..1011244)
FT                   /locus_tag="KLTH0E11286r"
FT                   /old_locus_tag="Klth0E.tIle.AAT.21"
FT                   /note="tRNA-Ile (AAT) cove score=71.40"
FT   gene            <1012290..>1012778
FT                   /locus_tag="KLTH0E11308g"
FT                   /old_locus_tag="KLTH-ORF8723"
FT   CDS_pept        1012290..1012778
FT                   /locus_tag="KLTH0E11308g"
FT                   /old_locus_tag="KLTH-ORF8723"
FT                   /product="KLTH0E11308p"
FT                   /note="similar to uniprot|P40314 Saccharomyces cerevisiae
FT                   YDR252W BTT1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23530"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="InterPro:IPR039370"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIB9"
FT                   /protein_id="CAR23530.1"
FT                   /translation="MPIDQEKLAKLQKLSAANKVGGTRRKFAKKTGSSAGGNKDDTKLQ
FT                   AQLAKLRAVTVDQVEEANFFKEDGKVLHFSKVGVQNAPQHNTSVFYGIPQEKSLNELFP
FT                   SIIPQLGEESINALTQLASQLQGAQGAQGAAGATEGGDEKADADIPELTGQDFEADVE"
FT   gene            complement(<1013019..>1013618)
FT                   /locus_tag="KLTH0E11330g"
FT                   /old_locus_tag="KLTH-ORF8720"
FT   CDS_pept        complement(1013019..1013618)
FT                   /locus_tag="KLTH0E11330g"
FT                   /old_locus_tag="KLTH-ORF8720"
FT                   /product="KLTH0E11330p"
FT                   /note="similar to uniprot|Q12041 Saccharomyces cerevisiae
FT                   YDR253C MET32 Zinc-finger DNA-binding protein, involved in
FT                   regulating expression of the methionine biosynthetic genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23531"
FT                   /db_xref="GOA:C5DIC0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIC0"
FT                   /protein_id="CAR23531.1"
FT                   /translation="MSEDAVFFQQAAEAIVATSLKSANVDPTIRELLNRIKYVDPNKTR
FT                   AQVPPQIMSENKSVLNYFDQLLNNVESLSGTESAPQGEKPGSKKRRRSEGPENSGKDDL
FT                   KVNTSVEDDAGAKKFPCGKCDLVFRRSSDLRRHERAHLPILPNICSLCGKGFARKDALK
FT                   RHFDTLTCKRNREKLLSIGGDINEILEKARLNGANV"
FT   gene            <1014490..>1017447
FT                   /locus_tag="KLTH0E11352g"
FT                   /old_locus_tag="KLTH-ORF8718"
FT   CDS_pept        1014490..1017447
FT                   /locus_tag="KLTH0E11352g"
FT                   /old_locus_tag="KLTH-ORF8718"
FT                   /product="KLTH0E11352p"
FT                   /note="similar to uniprot|P48526 Saccharomyces cerevisiae
FT                   YPL040C ISM1 Mitochondrial isoleucyl-tRNA synthetase null
FT                   mutant is deficient in respiratory growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23532"
FT                   /db_xref="GOA:C5DIC1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIC1"
FT                   /protein_id="CAR23532.1"
FT                   /translation="MVAPSLRSCSQHVYQKTLCLPKTKFANRSNLQKTFDLLVPQSSKD
FT                   VYRKQLDRFLAEAHKLDPAKRSEFVKNRLFVLHDGPPYANGDLHLGHAMNKTLKDIINR
FT                   YQLLKGKFIYYKPGWDCHGLPIELKALQKLGKDGSNMLPTKIRRVASQHAQKTIKSQKE
FT                   QFQQFAILTDWEDRYETMQKSFELNQLGVLKEMIRVGLIKRQNKPVYWGSETRTALAEG
FT                   ELEYNDNHVSTSAYVKLPFASKSADAVRRHYSLNSDIPLSFLIWTSTPWTLFSNQAICY
FT                   NEKFSYGIYKVEGEYLVVESGLKEALLQPEHKATAMLTGKELQGLKYTIPFLGNDEKPL
FT                   LHGEHVTKLSGTGLVHTAPGHGFDDYLIGITNKLEVFSPVDDEGRYKLELLPQELHKDL
FT                   IEPETGLPRRVLSEGTTKTILKLLTKQGLLLKAEKYVHSYPYDWRSKKPVLIRATPQWF
FT                   ADLTDVKKSALESLENVRFHPGRGKTRLASFIKSRSEWCISRQRSWGVPIPAFHKVDNH
FT                   EEVLMNEEVVEHVLGVIDKKGIDSWFKEDNSDIAEWLPSRYKDISHLFQRGRDTVDVWF
FT                   DSGSTWNVLEDFYTQRLKLTEMPYPLADVYLEGSDQHRGWFQSSLLTKIATSEQAAAPY
FT                   GTVITHGFTLDERGIKMSKSIGNTISPETVIRGDEKKGIPALGVDGLRLLISQADFTTD
FT                   VTIGPTVTKHVAEALKKLRLTFKFILGNLSTTENSNMLLPFEKLRAVDQFTICKLKKLS
FT                   DEVQTYYDSYNFSKVVTTTLYHMNNQLSAFYFDITKDSLYCDRPDSLKRRQIQTTLFHV
FT                   LDTYRCILGPITPILVQESWNHLETKWKNIEKTHSDLNTIDSPFTRPWKHLNLKNYEQV
FT                   VNNFEQNQLPILRAYANEFRALPNVTKSTQTIVSIIHSEDKLPFSEDCIADLLQVSGVK
FT                   IEKSENKRGVLVSIGADKEVSLFVESSDLYECPRCWKRNSTEIESLCHRCSHAIT"
FT   gene            <1017534..>1018184
FT                   /locus_tag="KLTH0E11374g"
FT                   /old_locus_tag="KLTH-ORF8717"
FT   CDS_pept        1017534..1018184
FT                   /locus_tag="KLTH0E11374g"
FT                   /old_locus_tag="KLTH-ORF8717"
FT                   /product="KLTH0E11374p"
FT                   /note="some similarities with uniprot|Q6LE92 Saccharomyces
FT                   cerevisiae YPL041C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23533"
FT                   /db_xref="InterPro:IPR018811"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIC2"
FT                   /protein_id="CAR23533.1"
FT                   /translation="MSLAFTSLGLSPASRLYAKGGSIALGLLRPSAVGVERCRCYSKKA
FT                   SSSNTVSEKAVGPAKDPSNKIYKLISKSKLLTRLSKRPAIGHYFDKLAETSPVSTISSF
FT                   LILHEITAIVPLFGLWWVLYSLNLNEQYELPLYFKELLDQCGDSIEKLVGDRSQGFDRN
FT                   RLVLSGAISYAIVKILYPARVLFSLWAAPYFFKWFLGPFKKLGSLLRPGKKSS"
FT   gene            <1018348..>1020069
FT                   /locus_tag="KLTH0E11396g"
FT                   /old_locus_tag="KLTH-ORF8716"
FT   CDS_pept        1018348..1020069
FT                   /locus_tag="KLTH0E11396g"
FT                   /old_locus_tag="KLTH-ORF8716"
FT                   /product="KLTH0E11396p"
FT                   /note="similar to uniprot|P39073 Saccharomyces cerevisiae
FT                   YPL042C SSN3 Component of RNA polymerase II holoenzyme
FT                   involved in RNA pol II carboxy-terminal domain
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23534"
FT                   /db_xref="GOA:C5DIC3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIC3"
FT                   /protein_id="CAR23534.1"
FT                   /translation="MYGIQNKPPNDYPIPIQQQSSQNIWQQQMVDNKGSTSASGKPLLM
FT                   ANNNVFSIGPYKRRKDANRVSVVEKYEIIGYIAAGTYGKVYKAKRKLQNPSSSTTSLVG
FT                   SEVANTTSNNPISDHNILDTNSINKTTRVQDASSGLPQASSIDFSKSEAKSSHTLPGGQ
FT                   EPQAGGVPDGSMMVSSNDNLPTLFAIKKFKTEREGVEQLHYTGISQSACREMSLCRELR
FT                   NKHLTSLVEIFLENKSIYMVSEFAEHDLLQIIHFHSHPEKRLIPPRMLKSIVWQILDGV
FT                   SYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFHNMVQTLYTGDKVVVTIWYRAP
FT                   ELLLGARHYTPAIDLWAVGCIFAELIGLRPIFKGEEAKMDSKKSVPFQANQLQRILEVL
FT                   GSPNEKTWPNIFKYSEYEQLSKFPRYRDNLPVWYHSAGGRNKEALDLLYQLLRYDPVTR
FT                   IDAVDALEHPFFTNEDPTVCENVFEGLNYQYPPRRIHTNDNDIMNIANNKAKNTAVHAQ
FT                   VMASNNPNNSNLGGLGVNRRILAAAAAAAAAVSGNNSSMRPGAASSSNGPARKKRG"
FT   gene            complement(<1020231..>1022312)
FT                   /locus_tag="KLTH0E11418g"
FT                   /old_locus_tag="KLTH-ORF8712"
FT   CDS_pept        complement(1020231..1022312)
FT                   /locus_tag="KLTH0E11418g"
FT                   /old_locus_tag="KLTH-ORF8712"
FT                   /product="KLTH0E11418p"
FT                   /note="some similarities with uniprot|P37838 Saccharomyces
FT                   cerevisiae YPL043W NOP4 Nucleolar protein essential for
FT                   processing and maturation of 27S pre-rRNA and large
FT                   ribosomal subunit biogenesis contains four RNA recognition
FT                   motifs (RRMs)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23535"
FT                   /db_xref="GOA:C5DIC4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIC4"
FT                   /protein_id="CAR23535.1"
FT                   /translation="MSQNNAAEGRGSSAKNSLDMKTLFVRSIPFEATDEELTNYFSELA
FT                   PIKHAVIVKDNEKNSRGFGFVSFAVEDDTKDALEKARKTKFKGRLLRVDIAKRRERSKG
FT                   DQRSSSSSEQAGNVENKENELMGGKPKLIIRNMPWSVRKPEQLKQIFMRFGTVVEAKIP
FT                   KKPDGKLCGFAFVTMKKLAACKKAIEDSKDLKIDGRQVAVDFAIQKNKWEDYKKENVAE
FT                   KVESESESESEIDKQEAGEEGSSNEASEAEDEDNENGSEDEDSDANSEEDEEMDSEEEE
FT                   DQSPGSQNWPKPNKHEQLSVFVRNVPYDATQESLEEHFGKFGPVKYALPVQDKETGLAK
FT                   GSAFVVFKSKDAFDECVNNAPASGTTSLLMSDDVPYRYVYEGRILSIAPALDRETAGRF
FT                   AERNASKRKEAFGKAPTAKDKRNLYLLNEGRITEGSKLAQLLTAKDMEIRESSYKLRVE
FT                   QLKKNPSLHLSLTRLAIRNLPRAMTDKALKALARKAIVEFAKEVNLHMRHPLSKEEIQR
FT                   STREKYKFMDEDEIAARKKKDKKQGVVRQAKVIMEVKGSSVGRSRGYGFVEFRDHKAAL
FT                   MGLRWLNAHEVTKPELLEGLDDEEKKAVDTEGLTRRRLCVEFAIENANVVKRRRDATKN
FT                   MRESSKRKLEEAGDEKTEQENQKKAKTDSNAKKPSKSGVDDNIKRLIGFKRKRKQARK"
FT   gene            <1022627..>1023835
FT                   /locus_tag="KLTH0E11440g"
FT                   /old_locus_tag="KLTH-ORF8708"
FT   CDS_pept        1022627..1023835
FT                   /locus_tag="KLTH0E11440g"
FT                   /old_locus_tag="KLTH-ORF8708"
FT                   /product="KLTH0E11440p"
FT                   /note="weakly similar to uniprot|P38907 Saccharomyces
FT                   cerevisiae YDR254W CHL4 Outer kinetochore protein required
FT                   for chromosome stability interacts with kinetochore
FT                   proteins Ctf19p Ctf3p and Iml3p exhibits a two-hybrid
FT                   interaction with Mif2p association with CEN DNA requires
FT                   Ctf19p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23536"
FT                   /db_xref="GOA:C5DIC5"
FT                   /db_xref="InterPro:IPR007902"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIC5"
FT                   /protein_id="CAR23536.1"
FT                   /translation="MDLPDEFIPSLDRPVILRKFNKLSAATIRGIVSKWWEKIDTREKR
FT                   SSTKELGRLIRKVEGKGHNRQKLIGFILDKFWPQGLNLSQISDLDFCSLLEQPNSFKWT
FT                   LMAAENKEIGSAVFQVIPEQLICALKQDLQPLFSIHTCLRPHPELPLLVLRVQLFDQKR
FT                   CGPESAQNPAPAYNSTRKLISRAPTYVVLPFNISSVGFSFGTDLYTKLIINSICKSVHS
FT                   KNKVKLAKVDKLPVRNLNTVAFLHGLSRYANAQGVWRAYADRKVDSSPLDNPHNHEIVQ
FT                   GREQLKWSLQSQTGKAMMRFKGRTNIPEPTATSAEKLRYKSLLPVPRVDFIIESEKSPE
FT                   KQAKFKLSLWGTDVFGGLHELCDKGYMDINRVPGWLTGENGPRSGKIINGEFYSEDISH
FT                   RTL"
FT   gene            complement(<1023850..>1026249)
FT                   /locus_tag="KLTH0E11462g"
FT                   /old_locus_tag="KLTH-ORF8707"
FT   CDS_pept        complement(1023850..1026249)
FT                   /locus_tag="KLTH0E11462g"
FT                   /old_locus_tag="KLTH-ORF8707"
FT                   /product="KLTH0E11462p"
FT                   /note="similar to uniprot|Q03308 Saccharomyces cerevisiae
FT                   YPL045W VPS16 Vacuolar sorting protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23537"
FT                   /db_xref="GOA:C5DIC6"
FT                   /db_xref="InterPro:IPR006925"
FT                   /db_xref="InterPro:IPR006926"
FT                   /db_xref="InterPro:IPR016534"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR038132"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIC6"
FT                   /protein_id="CAR23537.1"
FT                   /translation="MGVKNPSLGWEKLKDVYYRNRELCQLSLPKEDQYKLIISTTVLAI
FT                   EVEESIRVFQYKGEQLGVIELNKLPSELVCYELDSFDEGSLVLALSDRIRVYHNWSPLL
FT                   FQDFLLPDTIQDKIWDYKNRVLVLSSSQDLFYFDGLGLQVLLKNTENFTLLTKNHWHCN
FT                   EDIVVLLDLDHVFHLNIKSLELVPMFMGETWHTVSVSPRGLVCLFNAKTNELRIYKDSK
FT                   TKLMELNLETQPNDMAWCGDDTIACAFNHEEIRLYGPDSEYVTFWYPDEIIVLRGESNG
FT                   LRLITSEKVELISKVQQFTSNIFLMGSTEPSAILLDSVNLLSTQAPRALENLKIINLDQ
FT                   GVAECLDAALEELDPYWQKKLLAAAAFGKSSLPKNTQLSKVFVETCNKLRVLNVLTEMG
FT                   IILTSSNLLVITLDGLIARLIKTGNFYECIQICKFLKDRGRLASIFKSWANAKIAFSAD
FT                   LDDEDLFKVIIRLAEGLSVQLPLAEIGLAAFSEGRPALAKQLVLKEPLPDLELPSLLEL
FT                   DEHELALKEGRRRGIPGMIMSILLILQKQLTTSQFTKVIMLVMQDNQLYTYYARHDDEF
FT                   LFDFYRQTDQLSNLAHHIWDQEVRNQNPAEYLRQVEELYNRDSQDILIKNDQSLLHRQS
FT                   ELYEFQRSISHLLQVDLENMNLDGTIELLIKMKLDKQLNSLIKKFKVTDRKIYHIKCRV
FT                   LTQQDRFDDLFKFAQERKSPIGYHPFFKYCLKQKRKKEAAVYVRMISGIPYEKRIEMYL
FT                   RCESYNDAINLASKEKDIPSLKNIYKTIPPNQPQLKALVNEAMSKL"
FT   gene            <1026368..>1026661
FT                   /locus_tag="KLTH0E11484g"
FT                   /old_locus_tag="KLTH-ORF8704"
FT   CDS_pept        1026368..1026661
FT                   /locus_tag="KLTH0E11484g"
FT                   /old_locus_tag="KLTH-ORF8704"
FT                   /product="KLTH0E11484p"
FT                   /note="similar to uniprot|O13292 Saccharomyces cerevisiae
FT                   YPL046C ELC1 Elongin C forms heterodimer with Ela1p that
FT                   participates in transcription elongation expression
FT                   dramatically upregulated during sporulation widely
FT                   conserved among eukaryotes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23538"
FT                   /db_xref="GOA:C5DIC7"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR039948"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIC7"
FT                   /protein_id="CAR23538.1"
FT                   /translation="MSQITLVSKDGSEQSLSREAADLSPVLRSMLSKPFIEEQQSKITL
FT                   SEIKPDVLKKVVEYLEYCRQYQNAGEDEDVPEFEVPTEMSLELLLVADFLNI"
FT   gene            complement(<1026687..>1027895)
FT                   /locus_tag="KLTH0E11506g"
FT                   /old_locus_tag="KLTH-ORF8703"
FT   CDS_pept        complement(1026687..1027895)
FT                   /locus_tag="KLTH0E11506g"
FT                   /old_locus_tag="KLTH-ORF8703"
FT                   /product="KLTH0E11506p"
FT                   /note="similar to uniprot|Q12508 Saccharomyces cerevisiae
FT                   YDR255C RMD5 Cytosolic protein required for sporulation
FT                   also required for the ubiquitination of the gluconeogenetic
FT                   enzyme fructose-1 6-bisphosphatase which is degraded
FT                   rapidly after the switch from gluconeogenesis to
FT                   glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23539"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="InterPro:IPR027711"
FT                   /db_xref="InterPro:IPR037683"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIC8"
FT                   /protein_id="CAR23539.1"
FT                   /translation="MSDLLKNLNTEFGKLKEGASDGQSHLRRCLKDTHEFKLNIKKLKS
FT                   YLTKQMLEPGAGQDPVDDKISRKRQLAVDKLNKLHRQWDSGVKKHGKNALHQHTKFQKS
FT                   VLNKIYDFDLDQVYVNQLPADARQHIEKSIGVHISRYSMSEIPKTDPEAMVQYLKEVYG
FT                   VDPQVSSSYVEMSQIVRQLRGGNLEPCMRWCTEGSSLQFELHLLNAMYFLQAGDKVSTY
FT                   QYLLKHIPSFMEKTKKTHLRHQVAPLLAQLVVSSEAKVNVEDQRKKCMKLFTKEYCAQS
FT                   RLPFDSPLFLVVLSGVISFQFFIKYRTLRAVSHVDWSTKNELPFNVKLPEFLTNFHPIF
FT                   ICPVLKEETTQENPPYALPCHHIISKFSLDKMSKNGTCNFKCPYCPVMAARSKTSRVNF
FT                   VIL"
FT   gene            complement(<1028171..>1028467)
FT                   /locus_tag="KLTH0E11528g"
FT                   /old_locus_tag="KLTH-ORF8701"
FT   CDS_pept        complement(1028171..1028467)
FT                   /locus_tag="KLTH0E11528g"
FT                   /old_locus_tag="KLTH-ORF8701"
FT                   /product="KLTH0E11528p"
FT                   /note="similar to uniprot|Q03067 Saccharomyces cerevisiae
FT                   YPL047W SGF11 11kDa subunit of the SAGA histone
FT                   acetyltransferase complex involved in regulation of
FT                   transcription of a subset of SAGA-regulated genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23540"
FT                   /db_xref="GOA:C5DIC9"
FT                   /db_xref="InterPro:IPR013246"
FT                   /db_xref="InterPro:IPR041216"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIC9"
FT                   /protein_id="CAR23540.1"
FT                   /translation="MAQLTIDTASQSIFENLLTTMIQDIVARTTTQAQTLRARYGGIPK
FT                   PYFHDKSGTLDINGMPKQQESSIYFHCDNCSRDVSVNRFAAHVERCLTRGRRG"
FT   gene            complement(<1028766..>1030301)
FT                   /locus_tag="KLTH0E11550g"
FT                   /old_locus_tag="KLTH-ORF8700"
FT   CDS_pept        complement(1028766..1030301)
FT                   /locus_tag="KLTH0E11550g"
FT                   /old_locus_tag="KLTH-ORF8700"
FT                   /product="KLTH0E11550p"
FT                   /note="highly similar to uniprot|P15202 Saccharomyces
FT                   cerevisiae YDR256C CTA1 Catalase A breaks down hydrogen
FT                   peroxide in the peroxisomal matrix formed by acyl-CoA
FT                   oxidase (Pox1p) during fatty acid beta-oxidation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23541"
FT                   /db_xref="GOA:C5DID0"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:C5DID0"
FT                   /protein_id="CAR23541.1"
FT                   /translation="MGNDNPTNASNVRSDRVVTNSQGNPINEPFATQRVGQYGPLLLQD
FT                   FTLLDSLAHFNRERIPERNPHAHGSGAFGYFEVTDDITDVCGSAMFNEIGKKTRCMVRF
FT                   STVGGEKGSADTARDPRGFATKFYTEEGNLDWVYNNTPVFFIRDPAKFPHFIHTQKRNP
FT                   ETNLKDANMFWDFLTTPENQVAIHQVMILFSDRGTPATYRNMNGYSGHTYKWSNKKGEW
FT                   FYVQVHIKTDQGIKNLNNEEAVKIAGENPDYCGQDLFKNIKEGNFPTWTVYIQTMTEAE
FT                   AQKLPFSVFDLTKVWSHKQFPLRRIGKMVLNENPKNYFAQVEQVAFSPSHTVPYQEASA
FT                   DPVLQSRLFAYPDAHRHRLGANYHQIPVNCPYASRVFNPSIRDGPMNVDGNLGSEPNYL
FT                   STAKSYNYTQASKPIQQHQEVWNGPALPFHWATSPGDADFVQARGLYNVLARTPGQQQA
FT                   LAHNVAVHVANACPEIQERVFAMFSRVDKTLGQSIKREALSISPRSSSQQAKL"
FT   gene            complement(<1031665..>1032918)
FT                   /locus_tag="KLTH0E11572g"
FT                   /old_locus_tag="KLTH-ORF8694"
FT   CDS_pept        complement(1031665..1032918)
FT                   /locus_tag="KLTH0E11572g"
FT                   /old_locus_tag="KLTH-ORF8694"
FT                   /product="KLTH0E11572p"
FT                   /note="similar to uniprot|P29547 Saccharomyces cerevisiae
FT                   YPL048W CAM1 Translational cofactor elongation factor-1
FT                   gamma participates in the regulation of GTP- binding
FT                   protein EF-1 alpha may play a redundant role in the
FT                   regulation of protein synthesis or another GTP- dependent
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23542"
FT                   /db_xref="GOA:C5DID1"
FT                   /db_xref="InterPro:IPR001662"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR036433"
FT                   /db_xref="UniProtKB/TrEMBL:C5DID1"
FT                   /protein_id="CAR23542.1"
FT                   /translation="MSLGTLYGNFRIRTWVPQAIIKKFGLDIKIIAPEDNEQQFAKDFP
FT                   LKKVPGFLGPEGFKLTETMAVMYYLTKLIPDEEAKRELLGANAEEQAQVIRWLSFANSE
FT                   LLIELVNVFKPLLGMSPFIKPLFDAAVAKVDQITAVFEERLIEHTYLASEDITLADLFA
FT                   TTVFARGFQHCLGSEWRAAHPAITRWYNTVKASDYLEEFFVDFKPCDKPLQPPQNNKKK
FT                   EAKKETKKEAKKPSAEKPKAAAEAEKPAEQPKKPKHPLELLGKASFPLEDWKRKYSNED
FT                   TRPVALPWFWEHYNPEEYSIWRVDFKYNDELTLCFMSNNQVGGFMERLSASVKYMFGCI
FT                   VVYGEDRNNGIVGAVMLRGQDYVPAFDVAPDWTSYDYAKLDPSKEEDKEFINTMWAWDK
FT                   PVVINGEPREISDGKVLK"
FT   gene            <1033891..>1035174
FT                   /locus_tag="KLTH0E11594g"
FT                   /old_locus_tag="KLTH-ORF8691"
FT   CDS_pept        1033891..1035174
FT                   /locus_tag="KLTH0E11594g"
FT                   /old_locus_tag="KLTH-ORF8691"
FT                   /product="KLTH0E11594p"
FT                   /note="weakly similar to uniprot|Q03063 Saccharomyces
FT                   cerevisiae YPL049C DIG1 Regulatory protein of unknown
FT                   function constitutively-expressed involved in the
FT                   regulation of mating-specific genes and the invasive growth
FT                   pathway required for MAP-kinase imposed repression inhibits
FT                   pheromone-responsive transcription"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23543"
FT                   /db_xref="UniProtKB/TrEMBL:C5DID2"
FT                   /protein_id="CAR23543.1"
FT                   /translation="MSQSTGEGENKSREGRDRLRELGLQCVSPGFGKMDNRMLSTLQVS
FT                   KDIAKEQKEAIQKLSGDAKSSSPEPKINTGPDTAPSRVSGQDSGSSSTGDIEKNVAKAG
FT                   PKSLKRARIPPPLNIRASGSDSGSRSGKEDNFQFTGARSAPAHITRYPRGKSRVQYLGR
FT                   STDGEHSARKKARALPNWAHMNNAAMTPYAYYPPPATAIPYQGGYPAWQGALQNPYQSP
FT                   YIPAYMAPVPYAMLQAPFAQSVPDPQTAKNPASNLQRDFEAYRNKNPGVGTRDLFGNNK
FT                   SRWAPIQAQPQSAREEFFGARARTPIRQSSAAGASRPRPVEKTKDKQADSGPARNNSSK
FT                   EDDKDNNDDNDTEEVDLAIEEGAQPIPMHARQNSAASVANATMQGEIRLQQDSFAFTFS
FT                   MLDSATDKKMFMSICDKVWDEAQEITKR"
FT   gene            <1035396..>1036580
FT                   /locus_tag="KLTH0E11616g"
FT                   /old_locus_tag="KLTH-ORF8686"
FT   CDS_pept        1035396..1036580
FT                   /locus_tag="KLTH0E11616g"
FT                   /old_locus_tag="KLTH-ORF8686"
FT                   /product="KLTH0E11616p"
FT                   /note="highly similar to uniprot|P39107 Saccharomyces
FT                   cerevisiae YPL050C MNN9 Subunit of Golgi
FT                   mannosyltransferase complex also containing Anp1p Mnn10p
FT                   Mnn11p and Hoc1p that mediates elongation of the
FT                   polysaccharide mannan backbone forms a separate complex
FT                   with Van1p that is also involved in backbone elongation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23544"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DID3"
FT                   /protein_id="CAR23544.1"
FT                   /translation="MSLAMWSYRLRKTPLVALLVPLVLVGVLLWVFLGNEESLLGLDGS
FT                   SISTHKWAHESEKTFYFPYSHMFKTPKYSYKKKSNWLFSDTVEDNIPAGHISHYDLNKL
FT                   TSTDKAFANKEQVLILTPMQTFHDQYWDNLLQLTYPRDLIELGFIIPRTATGDTALRKL
FT                   EAAVKRTQLGKKDQRFSKITILRQDSQSFDSLQEKERHALKVQKERRAAMALARNELLF
FT                   STIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQKYMNEETKKIAERPYDF
FT                   NNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSLDGVGGGC
FT                   TLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEEFN"
FT   gene            complement(<1036695..>1038311)
FT                   /locus_tag="KLTH0E11638g"
FT                   /old_locus_tag="KLTH-ORF8685"
FT   CDS_pept        complement(1036695..1038311)
FT                   /locus_tag="KLTH0E11638g"
FT                   /old_locus_tag="KLTH-ORF8685"
FT                   /product="KLTH0E11638p"
FT                   /note="similar to uniprot|P11491 Saccharomyces cerevisiae
FT                   YDR481C PHO8 Repressible alkaline phosphatase a
FT                   glycoprotein localized to the vacuole regulated by levels
FT                   of inorganic phosphate and by a system consisting of Pho4p
FT                   Pho9p Pho80p Pho81p and Pho85p dephosphorylates
FT                   phosphotyrosyl peptides"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23545"
FT                   /db_xref="GOA:C5DID4"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:C5DID4"
FT                   /protein_id="CAR23545.1"
FT                   /translation="MEKASLMGKRPIKRRNKYRKLSHYAFALILLTVVVMSLPIGPSLE
FT                   KFVSRKSSKKNVIFFVTDGMGPASLSLSRSFRQFTQNLTIDDVLTLDHHLIGSSRTRSS
FT                   DSLVTDSAAGATAFSCALKSYNGAIGVDPDKQPCGTILEAAKLQGYLTGLVVTTRITDA
FT                   TPAAFSAHADYRFQEDLIAQQQLGDYPLGRMVDLMIGGGRTHFYSGTDIVYGSRGSRSD
FT                   GRNLIKEAIGDGWSYVGNREQFDALENGRNVSLPLLALLADYDIPFDFDRDASEYPSLK
FT                   EEAMTAINALTEATKNSDKGFFLLIEGSRIDHAGHQNDPAAQAREVLAFDEAFEAVLRF
FT                   AEESDVETVMVSTSDHETGGLVTARQITKAYPEYAWYPNVLDNAKHSGEFLRKMVQGYK
FT                   GDSKSTFIEQDVFEDNLGITDYSKADVEELLKLTSSGEINDKLNDMISTRAQIGWSTHG
FT                   HSAVDVNIYAYANRRATWHNVLENLQGNHENTEIGQFMANYLGLNLQDVTKKLGKTKHS
FT                   PTSSLSDLSLDADEYHHNLYI"
FT   gene            complement(<1038583..>1039245)
FT                   /locus_tag="KLTH0E11660g"
FT                   /old_locus_tag="KLTH-ORF8683"
FT   CDS_pept        complement(1038583..1039245)
FT                   /locus_tag="KLTH0E11660g"
FT                   /old_locus_tag="KLTH-ORF8683"
FT                   /product="KLTH0E11660p"
FT                   /note="highly similar to uniprot|Q02804 Saccharomyces
FT                   cerevisiae YPL051W YPL051W ARL3 GTPase of the
FT                   Rassuperfamily required to recruit Arl1p to the Golgi;
FT                   similar to ADP-ribosylation factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23546"
FT                   /db_xref="GOA:C5DID5"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DID5"
FT                   /protein_id="CAR23546.1"
FT                   /translation="MHRELLTNTKLHPDKTNKTNRQAMFHLAKGLYANWNRREQYSILI
FT                   LGLDNAGKTTFLEMLKKEYSKGSKSPEKITPTVGQNVATIPVNNCLLKFWDVGGQETLR
FT                   SLWPEYYAQAHGIIFVIDSADRERLEECCRTLKTVVTDEEVEGIPVLMLANKQDREDRM
FT                   EVQDIKEVFNKIAEHLGARDSRVLPISALNKEGVKEAAEWILVRLRRNKANKPPQYK"
FT   gene            complement(<1039413..>1039817)
FT                   /locus_tag="KLTH0E11682g"
FT                   /old_locus_tag="KLTH-ORF8681"
FT   CDS_pept        complement(1039413..1039817)
FT                   /locus_tag="KLTH0E11682g"
FT                   /old_locus_tag="KLTH-ORF8681"
FT                   /product="KLTH0E11682p"
FT                   /note="similar to uniprot|Q03375 Saccharomyces cerevisiae
FT                   YDR482C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23547"
FT                   /db_xref="InterPro:IPR013170"
FT                   /db_xref="UniProtKB/TrEMBL:C5DID6"
FT                   /protein_id="CAR23547.1"
FT                   /translation="MSYDGIGLKSAKGSSTSGHIQQSLALNTERKNVKNFLSRVEKQQQ
FT                   RPKSSAQTKRKDESILKHLSKRELELRVSEYRDALEDDDSLSDATIDAKCQEFREKTAL
FT                   QLRKEHVDEKLRNAYVSRSKRQAESGAADQ"
FT   gene            complement(<1039996..>1040586)
FT                   /locus_tag="KLTH0E11704g"
FT                   /old_locus_tag="KLTH-ORF8679"
FT   CDS_pept        complement(1039996..1040586)
FT                   /locus_tag="KLTH0E11704g"
FT                   /old_locus_tag="KLTH-ORF8679"
FT                   /product="KLTH0E11704p"
FT                   /note="some similarities with uniprot|Q02803 Saccharomyces
FT                   cerevisiae YPL052W OAZ1 Regulator of ornithine
FT                   decarboxylase (Spe1p) antizyme that binds to Spe1p to
FT                   regulate ubiquitin-independent degradation ribosomal
FT                   frameshifting during synthesis of Oaz1p and its ubiquitin-
FT                   mediated degradation are both polyamine- regulated"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23548"
FT                   /db_xref="GOA:C5DID7"
FT                   /db_xref="InterPro:IPR002993"
FT                   /db_xref="UniProtKB/TrEMBL:C5DID7"
FT                   /protein_id="CAR23548.1"
FT                   /translation="MAARSGIRDTATTPRADKAALTELYWDAILLTESEFLDSGYHDYT
FT                   GFQRQVVRQVGQALTTYERGHKAPFRSSSVALWRQIGLSYSLLYYPDWFQNPIWCKSDS
FT                   TRLQVILSQDISQVVKQLLMSLLEYTATLDLAWLRLCVLRDVTGIKDLLRNLSWLGGRV
FT                   VPNENRTAALDSLTALECATFSDEKYVIVEFEC"
FT   gene            <1041704..>1043077
FT                   /locus_tag="KLTH0E11726g"
FT                   /old_locus_tag="KLTH-ORF8674"
FT   CDS_pept        1041704..1043077
FT                   /locus_tag="KLTH0E11726g"
FT                   /old_locus_tag="KLTH-ORF8674"
FT                   /product="KLTH0E11726p"
FT                   /note="similar to uniprot|P27809 Saccharomyces cerevisiae
FT                   YDR483W KRE2 Alpha1 2-mannosyltransferase of the Golgi
FT                   involved in protein mannosylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23549"
FT                   /db_xref="GOA:C5DID8"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DID8"
FT                   /protein_id="CAR23549.1"
FT                   /translation="MAIRISKRLLRLGGLVLCMLGIFGLMLHKSEKGALLQIKNAPTQV
FT                   NDWATEKFKGWGSSADAEKELEEQRKEAESDVKEGKHFEDVLMDDEAKKLLADSEQKSL
FT                   SEVVGTSTASASTAAATGGAATKAGSKDGPVKACFVSLVRNEDLWKLVETIQNVQDRFN
FT                   NNFNYPWVFLNNEPFTEEFKRVVKGMVPDGTKFELIPEAYWSYPSWIDQEEAAKTRVEM
FT                   REQGIIYGDSESYRHMCRFESGFFWRHEALDEFDWYWRVEPETKLHCDIDYDVFEWMRD
FT                   NDKKYGFTISIHEYESTIKTLWSKTKEFLEIHPEYVAKNNMLDFISNDNGKKYNLCHFW
FT                   SNFEVASLDLWRSQAYRDYFDYLDQAGGFFYERWGDAPVHSIAAALFIPRDQIHYFPDI
FT                   GYYHPPYNNCPIDQTIFDKGKCSCNQDADFTFQGYSCTNHYFDVNKMEKPEGWKKFRQ"
FT   gene            <1043203..>1044339
FT                   /locus_tag="KLTH0E11748g"
FT                   /old_locus_tag="KLTH-ORF8671"
FT   CDS_pept        1043203..1044339
FT                   /locus_tag="KLTH0E11748g"
FT                   /old_locus_tag="KLTH-ORF8671"
FT                   /product="KLTH0E11748p"
FT                   /note="similar to uniprot|P33313 Saccharomyces cerevisiae
FT                   YBR155W CNS1 cyclophilin seven suppressor component of
FT                   Hsp90p chaperone machinery"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23550"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DID9"
FT                   /protein_id="CAR23550.1"
FT                   /translation="MPKPYVKPKRYVPGPGEPALPPQLSEFQNKSTDDVMEELNRMPFF
FT                   MSKLDGTDGEGGQNVELEALKALAYEGEPHEVAENFKNQGNDLYRAKRYKDAREIYNRG
FT                   IDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCKRALQYNVKNIKCYYRIAKAFLLL
FT                   NKLEDAKQAAEFGLKLDPENQALNALRQNVDKKKQDADAFEAKKLKEQTERERLETILE
FT                   ASMILRNFKNVDTANPPELLEEAKICLENKEDMESQLIFPAMVLYPISDEFDFIGAVGE
FT                   LSTPEDLLNTLLQRPEEWFEQPGHEEYTAKKLFGFMETEAGGLIKVGKKVTFHDVFKME
FT                   KPSVPLFDKSLRIYFVPKSKSEAWLAKWDKEEALKKRK"
FT   gene            complement(<1044412..>1046775)
FT                   /locus_tag="KLTH0E11770g"
FT                   /old_locus_tag="KLTH-ORF8669"
FT   CDS_pept        complement(1044412..1046775)
FT                   /locus_tag="KLTH0E11770g"
FT                   /old_locus_tag="KLTH-ORF8669"
FT                   /product="KLTH0E11770p"
FT                   /note="similar to uniprot|P38283 Saccharomyces cerevisiae
FT                   YBR156C SLI15 Mitotic spindle protein involved in
FT                   chromosome segregation."
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23551"
FT                   /db_xref="InterPro:IPR005635"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIE0"
FT                   /protein_id="CAR23551.1"
FT                   /translation="MDWAVRSARKKTRFLQGGSRSIVESLNKLNEVVTEGQDAITSACI
FT                   VSSKWLEEEMKKFRDAYPKKATTNSPEKSKLDEKIVLEESTPRKLEATDNNESPKASPQ
FT                   GSPQVSPHISSQVSPRVSPRAGPQASPQVSQHMSSGATAEGSLEESIQSTPKSTFAERS
FT                   AKKPENPTHNKKQDDETQSTLNIGGKSSATKSSPWSPYKSNKNNILPNFVEVPMAATKN
FT                   VTKNKVEKDSVFRRLNASQRRFVENSPPSALEQSARNPSTETSKPYEEVRDEKQALRDR
FT                   TQRRSNMFVPLPDKDPLVLHAASIPRQKKGSLDFTPNNNEIAPTSNNNTKTLNFTVDST
FT                   TAVNKTPKPPLSNVFDRLSSKSTKSFENKASSRSPTRDLKRQRPHHFTYREGTGSPKER
FT                   KSPQTEHTNRSIQETLKSIFDSQIPKLSQDNLGSDHNIGASASQITGRVKTRNSLIPKL
FT                   SGHTVVSPISANKRLSSQKYNEPLFTLDRSPSNRSKSTASTKVDARRSGVPEEFPVGTK
FT                   GSLVHTNKSNKSSVNERSLNNETSSQKLSTTNIEENSAKDEKKQIAAGLCGEDLDSSRK
FT                   GNIMRMKITQDRLTKFQLPPLAVSEKQDVKKKLDKRLSEVMRNQKEQQRRHQEKLKRKS
FT                   NLEEDLRQRKSRILQESEAQKIIKSIHPVFDIAEKEANVRSRNTVLYDLNSTDHRQMIG
FT                   GGQDETYGGDTTLPDIDSDSDAEDRSILAPWAQAPFLQEQLLVQQKWDPEKIFGPIPPL
FT                   HTDEIFQTSRLSRLKSRQSLSRTMQVTHSEPTRK"
FT   gene            <1047925..>1050339
FT                   /locus_tag="KLTH0E11792g"
FT                   /old_locus_tag="KLTH-ORF8665"
FT   CDS_pept        1047925..1050339
FT                   /locus_tag="KLTH0E11792g"
FT                   /old_locus_tag="KLTH-ORF8665"
FT                   /product="KLTH0E11792p"
FT                   /note="similar to uniprot|Q03770 Saccharomyces cerevisiae
FT                   YDR160W SSY1 Component of the SPS plasma membrane amino
FT                   acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
FT                   external amino acid concentration and transmits
FT                   intracellular signals that result in regulation of
FT                   expression of amino acid permease genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23552"
FT                   /db_xref="GOA:C5DIE1"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIE1"
FT                   /protein_id="CAR23552.1"
FT                   /translation="MNHGTSNKAVPGLFPELHYQDARDKPYEPACEATSVDSTVFKQMV
FT                   NELPKDYELDMKQDAFYLTRKYLTEMGNGGGGQQVTYTTFQEYDDTVRREFEMRQRLRE
FT                   LESALSNNGIKLKRLDDMNALYTRDAAKRNERLNSFVKAVRKIYRHRRRSTSHEHASLQ
FT                   IGPQKSNLTTVIDNIKPECGFIDVQFEKNLIEFKEELETGPIVSIEGVEEPQGSPRKPA
FT                   SHYIIRRKLRVRHLQMISLGATIGVGLFLNSGKAFSIAGPIGALIGFTVGGSLILATLF
FT                   SFAEMVALIPLITGISGLCSRFVGDSFGFSVGWCHWLSYAMGFPSEVIASTIMLSYYKN
FT                   MEEVATKKSTTALTITAIVVGSTAINLMDVRVYGEFEYFSSAFKLLVVFLLIIIMIVMN
FT                   AGGLKNEYIGFRYWNSNKSPISEVTFGPFRPTFDLQDKGFGSRNGVPGFGGVVLSCIAS
FT                   SLASAFAYVGSEIGFIAAGEARNPRKAVPSVTKRIFTRVIVFYLLSIFVVGLNIYSGDP
FT                   RLLRFNNAASSIAEVNNGDSGYQAIIDALGGSNCQRPTPQNIYPVDNPNQSPWVIAMQS
FT                   INQCTLSSFINGVSVAIGISAASSQLYASSRTLYSMATQQKAPSIFTWCNRSGVPYMCV
FT                   LFCGLLGFLSLLCLDIDSAEVFFDFVSIGAVGSIIVWLGMNLSYLRFYYALKQRPDIVS
FT                   RDAKEYPYKSPCQPYLAIYGMVLAVVLIVFNGFQNFFQWNTKNFVTSYLTLTLFIVMMV
FT                   GYGWAKGSKFNKLEQMDLDSGRREMDRVIWKEDLDYSPNWKEAFNKLLSHL"
FT   gene            complement(<1050390..>1051364)
FT                   /locus_tag="KLTH0E11814g"
FT                   /old_locus_tag="KLTH-ORF8657"
FT   CDS_pept        complement(1050390..1051364)
FT                   /locus_tag="KLTH0E11814g"
FT                   /old_locus_tag="KLTH-ORF8657"
FT                   /product="KLTH0E11814p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23553"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIE2"
FT                   /protein_id="CAR23553.1"
FT                   /translation="MQYQTYTRERVPPLKPAPRKDHFLCSCGTAQDERLRSFTFPAGRG
FT                   AAGRTQARRVSRAGGSDGGSDGGSDGDGSDDSCDDSCGDSGSDSDGSSESGRHSDGGST
FT                   CAYVDDSPQISPKTIPSMDRGDSDSGCTRSMHRAHNSVFSSFSDASSPIMRHRRSSAIS
FT                   ADKDTFSAAPRPAWPSPTKRTSDSVFNKRPAALSRPHSFSRPARVLIADTSQQLRRNSE
FT                   PFFLVKAEIGRLDGSHAGPAYAGLPQTGDAAPQSIDLEPASWDRAPAGPRTPKAVQGPS
FT                   ALLPPIQFADMESSQEDSSTASAGGEPDPEEMLSLKEFLLTSG"
FT   gene            complement(<1052611..>1053726)
FT                   /locus_tag="KLTH0E11836g"
FT                   /old_locus_tag="KLTH-ORF8647"
FT   CDS_pept        complement(1052611..1053726)
FT                   /locus_tag="KLTH0E11836g"
FT                   /old_locus_tag="KLTH-ORF8647"
FT                   /product="KLTH0E11836p"
FT                   /note="some similarities with uniprot|Q06701 Saccharomyces
FT                   cerevisiae YPL054W LEE1 Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23554"
FT                   /db_xref="GOA:C5DIE3"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIE3"
FT                   /protein_id="CAR23554.1"
FT                   /translation="MPPEKPFGTPADRPAGKPPGKSRARRGPRRRGERGERGERSGSRP
FT                   SSASSTSPSSASSAAPQSPVSSASQGPTSPADDKSAGFSPSQQRAIFYSRQVTKHSAQH
FT                   KNYSHVPCRFFRQGACQAGDSCPFSHSLNALAADQTPCKYFQRGHCRFGAKCANAHILP
FT                   DGTRANPTKYRGAPASAPASAPASLPLGEPLGGPLGAQLRGAALPDAVFSRNNAYCAGA
FT                   FSSSAPGLAPAAPLQPYFTDASAVVFEDDADPAGPADSACDFDGEDFIPGELADLLTPR
FT                   ELERRRSSLPHRLSFNDSGPGPAAPLPAPLSASGHSPNYLASPVFDYVHQRDAAWPADP
FT                   PSLASVHELGAHLARIKIPENSDSRAAGISL"
FT   gene            <1055267..>1056733
FT                   /locus_tag="KLTH0E11858g"
FT                   /old_locus_tag="KLTH-ORF8628"
FT   CDS_pept        1055267..1056733
FT                   /locus_tag="KLTH0E11858g"
FT                   /old_locus_tag="KLTH-ORF8628"
FT                   /product="KLTH0E11858p"
FT                   /note="weakly similar to uniprot|P38285 Saccharomyces
FT                   cerevisiae YBR158W AMN1 Involved in daughter cell
FT                   separation and Chromosome STability Chromosome STability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23555"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIE4"
FT                   /protein_id="CAR23555.1"
FT                   /translation="MLTPAPSRNGSFKRQRDSESPAAAPAPPAKKPAAACNACNACGTC
FT                   GECDVCDGQRDDACDPPPFILGDLTPLATPTKPATRRVPRLESHFSDLKLWSPTRGRPP
FT                   RREHAIFRTPEVVDRIMRFVDAARAIPREKPRHRRKPQSLSHALLMYDGDQAKAVQAWH
FT                   ETSAAGRSQSAPALQEPGLAPCLLVNKLWHAAALAIITENLAFADHRRFRQLAACPRQQ
FT                   RARFSRPASFVLHKLSRLTQGELDAVAPLVASEKLRWLELYICPKVLPPVPVFQHSRNI
FT                   EKLVLPGNRLLTDEFIMKIAPHLGKLRVLDLRACDQITDGAVLSITSNCPLLEVCNLGR
FT                   HRNGAAITSVSLVALARNTNIDTVGAAGCHVTDAGVWELAMHRGAHIRRLSLNNCRLLT
FT                   NNSVPALLSMNYFPQLSVLEIRDVKHITNLRPIVAYTSAKRALGFPVLVEGGERIDLLI
FT                   KEEEWRMERERSARVLAALSQWVNEEDPQD"
FT   gene            <1056945..>1057703
FT                   /locus_tag="KLTH0E11880g"
FT                   /old_locus_tag="Klth0E.mRNA.974.p"
FT   CDS_pept        join(1056945..1056968,1057173..1057703)
FT                   /locus_tag="KLTH0E11880g"
FT                   /old_locus_tag="Klth0E.mRNA.974.p"
FT                   /product="KLTH0E11880p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23556"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIE5"
FT                   /protein_id="CAR23556.1"
FT                   /translation="MNELLWRLNSYNYGESPSGYYGGGQHYHANYRGESYAPQRGGYYN
FT                   GGRGAHSDGYANRYEKRHNSGSRDRWTPSLAQGERPLEAPAPPSPAYEPARPAPSRFRS
FT                   TESPFYYLTGLDQSSENEQELLRIRNLFKEDDSIDARLQEQKLQLCKSELELGLLSTQC
FT                   EKDALNVQLTQENLDALLLMQ"
FT   gene            <1057892..>1058977
FT                   /locus_tag="KLTH0E11902g"
FT                   /old_locus_tag="KLTH-ORF8617"
FT   CDS_pept        1057892..1058977
FT                   /locus_tag="KLTH0E11902g"
FT                   /old_locus_tag="KLTH-ORF8617"
FT                   /product="KLTH0E11902p"
FT                   /note="highly similar to uniprot|P38286 Saccharomyces
FT                   cerevisiae YBR159W microsomal beta-keto-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23557"
FT                   /db_xref="GOA:C5DIE6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR027533"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIE6"
FT                   /protein_id="CAR23557.1"
FT                   /translation="MAFPWHLSKKQRPTKAEEMSFTEQFLALGSNNKITNALLWGIFAV
FT                   GVLKATTFVLSLSSLVADLFVLPGVSFSKYGAKKGKYCVVTGASDGIGKEYARQLAKRG
FT                   FNLILISRTLSKLEALKADFESAFGVQVKVLAIDIAQDSPENYSKIRDICAGLPVTVLI
FT                   NNVGQSHSIPVPFLETEEDEMRNIITINTTATLKITQLVAPLIVQNAKESRCRGLILTM
FT                   GSFGGLLPTPLLATYSGSKAFLQAWSAALAGELKPQNVDVEIVLSYLVTSAMSKVRRSS
FT                   AMIPSPAQFVAATLKSVGRRSGAQERFATMTPYWSHALYHFLIENTVGVYSKAANTINY
FT                   TFHKSIRTRALRKAARQAKHE"
FT   gene            <1059134..>1060030
FT                   /locus_tag="KLTH0E11924g"
FT                   /old_locus_tag="KLTH-ORF8612"
FT   CDS_pept        1059134..1060030
FT                   /locus_tag="KLTH0E11924g"
FT                   /old_locus_tag="KLTH-ORF8612"
FT                   /product="KLTH0E11924p"
FT                   /note="highly similar to uniprot|P00546 Saccharomyces
FT                   cerevisiae YBR160W CDC28 Catalytic subunit of the main cell
FT                   cycle cyclin-dependent kinase (CDK) alternately associates
FT                   with G1 cyclins (CLNs) and G2/M cyclins (CLBs) which direct
FT                   the CDK to specific substrates"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23558"
FT                   /db_xref="GOA:C5DIE7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIE7"
FT                   /protein_id="CAR23558.1"
FT                   /translation="MTELANYKRLEKVGEGTYGVVYKALDLRHGQRVVALKKIRLESED
FT                   EGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQP
FT                   LGDNIIKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINRDGNMKLADFGLARAFGVPLR
FT                   AYTHEIVTLWYRAPEVLLGGKQYSTGVDIWSIGCIFAEMCNRKPIFSGDSEIDQIFKIF
FT                   RVLGTPSEAVWPDIVYLPDFKPKFPKWHPKDLQQVVPSLDEHGIDLLQKLLTYDPINRI
FT                   SAKRAVMHPYFQGRADA"
FT   gene            <1061063..>1062157
FT                   /locus_tag="KLTH0E11946g"
FT                   /old_locus_tag="KLTH-ORF8606"
FT   CDS_pept        1061063..1062157
FT                   /locus_tag="KLTH0E11946g"
FT                   /old_locus_tag="KLTH-ORF8606"
FT                   /product="KLTH0E11946p"
FT                   /note="similar to uniprot|P33300 Saccharomyces cerevisiae
FT                   YPL057C SUR1 and similar to uniprot|P38287 Saccharomyces
FT                   cerevisiae YBR161W CSH1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23559"
FT                   /db_xref="GOA:C5DIE8"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIE8"
FT                   /protein_id="CAR23559.1"
FT                   /translation="MRRELKYLVYSHLALVAVLLYLTFDLLTLAIDDTFQDALLEVDLR
FT                   PPPEAEAKPQLIPKIIHQTYKTEDIPEQWREGQQRCVDLHPDYEYHLWTDETAREFIRE
FT                   EYPWFLDTFDGYRYPIQRADAIRYFLLSHFGGVYIDLDDGCERKLDPLLTVPAFVRKTS
FT                   PTGISNDVMGSVPHHPFFLKVLDSLEKYDRNWLVPYITIMFSTGPLFVSVIWKQYKRWG
FT                   VPDNGVVRILQPADYKKHTYSFFSISRGSSWHLDDAHFIKSLANHILACVVLGFIVAFI
FT                   VLYAEYCFYCWLGAGGGARRIGKAVRRVLSWVGITSDLSSGSETLEMNSEYRRLRKDSN
FT                   LPVNIVIPDLEDNVSEHYTDLSDK"
FT   gene            complement(<1062815..>1064206)
FT                   /locus_tag="KLTH0E11968g"
FT                   /old_locus_tag="KLTH-ORF8600"
FT   CDS_pept        complement(1062815..1064206)
FT                   /locus_tag="KLTH0E11968g"
FT                   /old_locus_tag="KLTH-ORF8600"
FT                   /product="KLTH0E11968p"
FT                   /note="weakly similar to uniprot|P38288 Saccharomyces
FT                   cerevisiae YBR162C TOS1 Target of SBF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23560"
FT                   /db_xref="InterPro:IPR018805"
FT                   /db_xref="InterPro:IPR018807"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIE9"
FT                   /protein_id="CAR23560.1"
FT                   /translation="MRLTQAAAAAASLVPLVAASCDYVGGNYYCSETDAVVYSNVGYSG
FT                   SYMDVTNMDESTCACTQESVSFEGSMTPLDEELSVHFRGPLELLQFGVYYPSSGASLKK
FT                   RGQDCDVAKRHHEHKREAAVAYVEVTSTLYVDASGSPVTSTNPSATAIVATSSSLAPAS
FT                   SAAQESSQTSSSSSSSSSASSSASSQTSSSSGSAAGSSSSSSSASSSSSGSSSSGSGSG
FT                   WNRVSYYTPGSATNLTFMNHQGGTAGSGTWSACFGNSISFAASDGVSGASSAQALDQVT
FT                   LASNKEYMIFSGVDCSDTSSGSCGHYRDDIPAKHGFGGATKMFVFEFKMPHDYSSSYNS
FT                   DMPAIWMLNAKVPRTLQYGDSTCSCWSTGCGELDLFEILSSGSEKLITHLHDGQGNDGN
FT                   SQGGGGTQDYFTRPTSSSFKAAVIFDGSDKTIHVVKVDDDFSSTLSASTVQSWLDKSGS
FT                   TAQLS"
FT   gene            <1066154..>1066342
FT                   /locus_tag="KLTH0E11990g"
FT                   /old_locus_tag="KLTH-ORF8594"
FT   CDS_pept        1066154..1066342
FT                   /locus_tag="KLTH0E11990g"
FT                   /old_locus_tag="KLTH-ORF8594"
FT                   /product="KLTH0E11990p"
FT                   /note="similar to uniprot|P38374 Saccharomyces cerevisiae
FT                   YBR162W-A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0E11990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR23561"
FT                   /db_xref="GOA:C5DIF0"
FT                   /db_xref="InterPro:IPR010580"
FT                   /db_xref="UniProtKB/TrEMBL:C5DIF0"
FT                   /protein_id="CAR23561.1"
FT                   /translation="MAVQTPKQRIANERFAKRNEKKLGKAKPKETKVESPLSKTWVIVL
FT                   LFLLVGGGILELLTLFM"
FT   gene            <1066961..>1068619
FT                   /locus_tag="KLTH0E12012g"
FT                   /old_locus_tag="KLTH-OR