(data stored in ACNUC22857 zone)

EMBL: CU928173

ID   CU928173; SV 1; linear; genomic DNA; STD; FUN; 1114666 BP.
XX
AC   CU928173;
XX
PR   Project:PRJNA12502;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Zygosaccharomyces rouxii strain CBS732 chromosome A complete sequence.
XX
KW   genomic DNA.
XX
OS   Zygosaccharomyces rouxii
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Zygosaccharomyces.
XX
RN   [1]
RP   1-1114666
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1114666
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   MD5; daef2b68d53a7a8744a013b1731f730d.
DR   BioSample; SAMEA3138235.
DR   CABRI; CBS 732.
DR   EnsemblGenomes-Gn; ENSRNA049641284.
DR   EnsemblGenomes-Gn; ENSRNA049641321.
DR   EnsemblGenomes-Gn; ENSRNA049641341.
DR   EnsemblGenomes-Gn; ENSRNA049641364.
DR   EnsemblGenomes-Gn; ENSRNA049641395.
DR   EnsemblGenomes-Gn; ENSRNA049641408.
DR   EnsemblGenomes-Gn; ENSRNA049641445.
DR   EnsemblGenomes-Gn; ENSRNA049641465.
DR   EnsemblGenomes-Gn; ENSRNA049641491.
DR   EnsemblGenomes-Gn; ENSRNA049641523.
DR   EnsemblGenomes-Gn; ENSRNA049641558.
DR   EnsemblGenomes-Gn; ENSRNA049641577.
DR   EnsemblGenomes-Gn; ENSRNA049641604.
DR   EnsemblGenomes-Gn; ENSRNA049641629.
DR   EnsemblGenomes-Gn; ENSRNA049641659.
DR   EnsemblGenomes-Gn; ENSRNA049641681.
DR   EnsemblGenomes-Gn; ENSRNA049641713.
DR   EnsemblGenomes-Gn; ENSRNA049641746.
DR   EnsemblGenomes-Gn; ENSRNA049641776.
DR   EnsemblGenomes-Gn; ENSRNA049641795.
DR   EnsemblGenomes-Gn; ENSRNA049641815.
DR   EnsemblGenomes-Gn; ENSRNA049641835.
DR   EnsemblGenomes-Gn; ENSRNA049641856.
DR   EnsemblGenomes-Gn; ENSRNA049641873.
DR   EnsemblGenomes-Gn; ENSRNA049641895.
DR   EnsemblGenomes-Gn; ENSRNA049641924.
DR   EnsemblGenomes-Gn; ENSRNA049641955.
DR   EnsemblGenomes-Gn; ENSRNA049641986.
DR   EnsemblGenomes-Gn; ENSRNA049642013.
DR   EnsemblGenomes-Gn; ENSRNA049642035.
DR   EnsemblGenomes-Gn; ENSRNA049642065.
DR   EnsemblGenomes-Gn; ENSRNA049642095.
DR   EnsemblGenomes-Gn; ENSRNA049642128.
DR   EnsemblGenomes-Gn; ENSRNA049672051.
DR   EnsemblGenomes-Gn; ENSRNA049672105.
DR   EnsemblGenomes-Gn; ENSRNA049672131.
DR   EnsemblGenomes-Gn; ENSRNA049672170.
DR   EnsemblGenomes-Gn; ENSRNA049672210.
DR   EnsemblGenomes-Gn; ENSRNA049672247.
DR   EnsemblGenomes-Gn; ENSRNA049672308.
DR   EnsemblGenomes-Gn; ENSRNA049672365.
DR   EnsemblGenomes-Gn; ENSRNA049672414.
DR   EnsemblGenomes-Gn; ENSRNA049672484.
DR   EnsemblGenomes-Gn; ENSRNA049672544.
DR   EnsemblGenomes-Gn; ZYRO0A00418r.
DR   EnsemblGenomes-Gn; ZYRO0A01012r.
DR   EnsemblGenomes-Gn; ZYRO0A01826r.
DR   EnsemblGenomes-Gn; ZYRO0A02046r.
DR   EnsemblGenomes-Gn; ZYRO0A02090r.
DR   EnsemblGenomes-Gn; ZYRO0A02354r.
DR   EnsemblGenomes-Gn; ZYRO0A02376r.
DR   EnsemblGenomes-Gn; ZYRO0A02992r.
DR   EnsemblGenomes-Gn; ZYRO0A03014r.
DR   EnsemblGenomes-Gn; ZYRO0A03432r.
DR   EnsemblGenomes-Gn; ZYRO0A04202r.
DR   EnsemblGenomes-Gn; ZYRO0A04884r.
DR   EnsemblGenomes-Gn; ZYRO0A05698r.
DR   EnsemblGenomes-Gn; ZYRO0A05720r.
DR   EnsemblGenomes-Gn; ZYRO0A06424r.
DR   EnsemblGenomes-Gn; ZYRO0A06556r.
DR   EnsemblGenomes-Gn; ZYRO0A06732r.
DR   EnsemblGenomes-Gn; ZYRO0A07414r.
DR   EnsemblGenomes-Gn; ZYRO0A07612r.
DR   EnsemblGenomes-Gn; ZYRO0A07832r.
DR   EnsemblGenomes-Gn; ZYRO0A08756r.
DR   EnsemblGenomes-Gn; ZYRO0A09064r.
DR   EnsemblGenomes-Gn; ZYRO0A09174r.
DR   EnsemblGenomes-Gn; ZYRO0A09746r.
DR   EnsemblGenomes-Gn; ZYRO0A10692r.
DR   EnsemblGenomes-Gn; ZYRO0A10978r.
DR   EnsemblGenomes-Gn; ZYRO0A11946r.
DR   EnsemblGenomes-Gn; ZYRO0A12078r.
DR   EnsemblGenomes-Gn; ZYRO0A12122r.
DR   EnsemblGenomes-Gn; ZYRO0A12188r.
DR   EnsemblGenomes-Gn; ZYRO0A12210r.
DR   EnsemblGenomes-Gn; ZYRO0A12232r.
DR   EnsemblGenomes-Gn; ZYRO0A12276r.
DR   EnsemblGenomes-Gn; ZYRO0A12584r.
DR   EnsemblGenomes-Gn; ZYRO0A12716r.
DR   EnsemblGenomes-Gn; ZYRO0A12760r.
DR   EnsemblGenomes-Gn; ZYRO0A13508r.
DR   EnsemblGenomes-Gn; ZYRO0A13684r.
DR   EnsemblGenomes-Tr; EFT00001982976.
DR   EnsemblGenomes-Tr; EFT00001982977.
DR   EnsemblGenomes-Tr; EFT00001982978.
DR   EnsemblGenomes-Tr; EFT00001982979.
DR   EnsemblGenomes-Tr; EFT00001982980.
DR   EnsemblGenomes-Tr; EFT00001982981.
DR   EnsemblGenomes-Tr; EFT00001982982.
DR   EnsemblGenomes-Tr; EFT00001982983.
DR   EnsemblGenomes-Tr; EFT00001982984.
DR   EnsemblGenomes-Tr; EFT00001982985.
DR   EnsemblGenomes-Tr; EFT00001982986.
DR   EnsemblGenomes-Tr; EFT00001982987.
DR   EnsemblGenomes-Tr; EFT00001982988.
DR   EnsemblGenomes-Tr; EFT00001982989.
DR   EnsemblGenomes-Tr; EFT00001982990.
DR   EnsemblGenomes-Tr; EFT00001982991.
DR   EnsemblGenomes-Tr; EFT00001982992.
DR   EnsemblGenomes-Tr; EFT00001982993.
DR   EnsemblGenomes-Tr; EFT00001982994.
DR   EnsemblGenomes-Tr; EFT00001982995.
DR   EnsemblGenomes-Tr; EFT00001982996.
DR   EnsemblGenomes-Tr; EFT00001982997.
DR   EnsemblGenomes-Tr; EFT00001982998.
DR   EnsemblGenomes-Tr; EFT00001982999.
DR   EnsemblGenomes-Tr; EFT00001983000.
DR   EnsemblGenomes-Tr; EFT00001983001.
DR   EnsemblGenomes-Tr; EFT00001983002.
DR   EnsemblGenomes-Tr; EFT00001983003.
DR   EnsemblGenomes-Tr; EFT00001983004.
DR   EnsemblGenomes-Tr; EFT00001983005.
DR   EnsemblGenomes-Tr; EFT00001983006.
DR   EnsemblGenomes-Tr; EFT00001983007.
DR   EnsemblGenomes-Tr; EFT00001983008.
DR   EnsemblGenomes-Tr; EFT00001983009.
DR   EnsemblGenomes-Tr; EFT00001983010.
DR   EnsemblGenomes-Tr; EFT00001983011.
DR   EnsemblGenomes-Tr; EFT00001983012.
DR   EnsemblGenomes-Tr; EFT00001983013.
DR   EnsemblGenomes-Tr; EFT00001983014.
DR   EnsemblGenomes-Tr; EFT00001983015.
DR   EnsemblGenomes-Tr; EFT00001983016.
DR   EnsemblGenomes-Tr; EFT00001983017.
DR   EnsemblGenomes-Tr; EFT00001983018.
DR   EnsemblGenomes-Tr; ZYRO0A00418r-1.
DR   EnsemblGenomes-Tr; ZYRO0A01012r-1.
DR   EnsemblGenomes-Tr; ZYRO0A01826r-1.
DR   EnsemblGenomes-Tr; ZYRO0A02046r-1.
DR   EnsemblGenomes-Tr; ZYRO0A02090r-1.
DR   EnsemblGenomes-Tr; ZYRO0A02354r-1.
DR   EnsemblGenomes-Tr; ZYRO0A02376r-1.
DR   EnsemblGenomes-Tr; ZYRO0A02992r-1.
DR   EnsemblGenomes-Tr; ZYRO0A03014r-1.
DR   EnsemblGenomes-Tr; ZYRO0A03432r-1.
DR   EnsemblGenomes-Tr; ZYRO0A04202r-1.
DR   EnsemblGenomes-Tr; ZYRO0A04884r-1.
DR   EnsemblGenomes-Tr; ZYRO0A05698r-1.
DR   EnsemblGenomes-Tr; ZYRO0A05720r-1.
DR   EnsemblGenomes-Tr; ZYRO0A06424r-1.
DR   EnsemblGenomes-Tr; ZYRO0A06556r-1.
DR   EnsemblGenomes-Tr; ZYRO0A06732r-1.
DR   EnsemblGenomes-Tr; ZYRO0A07414r-1.
DR   EnsemblGenomes-Tr; ZYRO0A07612r-1.
DR   EnsemblGenomes-Tr; ZYRO0A07832r-1.
DR   EnsemblGenomes-Tr; ZYRO0A08756r-1.
DR   EnsemblGenomes-Tr; ZYRO0A09064r-1.
DR   EnsemblGenomes-Tr; ZYRO0A09174r-1.
DR   EnsemblGenomes-Tr; ZYRO0A09746r-1.
DR   EnsemblGenomes-Tr; ZYRO0A10692r-1.
DR   EnsemblGenomes-Tr; ZYRO0A10978r-1.
DR   EnsemblGenomes-Tr; ZYRO0A11946r-1.
DR   EnsemblGenomes-Tr; ZYRO0A12078r-1.
DR   EnsemblGenomes-Tr; ZYRO0A12122r-1.
DR   EnsemblGenomes-Tr; ZYRO0A12188r-1.
DR   EnsemblGenomes-Tr; ZYRO0A12210r-1.
DR   EnsemblGenomes-Tr; ZYRO0A12232r-1.
DR   EnsemblGenomes-Tr; ZYRO0A12276r-1.
DR   EnsemblGenomes-Tr; ZYRO0A12584r-1.
DR   EnsemblGenomes-Tr; ZYRO0A12716r-1.
DR   EnsemblGenomes-Tr; ZYRO0A12760r-1.
DR   EnsemblGenomes-Tr; ZYRO0A13508r-1.
DR   EnsemblGenomes-Tr; ZYRO0A13684r-1.
DR   EuropePMC; PMC2765284; 19525356.
DR   EuropePMC; PMC5734014; 29079616.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00030; RNase_MRP.
DR   RFAM; RF00472; snosnR55.
DR   RFAM; RF00474; snosnR57.
DR   RFAM; RF00476; snosnR61.
DR   RFAM; RF00477; snosnR66.
DR   RFAM; RF01237; snR161.
DR   RFAM; RF01252; snR5.
DR   RFAM; RF01253; snR46.
DR   RFAM; RF01257; snR31.
DR   StrainInfo; 105346; 0.
XX
CC   The Zygosaccharomyces rouxii sequence is made of 7 chromosomes (A to G).
CC   The sequence was annotated by the Genolevures Consortium. For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1114666
FT                   /organism="Zygosaccharomyces rouxii"
FT                   /chromosome="A"
FT                   /strain="CBS 732"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Zyro0A"
FT                   /db_xref="taxon:4956"
FT   gene            <1150..>2192
FT                   /pseudo
FT                   /locus_tag="ZYRO0A00110g"
FT                   /old_locus_tag="pseudo-Zyro0A-1150-2192"
FT   gene            complement(<3142..>4002)
FT                   /locus_tag="ZYRO0A00132g"
FT                   /old_locus_tag="ZYRO-ORF9648"
FT   CDS_pept        complement(3142..4002)
FT                   /locus_tag="ZYRO0A00132g"
FT                   /old_locus_tag="ZYRO-ORF9648"
FT                   /product="ZYRO0A00132p"
FT                   /note="some similarities with uniprot|P36034 Saccharomyces
FT                   cerevisiae YKL219W COS9"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25450"
FT                   /db_xref="GOA:C5DP39"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP39"
FT                   /protein_id="CAR25450.1"
FT                   /translation="MSIISDESEMDLEKCVQTFEEEEIELPEDSSGGKLTYFLAPYFFE
FT                   KKWISDIIFPLFGALLVLLIRLAYFSLRDYFDTQLEMKPSDIFSPLWMIIHYLLCFTTC
FT                   FVNFIYHRKNFNIETKALQKLLKEVAEMDLTGDPAAWQRIASRVNHFSEEGGHHYPLFY
FT                   SGEHCMRFFVREIVKPIERQTYDIRCYQEGSTVVNFWKNPPNKALTERALANYNKCVES
FT                   FGKLSHTAEKDEFRDGIFEKFHSIFNTSLFYLVIIEYVSFVIMALALIVLLISRAIFDL
FT                   FATPH"
FT   gene            <4324..>5022
FT                   /locus_tag="ZYRO0A00154g"
FT                   /old_locus_tag="ZYRO-ORF9646"
FT   CDS_pept        4324..5022
FT                   /locus_tag="ZYRO0A00154g"
FT                   /old_locus_tag="ZYRO-ORF9646"
FT                   /product="ZYRO0A00154p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25451"
FT                   /db_xref="GOA:C5DP40"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP40"
FT                   /protein_id="CAR25451.1"
FT                   /translation="MSNKKKSKSKASESHKRGGRENSPRGQHNSPSLQRDNSISDQQGS
FT                   ENSGTGSGTNGIKLAARLLRNPLFSKRGFEHAKEGLKSERTGDSISTLKCIGSGLLFLY
FT                   PIVFIIYSIFGLASGDKNNSIHVFVYGGPLFTAVPYFIRYLDDVDTLLLSIFEIGEKSL
FT                   LGYFADPGIREFLLTVFEIAGLIYQCVKGRQTFKVFFWGIVGFIFYLVGNIILILERKK
FT                   RPESVVGNST"
FT   gene            <6051..>6665
FT                   /pseudo
FT                   /locus_tag="ZYRO0A00176g"
FT                   /old_locus_tag="pseudo-Zyro0A-6051-6665"
FT   gene            complement(<7771..>8634)
FT                   /locus_tag="ZYRO0A00198g"
FT                   /old_locus_tag="ZYRO-ORF9641"
FT   CDS_pept        complement(7771..8634)
FT                   /locus_tag="ZYRO0A00198g"
FT                   /old_locus_tag="ZYRO-ORF9641"
FT                   /product="ZYRO0A00198p"
FT                   /note="some similarities with uniprot|P47187 Saccharomyces
FT                   cerevisiae YJR161C COS5"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25452"
FT                   /db_xref="GOA:C5DP41"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP41"
FT                   /protein_id="CAR25452.1"
FT                   /translation="MSVISDESEMDLEKCVQTFEEEKIELPEDSSGGKLTYFLAPYFFE
FT                   KTWLDDIIASLSAAFLSPSLVRLPYFIMRDLYDDPFETKLSDIFSPLLMIIHYFLCFTF
FT                   SFWNFIDNRKKVNIEKKVLQQLLKEVAEMDLTGDPVAWQRIASRVNHFSRETGYRYSLF
FT                   CSGEHCMRFFVREIVKPIECQTYDIRCYLEGRMCVNFWKNPPDKVLVERAVANYNKSVE
FT                   NFGELSHTAEKDKFRDGIFEKFLNIFSTSILYLGAIHSASFVVMYLTYIISMISCAIFD
FT                   SFTAPH"
FT   gene            <9173..>10243
FT                   /locus_tag="ZYRO0A00220g"
FT                   /old_locus_tag="ZYRO-ORF9639"
FT   CDS_pept        9173..10243
FT                   /locus_tag="ZYRO0A00220g"
FT                   /old_locus_tag="ZYRO-ORF9639"
FT                   /product="ZYRO0A00220p"
FT                   /note="weakly similar to uniprot|P47187 Saccharomyces
FT                   cerevisiae YJR161C COS5 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25453"
FT                   /db_xref="GOA:C5DP42"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP42"
FT                   /protein_id="CAR25453.1"
FT                   /translation="MESDKESQRPVLPQDLFRNELTWMFYEMCKHRFPWVVSCLCLVAG
FT                   WVVAQMNFTYKNMLVSDMTAGALFGCALVWPFVRVRYLKFYPNTTELVQQVLESNPEVD
FT                   IEKWAEIANRLNIYFYQEHLWSTPHFFFNNQHVQLVFKDNVLRPYLEGKLDDITDMDKI
FT                   QSANCYLQSLNEKFELLLKVNLPEPVLNSELPRGTHRNKFSFYAAYLFVGFMVCYYQAL
FT                   TLLMIVMAFILNFFLLLINAILFQYLTLRIYQDSYCTLYPQMDIIRAMNFLAIIIKVSP
FT                   GKEPVKWDQIARYMNQYLAEENNGHSTNIFLDGKHCLNCYKTCFEPLSTNNGPSKYCDL
FT                   KEIVEGTQPSVNGETN"
FT   gene            complement(<11435..>12292)
FT                   /locus_tag="ZYRO0A00242g"
FT                   /old_locus_tag="ZYRO-ORF9637"
FT   CDS_pept        complement(11435..12292)
FT                   /locus_tag="ZYRO0A00242g"
FT                   /old_locus_tag="ZYRO-ORF9637"
FT                   /product="ZYRO0A00242p"
FT                   /note="some similarities with uniprot|Q70DG7 Saccharomyces
FT                   cerevisiae YHL044W Putative integral membrane protein
FT                   member of DUP240 gene family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25454"
FT                   /db_xref="GOA:C5DP43"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP43"
FT                   /protein_id="CAR25454.1"
FT                   /translation="MSMISYEGERDLEKCEQTFEEEEIELPEDSTGGKLTYFLAPYFFE
FT                   KTWLYDIITSLSAALLSSVTPLVYFSLCDFYHDPLESELSDFLSPLWMIIHCFLCFMML
FT                   FVNFIDHRKKVNIETKALQKLLKEVGEMDLTGDPVAWRRIASRVNHFSEETGYRYSLFC
FT                   SGEHCMRFFVREIVKPIECQTYDIRCYYERERYRNFWKNPSNKALTERALANYNNSVEN
FT                   FGELLHTTEKDKFRHGIFEKFLNIFSTSILYLGAIEFASFMIMMLTFIISMIAWIIFHP
FT                   FATA"
FT   gene            <12613..>13308
FT                   /locus_tag="ZYRO0A00264g"
FT                   /old_locus_tag="ZYRO-ORF9636"
FT   CDS_pept        12613..13308
FT                   /locus_tag="ZYRO0A00264g"
FT                   /old_locus_tag="ZYRO-ORF9636"
FT                   /product="ZYRO0A00264p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25455"
FT                   /db_xref="GOA:C5DP44"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP44"
FT                   /protein_id="CAR25455.1"
FT                   /translation="MSNKKKSKSKASESHKRGGRENSPRGQHNSLSPQRGNSISDQQGS
FT                   ENSGTGSGTNGIKLAARLFRNPLFSKRGFKHAKEGLKSERTGDSISGVRCFGSFFLFVY
FT                   PFLLIGYCIHGFLAGDINSKSAFLYGIPLCIAVPYCIRYLDDVDTLLSSIFEIGEKSLL
FT                   GYFADPVIREFLLTVFEIAGLIYKCIESSQKSRIYVWRIVGFVLYLVGHTLLILERKKR
FT                   PGSVADASA"
FT   gene            <15089..>16114
FT                   /locus_tag="ZYRO0A00286g"
FT                   /old_locus_tag="ZYRO-ORF9633"
FT   CDS_pept        15089..16114
FT                   /locus_tag="ZYRO0A00286g"
FT                   /old_locus_tag="ZYRO-ORF9633"
FT                   /product="ZYRO0A00286p"
FT                   /note="highly similar to uniprot|Q02895 Saccharomyces
FT                   cerevisiae YPL088W Putative aryl alcohol dehydrogenase
FT                   transcription is activated by paralogous transcription
FT                   factors Yrm1p and Yrr1p along with genes involved in
FT                   multidrug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25456"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP45"
FT                   /protein_id="CAR25456.1"
FT                   /translation="MGSIKPVKLGNSGLKISPILVGCMSYGSKKWQEWVIEDKQEVFKI
FT                   LKHCYDSGLRTFDTADFYSNGISERLLGEFLKTYNINRETVVILSKVFYPVDDTMELNP
FT                   SFDSVENELNLSNQRGLSRKHILAGVSNSVRRLGTYIDVLQIHRLDHDTPMKEIMRALN
FT                   DVVERGDARYIGASSMLATEFAELQFIAEKYDWFQFISSQSCYNLLYREDERELIPFAK
FT                   KHNIGLIPWSPNARGLLTRPLRQTTERSKKDWGFKVVKLDKLEDSDREIISRVEAIGKE
FT                   KGVSMAAVSMAWVLHKGCYPIVGLNSVERVDEAKEALSIKLTDDEILHLEEPYKTKASL
FT                   F"
FT   gene            complement(<16982..>18676)
FT                   /locus_tag="ZYRO0A00308g"
FT                   /old_locus_tag="ZYRO-ORF9632"
FT   CDS_pept        complement(16982..18676)
FT                   /locus_tag="ZYRO0A00308g"
FT                   /old_locus_tag="ZYRO-ORF9632"
FT                   /product="ZYRO0A00308p"
FT                   /note="similar to uniprot|P43548 Saccharomyces cerevisiae
FT                   YFL055W AGP3 Low-affinity amino acid permease may act to
FT                   supply the cell with amino acids as nitrogen source in
FT                   nitrogen-poor conditions transcription is induced under
FT                   conditions of sulfur limitation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25457"
FT                   /db_xref="GOA:C5DP46"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP46"
FT                   /protein_id="CAR25457.1"
FT                   /translation="MGWTDINILTKGKGDDASCESYTSSGITPDQIETGEGKNHNASLY
FT                   DPKTGVKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIM
FT                   ESIGEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWG
FT                   PQVPLYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKD
FT                   RPAFGFHYWNNPGALSHGFKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPLAIRQ
FT                   TFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKALKSPISIAITRAGWEGGTHLVNAFIL
FT                   VTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLMNVS
FT                   VGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQII
FT                   GIAANIFLALIQGWTSFVPFKAGDFVDAYVLLPAAAVLYIGISLLKTHSFKTVDLLTID
FT                   LDEGRRVDLDATFVDEDEDELDGEQDTNGEKFSKGKSYREKITRFFA"
FT   gene            <19597..>21327
FT                   /locus_tag="ZYRO0A00330g"
FT                   /old_locus_tag="ZYRO-ORF9630"
FT   CDS_pept        19597..21327
FT                   /locus_tag="ZYRO0A00330g"
FT                   /old_locus_tag="ZYRO-ORF9630"
FT                   /product="ZYRO0A00330p"
FT                   /note="similar to uniprot|P38358 Saccharomyces cerevisiae
FT                   YBR293W VBA2 Permease of basic amino acids in the vacuolar
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25458"
FT                   /db_xref="GOA:C5DP47"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP47"
FT                   /protein_id="CAR25458.1"
FT                   /translation="MDGEIAQPLLTRTVSSSNKQTNADKINQHYLSISHSDVGEYREEP
FT                   NDDEQGDLDDETTPLSRIPHLWLIEAALYTNVFLSGFDSTVTASTYQTIGNEFNHMDLS
FT                   SWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGISINILWLSFMRA
FT                   FTGIGGGGLITLSTIVNSDMIPTSKRGIFQAFQNLLLGLGAICGASFGGVITSSIGWRW
FT                   CFLLQVPISLAGALIGHLYVRNQDEYERRKSKESSQTKEMLKHIDFSGAFLIIIGLTLQ
FT                   LVYLSLGSAADESGNTWSSPGLSAVLVASFIVLVLFVLTEERTSARAIIPSKLVRSLFS
FT                   FLVLTISVLVGFASYAYLFTLPLFFQVILGDSTAKAGLRLAIPSVFTPVGGLIAGICMS
FT                   KFNCLQTLLYVGIAFMCLGNFLFLYIGADATDSLIGFFLIPANLGQGITFPSSLFTFIF
FT                   AFSKIDQATATSTLYLFRSIGSVWGVTGSAGIVQFCFSHHLEKALEGLLDERKIRKLIK
FT                   KITSNTSYIKELEGPVKVAVIESFDTATKKVHLISTSFCLVALILCVIKDVFKPKTTKS
FT                   "
FT   gene            <21776..>22063
FT                   /pseudo
FT                   /locus_tag="ZYRO0A00352g"
FT                   /old_locus_tag="pseudo-Zyro0A-21776-22063"
FT   gene            complement(<23054..>24706)
FT                   /locus_tag="ZYRO0A00374g"
FT                   /old_locus_tag="ZYRO-ORF9625"
FT   CDS_pept        complement(23054..24706)
FT                   /locus_tag="ZYRO0A00374g"
FT                   /old_locus_tag="ZYRO-ORF9625"
FT                   /product="ZYRO0A00374p"
FT                   /note="similar to uniprot|P40445 Saccharomyces cerevisiae
FT                   YIL166C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25459"
FT                   /db_xref="GOA:C5DP48"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP48"
FT                   /protein_id="CAR25459.1"
FT                   /translation="MGIRQLISQQEVEQKSDEDKQYITEDIEQLSTDSSIDASSNVFAD
FT                   PEIANYYSSIYENSQYECRHLFDPDFTWTRKEEKRVIKKNDWYVTFWTFLMFTALDFDR
FT                   SNISQALSDNMLENLNLTTNDYNTANTINLVCFLAAELPSQLISKKIGADVWIPTQMCL
FT                   WSIVSVCQASMTTKSGFYATRALLGALQGGFICDVCLWMSYFFTSKELPFRLSLFYIAN
FT                   PMTSVWSSLLSFGLLKIKTGGLMNQSWRWLFLVEGLFTLLIGIMSFLKMPPSPAQTKAW
FT                   YRKKGWYTDREEKIVVNRVLRDDPTKGDMHNRQPVSPKELLKTLLDYDLLPIYIVRFLG
FT                   DIGSSPVSTYMTLTLRKLGFSTYKTNALSIPYNVLSVITMLLAGYFSEIVNQRSLIIMG
FT                   TPIWILACLFPLRFWPGSQVNTWGTYALLTVLLGHAPIWPLSISWCSANSNSVRTRAVS
FT                   AAMVNIYSQAAGIVSANIYRTPDKPLYHKGNDALIGIAFGTIAACLFTKFYYIYRNKQK
FT                   DKIWNAFTEEEKLRYTIETTDDGNKRLDFRFVH"
FT   gene            complement(<25837..>26589)
FT                   /locus_tag="ZYRO0A00396g"
FT                   /old_locus_tag="ZYRO-ORF9623"
FT   CDS_pept        complement(25837..26589)
FT                   /locus_tag="ZYRO0A00396g"
FT                   /old_locus_tag="ZYRO-ORF9623"
FT                   /product="ZYRO0A00396p"
FT                   /note="similar to uniprot|P40579 and to YIR036C
FT                   uniprot|P40580 Saccharomyces cerevisiae, Hypothetical ORFs"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25460"
FT                   /db_xref="GOA:C5DP49"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP49"
FT                   /protein_id="CAR25460.1"
FT                   /translation="MVKSVIVTGVSRGIGRSIVEQIIGAGENAVVTGIARSESSLKSLK
FT                   EQFGDKFFYVVGDVTDKNAASALVQEALNKTGKIDAVVANAGVLEPVQTVQKADVDGWK
FT                   QLFDVNFFSVLSLATLAMPHLIKSQGNLVLVSSDACNMWFSGWGAYGASKAALNHLALT
FT                   ISKECDGVKAIAVAPGVVDTSMQDSIRENYGPSGMTPEAQKLFNDFKANGVLLDVKIPA
FT                   RVYANLALQGIPNELNGEYVSYDDKRLG"
FT   gene            <27262..>27333
FT                   /locus_tag="ZYRO0A00418r"
FT                   /old_locus_tag="Zyro0A.tAsp.GTC.1"
FT   tRNA            27262..27333
FT                   /locus_tag="ZYRO0A00418r"
FT                   /old_locus_tag="Zyro0A.tAsp.GTC.1"
FT                   /note="tRNA-Asp (GTC) cove score=60.45"
FT   gene            complement(<27895..>30447)
FT                   /locus_tag="ZYRO0A00440g"
FT                   /old_locus_tag="ZYRO-ORF9622"
FT   CDS_pept        complement(27895..30447)
FT                   /locus_tag="ZYRO0A00440g"
FT                   /old_locus_tag="ZYRO-ORF9622"
FT                   /product="ZYRO0A00440p"
FT                   /note="similar to uniprot|P05085 Saccharomyces cerevisiae
FT                   YML099C ARG81 Zinc-finger transcription factor of the
FT                   Zn(2)-Cys(6) binuclear cluster domain type involved in the
FT                   regulation of arginine-responsive genes acts with Arg80p
FT                   and Arg82p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25461"
FT                   /db_xref="GOA:C5DP50"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP50"
FT                   /protein_id="CAR25461.1"
FT                   /translation="MERRTRTSTTGVSDLVVNPHHGNRLKNGTKSKRGKTFTGCWTCRS
FT                   RKVKCDLRRPHCQRCEKSGLVCGGYDIKLRWSKPLQFDEFGVPISAAQGNAQDNTSGAS
FT                   NDEPQYQRRNIDFVRYDEEYEFYEDMDDELSTLHNPPLEKIADNRTWIIKKFGVFKGTD
FT                   DALLNYGKNKGKRRKMEKPVERQEPAIESSNSQTAPASVPSTAPVMDEQEILDMTYATP
FT                   NNHEWISKELRDDALLSASALQGFPIMDLQFEDNTAPLDEGIGSAIQEPNDFFSTSGDD
FT                   AALSRALRLLFHRHPSLDVEKVATPSHKDSSMEPIVPLGNQIDIDCTLLDSKMPKPAME
FT                   VVDSQLPDPRIFNVPGSQNPFLQLPTTGVQIHGLTRFLLNYYYKNVADLMTVVALNQNP
FT                   WKKLYFPRALKAVGDLAGMGYTANSRNSLLNALLAVSCFNLQSKFVKNSPEMQFYLNLG
FT                   IEFRKQASSFLKICLSNTVKQERYKDVLTAILSMNSIDVVWGTMADCQQHLTICENFVK
FT                   ARMKARPKISEKAKTLHRIFSFLKLIQDSTALDQVTDQEINDDENKDRDTNDDGQQGFD
FT                   FNTLRDPSPVSGSEEGSFREFVKYDGKIQIGFVKDSNMAQSSSVSTPIFKNIASESYAY
FT                   SDERMVTVEDIMSTDALYGLPQSLILLFSDCVKLARHKEYYRLKNMTTPRHFASLCQRF
FT                   EKRLFKWRSEWKCLKEGSEEFINDTIEGLHHHTSSFYYGLFIYYHTMVKDLNHSSLQMY
FT                   VEKVLTHLKLMSNLILFKKVRIVPLIWQGFVAGCASTKLETQEEFRKWAATLASSGMGS
FT                   YWGARQIMFEVWRRKRNGESGDSWYSVYRDWEMNLMLS"
FT   gene            <30948..>31589
FT                   /locus_tag="ZYRO0A00462g"
FT                   /old_locus_tag="ZYRO-ORF9621"
FT   CDS_pept        30948..31589
FT                   /locus_tag="ZYRO0A00462g"
FT                   /old_locus_tag="ZYRO-ORF9621"
FT                   /product="ZYRO0A00462p"
FT                   /note="similar to uniprot|P11747 Saccharomyces cerevisiae
FT                   YML098W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25462"
FT                   /db_xref="GOA:C5DP51"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP51"
FT                   /protein_id="CAR25462.1"
FT                   /translation="MSRKLKRTNLFAKDVSSLLYAYGDVSQPLPETVQCLDELVSGYLV
FT                   DVCSSAFRAAQNCQRNKLKLEDFRFAVRRDPIKLGRAEDLVATNKLITEAKKQFNGSDS
FT                   SSLKRFKDGEGNDLEGEGEDEDYEDYDDEADEDAAGGGNTHLDDDDKHMDSEIHHKSKG
FT                   NIDNSFEDDNELHQVKSEKKSKSSTRGGKQGSRGGSKTRGKRQKRGTSGT"
FT   gene            complement(<31637..>33382)
FT                   /locus_tag="ZYRO0A00484g"
FT                   /old_locus_tag="ZYRO-ORF9620"
FT   CDS_pept        complement(31637..33382)
FT                   /locus_tag="ZYRO0A00484g"
FT                   /old_locus_tag="ZYRO-ORF9620"
FT                   /product="ZYRO0A00484p"
FT                   /note="similar to uniprot|Q03103 Saccharomyces cerevisiae
FT                   YML130C ERO1 Glycoprotein required for oxidative protein
FT                   folding in the endoplasmic reticulum"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25463"
FT                   /db_xref="GOA:C5DP52"
FT                   /db_xref="InterPro:IPR007266"
FT                   /db_xref="InterPro:IPR037192"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP52"
FT                   /protein_id="CAR25463.1"
FT                   /translation="MKAGSSLLSLVSLLAVGSRAQNVTENNLEPRSISFGGNTSVVPSA
FT                   VPPPVPPPLNSTYFCTIDKGEVINPTCDVTFDEINEINGKIRKDLVSLVHTDFFKYFRL
FT                   HLYKQCPFWNQNNGFCVNRACAVDVVEDWDSLPEYWQPEVLGGLQENETISDEESVKED
FT                   CKFLDDLCANNKKQRMIEPDIEYCDINDLHGEGSVLVDLTANPERFTGYGGQESSQIWS
FT                   SIYGENCFSQGETGQSLAKDAFYRLVSGLHASIGTHLSNDHLNTETGKWGPDLDLFMAR
FT                   VGNFPDRVSNMYFNYAVVSKALWKIKPYLDHLKFCDSYDPSVKATIMNILSQLDSKVFN
FT                   ENLIFEGELSSKLKDDFRIRFKNVTQIMDCVHCDRCRMWGKVQTTGYATSLKILFELDE
FT                   SNENSKQHVVDKLTKYELIALFNTFDRLSKSIESVNNFEKMYNVRLEGGKIASFFKQNN
FT                   FFKLLGRASRSISESVQSISKSIDQVSESQKPSGPVFADLKLPETNSKGSDEPKTNVWV
FT                   KAWHTEIHNVCEAFKFIFRSYLDLPRNLYTLVLSVVNSMWNSFVGARYWNWEEENPVVY
FT                   NLNTW"
FT   gene            complement(<33846..>35222)
FT                   /locus_tag="ZYRO0A00506g"
FT                   /old_locus_tag="ZYRO-ORF9618"
FT   CDS_pept        complement(33846..35222)
FT                   /locus_tag="ZYRO0A00506g"
FT                   /old_locus_tag="ZYRO-ORF9618"
FT                   /product="ZYRO0A00506p"
FT                   /note="similar to uniprot|P54787 Saccharomyces cerevisiae
FT                   YML097C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25464"
FT                   /db_xref="GOA:C5DP53"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR037191"
FT                   /db_xref="InterPro:IPR041545"
FT                   /db_xref="InterPro:IPR041804"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP53"
FT                   /protein_id="CAR25464.1"
FT                   /translation="MSNIKQDLSEFDPLTQAETSPKDQNTAGEERTVEESTNRSATVGE
FT                   KDDGDEDEEPFYDFQLFIQQLRDPHAEPIVRFIKSFLHDFQTVRVLWTAKEQSKLINDF
FT                   KIFIYDKFGLYKPFCELEGSKLRNAQEGLEKLIMGKLYARCFSPCLEPLEQSLDKEHLQ
FT                   DLKDDRQLKLKSREYRFISPQELDIPNLLSDKLNKLVELSGKELNKVNHFKAPRDKMIC
FT                   VLNSCKIIMAMLTNNKLENGADSFIPLLIYTILKSNLSSLASNTRYIERFRFESFFRGE
FT                   ALYYLNSLQAAVSFIISINESTFTIENRNQFKQRYDDNQKQLIKEDEISERERENNSIV
FT                   NPRLSKSPNPSQFILQPLDEAANTIKGKVNEFFTSAKPQLKPEDEARRTDTSPPSVALY
FT                   DEDNQDIDRLAQKLQDREQRNTLSTLKSMFPEMDPEIVEDVCIAKKYRVGATVDILLSL
FT                   "
FT   gene            <35425..>36963
FT                   /locus_tag="ZYRO0A00528g"
FT                   /old_locus_tag="ZYRO-ORF9617"
FT   CDS_pept        35425..36963
FT                   /locus_tag="ZYRO0A00528g"
FT                   /old_locus_tag="ZYRO-ORF9617"
FT                   /product="ZYRO0A00528p"
FT                   /note="similar to uniprot|Q04489 Saccharomyces cerevisiae
FT                   YML096W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25465"
FT                   /db_xref="GOA:C5DP54"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP54"
FT                   /protein_id="CAR25465.1"
FT                   /translation="MCGILLHYATNQNFCNELLEFEEGFQGSKSGSSNSSQIFNAIVPY
FT                   VAARGPNFSSLRVSKEHCISWFSSVLSLREPFIRQSVEVGDRYILQFNGELYNEEILDN
FT                   DTSFVASLLENDKMSVFEVISFLEGEFAYTIYDMHEHKLYFGRDDIGKRSLSYRLDQAI
FT                   GDIYVASVTGQQEGFTDCLAGIVYIYDVEDKSLNQQMLPILNREVSSEIIEDEDEFQRI
FT                   THALYEQLKSAIVKRVESIHPMHLENSPIAVLFSGGLDCSVIAAMICQQLENQPSRRTV
FT                   ELLNVSFENYRTGLSPHDTPDRKLAVKSANALKQLFPSVDIKLVEIDVPYETYEEHRPK
FT                   VIDLMYPKNTEMDLSISIAFYFASKGSGYIDCGNGQRKKYQRQGIVLFSGLGADELYGG
FT                   YYKFARKSTDELVEELTRQINNIYNRNLNRDDKVIAANGVEVRYPFLDRHVIEFSMQSI
FT                   PINWKINKLILRKLALEKLNLNSISEEPKRAIQFGSKSAKMTKDGNRHGTDVLK"
FT   gene            complement(<36968..>37588)
FT                   /locus_tag="ZYRO0A00550g"
FT                   /old_locus_tag="ZYRO-ORF9615"
FT   CDS_pept        complement(36968..37588)
FT                   /locus_tag="ZYRO0A00550g"
FT                   /old_locus_tag="ZYRO-ORF9615"
FT                   /product="ZYRO0A00550p"
FT                   /note="similar to uniprot|P06838 Saccharomyces cerevisiae
FT                   YML095C RAD10 Single-stranded DNA endonuclease (with Rad1p)
FT                   cleaves single-stranded DNA during nucleotide excision
FT                   repair and double-strand break repair subunit of Nucleotide
FT                   Excision Repair Factor 1 (NEF1) homolog of human XPF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25466"
FT                   /db_xref="GOA:C5DP55"
FT                   /db_xref="InterPro:IPR004579"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP55"
FT                   /protein_id="CAR25466.1"
FT                   /translation="MNNTDTTSFQSILAGVKRLRDQNGSGDENSSKKHQQQRTTEQVEP
FT                   SKDVRSNEVISSFNQQRSATGDSNTNEETSGAAPIRVSNTGKSVLVNTTQKANPLLNHL
FT                   KNTNWRYVSSTGGNKIYYDYLIKNRSVLFLTLTYHKLYTEYISRRMLPLQRSDDNILIF
FT                   VVDDKNSEDILTEITKLCMFKGFTLLVAFNFEQAAKYIGYLNC"
FT   gene            <37726..>38292
FT                   /locus_tag="ZYRO0A00572g"
FT                   /old_locus_tag="Zyro0A.mRNA.276.p"
FT   CDS_pept        join(37726..37741,37823..38292)
FT                   /locus_tag="ZYRO0A00572g"
FT                   /old_locus_tag="Zyro0A.mRNA.276.p"
FT                   /product="ZYRO0A00572p"
FT                   /note="highly similar to uniprot|Q04493 Saccharomyces
FT                   cerevisiae YML094W GIM5 Subunit of the heterohexameric
FT                   cochaperone prefoldin complex which binds specifically to
FT                   cytosolic chaperonin and transfers target proteins to it"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25467"
FT                   /db_xref="GOA:C5DP56"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP56"
FT                   /protein_id="CAR25467.1"
FT                   /translation="MSSQRIDLTKLGPEQLAAVKQQIDQEFQHFNQSLQALTLARNRFQ
FT                   DCIEDIKSISSPENKDQKIMVPASASLYIPGKIVENDKFMVDVGTGYYVEKTDTEAMSF
FT                   YEHKIQKLNKESVQIQNIIKEKTSASLAIEAHIRQAAMSQHQEALKQQQAQQPTNAN"
FT   gene            <38479..>41073
FT                   /locus_tag="ZYRO0A00594g"
FT                   /old_locus_tag="ZYRO-ORF9613"
FT   CDS_pept        38479..41073
FT                   /locus_tag="ZYRO0A00594g"
FT                   /old_locus_tag="ZYRO-ORF9613"
FT                   /product="ZYRO0A00594p"
FT                   /note="similar to gnl|GLV|CAGL0H06985g Candida glabrata
FT                   CAGL0H06985g and weakly similar to YML093W uniprot|Q04500
FT                   Saccharomyces cerevisiae YML093W UTP14 Nucleolar protein
FT                   component of the small subunit (SSU) processome containing
FT                   the U3 snoRNA that is involved in processing of pre-18S
FT                   rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25468"
FT                   /db_xref="GOA:C5DP57"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP57"
FT                   /protein_id="CAR25468.1"
FT                   /translation="MAKKKNQPSSKLRKRAQNALELAQNELGESDYSDDESAYNSGRRG
FT                   VLNISRRGQDEDEFEGSENGEESFEDEDLDSDEALGSDDEYDVMNSKFSQTIRDKQKNK
FT                   NRNQEPEGDSDEEYTSIDEADLLPLSAVWDKAGNDDDDGDSSSGAEENSNGKLELQNEN
FT                   EIDGDDDDDDDEGDESESSQESGSEENPFDEVPQDDDDEVELNNVTSGLMKEGDKQEYK
FT                   RLNNYGTGKENEYALPSATSVSGSNKLNLADMIGVVDDKEAAAKATLVQDNSSTLSVPL
FT                   PQRIQQRHERKAAYEISKDEMDKWKDVVQQNRRAEHLDFASGRSVPDNTSSTFTRSAGQ
FT                   PQTELEEKVDKVLQNSNLVDPVKNSTFEELATAKMSPEDMKKKTREMRLMRELMFREER
FT                   KAKRLKKIKSKTYRRIKKKEMLKNRELAGVDEESDEDADVARAKERMTLKHRANSKWAK
FT                   EMVKHGMTNDAETREEMEEMLRQGERLNTKVLDHDSEEDDPNLSDIEREEEKEQSQGTS
FT                   GEKLGKSGIMDMAFMKTAEAREKDENRKTMEALRAAEVSGNVDEESDDEKAANVELNQG
FT                   RRIYNSVASVNSKQERAKKSGDKPNGKKQVKDGEVEVRYEEPEQQEARNGKESEDKKTE
FT                   SVNPWLATGDEEDESTVKHSSKVSVVDKDSTKAAKNLYKIEKKGKRNSKAADADEDLLL
FT                   DADDQHHMTFQTEDLTPNFMFKQQDVVAEAFAGDDVVTSFDDDKKRVAESEDDKEEDVT
FT                   LPGWGQWAGAGSNPKKKRKFVKKIKGTVEKNKRKDKNLQNVIINEKLNKKNLKYQSSAV
FT                   PFPFESKEQYERSLRMPLGSEWTSSSAHQKMIKPRILTKPSEVIDPLKAPFK"
FT   gene            complement(<41163..>41915)
FT                   /locus_tag="ZYRO0A00616g"
FT                   /old_locus_tag="ZYRO-ORF9609"
FT   CDS_pept        complement(41163..41915)
FT                   /locus_tag="ZYRO0A00616g"
FT                   /old_locus_tag="ZYRO-ORF9609"
FT                   /product="ZYRO0A00616p"
FT                   /note="highly similar to uniprot|P23639 Saccharomyces
FT                   cerevisiae YML092C PRE8 20S proteasome beta-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25469"
FT                   /db_xref="GOA:C5DP58"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR034644"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP58"
FT                   /protein_id="CAR25469.1"
FT                   /translation="MADRYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVI
FT                   ATEKKSSSPLALTETLNKISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEY
FT                   PPTKLLVSEIAKIMQEATQSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATA
FT                   IGKGSTAAKTFLEKRWNEELELEDAIHTVLLTLKESVEGEFNGDTIEIAVIGDENKDLL
FT                   GYKGVPGDKGPRFRKLTAQEINDRLDAL"
FT   gene            complement(<42373..>42786)
FT                   /locus_tag="ZYRO0A00638g"
FT                   /old_locus_tag="ZYRO-ORF9608"
FT   CDS_pept        complement(42373..42786)
FT                   /locus_tag="ZYRO0A00638g"
FT                   /old_locus_tag="ZYRO-ORF9608"
FT                   /product="ZYRO0A00638p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25470"
FT                   /db_xref="GOA:C5DP59"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP59"
FT                   /protein_id="CAR25470.1"
FT                   /translation="MVNFSPEGIDPQDFDALYEDIYMEACRFGPVRSMVICENRNDHLK
FT                   GNVYLYYEREQDAEDAKNNFNTRWFDERPLYCDLTHVADFREAVCRKHDLGTCERGGDC
FT                   NFMHVRRPSTKIRIDLEKSQAKHWQFETKRSKS"
FT   gene            <43310..>43723
FT                   /pseudo
FT                   /locus_tag="ZYRO0A00660g"
FT                   /old_locus_tag="pseudo-Zyro0A-43310-43723"
FT   gene            complement(<43886..>44092)
FT                   /locus_tag="ZYRO0A00682g"
FT                   /old_locus_tag="ZYRO-ORF9606"
FT   CDS_pept        complement(43886..44092)
FT                   /locus_tag="ZYRO0A00682g"
FT                   /old_locus_tag="ZYRO-ORF9606"
FT                   /product="ZYRO0A00682p"
FT                   /note="similar to uniprot|P39103 Saccharomyces cerevisiae
FT                   YML129C COX14 Mitochondrial membrane protein required for
FT                   assembly of cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25471"
FT                   /db_xref="GOA:C5DP60"
FT                   /db_xref="InterPro:IPR029208"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP60"
FT                   /protein_id="CAR25471.1"
FT                   /translation="MARYPWYTKVTDAVHRLTVLTLIGGSAWMMGSLGYTMYQNGKKYE
FT                   QKVTQQLEADEKRDLEGAASSAE"
FT   gene            complement(<44383..>45885)
FT                   /locus_tag="ZYRO0A00704g"
FT                   /old_locus_tag="ZYRO-ORF9605"
FT   CDS_pept        complement(44383..45885)
FT                   /locus_tag="ZYRO0A00704g"
FT                   /old_locus_tag="ZYRO-ORF9605"
FT                   /product="ZYRO0A00704p"
FT                   /note="similar to uniprot|Q03104 Saccharomyces cerevisiae
FT                   YML128C MSC1 Protein of unknown function green fluorescent
FT                   protein (GFP)-fusion protein localizes to the endoplasmic
FT                   reticulum msc1 mutants are defective in directing meiotic
FT                   recombination events to homologous chromatids"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25472"
FT                   /db_xref="GOA:C5DP61"
FT                   /db_xref="InterPro:IPR018803"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP61"
FT                   /protein_id="CAR25472.1"
FT                   /translation="MKPSISILYSLAVSANVANVIADGSIFDSWTHSDLKSYIKDQQRS
FT                   LEKLSSKTYEELKETLSEAWPGQTGSKKPWWQFWPSQSSVTGSSQPVTDWLFETWPMER
FT                   LHAFLKKNGIHPHPGATKDQLIKYIKDHFYSISEKLDTSGFYPSSSYFEHWTADDFKSW
FT                   LQDFEVPFEENNDELLDKVRENIYHVSKAAEEKRLNALKSLDLANRELLDSAGDIKKDV
FT                   FEHWSAEDLRKWLNSHKIPYNDDIEEKRDALAALASDQKELLKDDIQWFLEAAQRHSSP
FT                   FLSKSPDYVCSVWDKTLLNLGSAFNSVQNKVGDVINDTFLIDLDSWPRGKITEFLDARG
FT                   VSYSKIATNEQLRALVREVRNKPLKKAQEKYDQLTDGAWYHSLKNWAQRKSGEVQGNDY
FT                   YKSVSTNAKTLSKNTQSWASGLGKKVKDDFNSWSVEDLKNYLKKMSGGASTATMSKDEL
FT                   VKLVREKTNLMLGVQEQPWYERWTNNVKNLFSRVPAALAVRQ"
FT   gene            <46819..>48573
FT                   /locus_tag="ZYRO0A00726g"
FT                   /old_locus_tag="ZYRO-ORF9604"
FT   CDS_pept        46819..48573
FT                   /locus_tag="ZYRO0A00726g"
FT                   /old_locus_tag="ZYRO-ORF9604"
FT                   /product="ZYRO0A00726p"
FT                   /note="similar to uniprot|Q03124 Saccharomyces cerevisiae
FT                   YML127W RSC9 One of 15 subunits of the 'Remodel the
FT                   Structure of Chromatin' (RSC) complex DNA-binding protein
FT                   involved in the synthesis of rRNA and in transcriptional
FT                   repression and activation of genes regulated by the Target
FT                   of Rapamycin (TOR) pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25473"
FT                   /db_xref="GOA:C5DP62"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP62"
FT                   /protein_id="CAR25473.1"
FT                   /translation="MSAYAANHSPTPHSVTDTSIPGVPSGGGEDEVDMNNMFMQLVPQP
FT                   IRVTRNQSNGVAASKSLQFSLANLNVFQNLPKETSRGVDDLTRMKMAILSGIPEEVKWA
FT                   LKKYLAYSNKAPYMISLKDLPNLLPLFTNFIQDMEPLVEKFNTPVLGDVKCMEKLQTGL
FT                   NSLLIVRNLAQDTDSVQVLVSDTTIKNFILFVLQKFELVADGDSSWQIYDSNVSFFSEL
FT                   CHYALDLMEAISSYIAPAKKDDLYFQTLVSVLNYTKDRYMVISILRSLSRLLVRSKADE
FT                   ESAADNLDERTLSLIVSFLIVECDSELIIASLDFLYQYILPGAQRISILLDDPHRFATL
FT                   GAVLPRLLTYNIKEPEYDVLENFEVKLVKRLRPPAPSSAPDLPPSLFEQLLALNEPMRS
FT                   TAWLRCCFQPVVDAEFTQISLWRAYESKFAQPVRESGRKLLPAVEFIKNVSNAFSEASA
FT                   MVITDSTTGKKRFVMKGIQPRPKALSINEGEYAAKNSLPPLQSKFLDDSSNITPARQEE
FT                   LPDIKFPTKLSEVSKATSTFLCLLSNESSGPGVDFCRVIKPVVLHKLADIPPLSYALSE
FT                   YMENTPGV"
FT   gene            complement(<48973..>52695)
FT                   /locus_tag="ZYRO0A00748g"
FT                   /old_locus_tag="ZYRO-ORF9603"
FT   CDS_pept        complement(48973..52695)
FT                   /locus_tag="ZYRO0A00748g"
FT                   /old_locus_tag="ZYRO-ORF9603"
FT                   /product="ZYRO0A00748p"
FT                   /note="similar to uniprot|Q02773 Saccharomyces cerevisiae
FT                   YML091C RPM2 Protein component of mitochondrial RNase P
FT                   along with the mitochondrially-encoded RNA subunit RPM1
FT                   Rnase P removes 5' extensions from tRNA precursors Rpm2p is
FT                   also involved in maturation of RPM1 and in translation of
FT                   mitochondrial mRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25474"
FT                   /db_xref="GOA:C5DP63"
FT                   /db_xref="InterPro:IPR013888"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP63"
FT                   /protein_id="CAR25474.1"
FT                   /translation="MAFKSFKYKFYTKGYHSASQKPATAFFDSSYQYLRQNQGLVAVDS
FT                   AVPPSHLPHLGPHPVIGANVNFNIVDDVLQDYETADERREEQLREQYENNGNVNQHSHQ
FT                   RESKGSNTDTYNGRRQRSASISSHHQTRSPAALRRRSMGENTATLSLRTGAKDAFIDHT
FT                   LSQRYYSTTNTSRKESDIHSHYRIPPESQPVVPAGKDAKVAADNVAKEDNVVDNGRPAQ
FT                   LDQQFLSKQRDSMSPWEEDKEPCLNKDTFLRTHTDQINKCYENGDLNSINSLYQALKRN
FT                   DIIPPLKVYEQILDSVARRQFDNDDLDYKIAELLTCYQDLIMNRLKPSDRIYNTVLECL
FT                   FKASIAAYVTHNSNGVDFYKIAAELFHTIGGGSHLLSKSVLDHALLAMNLFPGHMSLVQ
FT                   AQRILDKNSNAKSDSFYYVALLSYAKTMNDPGAIESLYEEYRLALSSDPLLKEGEFEVY
FT                   SMTVSGLVETGELELAIKLLDRLMQDLRNVSGSSENVSLLLSNFLLSVSKLNCHKAYNL
FT                   WAQFHKLKWVPEFSYEFYLVLMANSFEDWKLTKKIYSCLYPMKCQFRGNHRNKLSEYLL
FT                   YPMGVESVLSSLMDYSLQLKDSEIIMKLIEESIIKKFRFDTALYPFIFAYLKEIRCPDE
FT                   YLLRFVKAQGNVIKDAESISNVEKYDFLNGIVQHFPSQVILKKVTEMEFFVDLCRNLNL
FT                   SDSRVVNYGGLIGCMTSLWGSPQTIDKYAFNMEIHAILITKLYDFDTYCSELDNDSLAE
FT                   FREKTMERFSKLATNYKRLNLDPAKVPGVVVQAIKLTNVAEDVMAFYNHPGDWDKSYHL
FT                   SLGSVIRNSVRTGIKEYQKLLLEGYCFDYDTYKELISAKFVDSHIIKSSLELCPDKEEQ
FT                   KYLTNLTVIRAPHDKLQDLVLLNPQFSSQILPFLKDESLLRLAKNADIYKWIEVTDFPK
FT                   AFMSIAVQAEYKASIEYIYSQLYQLKDYETILQFNKSCPVLDMEILLKSCIRCGEYTQY
FT                   NQLFEKFKDHLGSSSIDIQSEYLINNGQVDEAVHLINSANAKTPHKTLDLYTFGLFLQS
FT                   FTREIGYYDAPENTLQLANLLSTQSTFSGMLALYDIVSHTEPFNVGESAKSAVKAELLE
FT                   QMLNNIQDAINFVDVENEDIRDEFLLKLQNFFRFKVFLKQPFVTLNDMKKLLDIWQNVN
FT                   PYAIDTLFNNMVESIYLNPSAQSLYLENDLMFHYNSDSLLELTNEIENFYANKEDSEAV
FT                   DKIRRFKSVMNENKL"
FT   gene            complement(<53612..>54997)
FT                   /locus_tag="ZYRO0A00770g"
FT                   /old_locus_tag="ZYRO-ORF9599"
FT   CDS_pept        complement(53612..54997)
FT                   /locus_tag="ZYRO0A00770g"
FT                   /old_locus_tag="ZYRO-ORF9599"
FT                   /product="ZYRO0A00770p"
FT                   /note="highly similar to gnl|GLV|KLLA0D10505g Kluyveromyces
FT                   lactis KLLA0D10505g and highly similar to YML126C
FT                   uniprot|P54839 Saccharomyces cerevisiae YML126C ERG13 3-
FT                   hydroxy-3-methylglutaryl-CoA (HMG-CoA) synthase catalyzes
FT                   the formation of HMG-CoA from acetyl-CoA and acetoacetyl-
FT                   CoA involved in the second step in mevalonate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25475"
FT                   /db_xref="GOA:C5DP64"
FT                   /db_xref="InterPro:IPR010122"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP64"
FT                   /protein_id="CAR25475.1"
FT                   /translation="MTETKKQKTVQHPGKPQNVGIKGIEIYIPSQCVSQEELEKKDGVS
FT                   AGKYTIGLGQTKMSYVNDREDIYSMSLTVCSRLLKNYGIDPHSVGRLEVGTETLLDKAK
FT                   AVKTVLTQLFEGNNDLEGIDTYNACYGGTNALFNSINWIESNAWDGRDAIVVCGDIAIY
FT                   DKGAARPTGGAGTVALWIGPDAPLVFDNVRASYMEHAYDFYKPDFTSEYPYVDGHFSLT
FT                   CYVKAVDQVYRSYSKKAIARGLAKDPLSPESIGVKNHFDYNIFHVPTCKLVTKSYARLL
FT                   YDDFRAKPELYPEVDSNLAKVDYEKSLTDKSIEKTFVGATKQLCQERVQPSLIVPTNTG
FT                   NMYTGSLYASLASLLYYVGSEKLQGKRVGLFSYGSGLAASLFSLKVVGDVSHINKLLDL
FT                   DNKLNSRAVETPEQYEAAIHLREEAHLKKSFEPKGSIDLVAPGAYYLTSIDDKFRRNYS
FT                   VKQ"
FT   gene            <55544..>57589
FT                   /locus_tag="ZYRO0A00792g"
FT                   /old_locus_tag="ZYRO-ORF9598"
FT   CDS_pept        55544..57589
FT                   /locus_tag="ZYRO0A00792g"
FT                   /old_locus_tag="ZYRO-ORF9598"
FT                   /product="ZYRO0A00792p"
FT                   /note="similar to uniprot|Q04511 Saccharomyces cerevisiae
FT                   YML088W UFO1 F-box receptor protein subunit of the Skp1-
FT                   Cdc53-F-box receptor (SCF) E3 ubiquitin ligase complex
FT                   binds to phosphorylated Ho endonuclease allowing its
FT                   ubiquitylation by SCF and subsequent degradation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25476"
FT                   /db_xref="GOA:C5DP65"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP65"
FT                   /protein_id="CAR25476.1"
FT                   /translation="MCIYYKLHLSKKSHLLGRNLVLLRKISAMDGDESPHSALLALPAE
FT                   ILINILSHLDEKDLYVLQEVCSRLRRLVNDEELWKNLFISQIHTNYFPSFAQTPKYSIE
FT                   YVDRQQGLRQWGHNRAIKTKYVIAPSPRFEVQIESMIFDYPRCACYNDGVITVVQLHQR
FT                   RKKDRLVYIPCTTPQGCSTMHFNINSAVFGRFDGRVFGKLLSNKSYLTPVTEFNARHTH
FT                   CVTAIAASSSQDFSEDWCASGSANGELMWWCETKLVKDIRVSNRPIQRLALYKNWTIAL
FT                   DDDRIYVIHAMDQVHSLALPRVQNEAGAEVPLNVQFLKVDFGAKWLVMADLKGLYVIAF
FT                   DPEQNFGHTRCLQIQEGISNVVADESTCRREQNSNFAGGDGCFIAVITADNSVKVINIR
FT                   APGNVLKVNTHLHFDKEVHTCQVTNLVVVCALAGSLQIFDAASGELVKVVQKTDKDPQF
FT                   LGLSQGRMVVASRNVIQYLQYVPEERINKNRTGSSSRGQNIKWEKEVSLGMDIYDEEEQ
FT                   IRQETAERNRKLLEDYGGDMSEEELHLRIALMESESVAERPVQQGQEENDDADEELRRA
FT                   LEESRRQHEHEELLNSFADDDDDDFRDALGQSLAAERRRNPRARLRHNTPESRTHEDTS
FT                   THTNNDTQQQLDQHQQQQQQQQQQQQQTDDEEALQLAIALSLSEMS"
FT   gene            complement(<57722..>58657)
FT                   /locus_tag="ZYRO0A00814g"
FT                   /old_locus_tag="ZYRO-ORF9596"
FT   CDS_pept        complement(57722..58657)
FT                   /locus_tag="ZYRO0A00814g"
FT                   /old_locus_tag="ZYRO-ORF9596"
FT                   /product="ZYRO0A00814p"
FT                   /note="similar to uniprot|Q12746 Saccharomyces cerevisiae
FT                   YML125C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25477"
FT                   /db_xref="GOA:C5DP66"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP66"
FT                   /protein_id="CAR25477.1"
FT                   /translation="MADVLVGKNILDEPVHGIYIPTGLFLAGISITVYMSGENRLLYTL
FT                   PVLFSFLAYRAYAAYSRKRSIYSDRWSPLELEDKTIVSKNTAIYRFKLNTSVETLNLPP
FT                   GYHLMARAFINGTEEIRPYHPISPRYAPGYFDLMVKSYVDGKVSKFFAGLEPGKTVDFM
FT                   GPVGKLNYYCNSSTAIGLVAGGSGITPILQVLNEIITTPEDVTKISLLYANETENDILL
FT                   KDELDELVDKYPHFEVNYVVNRPSSNWKGLRGYVTKEMMQRCLPSPSVDHRLLICGPPD
FT                   MNSLVLELANNIGWRFSGEESEGNDQVFVF"
FT   gene            complement(<58896..>60503)
FT                   /locus_tag="ZYRO0A00836g"
FT                   /old_locus_tag="ZYRO-ORF9595"
FT   CDS_pept        complement(58896..60503)
FT                   /locus_tag="ZYRO0A00836g"
FT                   /old_locus_tag="ZYRO-ORF9595"
FT                   /product="ZYRO0A00836p"
FT                   /note="highly similar to uniprot|P54783 Saccharomyces
FT                   cerevisiae YML086C ALO1 D-Arabinono-1 4-lactone oxidase
FT                   catalyzes the final step in biosynthesis of D-
FT                   erythroascorbic acid which is protective against oxidative
FT                   stress"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25478"
FT                   /db_xref="GOA:C5DP67"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR030654"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP67"
FT                   /protein_id="CAR25478.1"
FT                   /translation="MVMLFDFLSVAPRRGFVFKNWAGIYSCRSQLYFQPTSVDEIVKVV
FT                   KAARQERKTLVTVGSGHSPSDMCMTNEWLMNLDRFNKVLELKEHPRKKYADVTVEAGMR
FT                   VYQLSEYLEQKGYAIQNLGSISEQSVGGIISTGTHGSSPYHGLVSSQYVNLTIVNGKGD
FT                   VVFLDSEHQPDVFKAALLSLGKIGVIVKATIRAVPKFNLRSTEELIKFDTLLDKWDTIW
FT                   TSSEYIRIWWYPYARKCILWRGIKTQEPVTIPRKSWWGTLVGRYFYETLLWVATQIYSP
FT                   LTPYIERFVFHRQYGQVETFGQGEVEVSKSVDGLNMDCLFSQFVDEWGCPLENGPEVLR
FT                   SLDHSIMQAAQNKEFYVHVPIEVRCSNTTTPDKPLNVEDRTSTSPGPIHGNTLRPYLDN
FT                   TPSHCRYAPLSDVTNNQLTLYINATMYRPFHWNSAVGRWYALFEDTMAAAEGKPHWAKN
FT                   FIGSTSLLEKQNKPETEYDDYEMRGMAKSVRKWYGQDLKNWQRIRREQDPDGVFLANKD
FT                   WCIRNGIVDEQDIEQADH"
FT   gene            <60861..>61805
FT                   /locus_tag="ZYRO0A00858g"
FT                   /old_locus_tag="ZYRO-ORF9594"
FT   CDS_pept        60861..61805
FT                   /locus_tag="ZYRO0A00858g"
FT                   /old_locus_tag="ZYRO-ORF9594"
FT                   /product="ZYRO0A00858p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25479"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP68"
FT                   /protein_id="CAR25479.1"
FT                   /translation="MGKLAEICCRVVAQELSWLSFAEARYIIENLPSAQCVELVWQHLC
FT                   QNMKDSKTLYLLMQNHPLIAGELDSTGWYGHKISYRRQSVPNLDLVESIRFFNTLEGHA
FT                   NYQFLTILELQNDMPGLESLVNLPSLVELSVAGISRPEQLVTSWHRALKVDSRRWSQLK
FT                   VLNVPQLTSPRLFFDSWQLIPSLLWMGVNLDGKTIGNIPKLNQLVIEAPIKAPMEILCW
FT                   LQEWQTMEIDGKVMIELDVNPNLVIPSIPSYFPLEARFSKLPGTYGYMRRLTNKRTEIP
FT                   EQDEVERPKTKRPKHRGIRRGASLQRFFGWGGL"
FT   gene            complement(<62129..>63574)
FT                   /locus_tag="ZYRO0A00880g"
FT                   /old_locus_tag="Zyro0A.mRNA.6153.m"
FT   CDS_pept        complement(join(62129..63444,63550..63574))
FT                   /locus_tag="ZYRO0A00880g"
FT                   /old_locus_tag="Zyro0A.mRNA.6153.m"
FT                   /product="ZYRO0A00880p"
FT                   /note="highly similar to uniprot|P09733 Saccharomyces
FT                   cerevisiae YML085C TUB1 Alpha-tubulin associates with beta-
FT                   tubulin (Tub2p) to form tubulin dimer which polymerizes to
FT                   form microtubules"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25480"
FT                   /db_xref="GOA:C5DP69"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP69"
FT                   /protein_id="CAR25480.1"
FT                   /translation="MREVISINVGQAGCQIGNSCWELYSLEHGIRPDGYLQEGLSKPKG
FT                   GEEGFSTFFYETGSGKYVPRAVYVDLEPNVIDEVRTGPYKDLFHPEQLINGKEDAANNY
FT                   ARGHYTVGRELLDDILDRIRKISDQCDGLQGFLFTHSLGGGTGSGLGSLLLEQLSIDYG
FT                   KKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKKNLDIGR
FT                   PSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKSK
FT                   AYHEANSVSEITNACFEPGNQMVKCDPRTGKYMATCLLYRGDVVTRDVQNAVSQVKNKK
FT                   TVQMVDWCPTGFKIGICYEPPTATPASQLSSVKRAVCMLSNTTAIADAWKRIDRKFDLM
FT                   YSKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYADEEF"
FT   gene            complement(<64264..>66078)
FT                   /locus_tag="ZYRO0A00902g"
FT                   /old_locus_tag="ZYRO-ORF9590"
FT   CDS_pept        complement(64264..66078)
FT                   /locus_tag="ZYRO0A00902g"
FT                   /old_locus_tag="ZYRO-ORF9590"
FT                   /product="ZYRO0A00902p"
FT                   /note="similar to uniprot|P25297 Saccharomyces cerevisiae
FT                   YML123C PHO84 High-affinity inorganic phosphate (Pi)
FT                   transporter and low-affinity manganese transporter
FT                   regulated by Pho4p and Spt7p mutation confers resistance to
FT                   arsenate exit from the ER during maturation requires
FT                   Pho86p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25481"
FT                   /db_xref="GOA:C5DP70"
FT                   /db_xref="InterPro:IPR004738"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP70"
FT                   /protein_id="CAR25481.1"
FT                   /translation="MSEKEDIHVEETAKNMTTGGNAAFHNYINDFAHIEDPLERRRLAL
FT                   QKIDEASFGWYHIRAIMVAGVGFLTDSYDIFAINLGVSMMTYVYWKDGNIPSSSETLLK
FT                   VSTSVGTVIGQFGFGILADVLGRKKIYGVELIIMIAACIMQCVIGASPAVNFTAIMTFF
FT                   RIIMGIGIGGDYPLSSIITSEFSTTKWRGAIMSAVFANQAFGQVAAGIVALILVEGYKD
FT                   DLKAAKSGSTCGPSCKRACDQMWRILIGMGCVPGCIALYFRLTIPESPRYTLDVEFDAA
FT                   RGVADASKFVSGTQGEAAQNDIERLQRNPTAVVAAAQEHPYEGISDSSEAPVRVDVPVE
FT                   NALPKASFKDFCHHFGQWKYGKILFGTAFSWFCLDVAVYGLNLNTAVILNAIGYSGKGS
FT                   IYQKLHDTAVGNLILICGGSLPGYWFTVFTVDIIGRKPIQLFGFFILTVIFCIIGFDYH
FT                   NLSGKELLGLYIICEFFQNFGPNTTTFLIPGEIFPTRYRSTAHGLSAAAGKVGAIIAQT
FT                   ALGTLINHNCAKDNKPTNCWLNHVMEIFALFMLLGLLVSLLIPETKRMTLEEVSEKYHD
FT                   EIDPSKYRNVPSQSSTNSDTASSTMEQV"
FT   gene            complement(<66827..>68146)
FT                   /locus_tag="ZYRO0A00924g"
FT                   /old_locus_tag="ZYRO-ORF9588"
FT   CDS_pept        complement(66827..68146)
FT                   /locus_tag="ZYRO0A00924g"
FT                   /old_locus_tag="ZYRO-ORF9588"
FT                   /product="ZYRO0A00924p"
FT                   /note="similar to uniprot|P29704 Saccharomyces cerevisiae
FT                   YHR190W ERG9 Farnesyl-diphosphate farnesyl transferase
FT                   (squalene synthase) joins two farnesyl pyrophosphate
FT                   moieties to form squalene in the sterol biosynthesis
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25482"
FT                   /db_xref="GOA:C5DP71"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR006449"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP71"
FT                   /protein_id="CAR25482.1"
FT                   /translation="MVKALELLSHPVELKSALKLKFIRQPLYAPRDIASPELTRCYELL
FT                   KATSRSFAAVIQELNPELRDAVMLFYLILRALDTVEDDMTIEPQLKVKVLRSFAEKLDT
FT                   RDWSFDGNSPEEKDRKVLVEFPCILHQYHELRPKYRQVIQDITVKMGNGMADYILDEQF
FT                   NLQGVQTVKDYDLYCHYVAGLVGEGLTHLIVEAGFGTPDLDANPQLYESMGLFLQKTNI
FT                   IRDYAEDLGDGRSFWPREIWSKYAEKLPDLGDPRNAQNGLSCINELVLNALSHVIDVFT
FT                   YLSSINEQSTFQFCAIPQVMAIATLALVFNNEKVLTDRVKIRKGTTCELILKSHTLHGC
FT                   LSIFRHYVRDIKSRVPVQDPNYLKVNIQVARIEQHIEEMYQDKLPNGAKPKETIYYTKA
FT                   QERFKQDEKILPIEQNEEYKFNMALTVLLTIVSAIYFYAK"
FT   gene            complement(<68502..>69077)
FT                   /locus_tag="ZYRO0A00946g"
FT                   /old_locus_tag="ZYRO-ORF9586"
FT   CDS_pept        complement(68502..69077)
FT                   /locus_tag="ZYRO0A00946g"
FT                   /old_locus_tag="ZYRO-ORF9586"
FT                   /product="ZYRO0A00946p"
FT                   /note="similar to uniprot|P38876 Saccharomyces cerevisiae
FT                   YHR189W PTH1 One of two (see also PTH2) mitochondrially-
FT                   localized peptidyl-tRNA hydrolases dispensable for cell
FT                   growth and for mitochondrial respiration"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25483"
FT                   /db_xref="GOA:C5DP72"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP72"
FT                   /protein_id="CAR25483.1"
FT                   /translation="MLRFRRRLTCFTGIGNPEPKYAGTRHNVGLIILDLLKNRFDAEQI
FT                   HPYKVSSLSPAKYCQISSQLVMIRSDGDYMNLSGKTVVPMWNRLPHRDHVTHVVLHDEL
FT                   SLPLGKVQLRKPGTSLRGHNGLKSIQNCWRNDNFYRLSVGIGRPPQRDSTVVSDYVLSK
FT                   FDERELEILQTKSFKTAWERIGHLVNNK"
FT   gene            <69245..>70144
FT                   /locus_tag="ZYRO0A00968g"
FT                   /old_locus_tag="ZYRO-ORF9585"
FT   CDS_pept        69245..70144
FT                   /locus_tag="ZYRO0A00968g"
FT                   /old_locus_tag="ZYRO-ORF9585"
FT                   /product="ZYRO0A00968p"
FT                   /note="highly similar to uniprot|Q00582 Saccharomyces
FT                   cerevisiae YML121W GTR1 Cytoplasmic GTP binding protein and
FT                   negative regulator of the Ran/Tc4 GTPase cycle through its
FT                   homolog and binding partner Gtr2p involved in phosphate
FT                   transport and invasive growth human RagA and RagB proteins
FT                   are functional homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25484"
FT                   /db_xref="GOA:C5DP73"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039397"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP73"
FT                   /protein_id="CAR25484.1"
FT                   /translation="MSSNNRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDVE
FT                   HSNRRFLGNMTLNLWDCGGQDVFMENYFTRQKDHIFQMVQVLIHVFDVESQEVIKDIEI
FT                   FTKALKQLKKYSPDAKIFVLLHKMDLVQLDKREELFQLMMKKLQETSSEYGFPNLIGFP
FT                   TSIWDESLYKAWSQIVCSLIPNMAVHQSNLKKLKSVMNAWEIVLFERSTFLVVCSSNAV
FT                   NGETLDPKRFEKISNIMKNFKQSCTKLKSGFKTLVLNENIYVSEISQNMVCFIVLNNSE
FT                   EPQSMVLENIRMAKEFFQ"
FT   gene            complement(<70521..>71861)
FT                   /locus_tag="ZYRO0A00990g"
FT                   /old_locus_tag="ZYRO-ORF9584"
FT   CDS_pept        complement(70521..71861)
FT                   /locus_tag="ZYRO0A00990g"
FT                   /old_locus_tag="ZYRO-ORF9584"
FT                   /product="ZYRO0A00990p"
FT                   /note="some similarities with uniprot|P40463 Saccharomyces
FT                   cerevisiae YIL135C VHS2 Gene whose overexpression
FT                   suppresses the synthetic lethality of the hal3 sit4 double
FT                   mutation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25485"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP74"
FT                   /protein_id="CAR25485.1"
FT                   /translation="MNGTTTIPEYKFTSSPQSDNGNSSMIFERTVEDACSSRPFSRHGS
FT                   SVSLLSRKYSNQSTGGVGIPVTASSSRCGHRTPRTSQHSSPSQQGSPLDSPELVPGTGT
FT                   VNHRRHLENFVAPALDASCSIIADESANLNDLDIVYMRKPSTIGLDLALGRTRSNSYAT
FT                   LREEHQQQQQQQQQQQQPVPPPLPRSNSASVGMDAKPRTLRFYSYADMLSDEMATSPTS
FT                   GTRPPLPHSASSTFLRPAPQHQPMHFSNPFKTTTATTGNSNGCSSCGCGNGTRSRKDST
FT                   ASSGNLNPNVRRCSNNVLSRSTTSHLQAAAPPAPAPALGLARANKLAKPRRRSAFQIES
FT                   SDEFSSDEEDESPFPSSNHMGFSPLGSRVSRTSTQNSVNSQPSSHRAGGGSFSNSSPSL
FT                   MRRESFQNSINGVLMEDTLQTEKVGDILRKRMGNVKKQDIKVTTGED"
FT   gene            <72860..>72968
FT                   /gene="SNR68"
FT                   /locus_tag="ZYRO0A01012r"
FT                   /old_locus_tag="Zyro0A_snoRNA_188"
FT   ncRNA           72860..72968
FT                   /gene="SNR68"
FT                   /locus_tag="ZYRO0A01012r"
FT                   /old_locus_tag="Zyro0A_snoRNA_188"
FT                   /product="snR68"
FT                   /note="C/D snoRNA monocistronic SNR68"
FT                   /ncRNA_class="snoRNA"
FT   gene            <72981..>74486
FT                   /locus_tag="ZYRO0A01034g"
FT                   /old_locus_tag="ZYRO-ORF9581"
FT   CDS_pept        72981..74486
FT                   /locus_tag="ZYRO0A01034g"
FT                   /old_locus_tag="ZYRO-ORF9581"
FT                   /product="ZYRO0A01034p"
FT                   /note="similar to uniprot|P32048 Saccharomyces cerevisiae
FT                   YNL073W MSK1 Mitochondrial lysine-tRNA synthetase required
FT                   for import of both aminoacylated and deacylated forms of
FT                   tRNA(Lys) into mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25486"
FT                   /db_xref="GOA:C5DP75"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP75"
FT                   /protein_id="CAR25486.1"
FT                   /translation="MKKAIVDSSKLFASRNRLIEGNPSKYYPSIVRGSSSVKEFVERWK
FT                   GLDSSTRNVNESLHGRICGVRSAGKNMCFLDLGGLQVVMNSKEMAERNDGLNLAQRYRA
FT                   GDYVLVSGRPGLTERQRTLSIRAEKPPTVLAAAQQPLPPSLEDRAKLKQNRVLDYQLSG
FT                   VEMLVTRHKVTRAVREFLDGRDFVEVETPILSNKANGASAEAFVTYSNALPENEKRLEL
FT                   RVAPELWLKRLIIGGLERVYELGKVFRNEGIDATHNPEFTTLEFYQAYVTMEDLIENVR
FT                   DMLVHICSAVSGLPMAQRLLSELQTKGLQRLDFVDTLSKETGTDFHGIQDWSNPELLWE
FT                   ATPIKDRSKLFPEGPQALSPSQMWNRLGGYYVEDRHCNGLCPTLVCNHPSIISPLAKPN
FT                   DNRLSKRFEMFIGGKEYINAYEEENCPQRQLQSFKDQAQSLLQYGDKESLSVDEAYVEA
FT                   MKWGMPPTGGVGLGIDRLVALLLGSTRIEEVLAFGCLDDVNRQ"
FT   gene            <74563..>76448
FT                   /pseudo
FT                   /locus_tag="ZYRO0A01056g"
FT                   /old_locus_tag="pseudo-Zyro0A-74563-76448"
FT   gene            complement(<77175..>79022)
FT                   /locus_tag="ZYRO0A01078g"
FT                   /old_locus_tag="ZYRO-ORF9575"
FT   CDS_pept        complement(77175..79022)
FT                   /locus_tag="ZYRO0A01078g"
FT                   /old_locus_tag="ZYRO-ORF9575"
FT                   /product="ZYRO0A01078p"
FT                   /note="weakly similar to uniprot|Q75D69 Ashbya gossypii
FT                   ABR154C ABR154Cp"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25487"
FT                   /db_xref="GOA:C5DP76"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP76"
FT                   /protein_id="CAR25487.1"
FT                   /translation="MDMSNNPEYVKETNEVWNRNFARARYWGAGLMGYWGLLVLIASIN
FT                   NWSTRFYPRATLVLRSQLDRFSPIRWLRGHVLIPTLLPRGKHLMHNRIGGLIPTRFESL
FT                   ILFIYFALVFIGESVNYETSKHNIYWPQKKDQLTRYVGDRSAIISMFIIIPTYLFAGRN
FT                   NFLLWLTGWRQSTFMTFHRWLARMAVVSSLVHTFTMLLNDYWLHTVHLRKYTQYWRWGS
FT                   VAIICGVIMVVQSLPFLRRSWYEIFLYGHIILALFFLIGVCIHLTVLGYGQYAYAAASV
FT                   WAFDRCIRLIRLGCFGIRYANVSITDEKHLLVIIDDSAQVWDKKPKPGAFGYLYFLTGP
FT                   FSWFQSHPFSVITIENSNSIAFQVTVKNGLTKRLYNDLISKADQTSRMKIMLEGFYGEY
FT                   KPVRGYDQVMMFSSGAGAISPLEYLKEVVDHNSNTNSNQEHHNVKYVKFYWMVPDLSYT
FT                   RVLAPELIKLQKLEYVHPIIYVTQPQSKFQSIGSVPSGDENSSSSVNQAAEDLEKSKGD
FT                   KTKDTSITVNSTEEAIPISSKLESELVNSCEIHYGSRPDLNQLLIQDLQETQPSDHVAV
FT                   MTCAHPAVCDQIRSIVAEETSIKKGRSGTLDLIELLQSW"
FT   gene            <79473..>80402
FT                   /locus_tag="ZYRO0A01100g"
FT                   /old_locus_tag="ZYRO-ORF9572"
FT   CDS_pept        79473..80402
FT                   /locus_tag="ZYRO0A01100g"
FT                   /old_locus_tag="ZYRO-ORF9572"
FT                   /product="ZYRO0A01100p"
FT                   /note="similar to uniprot|P53942 Saccharomyces cerevisiae
FT                   YNL072W RNH201 Ribonuclease H2 catalytic subunit removes
FT                   RNA primers during Okazaki fragment synthesis cooperates
FT                   with Rad27p nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25488"
FT                   /db_xref="GOA:C5DP77"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP77"
FT                   /protein_id="CAR25488.1"
FT                   /translation="MLPPTVEFCKGSLHSKTFYSPVPEQIAQCKDNDDNDNENDQIILG
FT                   VDEAGRGPVLGPMVYGISYCTKQFQDEILKPNYGFDDSKKLSDLERRRLFSKIYGENGE
FT                   VAEIANVGYAVTAITPADISSGMLRYPANANYNLNEQAHDVTIALIEGVLQRGVKLHHV
FT                   YVDTVGPPASYQKKLEQKFPHIKFTVAKKADSLYCVVSVASIVAKVTRDILLEQWAQQV
FT                   SPPEAGPLGSGYPADAKTTAWLRNTMKPLMGWDPHLVRFSWQTSETLLDNKGIQIEWEE
FT                   KSKSKPVWAGKSMLQAERKPLTLDSWYG"
FT   gene            <81173..>82201
FT                   /locus_tag="ZYRO0A01122g"
FT                   /old_locus_tag="ZYRO-ORF9569"
FT   CDS_pept        81173..82201
FT                   /locus_tag="ZYRO0A01122g"
FT                   /old_locus_tag="ZYRO-ORF9569"
FT                   /product="ZYRO0A01122p"
FT                   /note="similar to uniprot|Q08911 Saccharomyces cerevisiae
FT                   YOR388C FDH1 NAD( )-dependent formate dehydrogenase may
FT                   protect cells from exogenous formate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25489"
FT                   /db_xref="GOA:C5DP78"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP78"
FT                   /protein_id="CAR25489.1"
FT                   /translation="MCRHKVLLVLNAAGGKSEGHQKLLKCVEEKLGLKSFVESRGSELV
FT                   PVVDETKSSNKNSATGEIIVLPHGSMPTVDAPRIKLSVTADDAVQVEVCDNGKLTVNDN
FT                   VNDNNAFDDDDTNDGGFRSPKRRKISVSDLTNSNHVSAAEHVITTILVLVRSYNENLQR
FT                   QMHDVELDVHGSIRDNFDIENKVIGIIGAGKVGYRIMERLVAFNPRKILYYDPKELPVK
FT                   NVKKLNVVGLLINQRGDIVQRVDKLEEMLSHSDVVTINCPLNKDSKGLFNKELISHMKD
FT                   GSFLINASKGGICIARDIKEATKSGKLAGYSGDVQHSEYEAHDLKDILEGLLQRRHGQK
FT                   TN"
FT   gene            <82681..>84063
FT                   /locus_tag="ZYRO0A01144g"
FT                   /old_locus_tag="ZYRO-ORF9568"
FT   CDS_pept        82681..84063
FT                   /locus_tag="ZYRO0A01144g"
FT                   /old_locus_tag="ZYRO-ORF9568"
FT                   /product="ZYRO0A01144p"
FT                   /note="similar to uniprot|P12695 Saccharomyces cerevisiae
FT                   YNL071W LAT1 Dihydrolipoamide acetyltransferase component
FT                   (E2) of pyruvate dehydrogenase complex which catalyzes the
FT                   oxidative decarboxylation of pyruvate to acetyl-CoA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25490"
FT                   /db_xref="GOA:C5DP79"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP79"
FT                   /protein_id="CAR25490.1"
FT                   /translation="MSALIRAAVPRVARISLASRLALRCYASYPAHTVIGMPALSPTMA
FT                   QGNLAQWSKKEGEQIGAGDVLAEIETDKATMDFEFQDEAYLAKILVPEGTKDIPIGKPI
FT                   AVTVEDGGDVDAFKDFKVEESAPKEEPKKEEPKKEESSADAKPTPAPSQSASKVAAPPT
FT                   DRIVASPLAKTIALDKGISLKSVNGTGPNGRITASDVEAFLSKAPAAGAGGAAGASSAS
FT                   GAATETYEDEPISNMRSIIGRRLLESTQSIPSYIVSSDISVSKLLKLRKSLNASAKDQY
FT                   KLSINDILIKAITVAARRVPDANAYWLQDQGIIRSFKNVDVSVAVATPTGLLTPIIKNA
FT                   ESKGLVSISGEVKEKVARAKINKLKPEEFQGGTICISNMGMNNAVSLFTSIINPPQSTI
FT                   LAVSTVKRVAVEDAGAENGISFDDQMTITGTFDHRTIDGAKGGEFMRQLKNVVENPLEL
FT                   LL"
FT   gene            <84426..>84608
FT                   /locus_tag="ZYRO0A01166g"
FT                   /old_locus_tag="ZYRO-ORF9565"
FT   CDS_pept        84426..84608
FT                   /locus_tag="ZYRO0A01166g"
FT                   /old_locus_tag="ZYRO-ORF9565"
FT                   /product="ZYRO0A01166p"
FT                   /note="similar to uniprot|P53507 Saccharomyces cerevisiae
FT                   YNL070W TOM7 Involved in mitochondrial protein import
FT                   translocase of the outer mito. membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25491"
FT                   /db_xref="GOA:C5DP80"
FT                   /db_xref="InterPro:IPR012621"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP80"
FT                   /protein_id="CAR25491.1"
FT                   /translation="MSFLPSFILSDESKERISKILSMSHTVVHYGWMPFILYLGWAHTA
FT                   NRPNILNLLSPLPSI"
FT   gene            <84781..>85716
FT                   /locus_tag="ZYRO0A01188g"
FT                   /old_locus_tag="ZYRO-ORF9564"
FT   CDS_pept        84781..85716
FT                   /locus_tag="ZYRO0A01188g"
FT                   /old_locus_tag="ZYRO-ORF9564"
FT                   /product="ZYRO0A01188p"
FT                   /note="similar to uniprot|P40464 Saccharomyces cerevisiae
FT                   YIL134W FLX1 Protein required for transport of flavin
FT                   adenine dinucleotide (FAD) from mitochondria where it is
FT                   synthesized from riboflavin to the cytosol"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25492"
FT                   /db_xref="GOA:C5DP81"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP81"
FT                   /protein_id="CAR25492.1"
FT                   /translation="MGELTPLQKEVVAGLTAGTLTTITVHPLDLVKIRLQLLATSAHRY
FT                   GYREVAQSIVSSSQRSHILKEAYRGLGINLVGNALAWGVYFGLYREAKDLIYGWAIQDC
FT                   DQVVKFTDRDGKMSSLMYLGAGASSGLLTAILTNPIWVLKTRIMSTSSYASGSYRSTWD
FT                   GVKRLLQDEGARAMWHGLLPSMFGVSQGAIYFMIYDTLKNRFSSVRYREGRTNDSNNNP
FT                   RLKNTETIAMTTLSKMISVSTVYPFQLLKSNLQSFQSATEKYTLYRLANRIYKLEGIGG
FT                   FYRGLSANLIRSIPSACITFCVYENCKRYL"
FT   gene            complement(<85958..>86560)
FT                   /locus_tag="ZYRO0A01210g"
FT                   /old_locus_tag="ZYRO-ORF9561"
FT   CDS_pept        complement(85958..86560)
FT                   /locus_tag="ZYRO0A01210g"
FT                   /old_locus_tag="ZYRO-ORF9561"
FT                   /product="ZYRO0A01210p"
FT                   /note="similar to uniprot|P26784 Saccharomyces cerevisiae
FT                   YIL133C RPL16A N-terminally acetylated protein component of
FT                   the large (60S) ribosomal subunit, binds to 5.8 S rRNA; has
FT                   similarity to Rpl16Bp, E. coli L13 and rat L13a ribosomal
FT                   proteins; transcriptionally regulated by Rap1p and to
FT                   YNL069C uniprot|P26785 Saccharomyces cerevisiae YNL069C
FT                   RPL16B N-terminally acetylated protein component of the
FT                   large (60S) ribosomal subunit, binds to 5.8 S rRNA; has
FT                   similarity to Rpl16Ap, E. coli L13 and rat L13a ribosomal
FT                   proteins; transcriptionally regulated by Rap1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25493"
FT                   /db_xref="GOA:C5DP82"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP82"
FT                   /protein_id="CAR25493.1"
FT                   /translation="MSTFEPVVVIDGKGHLVGRLASIVAKQLLEGQKIVVVRAEALNIS
FT                   GEFFRNMLKYHDYLRKATAFNKNRGPFHFKAPSRIFYKAVRGMVAHKTARGKAAMERLK
FT                   VFEGIPPPYDKKKRVVVPHALRVLRLKPGRKYTNLGQLATSVGWKYENIVSKLEEKRKV
FT                   RSAEYYAKKKAFTKKVATAKAATSETEAAKKLAALGY"
FT   gene            complement(<87135..>87833)
FT                   /locus_tag="ZYRO0A01232g"
FT                   /old_locus_tag="ZYRO-ORF9559"
FT   CDS_pept        complement(87135..87833)
FT                   /locus_tag="ZYRO0A01232g"
FT                   /old_locus_tag="ZYRO-ORF9559"
FT                   /product="ZYRO0A01232p"
FT                   /note="similar to uniprot|P40465 Saccharomyces cerevisiae
FT                   YIL132C CSM2 Protein required for accurate chromosome
FT                   segregation during meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25494"
FT                   /db_xref="GOA:C5DP83"
FT                   /db_xref="InterPro:IPR031783"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP83"
FT                   /protein_id="CAR25494.1"
FT                   /translation="MGSEDNSNNTIGNDSSLDLNVSLDELDLVTAWAAPNPNSLAQYVA
FT                   NTIDKSNSDVIVFYIDASNTFPLYQFEKLVPKDERGAKIYESIRIQIALNLSELNLIVR
FT                   KILQFVSREKVARSLNKDTEQNGLKVLLILSGIEIMFKNSRMSSPQEPHHMILRDLFLR
FT                   LRVEANHSNDQFGLTLKTFLIVPLQECQRCQISPGTRMPNNKRQRMTPMNVGNSVGDYI
FT                   VKFYADTLIS"
FT   gene            complement(<88082..>90424)
FT                   /locus_tag="ZYRO0A01254g"
FT                   /old_locus_tag="ZYRO-ORF9558"
FT   CDS_pept        complement(88082..90424)
FT                   /locus_tag="ZYRO0A01254g"
FT                   /old_locus_tag="ZYRO-ORF9558"
FT                   /product="ZYRO0A01254p"
FT                   /note="some similarities with uniprot|P41813 Saccharomyces
FT                   cerevisiae YNL068C FKH2 Transcription factor of the
FT                   forkhead family that regulates the cell cycle and
FT                   pseudohyphal growth also involved in chromatin silencing at
FT                   HML and HMR potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25495"
FT                   /db_xref="GOA:C5DP84"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP84"
FT                   /protein_id="CAR25495.1"
FT                   /translation="MTDRRYSPQQHQGLVNSVIGILQCPEQPTMVSKQFSNQRNVATEV
FT                   QAYAKISGRDWTYYVKELEVSIGRNTDSLNLPPGTPQQKEGRVSIDLGPAKVVSRRHAV
FT                   IKFNMQHGGWEFHVLGRNGAKVNFKRVQTGAQSTAVILSSGTILDVGGTQMMFILPDQE
FT                   PVVSQSSIDHLLPKLASTYGSPNAGAYSPLDQNALLYDILQNGGYQNGNPPHNSGNISN
FT                   SDEPGNSVTGNGPLQSQPPQLQQVRTFKMYGNPSSNNMQYGAGQPGVLMSPDLSNSNGS
FT                   GNTPNYHNPQLSITQIGFPNSLDFASDLSRDENRNVKPPHSYATMITQAILSTGEGVIS
FT                   LADIYKYISSNYAYYRFAKTGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISEDYQ
FT                   RDFLNKWNSGKIGKVRRGSSVARQLQLHLSKFNSLPAQNDYTPEPTIIKQQSMAHRRVN
FT                   TAGSVDRMQLDTPLSASSDNASQPQHVPSLPQAQAQVQPPLPQPPLQQQQLQQPHQSSQ
FT                   HQPQQAQSINPSQQPPQLLQHQQQPQPHLQQLPQPQPQPQHHNNHNQQQQQQQQQPQAQ
FT                   RQLQQQSGPSLPLPHPSLQPPTVMPPPHQAVYSQNPLPSSTAASAAARSSITPLITTAT
FT                   GTGPTQISPTQGPNLLRSPTKAFHITAMEAYTPERGSANQNRSPSANQQQNDPENYLSK
FT                   DQNATGKVDKGRSSPGVWNLLQFSSVNNTPAVPQRERNNTANSNPTTNGGETKDVVSSP
FT                   LKSQTTQSNGKDLMLDTEGTKISLVND"
FT   gene            complement(<91512..>99242)
FT                   /locus_tag="ZYRO0A01276g"
FT                   /old_locus_tag="ZYRO-ORF9555"
FT   CDS_pept        complement(91512..99242)
FT                   /locus_tag="ZYRO0A01276g"
FT                   /old_locus_tag="ZYRO-ORF9555"
FT                   /product="ZYRO0A01276p"
FT                   /note="similar to uniprot|P40468 Saccharomyces cerevisiae
FT                   YIL129C TAO3 Identified in a hunt for mutants that activate
FT                   OCH1 transcription Transcriptional Activator of OCH1"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25496"
FT                   /db_xref="GOA:C5DP85"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR025481"
FT                   /db_xref="InterPro:IPR025614"
FT                   /db_xref="InterPro:IPR029473"
FT                   /db_xref="InterPro:IPR039867"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP85"
FT                   /protein_id="CAR25496.1"
FT                   /translation="MNTGFTFPPQQVNKDTGAQESFRFPKPSTSIPATTTAPNDITQVN
FT                   SSTANSETNLTNGFEDSAYNSNNGGGHNAVVAPIAETDELAPVIDIPPPLEISGKEIRS
FT                   FTPVPELAEKSGEDLYANNETNVDETGNFLINSVTPPDGLGSQLSQKPQELQQPQQPQQ
FT                   PQQPQQPQQPQQLQQQIPTETQRKSQVEDYVSNLRQQMATDWKSPSEYALHILFTKFVR
FT                   HAENKLNQCLHHPLTSEPPIVDILGEGVDPNFDKIVESLGHIAKNKPKPVIDAMMFWRK
FT                   TKSEIACVAAEEVENLLKEYENDQVKQYPIKHQPSSSISQPKTHSKSMSNGSRFSHKRN
FT                   SSSKSSTGSKGAIEDNKMRNLELSIITARDAAFQADRKSLISIYILCRVLIEIVKQAPE
FT                   GADEDLSDKLEEIVFTQLKTTDPMSISSSIIKSSNWNSFAELLGWMSERKFISVSDRFI
FT                   ADLEKIPTFVTRDLEPGVHLLILGMRYLRLKNYPLEKFEETADFMKSIAKFFYQAENLS
FT                   VSLAYAEVISQLLLPLAGSMTAEVNHPTWVEAMTALLSTTAKLQTESSSSKYWASIFRL
FT                   NVSILCVAPAELFSEYWITLIEKNARKIKNKSLPARVLFVVGLSRLVWVYLYRCPETLN
FT                   NTTRTLSRLFALFLSTKKKENWITTDLELINPLSDVLVTVGYAYPNFLMENAILPLVRT
FT                   SFNGFSLDGINYERMILVINTYRGLLMTNNKPEFPENDSRYYELSLNDISIKQNEALTS
FT                   NHEEVCTYFYKLFLLLDSNIGSEVWSPENQHNRPPTTPFEKFSLFSNDNNNNNNRNLNI
FT                   ALFATLIETIPSCLNISGQIPFKSTIEIISRNAVHADLLIASSCQNALKALASKKNPYT
FT                   LITWFAKYSFDFDEKTQSSYNMSYLSSTEYRRLLILYVGLLECWLEEFHSSNLEEKKRE
FT                   TGLDGIELMPVDNNLEELNEVETLEWKNTVTVIEEVEGNGLFFLCSQDAGIRHLGIQIL
FT                   RIISKFDEAMVEKTVRLSKCHSRSSSYFAAHRGTRLVDLLNDTDFYSLLDSKRTLLSMV
FT                   EKSRISKLTAKFKKGVLIKIAESEYGVDAALWQRIFPKLLSVVCVACPITMALCRSIVC
FT                   IRLVQVHGIILQIANNVEDRPREISPEVIINQWKLFLVVACTSLTSTNDQKLHIPTSGF
FT                   RHGRKKSQQIFTVQHQKIKSATSVFKMVLPLLNADSTMIRDAIISGLSSMNVNIYKAYI
FT                   ESIEGFLCTWSLQSSNNKIRVEMFHVLTILSRFLNETMILEDKVLLKKISEILRHVKKF
FT                   LEEESVQYSYEFQTLRSYFAELLRNYYSVVRLEPQFDQLFPFQARASCFKYLKEWCGYG
FT                   ELAFIAEERYNTMIRNTDNSRDRTAITAGIEFQRSRLEKVALETMVVLCSDTITKTIQD
FT                   VPEMPIVISFDIAGLLSWIESLFNAEDESFKNMGVSALENLLEMNTSNHQLFKEVAFQC
FT                   AAHHKSPHVSVLYYITLCKTVLKMDNLVLEEDELVSLGLFGVVSDREDARSYAVDLLSA
FT                   VEAKLHNSFYTKVFKERLASSSKTVYKSTAKEVSSIFAELLSQELCLKIFSALVGTMDS
FT                   FSFETKRDILILLTPWVNKFTLKSIEELDTFMILNNLFYITIDLNNTLPIEVEQLWISL
FT                   GKGNGFQNIHVSLEFIMTVSINHRNPNFVQHARDVVLYLGNVPGGIGLVDNLTSNLEPK
FT                   SMIPLTKSEVKGPTENDKGYFIANVWDRLNYHGKSITFSKAHLSIIFLVNLLTDPSEAL
FT                   KGNIANLLHVSVCLLDHYVPLIQESASKIVCDLIFGLAPTHEKSEDTVELLRSKQKIWS
FT                   YDNFMKDKNSARSPKAMDLLIRNLLSIFPDIGTLQVDWQKIALKWATTCSVRHITCRSF
FT                   QVFRSLLIFLDQGMLRDMLHRLSNTVADVNPDIQGFAMQILMTLNAITAELDPADLINF
FT                   PQLFWSITACLNSIHEQEFIEVLSCFMKFISKIDLNSPDTVRCLIATFPSNWEGRFDGL
FT                   QQIVMTGLRSANSSDITWKVLDKLNLLEDSRIIANSESRLLFALISNLPRFLQAMDRKD
FT                   YSNIQTAVDAMVSLSNANNQPSISRLLDSLAKNKFRSKKDFLSQVISFISRNYFPKYSA
FT                   QTIVFLSGLLLNKTDWVKLQSMEILKYIFPLVDLRKPEFAGVGADLISPLLRLLLTDYE
FT                   ARALEVLDCVPQVSGSKMDKDVLRVSMGNNDVKSSNRVTATLFGIPDESGWSVPMPTMT
FT                   AATTRHNVHAVFMTCTANTTGEDPAQEMPYMEDIVDFHADADYALGRSETNDSLSMIEE
FT                   KEASLSHMWAELDNLDSFFTRNNTASAAAAAAAAAAAAAGGKSKSAPPNDIGSLHDRSN
FT                   SVETAQTEQTLQLESAPQLYDKKVSAILNHSLTKVPSNISFKTSLADSFAANTGSQGLI
FT                   NELGHRGNQPIYSEDGSGTASGNVSAVCSANGNVGGNGSGLTRSRNSGNFKSPTNSLSL
FT                   SGKARSTESPQDSLFRFEGFLRSSQRGSRRKWQQHQQHQQLLSQTIHEQVIPSSSSYYD
FT                   AESTSPKPPLRASSVSPNAGNRGKSQKSQKHYHLPHFSSNKAQSWANHPSETE"
FT   gene            <100488..>103553
FT                   /locus_tag="ZYRO0A01298g"
FT                   /old_locus_tag="ZYRO-ORF9552"
FT   CDS_pept        100488..103553
FT                   /locus_tag="ZYRO0A01298g"
FT                   /old_locus_tag="ZYRO-ORF9552"
FT                   /product="ZYRO0A01298p"
FT                   /note="similar to uniprot|P40469 Saccharomyces cerevisiae
FT                   YIL128W MET18 DNA repair and TFIIH regulator required for
FT                   both nucleotide excision repair (NER) and RNA polymerase II
FT                   (RNAP II) transcription possible role in assembly of a
FT                   multiprotein complex(es) required for NER and RNAP II
FT                   transcription"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25497"
FT                   /db_xref="GOA:C5DP86"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024687"
FT                   /db_xref="InterPro:IPR029240"
FT                   /db_xref="InterPro:IPR039920"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP86"
FT                   /protein_id="CAR25497.1"
FT                   /translation="MASEEASIFLETSIVSFVSNVDIDESSSDKTATQIAERISDKKFK
FT                   LLDLIVSLRDYLTSQDLNRRKKALCCLSTVLSKLPDDKLLKNEISVVLSFYASKFDDTL
FT                   MMQETLSGIYSLSGMKFLSMTEVGPILDLLSNKYNPSSHLAATRYFAFKILEKIYQRFS
FT                   PKLIEDGELADLFVKTFLHVGNGEKDPRNLLLSFHLNELVSSNWNNVEKFKEDLFDILF
FT                   CYFPITFRPPKDDPYKISNADLKISLRSAISASPAFAEDAFGNLIDKLAASSPSVKNDT
FT                   LLTVKACIDKFGGEACLKHWLPLWSSLKFEIMHGNDAGYPDSPVSSPTQISEADNYQLS
FT                   VNVMRSIASALLQFDEKAFDKFLSHIVEEVRPNFTYEKDLKQTCCLLGSIASANQQIFN
FT                   KVVALVLPLFFKNSPELSKLKLEIMNLSFFFDAYIRVFGEANSEQNEVPPNSLSEQKDE
FT                   ILMVLSKALTASPKVEVTIRTLSIIQFTKLIKMKGFLMREEVALIVQYIYEAILTDNNK
FT                   NIYYAGLESLKAIGEIHEDIVFEISLKRMLELLPIDPNEGAQLNENEPVDKETILKAIL
FT                   DFTNSRHKLVKESVLGLSKKLCQVAPYADSSEYCFLIISSIHTLLSNNIEMIRENDAGF
FT                   IKENIEMPLFAAMTNYPSLQKDDHNLTLLSNIIFFLNLKSPRNTHQDELTRYKKYFVDS
FT                   LQLFVKPSRLVVPFEKLLCGIDKNCEFNEVEHYFAQTMDLLRSEEITEAQFERLGYLEL
FT                   LTIFTNKWMDEQSLSKFINLDDLSPVNLEMLVWIVKGLVMKNSHHAVLFQEKFVNLLSS
FT                   SEIGNYMAKLFEVFVVDVITFQKYKGISWNNNVKLTYKQKFFNDVFSRLVDAFKNTSEM
FT                   DVKSNYLTALSLVSKHISSNLIEPYMNEMLPLLLQSLDMPNSEVKVSALNTLLDTCEKF
FT                   HQLITEHVQTLSRSLLKLVSPVSYNSVSVRVLALRMLETLTHVVPLNHLLPFKEDIIDG
FT                   LLPVLDDKKRIVRKQCVGTRQAYFELGQVPFE"
FT   gene            complement(<103593..>104231)
FT                   /locus_tag="ZYRO0A01320g"
FT                   /old_locus_tag="ZYRO-ORF9550"
FT   CDS_pept        complement(103593..104231)
FT                   /locus_tag="ZYRO0A01320g"
FT                   /old_locus_tag="ZYRO-ORF9550"
FT                   /product="ZYRO0A01320p"
FT                   /note="similar to uniprot|P40470 Saccharomyces cerevisiae
FT                   YIL127C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25498"
FT                   /db_xref="GOA:C5DP87"
FT                   /db_xref="InterPro:IPR031404"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DP87"
FT                   /protein_id="CAR25498.1"
FT                   /translation="MSSNVSQLHANDAVKGLLAKMLPGAVQSAENSAQKTKQKQKGSKA
FT                   QLIDRNLKRRVQLQELDVEKLKKKQSRIRRRDLQKQRRGQEEIKQLAELEVLERHRKEG
FT                   KLTKKETKHLNRLVNVNAERAKSWELDEDEKEDLLELQKYILEKTTSANRVAKSQKRRQ
FT                   KKKTFNDNKKGVSASMARRYPGLTPGLAPVDMSDEEESSEEEEEVEMKE"
FT   gene            <104605..>108636
FT                   /locus_tag="ZYRO0A01342g"
FT                   /old_locus_tag="ZYRO-ORF9549"
FT   CDS_pept        104605..108636
FT                   /locus_tag="ZYRO0A01342g"
FT                   /old_locus_tag="ZYRO-ORF9549"
FT                   /product="ZYRO0A01342p"
FT                   /note="similar to uniprot|P32597 Saccharomyces cerevisiae
FT                   YIL126W STH1 helicase related protein snf2 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25499"
FT                   /db_xref="GOA:C5DP88"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029295"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP88"
FT                   /protein_id="CAR25499.1"
FT                   /translation="MSATTKDPVVNNKVLPVDEPVKKEEDSHSQTQQQQQEEEVIIIPK
FT                   PVSAEQLEQLIYRYRAIQNRPKENKVEIQAIERTLGEISKDQDLYLYQLERLRNEKKQD
FT                   VEYDQNLLSRQLLALQFLDKDMDIPDDLLLDERQLDVNGLEDSSVQSLDPVKVSLDFDE
FT                   NAKRLGLQDKFTHVFPTKLGVQSTEGMISSRIAKRISELERLPANLGAYSLEDALEFVT
FT                   KDDIPSNIDSLKIKALVELKGLKLLTKQKSLRQKLISNVASQAHHNIPYLRDSPVTMAA
FT                   QRSVQVRNKVIVPQTVRLAEELERQQLLEKRKKERNMHLRKVHRIVEYVNSKQLNTWNY
FT                   RDRCMQFGKHAQVMHNQIEKEEQKKVERNAKQRLAALKSNDEEAYLKLLDQTKDTRITQ
FT                   LLRQTNSFLDSLAQAVRVQQNEVKIMRGEEVPPITDEEREKVDYYEVAHRVKEKVDKQP
FT                   SILVGGALKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLFEMKKEPGP
FT                   FLVIVPLSTITNWTLEFEKWAPTLRTVVYKGTPNQRRSLQNQVRSGNFDVLLTTYEYII
FT                   KDRSVLAKPDWIHMIIDEGHRMKNSQSKLSYTITHYYHTKNRLILTGTPLQNNLPELWA
FT                   LLNFVLPKIFNSAKTFEDWFNTPFANTGAQEKLELTEEETLLIIRRLHKVLRPFLLRRL
FT                   KKEVEKDLPDKVETVIKCGSSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIM
FT                   QLRKICNHPFVFDEVESVINPSRQNTPLLYRVAGKFELLDRVLPKFKASGHRVLMFFQM
FT                   TQVMDIMEDFLRLRDHKYMRLDGATKTEDRQEMLREFNAENSDYFCFLLSTRAGGLGLN
FT                   LQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLD
FT                   IDGKVIQAGKFDNKSTAEEQEAFLRRLIESESSRDQEDKAELDDEELNEILARGDHEKV
FT                   LFDKLDQQRIQEEIDQAKAQGLEHPPPRLIEVDELPEIFTEDITNHLETEPVTLGRVRE
FT                   RKQVFYDDGLTEEQFLQAVEDENNTLEEAIQKRREARSKRQKQGKQQETVQEDDEGEPE
FT                   EQQEQEEEAEIDTLGNTPTEAVDEPFQPEEDAGANEKKPNGKRPSRSSSRKKRTSSAVA
FT                   AADTVAEDDEMVNSVEEDGGEPQEPEKKKPKLKIKLNLKKTPSTPESIESNEKKPEPKT
FT                   NKKTKKQEINEFASQVQNLLNSMREQVEESDGHALTSIFEKLPSKREYPDYYAVIEKPV
FT                   ALDTIMRNAKKGTYKSMEDVRRELQQMYDNARFYNEEGSWVYNDAEALEQFTNKWFETA
FT                   "
FT   gene            <108841..>109413
FT                   /locus_tag="ZYRO0A01364g"
FT                   /old_locus_tag="ZYRO-ORF9544"
FT   CDS_pept        108841..109413
FT                   /locus_tag="ZYRO0A01364g"
FT                   /old_locus_tag="ZYRO-ORF9544"
FT                   /product="ZYRO0A01364p"
FT                   /note="highly similar to uniprot|P05738 Saccharomyces
FT                   cerevisiae uniprot|P05738 Saccharomyces cerevisiae YGL147C
FT                   RPL9A Protein component of the large (60S) ribosomal
FT                   subunit, nearly identical to Rpl9Bp and has similarity to
FT                   E. coli L6 and rat L9 ribosomal proteins and to YNL067W
FT                   uniprot|P51401 Saccharomyces cerevisiae YNL067W RPL9B
FT                   Protein component of the large (60S) ribosomal subunit,
FT                   nearly identical to Rpl9Ap and has similarity to E. coli L6
FT                   and rat L9 ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25500"
FT                   /db_xref="GOA:C5DP89"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP89"
FT                   /protein_id="CAR25500.1"
FT                   /translation="MKFIQTEQFVQIPEGVSVYIKARSIKVVGPRGTLFKDLKHIDVSF
FT                   SRVSAKLVKITVHNGDRKHVAALRTVKSLVDNLITGVTKGYRYKMRYVYAHFPINVNVV
FT                   EKDGKKLVEIRNYLGDKQVRHVPVREGVKIEFSKNQKDELILEGNSIENVSQNAADIQQ
FT                   ICRARNKDIRKFLDGIYVSEKGVIEDY"
FT   gene            <110661..>113726
FT                   /locus_tag="ZYRO0A01386g"
FT                   /old_locus_tag="ZYRO-ORF9542"
FT   CDS_pept        110661..113726
FT                   /locus_tag="ZYRO0A01386g"
FT                   /old_locus_tag="ZYRO-ORF9542"
FT                   /product="ZYRO0A01386p"
FT                   /note="highly similar to uniprot|P20967 Saccharomyces
FT                   cerevisiae YIL125W KGD1 Component of the mitochondrial
FT                   alpha-ketoglutarate dehydrogenase complex which catalyzes a
FT                   key step in the tricarboxylic acid (TCA) cycle the
FT                   oxidative decarboxylation of alpha-ketoglutarate to form
FT                   succinyl-CoA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25501"
FT                   /db_xref="GOA:C5DP90"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP90"
FT                   /protein_id="CAR25501.1"
FT                   /translation="MLRAISSASARQTVSRLAQRSKAASAVNKSLVGLSQHNRFYASGA
FT                   DQFMATSNANYIEEMYEAWQKDPSSVHVSWNAYFKNMGNLNIPSSQAFQAPPTLTGGAQ
FT                   GAENIPIDSNFASAANIDQNVLLHLKVQLLCRAYQVRGHLKAHIDPLQISYGDDKSKGV
FT                   PRELTLEFYGFSERDLDREITLGPGILPRFARDGKTKMTLREIISSMEKLYCTSYGVEY
FT                   THIPSKSKCEWLRERIEIPSPYQYSIDEKRQILDRLTWSTSFESFLSTKFPNEKRFGLE
FT                   GLEAVVPGIKTLVDRCVDMGVEDVVLGMAHRGRLNVLSNVVRKPNESIFSEFKGTTTQD
FT                   GVDGPGDVKYHLGMNYKRPTTSGKYVNLSLVANPSHLESQDPVVLGRTRSLLALRNNLD
FT                   EQTKSIGVLLHGDAAFAGQGVVYETMGFQNLPEYSTGGTIHVITNNQIGFTTDPRHARS
FT                   TPYPSDLAKAFDAPIFHVNANDVEAVTFIFNLAAEWRQTFHTDAVIDIVGWRKHGHNET
FT                   DQPSFTQPMMYQKIAKQKSVFDVYAEKLMVEGSFTKADIEKHRQWVWSLFEESFEKAKG
FT                   YVPNPREWLTAPWENLKSPKEMATEILPHEPTKVDLDTLKKVGLAVSSWPEGFEVHRNL
FT                   RRILTNRAKSIESGEGIDWSTAEAMAFGTLALEGYNVRVSGEDVERGTFSQRHSVLHDQ
FT                   KSERVFVPLKNLSEKQGDFTISNSSLSEYGVMGFEYGYSLTDPDNLVMWEAQFGDFANT
FT                   AQVIIDQFIAGGEQKWKQRSGIVLSLPHGYDGQGPEHSSGRLERYLQLANEDSRFFPSE
FT                   EGLQRQHQDCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFSKQLLRHPLARSRMEE
FT                   FSDGEFQWIIEDVELGKSIAPKEEIKRIVLLTGQVYTALFKKRESLGDKNTAFIKIEQP
FT                   HPFPFAQLRDAIDSYPNLEDIVWCQEEPLNMGSWSYVSQRFPTVLKETQNYKNSQVRYC
FT                   GRDPSGTVAAGNKPAHTAEEEDFLNDVFGLKN"
FT   gene            <114071..>114958
FT                   /locus_tag="ZYRO0A01408g"
FT                   /old_locus_tag="ZYRO-ORF9538"
FT   CDS_pept        114071..114958
FT                   /locus_tag="ZYRO0A01408g"
FT                   /old_locus_tag="ZYRO-ORF9538"
FT                   /product="ZYRO0A01408p"
FT                   /note="similar to uniprot|P40471 Saccharomyces cerevisiae
FT                   YIL124W AYR1 NADPH-dependent 1-acyl dihydroxyacetone
FT                   phosphate reductase found in lipid particles and ER
FT                   involved in phosphatidic acid biosynthesis and required for
FT                   spore germination capable of metabolizing mammalian steroid
FT                   hormones"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25502"
FT                   /db_xref="GOA:C5DP91"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP91"
FT                   /protein_id="CAR25502.1"
FT                   /translation="MSSSVIKTALVTGASSGIGYAVVKELAENGFTVYACARRLDLLEQ
FT                   LSRGYEANKVIPYALDISNFEEIVQLKEYLSKHLPHQRLDVLYNNAGQSCTMPAVDVTN
FT                   ERLNQLFQVNVIGHMNITSQLCQFLINAKGTIVFTGSLSGVSVFPFGAAYAATKAAIHQ
FT                   YARVLHAEMKMFDVRVINAITGGVSTDIADKSPLPKSSPFYFPEGLKALEERKLMSAKN
FT                   FPMSAETYAQKLVKDILSPRDPVDVYRGTLASVVSWLMMFAPYWLVEWVTFKKFKLDSV
FT                   EKALGQKRETEKQE"
FT   gene            <116475..>118121
FT                   /locus_tag="ZYRO0A01430g"
FT                   /old_locus_tag="ZYRO-ORF9534"
FT   CDS_pept        116475..118121
FT                   /locus_tag="ZYRO0A01430g"
FT                   /old_locus_tag="ZYRO-ORF9534"
FT                   /product="ZYRO0A01430p"
FT                   /note="some similarities with gnl|GLV|CAGL0J09922g Candida
FT                   glabrata CAGL0J09922g and some similarities with
FT                   uniprot|P40472 Saccharomyces cerevisiae YIL123W SIM1
FT                   (putative) invovled in control of DNA replication or
FT                   uniprot|P53616 Saccharomyces cerevisiae YNL066W SUN4
FT                   Protein involved in the aging process"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25503"
FT                   /db_xref="InterPro:IPR005556"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP92"
FT                   /protein_id="CAR25503.1"
FT                   /translation="MKLSANILTAALLGSQVFVNAMPHMPIKRDEEDCSETVPAHADSH
FT                   QHKRAVAVNYVYQTVTVDGNGNSYTPTASASGSAASSSAPSSSDAVAMVTQYVTPGVSA
FT                   SSPSGGYGGGLSGFATSVIHNAQPSQSSSPSSSGSGSSSSSSSSPSGSGDNWTETNSEA
FT                   SSSGDASSNSNASASAGNGDSTASSSADSTAESGTNSSAQASAEAQAHSNNGNSHSDSD
FT                   SSSSSSSSSNNNGGSSSSSSSSSSSSGSSSSSSGSSGSGGSSSSSSSSSSSGGIFGDLS
FT                   AYEGPNEKFQDGTIPCSQFPSGQGVIPIDWINEGGWSGVENSDTSTGGSCKEGSYCSYA
FT                   CQAGMSKTQWPSTQPSDGRSIGGLYCKNGYLHRTNTDADYLCEWGQDVASIVSKLDQDV
FT                   AICRTDYPGTENMVIPTYVKSGNSQPLTVVNQDTYYQWEGKPTSGQFYVNNAGVSLEDG
FT                   CVWSTPGSGKGNWAPLNFGAGYTNGITYLSLIPNPNNNVPLNYNVKIVAADDSSIVTGD
FT                   CKYENGEYNGSGSDGCTVAVTSGKAQFVLYN"
FT   gene            <119540..>120700
FT                   /locus_tag="ZYRO0A01452g"
FT                   /old_locus_tag="ZYRO-ORF9530"
FT   CDS_pept        119540..120700
FT                   /locus_tag="ZYRO0A01452g"
FT                   /old_locus_tag="ZYRO-ORF9530"
FT                   /product="ZYRO0A01452p"
FT                   /note="weakly similar to uniprot|P40473 Saccharomyces
FT                   cerevisiae YIL122W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25504"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP93"
FT                   /protein_id="CAR25504.1"
FT                   /translation="MQEGSKREEDIIKKINSSTFQQSRGDASSNPVKTRIRRQILKDLG
FT                   FLQEGEQEVEDELIANDKCLDLYLQIRLERERKQIESLRESNLDRLNTIIDKCLQSDKF
FT                   TKDSLWKILDLIYKPLPSGSSASSSQQQQEQQQEQRPAQPTVALSPDARKRKLASPVVS
FT                   PKGHKRFASDVPSLGTVAATQPPYYGAPIQSGPTPWVGQQYNQQAPPQHQQQYEFKNTI
FT                   PAGLGGPARHPHQETIQTTPISENQPPTAAMAQQQQYFAGHYSPAQFVANGARGGYFLP
FT                   AATATAAAQSGRPHPVVMMQSDSPTQRAPSGYLQPPQHIPSSYGSTIKQEYPMTTRRLQ
FT                   GHRRSQSANVPTFGIGSTKSPSRELHATPQKPVNFLIHTPKHPPPG"
FT   gene            <121026..>122642
FT                   /locus_tag="ZYRO0A01474g"
FT                   /old_locus_tag="ZYRO-ORF9527"
FT   CDS_pept        121026..122642
FT                   /locus_tag="ZYRO0A01474g"
FT                   /old_locus_tag="ZYRO-ORF9527"
FT                   /product="ZYRO0A01474p"
FT                   /note="similar to uniprot|P40474 Saccharomyces cerevisiae
FT                   YIL121W QDR2 Multidrug transporter required for resistance
FT                   to quinidine barban cisplatin and bleomycin member of the
FT                   major facilitator superfamily of transporters conferring
FT                   multiple drug resistance (MFS-MDR)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25505"
FT                   /db_xref="GOA:C5DP94"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP94"
FT                   /protein_id="CAR25505.1"
FT                   /translation="MCTDTDTKVVFDSSQKDSNSLKTSDQKSDGSLAGKDNESEIPYSR
FT                   FKRRDKLLLVAQCASTGLFSSIAASIYFPVLTTVERKFHITEEQANITVVVYYVFQGLS
FT                   PSFMGNMADTLGRRPVILVSVLIYFVACLGIASCNTYSQLIGLRCLQAAGISPVIAINS
FT                   GMMTDITTRAERGGYVGYTSGCQVLGSAFGALIGAGLSSRWGWRSVFWFLSIGSGICLV
FT                   ISTLLLPETKRTIVGNASITPRSILNRSPILAIPAVRRELHLDNPDLQTLEPSPKMNIL
FT                   ASYKILLTPEIDLLLFVAGLQFATWTTHQTALSLNLSKKYNLSVAKIGLCFLPSGISTL
FT                   LSVVFSGRFLNWNYKRRLALHNNWLQEQKKQLFEENDNDIDRVNHLLATDPRYHFNIFR
FT                   ARLQLAFFTLVLSSGGFAAFGWCIQVKAPLAAVLVTSGFASLFSNCILTMSTTLVVDLF
FT                   PSKASTAAGLVNLFRCMLSVVFIASLHKMSSKMNYGGVFTFLAALTASSSVLLLIPVSN
FT                   GKTLSYRRREEERRLLEDVEN"
FT   gene            complement(<123559..>124797)
FT                   /locus_tag="ZYRO0A01496g"
FT                   /old_locus_tag="ZYRO-ORF9526"
FT   CDS_pept        complement(123559..124797)
FT                   /locus_tag="ZYRO0A01496g"
FT                   /old_locus_tag="ZYRO-ORF9526"
FT                   /product="ZYRO0A01496p"
FT                   /note="highly similar to gnl|GLV|CAGL0J09966g Candida
FT                   glabrata CAGL0J09966g and similar to YNL064C uniprot|P25491
FT                   Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
FT                   (nuclear envelope protein) heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25506"
FT                   /db_xref="GOA:C5DP95"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP95"
FT                   /protein_id="CAR25506.1"
FT                   /translation="MVKETKFYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAE
FT                   KFKEASSAYEVLMDAEKREAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGG
FT                   GASRPRGPQRGRDIKHEITVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGAVKKCTS
FT                   CNGQGVKFITRQMGPMIQRFQTECDACDGTGDIINPKDRCKACSGKKVANERKILEVHV
FT                   DPGMKDGQKIVFKGEADQAPDIIPGDVIFVVSERPHKHFRRDSDDLVYEADIDLLTAIA
FT                   GGEFAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGGFGNLLVKFNIVFPKD
FT                   HFTSLENMKKLEEILPPRKKTSIPSKAHVDDCVLSEFDAAKYSSTRGGRSANSYDEDDE
FT                   DQPGAEGVQCASQ"
FT   gene            <125522..>126433
FT                   /locus_tag="ZYRO0A01518g"
FT                   /old_locus_tag="ZYRO-ORF9521"
FT   CDS_pept        125522..126433
FT                   /locus_tag="ZYRO0A01518g"
FT                   /old_locus_tag="ZYRO-ORF9521"
FT                   /product="ZYRO0A01518p"
FT                   /note="similar to uniprot|P53944 Saccharomyces cerevisiae
FT                   YNL063W MTQ1"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25507"
FT                   /db_xref="GOA:C5DP96"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP96"
FT                   /protein_id="CAR25507.1"
FT                   /translation="MPRVAPRLLKKALKAHSLLPLLLPACRSIEQSAQEFRWIRNELPN
FT                   MKQVRQACLQRFKLVPLQYILGNQPFGELDIVCRPGVLIPRWETEEWVCELSERLLGSM
FT                   GPLNSPFPIWDLCCGTGCVGLLLQRRLGPGCSLTAVDVTDAALGLCVENAHRNDLERPR
FT                   LIATDVLTKKIVPDSRISLLTCNPPYIPKNQFAADTSPSVKRHEPQLALIGDLEFYSSL
FT                   VNTWIHHTDSFVYEVGDRRQIEYVMHGIRDDPRLQLEWCVGYRLDSSGCPRVVYGYKAE
FT                   SSLAGALSGYGDLLYIPPGAGK"
FT   gene            complement(<126496..>127860)
FT                   /locus_tag="ZYRO0A01540g"
FT                   /old_locus_tag="ZYRO-ORF9519"
FT   CDS_pept        complement(126496..127860)
FT                   /locus_tag="ZYRO0A01540g"
FT                   /old_locus_tag="ZYRO-ORF9519"
FT                   /product="ZYRO0A01540p"
FT                   /note="similar to uniprot|P41814 Saccharomyces cerevisiae
FT                   YNL062C GCD10 Subunit of tRNA (1-methyladenosine)
FT                   methyltransferase with Gcd14p required for the modification
FT                   of the adenine at position 58 in tRNAs especially tRNAi-Met
FT                   first identified as a negative regulator of GCN4
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25508"
FT                   /db_xref="GOA:C5DP97"
FT                   /db_xref="InterPro:IPR017423"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP97"
FT                   /protein_id="CAR25508.1"
FT                   /translation="MDYLHHITADQHVILKLPSGNWKIVELKPHTSVSLGKFGAFQVDD
FT                   IIGYPLGTQFEIYYENQSQPNDDDPKNKNRTPVGKVRIMDEDVGGSTEGSELSNVNSSA
FT                   NNMNLINIGNEIQAMTSEQIEELKRQSISGEEIVAKMIESHSAFHKKTLQSQEKYLNRK
FT                   KRKFAKYFTVEYLSASFLLQWLLEKGDTQKVLDMSEETVAMLLNVANIRSEGQYLCMDE
FT                   TGGLLVYFMLERMFGGDNNSSHTGKIVVLHENEHANLDLLKYSNYSEKFINDHVKTVSL
FT                   LDFFEPPNESEIDSYFKPIPKEEARQLKAGKKNAYQRRLKWYYNQHEIVQLSTKSQYDA
FT                   LIIASTLQLSTLVPLLAEKVHGSRPVVCYSQFKEILLELTHTLYTDLRFLAPSISETRV
FT                   RPYQSVRGKLHPLMTMRGGGGYLMWAHRVIPAPEPPAHETEDEGNGPEEKKQKTQ"
FT   gene            <128145..>129998
FT                   /locus_tag="ZYRO0A01562g"
FT                   /old_locus_tag="ZYRO-ORF9518"
FT   CDS_pept        128145..129998
FT                   /locus_tag="ZYRO0A01562g"
FT                   /old_locus_tag="ZYRO-ORF9518"
FT                   /product="ZYRO0A01562p"
FT                   /note="similar to uniprot|P40991 Saccharomyces cerevisiae
FT                   YNL061W NOP2 Probable RNA m(5)C methyltransferase essential
FT                   for processing and maturation of 27S pre-rRNA and large
FT                   ribosomal subunit biogenesis localized to the nucleolus"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25509"
FT                   /db_xref="GOA:C5DP98"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023273"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP98"
FT                   /protein_id="CAR25509.1"
FT                   /translation="MGNRRLSKRQPDPPTFDEFKSRKDKKSSKKKEKVKRQLPTEDGVE
FT                   KKKSKKQKSSKPVAEKVEKEETEEDKLPEVDLEELSKAKKSLFDDEEEEVNGDSEDEQL
FT                   QDEFDLEQEYDDDDDEDEAHAQQMFSDDDDDEVDLEELNVDNMESLSKKLDEEQALDAE
FT                   EAEMELVEGEREQPKANVLPTEEEEEMEAQQQPDLTTVRTRMIEIVKVLDDFKNLAAEG
FT                   RSRTEYVDRLIKDICQYFGYSPFLAEKLFQLFSPAEALEFFEANEISRPITIRTNTLRT
FT                   RRRDLAQALVNRGVNLQPIGSWTKVGLQIFDSQVPIGATPEYLAGNYILQAASSFLPVI
FT                   ALDPQENERILDMAAAPGGKTTYISALMKNTGCVFANDANKSRTKSLVANIHRLGCTNT
FT                   IVCNYDAREFPRVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFMQIPHLQKQLLL
FT                   SAIDSVDSHSKTGGIIVYSTCSVAVEEDEQVVDYALRKRPNIKLIETGLAIGKEGFASY
FT                   RGKKFHPSLKLTRRYYPHTYNVDGFFVAKFQKLGPSPHDDNQNSAKEKEAAAVKEAVEE
FT                   GIIHSDFASFDNEEDDKYIQKSQKQNLLKRGVNPKSVKSNK"
FT   gene            complement(<130119..>132365)
FT                   /locus_tag="ZYRO0A01584g"
FT                   /old_locus_tag="ZYRO-ORF9516"
FT   CDS_pept        complement(130119..132365)
FT                   /locus_tag="ZYRO0A01584g"
FT                   /old_locus_tag="ZYRO-ORF9516"
FT                   /product="ZYRO0A01584p"
FT                   /note="highly similar to uniprot|P53946 Saccharomyces
FT                   cerevisiae YNL059C ARP5 Nuclear actin-related protein
FT                   involved in chromatin remodeling component of chromatin-
FT                   remodeling enzyme complexes"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25510"
FT                   /db_xref="GOA:C5DP99"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR027664"
FT                   /db_xref="UniProtKB/TrEMBL:C5DP99"
FT                   /protein_id="CAR25510.1"
FT                   /translation="MSRDNSLPPLRVRVLEDPPLRDQPEPFQDQSSYNPNVPIAIDFGS
FT                   SKLRAGYVNDPNPSHIFPNRLTRYRDRKLAKTMTFIGNDTSLDQAVRVQAKSAFDGPLV
FT                   TNWDYVEDTLEYTFNHLGVAANGGISNPLVINERLATIQSQRANWYQILFECFDVPGVT
FT                   FGIDSLFGFYHNSGPNSTGLVIGCGNEDTNVIPVVDGKGVLTESKRINWGGNQATEYLT
FT                   NLMSLKYPYFPTKLSPFQYKTMYEDYCYVSQSYDEELEKYLSLDNLETNNVVLEAPFTE
FT                   VVQPQKTEEELRLQAEKRKESGKRLQEQAKQKRVERMIQKEEELQYYTQVREQLKDQPK
FT                   KKVLSILQNSGFDDERDFKKYVYNLERSLKKSQSTELEDGEEDDQDTENKFELLNVPDE
FT                   QLNEEQLKEKRKQKILKASQDARNKAKEEKERAAQIEEKKRLQDEQWRENDLTSWIKDK
FT                   HQKLNKLISQRKERIKMRDEMKDRKSQMSQSRMKNLATLAEDSGRGGSKRTRQQATIDN
FT                   DPNDTFGANDEDWMVYSDISQSPEALEELIEDQYKEIVALERVLLEFDPNFTEEDTLDA
FT                   QYDWRNSVLHLFLRGPRPHDGESIHHQHQMHMNIERIRVPEVLFQPNMGGEDQAGIPEL
FT                   CETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAKLPGLRERIVKEFSEFLPSGSPFSI
FT                   RKSQDPSLDAWRGMAKLAQNTEDFKHGYITKQEYLEYGPEYIKEHNLGNVHYFE"
FT   gene            <133530..>134252
FT                   /locus_tag="ZYRO0A01606g"
FT                   /old_locus_tag="ZYRO-ORF9514"
FT   CDS_pept        133530..134252
FT                   /locus_tag="ZYRO0A01606g"
FT                   /old_locus_tag="ZYRO-ORF9514"
FT                   /product="ZYRO0A01606p"
FT                   /note="highly similar to uniprot|Q00245 Saccharomyces
FT                   cerevisiae YIL118W RHO3 Non-essential small GTPase of the
FT                   Rho/Rac subfamily of Ras-like proteins involved in the
FT                   establishment of cell polarity GTPase activity positively
FT                   regulated by the GTPase activating protein (GAP) Rgd1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25511"
FT                   /db_xref="GOA:C5DPA0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPA0"
FT                   /protein_id="CAR25511.1"
FT                   /translation="MGMLCGSSSSQSSKKPIERKIVILGDGACGKTSLLNVFTRGYFPK
FT                   VYEPTVFENYIHDIFVDNRHITLSLWDTAGQEEFDRLRSLSYSDTDVIMLCFSLDSRDS
FT                   LMNVQHKWVGEIADHCEGVKLVLVALKCDLRRAEPENTAITPNLIHQQRTEQSRSDLEQ
FT                   NISGINSTQNGDVISYEEGVAMAKKIGALRYLECSAKFNKGVNEAFTEATRVVMNSEPR
FT                   NKETREQEESSGSRCTIM"
FT   gene            complement(<134352..>135293)
FT                   /locus_tag="ZYRO0A01628g"
FT                   /old_locus_tag="ZYRO-ORF9512"
FT   CDS_pept        complement(134352..135293)
FT                   /locus_tag="ZYRO0A01628g"
FT                   /old_locus_tag="ZYRO-ORF9512"
FT                   /product="ZYRO0A01628p"
FT                   /note="some similarities with uniprot|P53947 Saccharomyces
FT                   cerevisiae YNL058C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25512"
FT                   /db_xref="GOA:C5DPA1"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DPA1"
FT                   /protein_id="CAR25512.1"
FT                   /translation="MAGHTVVQRALPNIASGSFAQSASKTSSHTSKTSYSAVVTPPSSD
FT                   GNPNVWRANHLPDGLIYIIVGGTAAAIFAFIILWYAVARYMSRRVAKKTMYETNIQWRD
FT                   TPSSGLYDHGDEKELYQSLVDHSDKNDARPKKSLIGLLGGGNGLGSSTSYDTVADADMD
FT                   DDLIGGGYQERFNPVQDFVPSHFPRSSLFISPTLEVAQQNQQSKSVGRTNHFQNLSVTS
FT                   LPSASESSSNLLDRPERTASPERKPKAYGRYHQRNRSSVGVSDHSHSRSHSRSKSASSF
FT                   EMPNVNNNNKKHGTTPSRFLNNLLEGNDDGTT"
FT   gene            <135642..>136205
FT                   /locus_tag="ZYRO0A01650g"
FT                   /old_locus_tag="ZYRO-ORF9510"
FT   CDS_pept        135642..136205
FT                   /locus_tag="ZYRO0A01650g"
FT                   /old_locus_tag="ZYRO-ORF9510"
FT                   /product="ZYRO0A01650p"
FT                   /note="highly similar to uniprot|P53949 Saccharomyces
FT                   cerevisiae YNL056W Cytoplasmic protein required for
FT                   replication of Brome mosaic virus in S. cerevisiae which is
FT                   a model system for studying replication of positive- strand
FT                   RNA viruses in their natural hosts"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25513"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPA2"
FT                   /protein_id="CAR25513.1"
FT                   /translation="MLYYKILLYYRIYLKPMMYIPPLNFSPVVSTDVSLYRSGYPMPLN
FT                   YPFIRDQLHLRTIIHVGDKQDLSPEYAEFLEQGNIQFHNIYMDSCRDDGFKDRMNQILE
FT                   IVLNVDNYPMLIHSGKGKHRVGTVVGIIRKLLQGWSIAGIYQEYDIFSGGLKGEADLEF
FT                   ITMFETSLFIRKDKIPGFVTSVTT"
FT   gene            <136284..>137444
FT                   /locus_tag="ZYRO0A01672g"
FT                   /old_locus_tag="ZYRO-ORF9509"
FT   CDS_pept        136284..137444
FT                   /locus_tag="ZYRO0A01672g"
FT                   /old_locus_tag="ZYRO-ORF9509"
FT                   /product="ZYRO0A01672p"
FT                   /note="highly similar to uniprot|P07172 Saccharomyces
FT                   cerevisiae YIL116W HIS5 Histidinol-phosphate
FT                   aminotransferase catalyzes the seventh step in histidine
FT                   biosynthesis responsive to general control of amino acid
FT                   biosynthesis mutations cause histidine auxotrophy and
FT                   sensitivity to Cu Co and Ni salts"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25514"
FT                   /db_xref="GOA:C5DPA3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPA3"
FT                   /protein_id="CAR25514.1"
FT                   /translation="MTFDLTKIVRPKIYNLEPYRCARDDFKDGVLLDANENPHGPTQPG
FT                   LEGSGLNRYPDPHQLAFKTAMANFRNGENHQYKDLPQPLTAENLCLGVGSDESIDAIIR
FT                   ACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNSFQANTDEVIKTAQNDPS
FT                   IKLIFITSPGNPTGAKVETSRIEKILQNWDRGMVVVDEAYIDFCGGSTAPLVTKYPNLC
FT                   VLQTLSKSFGLAGIRLGITFASKEMARVLNSMKAPYNISSLASEYALRAVQPDNLKVMK
FT                   QLSLENKSQQHRLVKELTSLPNVHKEPIGGLDANFILLRIGNGDGDNDLAKKLYYKLAT
FT                   ESGVVVRYRGSELGCTGCLRITVGTKEENDKLVKEFAKLLTQLTSN"
FT   gene            complement(<137498..>141925)
FT                   /locus_tag="ZYRO0A01694g"
FT                   /old_locus_tag="ZYRO-ORF9508"
FT   CDS_pept        complement(137498..141925)
FT                   /locus_tag="ZYRO0A01694g"
FT                   /old_locus_tag="ZYRO-ORF9508"
FT                   /product="ZYRO0A01694p"
FT                   /note="similar to uniprot|P40477 Saccharomyces cerevisiae
FT                   YIL115C NUP159 Subunit of the nuclear pore complex that is
FT                   found exclusively on the cytoplasmic side forms a
FT                   subcomplex with Nup82p and Nsp1p required for mRNA export"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25515"
FT                   /db_xref="GOA:C5DPA4"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR037686"
FT                   /db_xref="InterPro:IPR039462"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPA4"
FT                   /protein_id="CAR25515.1"
FT                   /translation="MTCIGSEIETLTSEDFGFKKLGQAAILPSYDERLPFASLQNLDIS
FT                   NHRSLYVACSGNKIVIGKLQQLRDYIQNDAKSEISFIWEREVDDVIAVKLIRDEKLVYV
FT                   NKQSQVFELDLNKLGEPSEVFNFDCDLVYVKFWRNSVLLALDSNGQLRGLHLVQRQLTS
FT                   LLENVAAFDLFQDKLYAFFKSFSVQVFELQSWNQLSKNSEFTTPSELLDEIKEEYLPIS
FT                   ITVLASQEYQLVFGIPVSADEEDVSYDHRIFVVRKDDDKMTFQESFDITPAFGSVLRYP
FT                   MYYDEKLSQLLNDTPQINILASSCSSEITIWDSAKVVQPLQDSERAVLPISKVTDNDTN
FT                   PVGIALDVVTEGVVAQPCPGVDSVDKLPLIYVLNNEGNLQIIGFYHATAIKEGKFNVDA
FT                   LKQSIVAQETVEEVPFKESEAKDEPKKLEDPVNSLGGLSLGGETNKTESKPLFGGLGQA
FT                   DSGTTISQDSSTSNQPSFGKPSFGQSSFGQSSFGKPAFGQSSSDQSPFGQSSFGTPAFG
FT                   QSSSGQSPFGQSAFGKPAFGQSSSESSAPAFGKTSFGTSIESSAPAFGKPSFGAATNTS
FT                   APATESSVPAFGKPSFGVATDTSAPATESSVPAFGKPSFGAAANTSSPAFGQHIFGKSG
FT                   FGASSGNESALDKPSEPAFGKAAFGQPSFGQPSFGQSSFGQPSFGSTTNGPTSSSSTFG
FT                   KPSFGSNSNTGFGAFAFPKEKSPFESSSLNTSGSSFGNFAKGQSKSESPFANLVKKEND
FT                   DNKSLFGAEKKDGDTSDKPKLEISEQPKSESSTSSSPPAETKPSFSRLSTGVNAKSITT
FT                   PEKPTFGHSTLGSISSNKKQSPFAALAKDENLPVFTSPSYGASTSRPSFGQASAAPSSP
FT                   SKQKFSPLGQKEGKKEEEEDKNAKEGKKAEDSTEEEKTSTGKKSSPDNDDDLSDSTVEQ
FT                   TPARSESSISSLTAKIKESATLSSNDLKSPSITQQPKSKEGQSPFAQYTNDLNKPSSTG
FT                   FTFSQVPNLNKEKEDSNNEFKLQISTKDDKRTETQTPESSENEGTLPEDLENSIEGAPK
FT                   DSVSSHPDEKGGYGGDDESQPKTSEVKKEGDRIKSSSPTALNAVSREESYDTLDDFTRG
FT                   ELENAGIGAKAAAEGRKDQLKTVESAVSVDAENSSDDHERSVQTQASPPVLVSSGTQVE
FT                   KAASGDADCQTNPIELSDFKIQAFENDDAYLGEQYRPKPMPEYFSGASVTNIKYSSQDP
FT                   ILKSIERTYHYVSAELSVLMENISGLDSFFQDQCFEHPVKINESSITNMYQWRIPDASK
FT                   LQTILAEKNKPMKELYGQVESTSGKVSELTEKGIESLQNKLIVIRDEYSNLEKLSHEFQ
FT                   KAFGGLRYHQLDKQSELRNKMFKTSETIQHIEELLQILKLYTVQGKQMESNTYVVKLAR
FT                   EAADRENLLQEIARLREDIRNLNLKDERALEPKESSAAVANGIQSIEVVQVGLKLNTKR
FT                   QLGEMLKKRTNIET"
FT   gene            complement(<142173..>143018)
FT                   /locus_tag="ZYRO0A01716g"
FT                   /old_locus_tag="ZYRO-ORF9501"
FT   CDS_pept        complement(142173..143018)
FT                   /locus_tag="ZYRO0A01716g"
FT                   /old_locus_tag="ZYRO-ORF9501"
FT                   /product="ZYRO0A01716p"
FT                   /note="highly similar to uniprot|P04840 Saccharomyces
FT                   cerevisiae YNL055C POR1 Mitochondrial porin (voltage-
FT                   dependent anion channel) outer membrane protein required
FT                   for the maintenance of mitochondrial osmotic stability and
FT                   mitochondrial membrane permeability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25516"
FT                   /db_xref="GOA:C5DPA5"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR027246"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPA5"
FT                   /protein_id="CAR25516.1"
FT                   /translation="MAPPFFSDIGKDINGLLGKDFYHGTNAAVDVSTVAKNGVKFTLKA
FT                   KQAVKDGPLSANVETRVSDKATGLTLTQGWSNANNLNTKIELADLTPGLKSELVTSLVP
FT                   GVSKAAKLNVSFVQPFFTARGAFDLLKGPSFVGDLTLAHEGIVGGAEIGYDITGGSLSR
FT                   YAVALGYSAGDYSLGLSTNNAQLTTVSFFQNVSPILQVGAKATSVPKELTNVNIEFATK
FT                   YLPDATSQIKTKIADSGIVALAYKQELRTGVTLGVGASFNALNLAEPVHKLGGSLSFSA
FT                   "
FT   gene            <143935..>146781
FT                   /locus_tag="ZYRO0A01738g"
FT                   /old_locus_tag="ZYRO-ORF9500"
FT   CDS_pept        143935..146781
FT                   /locus_tag="ZYRO0A01738g"
FT                   /old_locus_tag="ZYRO-ORF9500"
FT                   /product="ZYRO0A01738p"
FT                   /note="weakly similar to uniprot|P53950 Saccharomyces
FT                   cerevisiae YNL054W VAC7 Integral vacuolar membrane protein
FT                   may function to regulate Fab1p kinase activity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25517"
FT                   /db_xref="GOA:C5DPA6"
FT                   /db_xref="InterPro:IPR024260"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPA6"
FT                   /protein_id="CAR25517.1"
FT                   /translation="MSDEDHKLTVETETVEAPGESLLPSTIQPQSITTNENSNENGNMD
FT                   YDNITTATTMTGMNNSNNNVNDNNNVSGISNNNVNSTNSNMNSNANNGSSNANTNMSTN
FT                   GSTAFRDISPAHFAAAHAAAHAATSTHQPSSATEANFNLIDHNPLSPHAIQSLKNKKSS
FT                   LLINNDGKKESLPNNGNLSTSELSRRSRNDDLEPSQMAAGGQQDQRVPQSSHSAKAATA
FT                   PPAPPKQNANLAGPPMIQRPSLPLMNSREILLENEKQKSGGCKPKESKEPERAPTNPTN
FT                   SHTDNVAASAHNEEDTDSLHKPTKADFFAARLASAVGENDISDSEETFIYESAANSTKN
FT                   AVPSGVGNNSINDNSYNKYPDSAQHGVASKMSVPVLNNNAKLLNRLKSTRHTSLSALPA
FT                   NPSMPFSAVAPTPSPIANTGTGITAHSSTDDLNSVKSFARQNQRGPVDLQSVKSFSSEP
FT                   RSPDKRMSLVSLAKGNSAVAPVPSSRTNTGPQQPQQPQLPQLPQLPQQPQQYPQQLPQP
FT                   QQQLSRKPSISNSTLRHVSASHMGVPRAKPEPTGFKRKLRTTASKIFDANGAPLRRYSG
FT                   VPDDVNLEDYIEQHPSQDTKRLGHDLGGIDDQQSTIQEEAEAAAAAAAAAEYGGDVDGD
FT                   DIQSMFFYNHHGNLEARPQISDYEEDGEDLENNNNPNNNNGSHNHQSNGNTTYLNAPYG
FT                   GNLPYANEYTPLKPKTHHARTTLGYSPHNFYTRKTSWAKFKSFIYFSCVTCMLLTVGFV
FT                   LGFLLASNKELQDFNIVLIDNVLSSADELIFDVTVSALNPGFLSIDVQNVDLDIFAKSS
FT                   HVQEDGIKYRAGSSTIGDDDDDDDPPNQKETVLLGTAYMLETPLRFHGNVLLKRDYDVG
FT                   ISSIKLLDPGAKQQQESDTLALLRLKPKQLEDDVSKWKNIIKHDYQLIVRGNMRYKVPY
FT                   GGAKSVPVQSHTEVKASP"
FT   gene            <147401..>148399
FT                   /locus_tag="ZYRO0A01760g"
FT                   /old_locus_tag="ZYRO-ORF9496"
FT   CDS_pept        147401..148399
FT                   /locus_tag="ZYRO0A01760g"
FT                   /old_locus_tag="ZYRO-ORF9496"
FT                   /product="ZYRO0A01760p"
FT                   /note="weakly similar to uniprot|P38590 Saccharomyces
FT                   cerevisiae YNL053W MSG5 Dual-specificity protein
FT                   phosphatase required for maintenance of a low level of
FT                   signaling through the cell integrity pathway regulates and
FT                   is regulated by Slt2p also required for adaptive response
FT                   to pheromone"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25518"
FT                   /db_xref="GOA:C5DPA7"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPA7"
FT                   /protein_id="CAR25518.1"
FT                   /translation="MSAQDPARSPRSFQAKNTKNLSLNISKPSTATAARTTTGLQDTPI
FT                   PRPVGLGDTKFRRPTPLMSRRSDAAIYTQRRNANSNGNNNSNNGNGPRLHRVHSLSLSV
FT                   KTTELEPPASSKQMWVLPRKKSFDEDVEKSGVGPSSAENAGNAYPDGPLCVVSPNVYLY
FT                   SEPTLEQALKFDLVINVAAEIADLGPLIHRGSGVEYVRVPWTHNTRIIDELPILTETIH
FT                   LAQQRGLRVLIHCQCGVSRSASLIVAYIMRYEKLPLNDAYEKLKSVALDISPNMGLIFQ
FT                   LMEWGETLDSESRLISSFSQETTPRTPGEYFKTNLSSASTCSSTTVVSERE"
FT   gene            complement(<148588..>149925)
FT                   /locus_tag="ZYRO0A01782g"
FT                   /old_locus_tag="ZYRO-ORF9494"
FT   CDS_pept        complement(148588..149925)
FT                   /locus_tag="ZYRO0A01782g"
FT                   /old_locus_tag="ZYRO-ORF9494"
FT                   /product="ZYRO0A01782p"
FT                   /note="similar to uniprot|P53960 Saccharomyces cerevisiae
FT                   YNL040W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25519"
FT                   /db_xref="GOA:C5DPA8"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPA8"
FT                   /protein_id="CAR25519.1"
FT                   /translation="MVTESLTRPTTVGALACQRNSFLFNGFKTTVISCEPVKGKPKDPV
FT                   KYLVELHDTILFPEGGGQPSDSGYLKCSNDRIPVSYVSRVGLHAKHHVGQYIDPGTTVE
FT                   VEVDQSKRVDYMQQHTGQHLLSAILESEPYKLDTLSWSMGGVISAKKPTLEINDYFNYI
FT                   ELPRKLTSQEIEQVSHKVNELISINPQQISVIERTPEAHGDVQTSKIPDDYDLEKGVLR
FT                   TIHIGEIDSNPCCGTHLQRTNQIGSILISPNQTNIRGSNSRLYFMCGNRVVNYGMAVNK
FT                   LVGTAKSSLSCLESEIPEKIDRQRDLIQKSSKREQFWIKELASYESDRLLAKVKEAGKA
FT                   FLLKDEYGTLEFLLQVFKEFTNKLGKTPNEYQLVLCGREKSTESGSVLIVSESGEKIST
FT                   IAASLSGVVPTLKGGGGKKGGKWQGKIVKFTENDWKSVKNYLETEF"
FT   gene            complement(<150103..>151233)
FT                   /locus_tag="ZYRO0A01804g"
FT                   /old_locus_tag="ZYRO-ORF9493"
FT   CDS_pept        complement(150103..151233)
FT                   /locus_tag="ZYRO0A01804g"
FT                   /old_locus_tag="ZYRO-ORF9493"
FT                   /product="ZYRO0A01804p"
FT                   /note="similar to uniprot|P53962 Saccharomyces cerevisiae
FT                   YNL035C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25520"
FT                   /db_xref="GOA:C5DPA9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR039328"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPA9"
FT                   /protein_id="CAR25520.1"
FT                   /translation="MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTG
FT                   KSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPF
FT                   LSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVL
FT                   MSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELND
FT                   KSDEAKEPRPVEFNDVRESWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNN
FT                   AIDINAAHGDEVVRDVFVPARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLN
FT                   VLDEQPVVVEEPKETKHSKKKHSKSKKSNKQRFKPY"
FT   gene            complement(<151477..>151550)
FT                   /locus_tag="ZYRO0A01826r"
FT                   /old_locus_tag="Zyro0A.tIle.AAT.33"
FT   tRNA            complement(151477..151550)
FT                   /locus_tag="ZYRO0A01826r"
FT                   /old_locus_tag="Zyro0A.tIle.AAT.33"
FT                   /note="tRNA-Ile (AAT) cove score=71.64"
FT   gene            <152134..>154248
FT                   /locus_tag="ZYRO0A01848g"
FT                   /old_locus_tag="ZYRO-ORF9492"
FT   CDS_pept        152134..154248
FT                   /locus_tag="ZYRO0A01848g"
FT                   /old_locus_tag="ZYRO-ORF9492"
FT                   /product="ZYRO0A01848p"
FT                   /note="similar to uniprot|P40494 Saccharomyces cerevisiae
FT                   YIL095W PRK1 Protein serine/threonine kinase regulates the
FT                   organization and function of the actin cytoskeleton through
FT                   the phosphorylation of the Pan1p-Sla1p-End3p protein
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25521"
FT                   /db_xref="GOA:C5DPB0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPB0"
FT                   /protein_id="CAR25521.1"
FT                   /translation="MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPAD
FT                   TPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYE
FT                   VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIE
FT                   NVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQA
FT                   IDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQ
FT                   QPMQRPNICQVLEEVSRMQGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAP
FT                   PAQVAPLTPAQSLGANGMPVGVTPQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGP
FT                   AQVAGPVPMGSQDMSSGILPPFNRASTLPTDGFSTGPGKDGGVITSAVNTGPETIKDRP
FT                   FNYVDSETQTSDAGSITTSKPYLHPSAVSSTRSLPAQNADHDSRPRSSSLDFKSAARKK
FT                   PADEEILENLIALSNRRDDPNKRNSFNSFNSSPIGQRSPTGGANVPTTPDSLARIKSNP
FT                   DTKESIQKKVQSLLKAAEDSPKNKSTSEIVNIRTTTSSFSENGLRKTTSNVENGKSTTR
FT                   SIKTPSSVNGKSESKSKPPPPPPKPEHLRPKKPPKPAFLSGKRKEPEVLLNEVKDAVMD
FT                   SNVDTIETDV"
FT   gene            complement(<154507..>156630)
FT                   /locus_tag="ZYRO0A01870g"
FT                   /old_locus_tag="ZYRO-ORF9487"
FT   CDS_pept        complement(154507..156630)
FT                   /locus_tag="ZYRO0A01870g"
FT                   /old_locus_tag="ZYRO-ORF9487"
FT                   /product="ZYRO0A01870p"
FT                   /note="highly similar to uniprot|P53973 Saccharomyces
FT                   cerevisiae YNL021W HDA1 Putative catalytic subunit of a
FT                   class II histone deacetylase complex that also contains
FT                   Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
FT                   subcomplex to form an active tetramer deletion increases
FT                   histone H2B H3 and H4 acetylation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25522"
FT                   /db_xref="GOA:C5DPB1"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR017321"
FT                   /db_xref="InterPro:IPR019154"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPB1"
FT                   /protein_id="CAR25522.1"
FT                   /translation="MNTDNPVKQEDEGSKRKLEESPNGPVEKKPNVASVSNGRQKRQII
FT                   VPACEPKIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGL
FT                   INDPTLSGEDDIGELMLKIPVREATVEELLQVHTKEHLEFIEKTSQMNREELLKETETG
FT                   DSVYFNSDSYSAAKLPCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSN
FT                   VAVAAQNILKNYPESVRRILILDWDIHHGNGTQKAFYNDDRVLYISLHRFELGKYYPGT
FT                   IHGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREYRPDLVIISSGFD
FT                   AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVALEGGYNLDAIATSALSVAKILIGE
FT                   PPEELPDPSKNPKLEAIEMIDKVIHVQSKYWKCFRRLGNSGCNFKEPVTESLITKNFPL
FT                   QKAIRQEQFHQLEKEYGFVTLPVPKLELPEDTVLCSPDVFQESTVIIFVHDTPEIWAKR
FT                   DVITGMIDPSTSITVDSPLDFIKWSLARKYGVIDVNIPQSLFEQDNYSAMITSQEVLIY
FT                   LWDNFVKYFPSLSKVAFVGVGDAYSGIVHLLGHRDTRSVVKAVINFVGRKQLKPLVPLV
FT                   DESLGDWYFKNSLVFSDRNNPCWVDNENKKPRRKFGRVLRCESDGINNNMEERFDEATD
FT                   FILDSFEEWSDSE"
FT   gene            <156967..>158364
FT                   /locus_tag="ZYRO0A01892g"
FT                   /old_locus_tag="ZYRO-ORF9486"
FT   CDS_pept        156967..158364
FT                   /locus_tag="ZYRO0A01892g"
FT                   /old_locus_tag="ZYRO-ORF9486"
FT                   /product="ZYRO0A01892p"
FT                   /note="similar to uniprot|P53972 Saccharomyces cerevisiae
FT                   YNL022C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25523"
FT                   /db_xref="GOA:C5DPB2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPB2"
FT                   /protein_id="CAR25523.1"
FT                   /translation="MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPK
FT                   HIYAVVASCWKYRMYLERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQ
FT                   MGKHPIKDYVLKYKTRLHAELVKLKVKLKVKELSELVDQDDGDDATPVRWIRINPLKCD
FT                   IPVVVEQLNKKFPHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQ
FT                   DRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPA
FT                   RAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLES
FT                   SNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLLDS
FT                   KVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGF
FT                   FAVCFQR"
FT   gene            complement(<158403..>159509)
FT                   /locus_tag="ZYRO0A01914g"
FT                   /old_locus_tag="ZYRO-ORF9485"
FT   CDS_pept        complement(158403..159509)
FT                   /locus_tag="ZYRO0A01914g"
FT                   /old_locus_tag="ZYRO-ORF9485"
FT                   /product="ZYRO0A01914p"
FT                   /note="highly similar to uniprot|P40495 Saccharomyces
FT                   cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase an
FT                   NAD-linked mitochondrial enzyme required for the fourth
FT                   step in the biosynthesis of lysine in which homo-
FT                   isocitrate is oxidatively decarboxylated to alpha-
FT                   ketoadipate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25524"
FT                   /db_xref="GOA:C5DPB3"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPB3"
FT                   /protein_id="CAR25524.1"
FT                   /translation="MFRSSVAKVAARRAYSAPKSMKIGLIPGDGIGKEVIPAGKQVLEA
FT                   LGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYS
FT                   SPIVALRKELGLYANVRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRV
FT                   AEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVY
FT                   EKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVP
FT                   SANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDAN
FT                   LIKGDVNTPDLGGKATTQQVVDDILSKI"
FT   gene            <159749..>162610
FT                   /locus_tag="ZYRO0A01936g"
FT                   /old_locus_tag="ZYRO-ORF9484"
FT   CDS_pept        159749..162610
FT                   /locus_tag="ZYRO0A01936g"
FT                   /old_locus_tag="ZYRO-ORF9484"
FT                   /product="ZYRO0A01936p"
FT                   /note="similar to uniprot|P53971 Saccharomyces cerevisiae
FT                   YNL023C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25525"
FT                   /db_xref="GOA:C5DPB4"
FT                   /db_xref="InterPro:IPR000967"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR034077"
FT                   /db_xref="InterPro:IPR034078"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPB4"
FT                   /protein_id="CAR25525.1"
FT                   /translation="MSGFERSEAEIGMAAQEYDGKDAPQVVDNSLILEFSDDSDETTDE
FT                   ETTDEDEDDRMMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIRE
FT                   WALKSTGRTMDKTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAP
FT                   ICEHGCSKVCHLGPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLP
FT                   CGVHKCSKKCHSGLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDD
FT                   QGNGWIGVFRCKDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPL
FT                   NKLGQARVKCTDHIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARS
FT                   FLVPCQFREDPRCNTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVE
FT                   AEHVCLKSCNLTLTCGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKL
FT                   PPCPYSCISVVRDGYPCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQ
FT                   DVSCGQICNKPLGSCRHTCQKKCHDGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPD
FT                   FPCPFSVVIKCACGRKESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLK
FT                   ENGDSSVENTVSNALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKS
FT                   SLHFKPMKPAQRHFVHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALP
FT                   IYQAFKQREKETKIRRYEMQNVTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQ
FT                   RIYGEHLKPTLVRNPVYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMF
FT                   IGDGVELCQVGEYLQPEAPTESS"
FT   gene            complement(<162742..>163533)
FT                   /locus_tag="ZYRO0A01958g"
FT                   /old_locus_tag="ZYRO-ORF9482"
FT   CDS_pept        complement(162742..163533)
FT                   /locus_tag="ZYRO0A01958g"
FT                   /old_locus_tag="ZYRO-ORF9482"
FT                   /product="ZYRO0A01958p"
FT                   /note="similar to uniprot|P40496 Saccharomyces cerevisiae
FT                   YIL093C RSM25 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25526"
FT                   /db_xref="GOA:C5DPB5"
FT                   /db_xref="InterPro:IPR016939"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPB5"
FT                   /protein_id="CAR25526.1"
FT                   /translation="MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTRE
FT                   ARFINPSTGKKTVQWKEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLRE
FT                   VFYQQHPWEFSRPKMLVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGII
FT                   DAYDRTRFEFYRLRMQEEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAI
FT                   EETELLAARRASPAESWGQEKQEGEPNKSDEDGQETEELHL"
FT   gene            <164037..>164255
FT                   /locus_tag="ZYRO0A01980g"
FT                   /old_locus_tag="ZYRO.mRNA.226AT.p"
FT   CDS_pept        164037..164255
FT                   /locus_tag="ZYRO0A01980g"
FT                   /old_locus_tag="ZYRO.mRNA.226AT.p"
FT                   /product="ZYRO0A01980p"
FT                   /note="highly similar to uniprot|Q8TGJ3 Saccharomyces
FT                   cerevisiae YNL024C-A Identified by gene-trapping
FT                   microarray-based expression analysis and genome-wide
FT                   homology searching"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25527"
FT                   /db_xref="GOA:C5DPB6"
FT                   /db_xref="InterPro:IPR009653"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPB6"
FT                   /protein_id="CAR25527.1"
FT                   /translation="MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKGHGVLSAFW
FT                   KMARVGERASPYVSLACILMALSQLNS"
FT   gene            complement(<164386..>166515)
FT                   /locus_tag="ZYRO0A02002g"
FT                   /old_locus_tag="ZYRO-ORF9481"
FT   CDS_pept        complement(164386..166515)
FT                   /locus_tag="ZYRO0A02002g"
FT                   /old_locus_tag="ZYRO-ORF9481"
FT                   /product="ZYRO0A02002p"
FT                   /note="similar to uniprot|P40498 Saccharomyces cerevisiae
FT                   YIL091C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25528"
FT                   /db_xref="GOA:C5DPB7"
FT                   /db_xref="InterPro:IPR010678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DPB7"
FT                   /protein_id="CAR25528.1"
FT                   /translation="MVKRTGNGTDAIDGSRKRGRKDLRSIRRARNDKEPVEEPEIPVAS
FT                   EEDGELSEDSEEDATNEVQEQEDSKEKAYGALLTILKSEHPEDRQRERRKKKQDLQDPS
FT                   SSDDELSEDEKGEVEANLVDTPGEEEPQSEEELSEGDEDESEDERDPFESHFNMQSESI
FT                   DSLDEAWKQKKIVNKSGKIRVDDDESLIYTKTLAGKGQEFELPSHKGHLSSYPLKRKLK
FT                   IQNNLLESQDDVLTPLQRKIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKT
FT                   RDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKS
FT                   KLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSP
FT                   LGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDT
FT                   DFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSV
FT                   SKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYAD
FT                   FIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKG
FT                   VKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSSKR
FT                   AAVLTHGQNEIYEFK"
FT   gene            <167059..>168519
FT                   /locus_tag="ZYRO0A02024g"
FT                   /old_locus_tag="ZYRO-ORF9480"
FT   CDS_pept        167059..168519
FT                   /locus_tag="ZYRO0A02024g"
FT                   /old_locus_tag="ZYRO-ORF9480"
FT                   /product="ZYRO0A02024p"
FT                   /note="similar to uniprot|P40499 Saccharomyces cerevisiae
FT                   YIL090W ICE2 Integral ER membrane protein with type-III
FT                   transmembrane domains mutations cause defects in cortical
FT                   ER morphology in both the mother and daughter cells"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25529"
FT                   /db_xref="GOA:C5DPB8"
FT                   /db_xref="InterPro:IPR013635"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPB8"
FT                   /protein_id="CAR25529.1"
FT                   /translation="MSFVVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFN
FT                   LYFMSTTLSLFVRGYASRFYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGS
FT                   QPEQSLLEVLKSNPFSAHSNWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQ
FT                   AVGESHRWLLYEINSNIWNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFT
FT                   LSLVCGLGLYGIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKH
FT                   QRNYSSTNNLLSYYHDVVLDSAEMMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPV
FT                   GIFFKNFTISVPSSIEGLFQVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKG
FT                   DRQLNKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIV
FT                   VDSWGFWNWCNIFWTILVYGSELIGGKK"
FT   gene            complement(<168736..>168849)
FT                   /gene="SNR66"
FT                   /locus_tag="ZYRO0A02046r"
FT                   /old_locus_tag="Zyro0A_snoRNA_186"
FT   ncRNA           complement(168736..168849)
FT                   /gene="SNR66"
FT                   /locus_tag="ZYRO0A02046r"
FT                   /old_locus_tag="Zyro0A_snoRNA_186"
FT                   /product="snR66"
FT                   /note="C/D snoRNA monocistronic SNR66"
FT                   /ncRNA_class="snoRNA"
FT   gene            <169587..>170582
FT                   /locus_tag="ZYRO0A02068g"
FT                   /old_locus_tag="ZYRO-ORF9478"
FT   CDS_pept        169587..170582
FT                   /locus_tag="ZYRO0A02068g"
FT                   /old_locus_tag="ZYRO-ORF9478"
FT                   /product="ZYRO0A02068p"
FT                   /note="highly similar to uniprot|P47821 Saccharomyces
FT                   cerevisiae YNL025C SSN8 Component of RNA polymerase II
FT                   holoenzyme involved in RNA pol II carboxy-terminal domain
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25530"
FT                   /db_xref="GOA:C5DPB9"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028367"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPB9"
FT                   /protein_id="CAR25530.1"
FT                   /translation="MSGSYWPSTQRRKWQFTKESLAKERQKLWVMECQLFPQGLNIVMD
FT                   SKQNGTSRVTTKNIPITHKDLHYDKDYNLRIYCYFLIMKLGRRLNIRQCALATAHVYLS
FT                   RFLLRVSVREVNLYLLVTTCVYLACKVEECPQYIRTLVSESRSLWPEFVPPDPTKVTEF
FT                   EFYLLEELQSYLVVYHPYSTMEQIVNVLEQPPFHMQLSSEDLQNCWSLINDSYINDAHL
FT                   TYPPHIIAISCLFITISMKAGAAKNAIQNSQTNMQAMSETEASLAQALKHQEIFNRFLA
FT                   ESQVDLEEVTDTIQELISLYDHWDKYHEPWIKFLLHTLYLRSPNSTARSS"
FT   gene            <170989..>171060
FT                   /locus_tag="ZYRO0A02090r"
FT                   /old_locus_tag="Zyro0A.tGlu.TTC.2"
FT   tRNA            170989..171060
FT                   /locus_tag="ZYRO0A02090r"
FT                   /old_locus_tag="Zyro0A.tGlu.TTC.2"
FT                   /note="tRNA-Glu (TTC) cove score=60.23"
FT   gene            complement(<171184..>172587)
FT                   /locus_tag="ZYRO0A02112g"
FT                   /old_locus_tag="ZYRO-ORF9477"
FT   CDS_pept        complement(171184..172587)
FT                   /locus_tag="ZYRO0A02112g"
FT                   /old_locus_tag="ZYRO-ORF9477"
FT                   /product="ZYRO0A02112p"
FT                   /note="similar to uniprot|P40501 Saccharomyces cerevisiae
FT                   YIL088C AVT7 Putative transporter member of a family of
FT                   seven S. cerevisiae genes (AVT1-7) related to vesicular
FT                   GABA-glycine transporters"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02112g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25531"
FT                   /db_xref="GOA:C5DPC0"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC0"
FT                   /protein_id="CAR25531.1"
FT                   /translation="MQPTGTVRSSVINLVKTIVGAGLLAIPYAFKSDGVLVGVLLILLA
FT                   AITSGFGLFVLGKCSKTLIDPRDSSFFSLCMLTYPSLSPLFDLAMITQCFGVGLSYLVL
FT                   IGDVFPGLFGGQRDWWIVGSSLVVVPLCLLKKLDSLKYSSIIGLFALAYLSLLILSTFV
FT                   YEYSSGRYEEVRGDISWWSVYDYKGLMSTFSIIIFAYTGSMNLFSIVNELRNNTMTNIT
FT                   AVVNRSIAIATVFFIAVALAGYLTFGSNTLGNIMLNYDDTSIYVHIGKFCLGSMVVLTF
FT                   PLLFHPCRIAVNNLCVWAQLQREKRAESHQECEPLNPNTPSSVRPISLSVQDSDSRSLV
FT                   NSYGATQGNEEIEDLEVAGNGSPHVNIPDGRFYIITALLLIAMYALALNVNSFATVLAF
FT                   VGATGSTSISFTLPGLFGYKLIGTDYLAAGQVIPSLEVFYKRCSFLLTWFGLGVMFLSL
FT                   YVIYTNGAG"
FT   gene            <172722..>173234
FT                   /locus_tag="ZYRO0A02134g"
FT                   /old_locus_tag="ZYRO-ORF9476"
FT   CDS_pept        172722..173234
FT                   /locus_tag="ZYRO0A02134g"
FT                   /old_locus_tag="ZYRO-ORF9476"
FT                   /product="ZYRO0A02134p"
FT                   /note="some similarities with uniprot|P53965 Saccharomyces
FT                   cerevisiae YNL032W SIW14 Tyrosine phosphatase that plays a
FT                   role in actin filament organization and endocytosis
FT                   localized to the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25532"
FT                   /db_xref="GOA:C5DPC1"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC1"
FT                   /protein_id="CAR25532.1"
FT                   /translation="MTNEVVPPENFSHVVGEIYRSSFPRVENFYFLKHRLKLKSVLVLI
FT                   PEELPPENEEFLQEAGIQLFQVGMSGNKEPFVNIPGDELTRAMEIVLNPQHQPILIHCN
FT                   RGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYNDSDIKRIASAN
FT                   NWLPIQW"
FT   gene            complement(<173407..>173880)
FT                   /locus_tag="ZYRO0A02156g"
FT                   /old_locus_tag="ZYRO-ORF9474"
FT   CDS_pept        complement(173407..173880)
FT                   /locus_tag="ZYRO0A02156g"
FT                   /old_locus_tag="ZYRO-ORF9474"
FT                   /product="ZYRO0A02156p"
FT                   /note="similar to uniprot|P40502 Saccharomyces cerevisiae
FT                   YIL087C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25533"
FT                   /db_xref="GOA:C5DPC2"
FT                   /db_xref="InterPro:IPR019419"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC2"
FT                   /protein_id="CAR25533.1"
FT                   /translation="MENPSNSTGHLPKQSFLARLYSHTTTPAPGIANAALLLATPIVSP
FT                   GIQNPANAVERAGRVQLLNKFTRPQYLGPSKRVALLFGGANALGAWIIHDQDLESGAGF
FT                   LAAWSTLYLIVGGRGSIKAVRYGKVWPLVLTAASGLNALLYSRRFISGAGALV"
FT   gene            complement(<176135..>176545)
FT                   /locus_tag="ZYRO0A02178g"
FT                   /old_locus_tag="ZYRO-ORF9472"
FT   CDS_pept        complement(176135..176545)
FT                   /locus_tag="ZYRO0A02178g"
FT                   /old_locus_tag="ZYRO-ORF9472"
FT                   /product="ZYRO0A02178p"
FT                   /note="highly similar to uniprot|P61830 Saccharomyces
FT                   cerevisiae YNL031C one of two identical histone H3
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25534"
FT                   /db_xref="GOA:C5DPC3"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC3"
FT                   /protein_id="CAR25534.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG
FT                   TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSL
FT                   FEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
FT   gene            <176939..>177250
FT                   /locus_tag="ZYRO0A02200g"
FT                   /old_locus_tag="ZYRO-ORF9471"
FT   CDS_pept        176939..177250
FT                   /locus_tag="ZYRO0A02200g"
FT                   /old_locus_tag="ZYRO-ORF9471"
FT                   /product="ZYRO0A02200p"
FT                   /note="highly similar to uniprot|P02309 YBR009C and to
FT                   uniprot|P02309 YNL030W Saccharomyces cerevisiae, HHF1 and
FT                   HHF2, two identical histone H4 proteins; core histone
FT                   required for chromatin assembly and chromosome function;
FT                   contributes to telomeric silencing; N-terminal domain
FT                   involved in maintaining genomic integrity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25535"
FT                   /db_xref="GOA:C5DPC4"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC4"
FT                   /protein_id="CAR25535.1"
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG"
FT   gene            complement(<177325..>178869)
FT                   /locus_tag="ZYRO0A02222g"
FT                   /old_locus_tag="ZYRO-ORF9470"
FT   CDS_pept        complement(177325..178869)
FT                   /locus_tag="ZYRO0A02222g"
FT                   /old_locus_tag="ZYRO-ORF9470"
FT                   /product="ZYRO0A02222p"
FT                   /note="similar to uniprot|P40504 Saccharomyces cerevisiae
FT                   YIL085C KTR7 Putative mannosyltransferase involved in
FT                   protein glycosylation member of the KRE2/MNT1
FT                   mannosyltransferase family or uniprot|P53966 Saccharomyces
FT                   cerevisiae YNL029C KTR5"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25536"
FT                   /db_xref="GOA:C5DPC5"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC5"
FT                   /protein_id="CAR25536.1"
FT                   /translation="MLRIRAKVRRACEEISDNREFFLTLAASIVFLFVLLTKVFVKGVV
FT                   FPIETSDKYIGSDRDKPFYEGCVDTMQYLKDPAYTKMNATFVMLTRNEEIDGVLHSVNS
FT                   LESRFNQWFHYPYVFLNDVPFSEEFKREIKNAVSGEVQFGLVDKYMWQIPEETSDPRAF
FT                   KNAIDTQGDRGFLYGGSASYHRMCRFYSGSFYRHPLVQRHEWYWRVEPEVDFYCDITYD
FT                   PFFEMARHNKKYGFNILIEEIYATVPNLFRYTMAFIKKYRIKTKTLWKLFSMNHYILKT
FT                   SNQELQDWVNFYRDVEPKLVEKLIIEDFLKGEDPEDSIGLNFLIRRSKSSTPIVEDKFE
FT                   NEEYNLIHFWSNFEIARVDTFDNPIYNAYFEYLDKMGGFWRERWGDAPVHSLGLGLTMN
FT                   VEDIHYFRDIGYQHSVMAHCPKNAPHKQLVYKEGDPRHKRGYFKNWYDSTSENGSGCRC
FT                   SCPSQRDTEDKSSECMDRWKNLLTADDAELDGGRHSGYVDTNKVERKLKQKLFQSD"
FT   gene            complement(<179204..>180214)
FT                   /locus_tag="ZYRO0A02244g"
FT                   /old_locus_tag="ZYRO-ORF9469"
FT   CDS_pept        complement(179204..180214)
FT                   /locus_tag="ZYRO0A02244g"
FT                   /old_locus_tag="ZYRO-ORF9469"
FT                   /product="ZYRO0A02244p"
FT                   /note="similar to uniprot|P40505 Saccharomyces cerevisiae
FT                   YIL084C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25537"
FT                   /db_xref="GOA:C5DPC6"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC6"
FT                   /protein_id="CAR25537.1"
FT                   /translation="MSQRQTAQDVSRKDKRRHNIESKVGKIYQTFVLDKDSYYKDRLTA
FT                   LQTDLTTLHQGNNKSYLRTLRDYEEERDLELVRLRLFEEYRVSRSGVEFQEDIEKAKVE
FT                   HERLVKLCKEKLYENIQHKIKMLQEDRLLMDVANAHSYAIDYYRGKYQKHTRSHGANGW
FT                   ESSSNEVGGAGTGRGDSANESATDTGTERRSLRRRAATKGAPATSRLASHAEESDFQTN
FT                   YSSAQGGTNNQNAGGGGPISALKSQDARSTDVNSDSEFMQDISDHAELYALLFGEKEQD
FT                   NRTSERRKHRTSQRYTAKSAPPLPSLNQDEVSEDIAMIRQMTDQPPAPFKPKTSE"
FT   gene            <180349..>181575
FT                   /locus_tag="ZYRO0A02266g"
FT                   /old_locus_tag="ZYRO-ORF9467"
FT   CDS_pept        180349..181575
FT                   /locus_tag="ZYRO0A02266g"
FT                   /old_locus_tag="ZYRO-ORF9467"
FT                   /product="ZYRO0A02266p"
FT                   /note="similar to uniprot|Q04235 Saccharomyces cerevisiae
FT                   YML005W TRM12 Putative tRNA methyltransferase has a role in
FT                   tRNA modification S-adenosylmethionine-dependent
FT                   methyltransferase of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25538"
FT                   /db_xref="GOA:C5DPC7"
FT                   /db_xref="InterPro:IPR026274"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC7"
FT                   /protein_id="CAR25538.1"
FT                   /translation="MAWEIVVNDSKLIKAIKNELESKSLFVKPIYREGSKSVIRTGIDD
FT                   ADDEVLGRYGSCKRWYELDRGDTDGGNQIVRYTRKYLIDHNCLSQELMEFVPLRYTIYT
FT                   PLLLFNNSEKSFNNDNWNRFFAAHDPQDFFAGLAQCFPQVTHIAINMPIVESDTMRRPF
FT                   QLHPLYGEFNGKLSANYWLHPTQQDFENTLWCHTVQNGIHQYWAPMFTMFSRGNIKEKK
FT                   RILDTFEGIEGNDVVDLYAGIGYFTLSYLKRGARNCFCFELNPWSTQALKRGVTANGFN
FT                   SEKVHVYTENNINALERIKNFEPKDLRIRHINLGLLPSSKDGWSIAQSIIHYQDSLSDE
FT                   NHKVTLHIHENVHVDRLQDGTFIQSTIDHLSMDRNHNYSATHLERIKTFAPDVWHVCLD
FT                   VDVHGKSKN"
FT   gene            <181918..>183777
FT                   /locus_tag="ZYRO0A02288g"
FT                   /old_locus_tag="ZYRO-ORF9466"
FT   CDS_pept        181918..183777
FT                   /locus_tag="ZYRO0A02288g"
FT                   /old_locus_tag="ZYRO-ORF9466"
FT                   /product="ZYRO0A02288p"
FT                   /note="similar to uniprot|Q288C3 Torulaspora delbrueckii
FT                   CRZ1 Calcineurin-responsive zinc finger transcription
FT                   factor and some similarites with YNL027W uniprot|P53968
FT                   Saccharomyces cerevisiae YNL027W CRZ1 Transcription factor
FT                   that activates transcription of genes involved in stress
FT                   response nuclear localization is positively regulated by
FT                   calcineurin-mediated dephosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25539"
FT                   /db_xref="GOA:C5DPC8"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC8"
FT                   /protein_id="CAR25539.1"
FT                   /translation="MSNPLEELSDGQNQEVLIGSSGDGNNAKRGEAHTEMSYLNARPFI
FT                   KPEVLEFSSPELEERNENAFVQNYALQQNNNQTHNDSSYNNSNNDNNYGKNGEPLPSLN
FT                   TNEMFFSPSSTSSQNWRTPTLKVEDHDGWQEMLEPSPMSHQDVQSSQPFESDRRFLSTS
FT                   SWQPENDPYTSDLDSDFGGTSSVYHTPNLTAQDATIASPAMSYLTTGDDEVDDLLSVKS
FT                   GVSSNSNCMLPRNSDGYKHVTNINELDNLLTVINDHFDLELNDLGSSSVPSNNQELRRD
FT                   MDLEMPNQQQSQSIQPPPVISIQEFPEQPIMNRNEDQHLPEQDSSPSPEETVPLQRQRD
FT                   KQHDAYSNLKQQQTQQQQTQQQQTQQQQQQQQQQLQNILLCPTDSLSDASYEEMRSGRI
FT                   KKRRASHGSRRLSRASRSSSVSPDEKARSLGEDSDRLLELADLQLPSPIPSRQNSNNSG
FT                   GDTNNNANDSSNDFTKAGGKSMGALEEGETLQNLSGNTKKRLSQKNPAAFACELCGKRF
FT                   TRPYNLKSHLRTHTNERPFECSICGKAFARQHDRKRHEDLHTGKKRYVCGGTLKNGSSW
FT                   GCGKKFARSDALGRHFKTESGRRCIVPLYEEASREKGFIPDLP"
FT   gene            <183977..>185455
FT                   /locus_tag="ZYRO0A02310g"
FT                   /old_locus_tag="ZYRO-ORF9462"
FT   CDS_pept        183977..185455
FT                   /locus_tag="ZYRO0A02310g"
FT                   /old_locus_tag="ZYRO-ORF9462"
FT                   /product="ZYRO0A02310p"
FT                   /note="similar to uniprot|P53969 Saccharomyces cerevisiae
FT                   YNL026W SAM50 Essential component of the Sorting and
FT                   Assembly Machinery (SAM complex) of the mitochondrial outer
FT                   membrane the authentic non-tagged protein was localized to
FT                   the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02310g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25540"
FT                   /db_xref="GOA:C5DPC9"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC9"
FT                   /protein_id="CAR25540.1"
FT                   /translation="MDQFDTNLSERLIEQSRSNSTSQDEQLEKAVKLQNYYGQLLHEKS
FT                   SELVAVNGVIVNNSESIRPQVLQRYLDATILQAKTVGQLVESADILDMKLVQHGLVENA
FT                   QQTLGSRGTLQLPLIKYHFASQIYDSANIPETVSVIDVISQLQLFPLRKFMARTGTNIG
FT                   NGEGDGYLQFQLRNMFGGGEQLRFDVTKGTKTFSSYLINYAQPLNPWWVWDSLFFKNCK
FT                   QMGNRNSIETLLRGFRTCLRSGFYGDSVLNHEFFCDVALRNNKMNSLDTCDTLLYQAGD
FT                   DVKKSLGHIMIWDRRDNPVSASRGSLFRWYNELSLGKFWKSQIELSKAQSWFRDDWLTV
FT                   NGTLKTGYIHNFHPTSQSLNICDKFQNGGGNDVRSFQYMGLGPKDIYDSIGGDAFVSYG
FT                   VSVFTRLPFHKISHSNFRLHWFLNGGKLINHNNSSLQDVIKNLSTQHSTSIGFGLVLKH
FT                   PVARFELNFALPVTCHTGDCIRKGFQYGIGLSFL"
FT   gene            complement(<185528..>186598)
FT                   /locus_tag="ZYRO0A02332g"
FT                   /old_locus_tag="ZYRO-ORF9460"
FT   CDS_pept        complement(185528..186598)
FT                   /locus_tag="ZYRO0A02332g"
FT                   /old_locus_tag="ZYRO-ORF9460"
FT                   /product="ZYRO0A02332p"
FT                   /note="highly similar to uniprot|P40506 Saccharomyces
FT                   cerevisiae YIL083C Homolog to human PPCS"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02332g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25541"
FT                   /db_xref="GOA:C5DPD0"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPD0"
FT                   /protein_id="CAR25541.1"
FT                   /translation="MVPRSPSKSQIHTSITEVSHAIDRSINEAAFPIAQTSDEDRYFLT
FT                   NPKPPYLEDLIKDAKEFIGLQRSLNRDKIVLVTSGGTTVPLENNTVRFIDNFSAGTRGA
FT                   SSAEQFLANGYSVIFLHREFSLAPFNRLFTHNMEAQFLDYIDTNGNIKPEFRDTVLRNK
FT                   RLYDKYMVEDKKLLLLPFTTVNQYLWSLKSVAKLLNFSGGLFYLAAAVSDFFVPYSRLP
FT                   EHKIQSRDKGGDSEAESNSTTTSDGKLIVNLDPVPKFLRRLVESWAKQAMIVSFKLETD
FT                   ESILIHKSTQALDRYNHQLVIGNLLQTRNKQVVFVDQKNREGTWIKLDGSHKSIEEMII
FT                   PEVVKHHDRWILTQEN"
FT   gene            <186813..>186886
FT                   /locus_tag="ZYRO0A02354r"
FT                   /old_locus_tag="Zyro0A.tIle.AAT.3"
FT   tRNA            186813..186886
FT                   /locus_tag="ZYRO0A02354r"
FT                   /old_locus_tag="Zyro0A.tIle.AAT.3"
FT                   /note="tRNA-Ile (AAT) cove score=71.64"
FT   gene            <187946..>188019
FT                   /locus_tag="ZYRO0A02376r"
FT                   /old_locus_tag="Zyro0A.tIle.AAT.4"
FT   tRNA            187946..188019
FT                   /locus_tag="ZYRO0A02376r"
FT                   /old_locus_tag="Zyro0A.tIle.AAT.4"
FT                   /note="tRNA-Ile (AAT) cove score=71.64"
FT   gene            <188639..>189871
FT                   /locus_tag="ZYRO0A02398g"
FT                   /old_locus_tag="ZYRO-ORF9457"
FT   CDS_pept        188639..189871
FT                   /locus_tag="ZYRO0A02398g"
FT                   /old_locus_tag="ZYRO-ORF9457"
FT                   /product="ZYRO0A02398p"
FT                   /note="similar to uniprot|P32588 Saccharomyces cerevisiae
FT                   YNL016W PUB1 Poly(A) RNA-binding protein abundant mRNP-
FT                   component protein hypothesized to bind a pool of non-
FT                   translatable mRNAs not reported to associate with
FT                   polyribosomes"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25542"
FT                   /db_xref="GOA:C5DPD1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034639"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPD1"
FT                   /protein_id="CAR25542.1"
FT                   /translation="MMSEEQGPVIGVNASVPVQEEPTVSPSPERSDSEERETTPVVPAN
FT                   ATKGGRETSDRVLYVGNLDKSITEEVLRQYFQVGGQISNVKVMIDKNNARANYAFVEYF
FT                   KSHDANIALQTLNGKQIENNVVRINWAFQSQQALPDENTYNLFVGDLSVDVDDETLCNA
FT                   FRSFPSFIQGHVMWDMQTGGSRGYGFVSFGDQEQAQLAMDSMQSQELNGRPLRINWASK
FT                   RENHHNGNRRGGLAGNRNGGMRLFPNNNNGFGRGMPMPPPNSMGIPLGGTLPPNAQPMG
FT                   APPSGPAPTVPPPVNPQAVEAMIRRAPPRVTTSYIGNIPHFATDSDLIPLLQNFGFILD
FT                   FKHYPEKGCCFVKYDTHEQAAVCIVALANFFFQGRNLRTGWGKERTTFVPMAQPQQPMM
FT                   MADQSQQPIEH"
FT   gene            <190417..>192654
FT                   /locus_tag="ZYRO0A02420g"
FT                   /old_locus_tag="ZYRO-ORF9456"
FT   CDS_pept        190417..192654
FT                   /locus_tag="ZYRO0A02420g"
FT                   /old_locus_tag="ZYRO-ORF9456"
FT                   /product="ZYRO0A02420p"
FT                   /note="similar to uniprot|P25037 Saccharomyces cerevisiae
FT                   YDL122W UBP1 Ubiquitin-specific protease that removes
FT                   ubiquitin from ubiquitinated proteins cleaves at the C
FT                   terminus of ubiquitin fusions irrespective of their size
FT                   capable of cleaving polyubiquitin chains"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25543"
FT                   /db_xref="GOA:C5DPD2"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPD2"
FT                   /protein_id="CAR25543.1"
FT                   /translation="MSFVLGPIVQKISSFISNNNNKTSIPIALGIVILSTAFLFLKSKK
FT                   HNSNVGDIARGMTSKSGFRRWMPRSGQMENEVLKRGGNIGGLVNDGNTCFMNCVLQSMA
FT                   SSKELLKFLDEEIACKAKLDEDQSNGDDVNNEKPHNTSKQQQKREEEAKSEGETVPDVT
FT                   FSAALKELLDKLNAKYYRDRPYFKANKLLKSMSKAPNKNILLGYDQEDAQEFFQTMLSE
FT                   LEKNAKSLDNTTIDKHAILEKDLPETAVIGQARLDHVGAVYIPTEQVTPNLIPPGSKEK
FT                   YFTKFKLITPLDGILAERIGCLQCGETGGIRYSVSSGLSLNLPSDNMGSSLKLSDLLKD
FT                   YIKPEIIEGVECNRCALIAVRDHLKEQLQQYEDKKANAIPAKLCQAFQSRIQELEKVLS
FT                   KPVIDDEEYKKLHTENMVRKSSKSKQVLISRPPPLLAIHINRSVFDPRTFMIRKNNARV
FT                   LFKSRLNLSPWCCDIDEINMDARMPMSQKEEVIMDSSEDENVGGEFYTKLHQKYEREFE
FT                   DSDEDSDQPIGSSDDKLVSNYDPLGGDGNSLSSYSDEEESNESDYIEKTDALGNTIREP
FT                   RARANDKVEVAVRENASGASSSEEEEEPEDKNQEMDGDDEDERASAPQNTESEGEDEGE
FT                   ATNGPLPSKFSVPATPLTYSLRSVVVHYGTHNYGHYIAFRRYRGYWWRISDETVYIVDE
FT                   TEVLSTPGVFMLFYEYDYDESTGQTKQEDWQLEEEYNPEKIEIAGEPESLS"
FT   gene            complement(<192797..>193123)
FT                   /locus_tag="ZYRO0A02442g"
FT                   /old_locus_tag="ZYRO-ORF9454"
FT   CDS_pept        complement(192797..193123)
FT                   /locus_tag="ZYRO0A02442g"
FT                   /old_locus_tag="ZYRO-ORF9454"
FT                   /product="ZYRO0A02442p"
FT                   /note="weakly similar to uniprot|Q07541 Saccharomyces
FT                   cerevisiae YDL121C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25544"
FT                   /db_xref="GOA:C5DPD3"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPD3"
FT                   /protein_id="CAR25544.1"
FT                   /translation="MDFYFYLLFFIFVIIFALLLPTLSGVGGFKIGQKNSRTSNDHRLK
FT                   FKLSSEKDIGKSSSHGFEIDSKTGLKKRVIGNYSEDPNHYDYDLDELISADDDENDQRP
FT                   KAHV"
FT   gene            <193301..>193831
FT                   /locus_tag="ZYRO0A02464g"
FT                   /old_locus_tag="ZYRO-ORF9453"
FT   CDS_pept        193301..193831
FT                   /locus_tag="ZYRO0A02464g"
FT                   /old_locus_tag="ZYRO-ORF9453"
FT                   /product="ZYRO0A02464p"
FT                   /note="similar to uniprot|Q07540 Saccharomyces cerevisiae
FT                   YDL120W YFH1 Yeast Frataxin Homologue mitochondrial protein
FT                   that regulates mitochondrial iron accumulation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25545"
FT                   /db_xref="GOA:C5DPD4"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR017789"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPD4"
FT                   /protein_id="CAR25545.1"
FT                   /translation="MIRSTFVRASRLGRTCTAASAIRRASLLPIRKWNYPHPQLHAQRF
FT                   YAESFTLGDEIPPEVTNLSFQTYHEQADTFLESLSDQLEALSQKYPESVPDVELTQGVM
FT                   QLELGGIGSYVINKQPPNKQIWLASPVSGPNRFDFYKNEWISLRDGSKLLDILNEEINQ
FT                   AVTEENVTLTPSD"
FT   gene            <194777..>198022
FT                   /locus_tag="ZYRO0A02486g"
FT                   /old_locus_tag="ZYRO-ORF9451"
FT   CDS_pept        194777..198022
FT                   /locus_tag="ZYRO0A02486g"
FT                   /old_locus_tag="ZYRO-ORF9451"
FT                   /product="ZYRO0A02486p"
FT                   /note="similar to uniprot|P22855 Saccharomyces cerevisiae
FT                   YGL156W AMS1 vacuolar alpha mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25546"
FT                   /db_xref="GOA:C5DPD5"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPD5"
FT                   /protein_id="CAR25546.1"
FT                   /translation="MPLKQINHDPQFKPVKSIYENRLRQFIDTGGYKDLNLPKFYDKQR
FT                   IHQDGEYVKIWYYQIPWEKGFDPTAPSVRPSWKSIIDADKNGEIKWKNTAENQPFGPSW
FT                   TTTWFKVNLSIPQDWLDSGDQLTFEFNCDNEGIVIDPETLVPYTAFSGNERKEYHLPRN
FT                   GDGKYFFYIECGNNGMFGVGSGGTNNAPDPNRYFHLKTADIVWPDWDARALYFDFWELS
FT                   DAARELPDDSWQRNRARQIGNEVMNLFDPNDRSSVVRCREFLKKEYYDKYNDSDKVYGK
FT                   GDSSLLPNVYAIGNCHIDTAWLWPWAETHRKIVRSWSSQTTLMDKYPEYQFVASQAQQF
FT                   KWLKDEHPEFFYGSLVPKVEQGQFYAVGGSWVENDTNIPQGESLCRQFLLGQRFFMKHF
FT                   GAKSTVFWLPDTFGYSSQIPQICRTSGIERFLTQKLAWNNIDNFPHSTFNWVGIDGSQV
FT                   LTHMPPGNTYTSDANFGDVLRTAKQNKTQEFYEPGLMLYGKGDGGGGPTKEQLEKMRRI
FT                   RSLYNRNGNVIPKLQLGLSIDQFYDNILERTHQGDDLPAWVGELYLEFHRGTYTTQARM
FT                   KQLMRSSEIKLHDLEWIATKTSLLYPGKYKYPASKINDLWENVLLCQFHDVLPGSCIEL
FT                   VYKYEARPMLENVLKEADKLLQGAQTVLIDNAVKSKDQVSVGTLAWCKEDLKADASDFI
FT                   PATCTVEDDYFVLNNGELTVKISKHSGVITSIVNEKTKTEYIDNKHGRNKLGANQFVLF
FT                   DDEPTSFPAWDTELYSVNKYKYLTKVEKIEVVSSTASAVTVEVVVPVRQDCKLKTQITL
FT                   KGKEAGVTDESKVDIHTKVENWNAFYQFLKVEFPVNIINDFASYETQFGITKRPTHYNT
FT                   SWDTAKFEVCHHKFADYSEYTKGVSILNDCKYGFSTHGNLMRLSLLRSAKAPDANADMG
FT                   NHEFSYAIYPHRGPLSHKTVKLGLEFNYHYKFDLSSEAAKAFDQFITLGGDPNVVLSNI
FT                   KRGEDDKSIDSQYALDPQDKTTVVVRLYESLGGESLATLTTSLPIKEVHKIDSLETKSL
FT                   EKLHFHTNKNDAKLQDIPITLRPFEIGTYKLVL"
FT   gene            <198372..>199457
FT                   /locus_tag="ZYRO0A02508g"
FT                   /old_locus_tag="ZYRO-ORF9449"
FT   CDS_pept        198372..199457
FT                   /locus_tag="ZYRO0A02508g"
FT                   /old_locus_tag="ZYRO-ORF9449"
FT                   /product="ZYRO0A02508p"
FT                   /note="similar to uniprot|P18898 Saccharomyces cerevisiae
FT                   YGL155W CDC43 Beta subunit of geranylgeranyltransferase
FT                   type I catalyzes geranylgeranylation to the cysteine
FT                   residue in proteins containing a C-terminal CaaX sequence
FT                   ending in Leu or Phe has substrates important for
FT                   morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25547"
FT                   /db_xref="GOA:C5DPD6"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPD6"
FT                   /protein_id="CAR25547.1"
FT                   /translation="MSTSLESTKHVKFLKRHLLMLPSSQQSHDVNRIAIIFYSIVGLSA
FT                   LGVDCSREYASSIPYIYQHYVKLQIPGYEEVFSGFVGSLATNVSNTSCISLPNTLFALL
FT                   TLRIMKCDEFFQKTVDRESLGNFIRKCQYPDGSFASVLDMNKPTPSPVDSTDLRFCYIA
FT                   AAILRLLGCETKEDFEEFIDVDRVIDYMMTKKCDFGGFGDYGETHAGYTSCALCAFQLL
FT                   HGLDKLDSEFKERTVDWLLHRQVSNSGTVLLQEGKNPYYDPEENGGFQGRENKFADTCY
FT                   AFWCLNSLKILDENEFNNVCRAGLAQDYLLTKTQNNLIGGFSKNDEDDPDLYHTCLGIA
FT                   VLQLMNGTFDGIFCIPKQFAP"
FT   gene            complement(<199620..>200513)
FT                   /locus_tag="ZYRO0A02530g"
FT                   /old_locus_tag="ZYRO-ORF9448"
FT   CDS_pept        complement(199620..200513)
FT                   /locus_tag="ZYRO0A02530g"
FT                   /old_locus_tag="ZYRO-ORF9448"
FT                   /product="ZYRO0A02530p"
FT                   /note="similar to uniprot|Q07534 Saccharomyces cerevisiae
FT                   YDL119C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25548"
FT                   /db_xref="GOA:C5DPD7"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR030847"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPD7"
FT                   /protein_id="CAR25548.1"
FT                   /translation="MSEKSATTSAHLLGGFFGGLSSAVTLQPLDLLKTRIQQNKNATLF
FT                   TVLKQIDNPLNLWRGTITSAVRTSTGSALYLSCLNLMRTALAKDRGSSAAGPSSSNLPQ
FT                   LTTYENLIAGALARGIVGYLTMPFTVLKVRYESTLYNYSSISEATRDVYRTYGIKGFFR
FT                   GFGPTSLRDVPYSGLYVLLYEKAKLIVPLILPREVIAHEHNGKFTSTTSATVNALSAIF
FT                   SASLATSITAPFDTIKTRMQLEPKKFTSFFTTLTIIVRQESPIKLFSGLSMRLTRKALS
FT                   AGIAWGIYEELIKRFM"
FT   gene            complement(<200774..>201583)
FT                   /locus_tag="ZYRO0A02552g"
FT                   /old_locus_tag="ZYRO-ORF9447"
FT   CDS_pept        complement(200774..201583)
FT                   /locus_tag="ZYRO0A02552g"
FT                   /old_locus_tag="ZYRO-ORF9447"
FT                   /product="ZYRO0A02552p"
FT                   /note="similar to uniprot|P50113 Saccharomyces cerevisiae
FT                   YGL154C LYS5 Phosphopantetheinyl transferase involved in
FT                   lysine biosynthesis converts inactive apo-form of Lys2p
FT                   (alpha-aminoadipate reductase) into catalytically active
FT                   holo-form by posttranslational addition of
FT                   phosphopantetheine"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25549"
FT                   /db_xref="GOA:C5DPD8"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPD8"
FT                   /protein_id="CAR25549.1"
FT                   /translation="MKNQIMSYGDMQESIRNLDRAGNWHSILLLDSCHEGLQDAFVFEE
FT                   SMRFLSLEQQARILRKKSYPDRCKALCNRLLQISGISMATGLPHTQLKYKNGTYGKPQL
FT                   KDIDGLAFSMSNGERYVAQYIVKGKHCEVGIDLASTADYSGDQDLNNFKEIFSSQEFES
FT                   LIQCNPTKRAPMFAYIWSLKECYTKYTGLGLNSELCNIDFGKLNLFDSDNTLRRRIGGK
FT                   EIWFYSHWITPNEVVTVCHESSYDLDQNPHLHHLTLQDVLKQLRKTR"
FT   gene            <201699..>202760
FT                   /locus_tag="ZYRO0A02574g"
FT                   /old_locus_tag="ZYRO-ORF9446"
FT   CDS_pept        201699..202760
FT                   /locus_tag="ZYRO0A02574g"
FT                   /old_locus_tag="ZYRO-ORF9446"
FT                   /product="ZYRO0A02574p"
FT                   /note="similar to uniprot|P53112 Saccharomyces cerevisiae
FT                   YGL153W PEX14 Peroxisomal membrane protein that is a
FT                   central component of the peroxisomal protein import
FT                   machinery interacts with PTS1 (Pex5p) and PTS2 (Pex7p)
FT                   peroxisomal matrix protein signal recognition factors and
FT                   membrane receptor Pex13p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25550"
FT                   /db_xref="GOA:C5DPD9"
FT                   /db_xref="InterPro:IPR006785"
FT                   /db_xref="InterPro:IPR025655"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPD9"
FT                   /protein_id="CAR25550.1"
FT                   /translation="MSTGVQDDRKPLFDSAVSFLSDPSVKDAPLTKKIEFLQSKGLTQQ
FT                   EVELALKKSQQDHEMLSQNVNNSSTATVAREPDRGSLMYEAVPPPLPRRDWKDYFIMAT
FT                   ATAGLFYGVYEVTKRYVIPNILPEAQSKLEQDKKEIQDQFERVDKLLVTLENEQSEFKK
FT                   QEEQKLVELDKTVVDLQTCLEQTSYTRDKIEDEFKIMKLEMANLQSKLDTFVMAKRGDQ
FT                   QLENISSELESLKNLIKTREMHPGNSTSSTNDAVNHKSPLNKNPVPGVEAIPSATEILS
FT                   KMNFGNNNNNNKDQEQASVPAWKKAREESLNHSNSNPNSNSIPEWQKSAMNNTTNPELH
FT                   DSTSNNSESTAQE"
FT   gene            <202977..>206237
FT                   /locus_tag="ZYRO0A02596g"
FT                   /old_locus_tag="ZYRO-ORF9444"
FT   CDS_pept        202977..206237
FT                   /locus_tag="ZYRO0A02596g"
FT                   /old_locus_tag="ZYRO-ORF9444"
FT                   /product="ZYRO0A02596p"
FT                   /note="similar to uniprot|P53114 Saccharomyces cerevisiae
FT                   YGL151W NUT1 Component of the RNA polymerase II mediator
FT                   complex which is required for transcriptional activation
FT                   and also has a role in basal transcription"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25551"
FT                   /db_xref="GOA:C5DPE0"
FT                   /db_xref="InterPro:IPR014801"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPE0"
FT                   /protein_id="CAR25551.1"
FT                   /translation="MENENFYKLALRCADRQIASGDFLNFYKEFYNEKFSAKMENEDTP
FT                   NESKVLEVSNLLASECIRLLSFEKSLILANYVVEMVFVNYNSDLVHAFLPQLYYITNSN
FT                   MLIHFFAQSSAFFSKLSDKLVMDQLNKDLSTYVIPSILNVDVTTIGNDLVVAICKFLLL
FT                   MMNFINGNVVLSSDRSRDNLNALLNRLSKVNKLLHKKVQQQADAKLIFKNAKNNVFPLE
FT                   SAVQEFVSSPSITSPQFEPSPISNAKAQASGGATVSGAKYQDIKLVRYYKNIWLNNKII
FT                   NWGPIDSDFLSRYASIATSAFQGVTYSPQSTDSILQDLIETSFTCFAQFVNNKQYHQLN
FT                   SNFNLLERQWMVFICKHLPLLILENGSGNSHTVPQALESIDDKVVKAIRTYYSEKDDMK
FT                   GRNEDLFDDYPSNNLDIRHEFIKNLVSLGLQSPTLLNDYLREDQMIDTRTLLTTDDLIV
FT                   TNSQGVQELVKDFKHFLTNSLDSLEPEVLINDSNDNADGLQQIFHNFENIPPTKQREIS
FT                   NILIDILQHALENLEFDRIAKICSVLSFNFSHSLTTILSFSSPTKICEMLIKFVDVSWD
FT                   KFVEPRCKELVESEYDTMNFFLSFSCSILLLIVIWQTYDFSLVDVVLQSSESNTENSFV
FT                   ISYISKLPEIPDVFLLDPKNSLDQEMRTKSHQVVQNWLRDLFVNGSISDDLLQSVDLKQ
FT                   LAVLVPFIFKQVLLTLEVGAIEDVSNLVGGLEYFLQPFMLIGLVKIVYWLEQYLYSLKS
FT                   ENLDEGLLEKLLTLLNSIFNPQALNEDSKLFHSSLLRLNAVRLLRVLRQFRSQSQSNYG
FT                   IYSTESSGHPKLELLIERLLSALNVSPTYNLDPRVITTENIYSQKQVGYGRFLILNENP
FT                   INKIMTNQINSFWNLHSSTYYNLDYLKEVINLVSPRVFLQDVLATLEYKLDTYGVAGTR
FT                   NKIAAVESEHVMDYLFYFLVLYDVRSQVDAVSLLQVMDGNSESPIVKEEMQMKTTEVAP
FT                   KAEVSQDDDFDMLFGEPETNVTGVDKENQSTNVESKPTESKYNLTATLERHSFGLIIHE
FT                   MKQECNEALSTGDISKDVCDKITKYHEKYVYLLKTCVF"
FT   gene            complement(<206448..>210764)
FT                   /locus_tag="ZYRO0A02618g"
FT                   /old_locus_tag="ZYRO-ORF9442"
FT   CDS_pept        complement(206448..210764)
FT                   /locus_tag="ZYRO0A02618g"
FT                   /old_locus_tag="ZYRO-ORF9442"
FT                   /product="ZYRO0A02618p"
FT                   /note="similar to uniprot|P53115 Saccharomyces cerevisiae
FT                   YGL150C INO80 ATPase that forms a large complex containing
FT                   actin and several actin-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25552"
FT                   /db_xref="GOA:C5DPE1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR020838"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031047"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPE1"
FT                   /protein_id="CAR25552.1"
FT                   /translation="MSLAALLNKEEGEQIPTPTSTPPAPVVSPVTGDESSRNTAIVNGN
FT                   GIMDPVQKYLQGLNRDFSVVSQRDALEHEYQDWKFINYQEFELVSEWNNQSKDWKGAAL
FT                   DSLYKDMATTKAEWDTYAKYKENKLKLLGEMDDVVEDEKPKKPKRAPRKRKIQEVDEDD
FT                   QVVENGGDTVEHLQQPVEEKYEVKQEEPDGSQQPSPLVNGKTHEEVEEDGGNEEDGDQD
FT                   QEQDQDQEPDSVGDDVGTDMPAAGGAEADEAEEETQEPEQEEDSHDVQFSLEDDENDKD
FT                   FLLDDDRPRPSSRKDKTVTLDSDRSKIVKELVKMCNKNKVVKVKKRRFTNAIVTDYNPL
FT                   DSKLSVKVTLKQYHVRRLKRHINEAKRAAAVAEAAKAKEEAAKNKAKEPTGSPSSKKRK
FT                   ITAKDGSQDVTPANEIDSATASPTKNGLPTYGLKMTVKEARAIQRHYDNTFFTIWKDMA
FT                   RKDCAKMARLVQQIQSIRTANFKKTSSLCAREARKWQFRNFKQVKDFQTRARRGIREMS
FT                   SFWKKNEREERDLKKKAEKEALESARKEDEARENKRQAKKLNFLLTQTELYSHFIGRKI
FT                   KTNELEGAMADQQLQQQQQQQQQQQLHQHFQHGHVDLDATEANKTEFHNIDFDNEDDEQ
FT                   LRIKAAQNASNALAETRAKTKEFDDSSSNGEELNFQNPTSLGEITIEQPQMLACTLKEY
FT                   QLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEKYNIWGPFLVVTPASTLH
FT                   NWVNEISKFVPEFNILPYWGNGNDRKVLRRFWDRKNFRYTRDSPFHVMVTSYQMVVSDV
FT                   TYLQKMKWQYMILDEAQAIKSSQSSRWRNLLSFHCRNRLLLTGTPIQNSMQELWALLHF
FT                   IMPSLFDSHDEFNEWFSRDIESHAEANTTLNQQQLRRLHMILKPFMLRRVKKNVQSELG
FT                   DKIEVDVMCDLTHRQAKLYQILKSQISTNYDAIENAAGSDDASSDQNLINTVMQFRKVC
FT                   NHPDLFERADVSSPFGFVDFGKIASMAREGGISEVMYSTKNPITYQMPRLIYEDVVLPS
FT                   FQNDIAARKKLLNVTMNVLDPVKNRDLIEHLRLLTGLKPNEFSEIASKDIVQRALEFNK
FT                   EDSNKPLIQEIYDDGNCAPKNFKSGLHVYDKPERLLALSRTTTDGVLSSLVDIQNKIYD
FT                   DQYFNCMHPGYRPGAASTPISIDVLGCRHLYERRGQELFNPTISQALSEIPPETQYNLK
FT                   VEKKIPVDHFPITGKFPAAFNKYFSSPISMPSMDRFITESAKLRKLDELLVDLKRNGHR
FT                   VLIYFQMTKMMDLMEEYLTYRQYKHIRLDGSSKLEDRRDLVHDWQTVPDLFVFLLSTRA
FT                   GGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLVRDTIEERMRDR
FT                   AKQKEHVQQVVMEGKTQAKKVKRIEGEDNKETVTFK"
FT   gene            <211596..>212726
FT                   /locus_tag="ZYRO0A02640g"
FT                   /old_locus_tag="ZYRO-ORF9437"
FT   CDS_pept        211596..212726
FT                   /locus_tag="ZYRO0A02640g"
FT                   /old_locus_tag="ZYRO-ORF9437"
FT                   /product="ZYRO0A02640p"
FT                   /note="highly similar to uniprot|P28777 Saccharomyces
FT                   cerevisiae YGL148W ARO2 Bifunctional chorismate synthase
FT                   and flavin reductase catalyzes the conversion of 5-
FT                   enolpyruvylshikimate 3-phosphate (EPSP) to form chorismate
FT                   which is a precursor to aromatic amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25553"
FT                   /db_xref="GOA:C5DPE2"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPE2"
FT                   /protein_id="CAR25553.1"
FT                   /translation="MSTFGHIFRVTTYGESHCRSVGCIVDGVPPGMSLTDKDIQPQLSR
FT                   RRPGQSKLSTPRNEKDKVEIQAGIEFNKTLGTPIAMLIRNEDQRPHDYSDMDNYPRPSH
FT                   ADYTYMEKYGLKASSGGGRASARETIGRVAAGAIAEKFLSQVSNVEIVGFVSQIGSVKM
FT                   NRDTFDPHFHHLLNTITREKVDSAGFIRCPDAAIAAEMVKEIEKYRGQKDSIGGVVTCV
FT                   IRNLPAGIGEPCFDKVEALLAHAMLSIPASKGFEIGSGFSGVSKPGSQHNDLFVFDEET
FT                   QKLRTKTNNSGGVQGGITNGENVYFSVAFKSVATIAQEQETATYDGKAGVLAAKGRHDP
FT                   AVTPRAIPIVESMAALVLADSLLIQKSRDFARSVTH"
FT   gene            <213322..>215982
FT                   /locus_tag="ZYRO0A02662g"
FT                   /old_locus_tag="ZYRO-ORF9435"
FT   CDS_pept        213322..215982
FT                   /locus_tag="ZYRO0A02662g"
FT                   /old_locus_tag="ZYRO-ORF9435"
FT                   /product="ZYRO0A02662p"
FT                   /note="similar to uniprot|Q07533 Saccharomyces cerevisiae
FT                   YDL117W CYK3 SH3-domain protein located in the mother-bud
FT                   neck and the cytokinetic actin ring mutant phenotype and
FT                   genetic interactions suggest a role in cytokinesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25554"
FT                   /db_xref="GOA:C5DPE3"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPE3"
FT                   /protein_id="CAR25554.1"
FT                   /translation="MSVSIQVPPLPFKVKARYGWSGQTKGDLGFLEGDVMEVTRITGDW
FT                   FYGRLLRNKKCSGYFPNNFVNILQERLNRNQEAKKKEVMSQPPPPPPQESSRKVGIPPI
FT                   PARSTEEGSPRSSRSSRSSKSSDGSLRAIAKRQQQQQEAANVRHLRSRGYHAYSSPTLP
FT                   TVSPSGHEALSAKMYRIPESTSRRYEGESDFLPELPPIPISPRTDLHRRPKLPPSLKSK
FT                   SAADLYAVGTSKDSFDYFQEHKNFYDGYHPSSSSSFTNDTTSMDLFSDAQYLENSALSS
FT                   ENSYAIMSDFSATSAGSFARHKFAQSFEDSLERSQNATGSGSLNDSGNGKMGGVLRRMV
FT                   KKGSGSPVSDVPGSPVSGEYPKLPDLKSLVVNSTRSDARDWLTVKTHLNRSRSLTKHEK
FT                   HPRYMRALEMHRDLVLHPQDAIYNGLNTNEVKAHGQPGIVDIELAGLNLEYIDNMTRKR
FT                   CIKDGSMRLDDWAQTTFSARYATPVEKLRGIYVFCTEMFGLVDDNGCTDFSRQPSHLDR
FT                   ILYQKHCTPYQLTCLFKRLCNSLGITCEVVIGFLKTPISKTHEFKYNHCWLRVLANKEW
FT                   RFIDVILGNVSNPVHEFVNNKRITRAENRYFLVEPLEFIYTHVPAKESEQHIVPSIDQL
FT                   SALYLPLVFPSFFRNGLKLYKFSTALAYLEDSEIYECSIEIPSDIEVFASVVIPAENSK
FT                   LAKASRKMDLALTQVKRHRVDSSRRIAVVKAILPPGVKEGALYIHSGLRGSQTTLANVH
FT                   PLSMMVSLQHEGEEMKYEFVVRRPSENVQKVEMYVVEPQNKYLFVNNEYSFEIIQQPFD
FT                   GILYNPSGINKNCKQPLALKSPSGKIYELKKNDPHFAFGTWKFNVVLKETGVWTGLVLA
FT                   DSGMGWCSFAEWLCI"
FT   gene            <216306..>218489
FT                   /locus_tag="ZYRO0A02684g"
FT                   /old_locus_tag="ZYRO-ORF9434"
FT   CDS_pept        216306..218489
FT                   /locus_tag="ZYRO0A02684g"
FT                   /old_locus_tag="ZYRO-ORF9434"
FT                   /product="ZYRO0A02684p"
FT                   /note="similar to uniprot|P52891 Saccharomyces cerevisiae
FT                   YDL116W NUP84 Subunit of the nuclear pore complex (NPC)
FT                   forms a subcomplex with Nup85p Nup120p Nup145p-C Sec13p and
FT                   Seh1p that plays a role in nuclear mRNA export and NPC
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25555"
FT                   /db_xref="GOA:C5DPE4"
FT                   /db_xref="InterPro:IPR007252"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPE4"
FT                   /protein_id="CAR25555.1"
FT                   /translation="MGMEVDEDDLRECYIKFGEALKDFKSVELSSTNPPDPFNILRDFR
FT                   SIAGSAALKSLEKKDSNKEGSDWELEAKLWHLLELLGSYRTSDINPDEMTTYSYNSNAV
FT                   FEKKLLQEDRNLYQIWIIIVWIQNNMNPRLTESLPTSKWSNSIISGGLKSCDLDFPLRD
FT                   LEADINVKDKLEDHAFYKYVYHLLLAGKVDSAIEECRLTENLTLSMILCGMQEYLDPVR
FT                   DTQIQNEFETQQGVKKHALWRRTVYSLSMDSRLDQYERAIYSFLAGTIPQDDVINDSNW
FT                   DSDLLLHLNQILQIEIENYLFAKGKLTTDELIIPLPSKPQGLQNVLDLVSSKHVEESEH
FT                   PIRILIGAVILDTLSLVLHSSVEMLLDFVKGGSTDNYLAEKPYLLRIVTHISLFLSILE
FT                   PQDEVSSNDRSKLITAYISVLKFHGLYDIIPIYVKFLDEQAALEAYSFILSTLEDHEVR
FT                   RKQLEVANFLQLPTPNILRRTTQRIFNETEGDYTPQGEILVTFDVEAVDRHLISGVEWL
FT                   LEGKLYVEAVESIVALSRRFLINGRIKALEYFMDRNQLNDVLKSYEFAKISQRDSEHEK
FT                   DYAVAEILEYQYLVEGLKKYQEWQKTVKLMDLESNVPTVIAKFQEFSKFTYKLIKNFLV
FT                   DLSEDGSNPDGDVFYEIRSLYTPYLIIELHKGLVEASKLLKISMFIKEALEITNLVANE
FT                   TDKIYLLFQTSGKLEEYLQLVAYTAILSGSDYK"
FT   gene            <218642..>220858
FT                   /locus_tag="ZYRO0A02706g"
FT                   /old_locus_tag="ZYRO-ORF9432"
FT   CDS_pept        218642..220858
FT                   /locus_tag="ZYRO0A02706g"
FT                   /old_locus_tag="ZYRO-ORF9432"
FT                   /product="ZYRO0A02706p"
FT                   /note="similar to uniprot|P32580 Saccharomyces cerevisiae
FT                   YPL029W SUV3 ATP-dependent RNA helicase component of the
FT                   mitochondrial degradosome"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02706g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25556"
FT                   /db_xref="GOA:C5DPE5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPE5"
FT                   /protein_id="CAR25556.1"
FT                   /translation="MRGRWGLLRFTCGGLLRNFRREYHGKRNSLRIFEDNRWLVQKPSL
FT                   TSIPPQERSQVDAIGFMFGRNAPENIYTSDENFKELLDKSMHHVYNQKLTASFAGQENY
FT                   KDYAWLKLRDYIYGQLKDGSLQEKVKQYKPSLTQLIKPSCPAHVVPQLIKVDDYDSNTW
FT                   QTILKNKVDSKLNKYVHFLSQTYDYIYEQEVLPLMMKTKKTDGSDDVDISNPVEWFAEA
FT                   RKMKRHIIMHIGPTNSGKTYRALQQLKHANRGYYAGPLRLLAREIYDRFQKDGVRCNLL
FT                   TGEEVIHDLDSAGNPAGLTSGTVEMVPLTQDFDVVVLDEIQMMADLDRGWAWSNALLGA
FT                   KAREVHVCGEKSTLPLIKNIIKMTGDKLTVNEYERLGKLKVEDWVLPKGYKSLRKGDCV
FT                   VAFSKKRILDLKLRIEKDTNLKVAVIYGSLPPETRIQQAHLFNSGEYDIMVASDAIGMG
FT                   LNLSIDRVIFTTDVKFNGKELVELSSSNIKQIGGRAGRFKSGSQGQDIPQGFITTFDPS
FT                   VLSTIRRGMDAPIDYLQSAVIWPTDEICGNIITKFPPGTPPSVLLKAIALRLEKSSHKL
FT                   FTMSDLKNKLNVLAIFEHMDDIAFFDKLRLSNAPVKDLPLVRNAFAQFCDTIAKRQTRG
FT                   LLSYPFPFEVLDYKCITDEKFGLELYESLYNIIMLYFWLGNRYPSYFIDYESATDLKYF
FT                   CELIIFEKLDRLKKNPYNKGAPQSVGSIYKQRAHFVNQYTRKRN"
FT   gene            <221117..>222313
FT                   /locus_tag="ZYRO0A02728g"
FT                   /old_locus_tag="ZYRO-ORF9430"
FT   CDS_pept        221117..222313
FT                   /locus_tag="ZYRO0A02728g"
FT                   /old_locus_tag="ZYRO-ORF9430"
FT                   /product="ZYRO0A02728p"
FT                   /note="highly similar to uniprot|P41338 Saccharomyces
FT                   cerevisiae YPL028W ERG10 Acetyl-CoA C-acetyltransferase
FT                   (acetoacetyl-CoA thiolase) cytosolic enzyme that transfers
FT                   an acetyl group from one acetyl-CoA molecule to another
FT                   forming acetoacetyl-CoA involved in the first step in
FT                   mevalonate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25557"
FT                   /db_xref="GOA:C5DPE6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPE6"
FT                   /protein_id="CAR25557.1"
FT                   /translation="MSDNVYVVASCRTPVGSFQGSLASKTAIELGTAAVKGAISKVPQL
FT                   KPETDYDEIIFGNVLSANSGQAPARQVALGAGLHNHIVDTTVNKVCASALRSIILGAQS
FT                   IKCGTSDVVVAGGCESMTNTPYYMPAARSGARFGETKLVDGIQRDGLNDAYDGLAMGVH
FT                   AEKCARDWDCSRQDQDEFAISSYQKAQKAQNEGKFDKEIVPITIKGFRGKPDTQVTKDE
FT                   EPSKLNVEKLKSARTVFQKENGTVTAPNASPLNDGAAAVILVSEKKLKQLGLKPIAVIR
FT                   GWGEAAHEPADFTWAPSLAVPKALTHAGIKDIGQIDFFEFNEAFSVVGLANTKILKIDP
FT                   SKVNVYGGAVALGHPLGCSGARIVVTLLSVLEQENGKLGAAAICNGGGGASSIVLEKL"
FT   gene            <222495..>223037
FT                   /locus_tag="ZYRO0A02750g"
FT                   /old_locus_tag="ZYRO-ORF9429"
FT   CDS_pept        222495..223037
FT                   /locus_tag="ZYRO0A02750g"
FT                   /old_locus_tag="ZYRO-ORF9429"
FT                   /product="ZYRO0A02750p"
FT                   /note="similar to uniprot|Q03786 Saccharomyces cerevisiae
FT                   YDR248C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25558"
FT                   /db_xref="GOA:C5DPE7"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPE7"
FT                   /protein_id="CAR25558.1"
FT                   /translation="MANKVIVLAGTAGTGKSTVADILIKNHSARYPDVRFIEGDTLHPP
FT                   SNVEKMSAGIPLVDEDRWGWLEKVANVSSETAKEHGLCIAACSSLKKKYRDFMREKRPD
FT                   TIFYFVFLYGTKQEVLGRLERRSQHFMKATMMESQFKDLELPLEGEPHCCIVHIDGKSF
FT                   EQVEEDTKEKVSKMFAE"
FT   gene            complement(<223226..>224473)
FT                   /locus_tag="ZYRO0A02772g"
FT                   /old_locus_tag="ZYRO-ORF9428"
FT   CDS_pept        complement(223226..224473)
FT                   /locus_tag="ZYRO0A02772g"
FT                   /old_locus_tag="ZYRO-ORF9428"
FT                   /product="ZYRO0A02772p"
FT                   /note="similar to uniprot|Q12505 Saccharomyces cerevisiae
FT                   YPL026C SKS1 multicopy suppressor of snf3 and grr1 mutants
FT                   serine/threonine protein kinase homologous to Ran1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25559"
FT                   /db_xref="GOA:C5DPE8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPE8"
FT                   /protein_id="CAR25559.1"
FT                   /translation="MLTNCQINNFQITSQIGSGAYGLVFHALDIITENEYAIKAVVKSN
FT                   SLNDFGKPKTDDNIKKSTVLQTQLYHFFKSFQNKLFLPTVDLDSIQSLSNAELARAPHY
FT                   KEIALHLKVHSHENVCTIHQVLESPLATFIVMDYYHLDLFTAIVDREHFTSNGLLIKKV
FT                   FLQLCSALEHCHHNGVFHCDIKPENVLLDANNNVHLCDFGLSTTCQYLAPNVCIGSSYY
FT                   MAPERILYCSGENDTVTSFPTSTGDVWSLGVILINLCCIRNPWLKAHQTEDSTFNYYAK
FT                   NPSVLKQILPISEEVYEILIKVLQINPYARIDIKSLMNEVANLTSLTNEGPLKSVPKLD
FT                   DHLYDTFITGDRGMCLREMLKEEKEEEREIEIDDESLSESIPCESDEEWTKSFGNSLFM
FT                   QWAGNNLSTLTNFSYN"
FT   gene            complement(<225436..>226071)
FT                   /locus_tag="ZYRO0A02794g"
FT                   /old_locus_tag="ZYRO-ORF9426"
FT   CDS_pept        complement(225436..226071)
FT                   /locus_tag="ZYRO0A02794g"
FT                   /old_locus_tag="ZYRO-ORF9426"
FT                   /product="ZYRO0A02794p"
FT                   /note="similar to uniprot|Q03784 Saccharomyces cerevisiae
FT                   YDR246W TRS23 Component of the targeting complex (TRAPP)
FT                   involved in ER to Golgi membrane traffic"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25560"
FT                   /db_xref="GOA:C5DPE9"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPE9"
FT                   /protein_id="CAR25560.1"
FT                   /translation="MAVRMLLVINKSGGLIYHRSFEGDVDKGLNSNDYLILASILHGSF
FT                   AIATQLTPKALQLSQSSSKNIDYTVPYIPYVGMPRGRTSSERSKYGASAPQGKLGSFKG
FT                   DDFFKESFQSWNRSGVRQLCTDQFTMYIYQTMTGLKFVVACSQGTLSPANPSSSNNIFN
FT                   IHVADNFLRKIYCLYSDYVMKDPFYSLEMPIKSTLFDKKVKQMVDNLV"
FT   gene            <226168..>226920
FT                   /locus_tag="ZYRO0A02816g"
FT                   /old_locus_tag="ZYRO-ORF9425"
FT   CDS_pept        226168..226920
FT                   /locus_tag="ZYRO0A02816g"
FT                   /old_locus_tag="ZYRO-ORF9425"
FT                   /product="ZYRO0A02816p"
FT                   /note="similar to uniprot|Q02685 Saccharomyces cerevisiae
FT                   YPL024W RMI1 Protein of unknown function GFP tagged protein
FT                   localizes to the cytoplasm and nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25561"
FT                   /db_xref="GOA:C5DPF0"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="InterPro:IPR042470"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPF0"
FT                   /protein_id="CAR25561.1"
FT                   /translation="MSKAHTHSQTHTYNLSFILDESTMSTIIFQDISQVPSPLQINDRS
FT                   TLTGRDLAILEAFENEPWNSGPPPLVDQKLSRLDRDLLFQILMVENTSKSKLNQVDDIR
FT                   AKLDPTLQRVDRLKTTRDRVVINQVDIDSDEPTSENASTNALNQSRAVFRLVLQDRKGS
FT                   LFYAINSSPLSWLQVCMLGSKVIIKKGSIFNRGVFILQEPNVLFLGGINRAWNENRDGK
FT                   LCEYLEAKLQRDAEDMKLNGSKKRKNTR"
FT   gene            complement(<227004..>228956)
FT                   /locus_tag="ZYRO0A02838g"
FT                   /old_locus_tag="ZYRO-ORF9423"
FT   CDS_pept        complement(227004..228956)
FT                   /locus_tag="ZYRO0A02838g"
FT                   /old_locus_tag="ZYRO-ORF9423"
FT                   /product="ZYRO0A02838p"
FT                   /note="highly similar to uniprot|P46151 Saccharomyces
FT                   cerevisiae YPL023C MET12 Isozyme of
FT                   methylenetetrahydrofolate reductase catalyzes the reduction
FT                   of 5 10-methylenetetrahydrofolate to 5-
FT                   methyltetrahydrofolate in the methionine biosynthesis
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25562"
FT                   /db_xref="GOA:C5DPF1"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPF1"
FT                   /protein_id="CAR25562.1"
FT                   /translation="MSIRELYESKDGPTLSLEFFPPKTETGKQNLLERMERMTALGPLF
FT                   ATVTWGAGGSTAEKTLELASLAQKNLNLPICMHLTCTNMDRNIIDDALTRCKAAGIHNI
FT                   LALRGDPPIGQDWSDLEASQSEFKHAVDLVRYINYRFPNEFCIGVAAYPEGHCEGEAEG
FT                   NEQNPWKDLPFLKEKIDAGADFVITQLFYDVDKFLQFEQMFRQHISTDLPLIPGLMPIN
FT                   SYLLFNRAAKLSHASIPSSVLQKFPPEIQADDDAVKSIGVDILIEIIETIYKATHGRIK
FT                   CFHFYTLNLEKAVAKIVATSPTLSDTLDVVEDENDEAATSEPEEQDQEGDIVLEDANVK
FT                   NLIEDNRKRRRQSSTVSNVSSELTSNRVIIGKKNQHGVGAPTRKVVISISQGSGTLGRD
FT                   ATWDEFPNGRFGDTRSPAFGEIDGYGPTLKVSNKKAYELWGQPKTIQDLQIIFIKYLEG
FT                   SIDALPWCDLGLSPETALIQEELIQLNERGFLTLASQPATNGSPSTNKIFGWGPAYGVV
FT                   YQKAFIEMFVPKNIWENGNMKKAIEQYGRAKLTYYANDSQGNFETNLESNSSNVVTWGV
FT                   FSDSQVIQSTIVSEESFKAWSDEAFSIWLEWAKLFPRNTSTNSLLRQIHQEYCLISIVH
FT                   HDYINPDELWEIILS"
FT   gene            <229176..>232337
FT                   /locus_tag="ZYRO0A02860g"
FT                   /old_locus_tag="ZYRO-ORF9422"
FT   CDS_pept        229176..232337
FT                   /locus_tag="ZYRO0A02860g"
FT                   /old_locus_tag="ZYRO-ORF9422"
FT                   /product="ZYRO0A02860p"
FT                   /note="similar to uniprot|P06777 Saccharomyces cerevisiae
FT                   YPL022W RAD1 Single-stranded DNA endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25563"
FT                   /db_xref="GOA:C5DPF2"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR006167"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPF2"
FT                   /protein_id="CAR25563.1"
FT                   /translation="MPQLFIHEDSDDEQLQLELSRQAEEAVELNKAPDQDQPEESPSLE
FT                   KTPSLEKTPAEPSQPLYPLIPEENLDDNGLKPNLDDIRQVDIQLNLPLTFQQQVVENTL
FT                   VTDDPLVILGKGIGIISIVANLLFTLATPTRINGQPKRSFVIVMNASPGDNLRISEELQ
FT                   ELSWLSSCSEDIQGEDNDIDEDSQRPFHVINAESQNADKRQKLYNSGGIFSVTSRILIV
FT                   DLLSGLLHPSRITGIVVLNVEKLKSFSNESFILEIYRSKNKWGFIKAFSESPESFVTQF
FT                   SPLMRKLKELRLKNVTLWPRFRVEISQCLNNAVNPQINKVVEVKVSQTNSMSQIQFGLM
FT                   ECLKKCIAEMNRKNPELVLETWNIENALDPTFVKSIDAVMVPNWHRISYESKQLIKDIR
FT                   FLKNLLKLLVSGDAVDFYEELQLSLDANKPSISRKYSESPWLMADESQMVISYAKKRIY
FT                   SDGEYVLEEMPKWEQLISIMEDISYQRAYKDVSGPTLIVCSSYTTASQLARVLSQADRK
FT                   DGFRRSMLRKLQLYKERREESKTLVKEIREREPDAMPELNVSAAFAKEQVITRRRRTRG
FT                   AAAMAAVERLKNAGTGEDIESVIDDYNIKEELEPEGLLEMADNEATAPTTEYEDEDDFG
FT                   EKLFHDMSHNAITKEIWDQRTQYFQFVHRGDQIIIEIFANITDDSYLQEIMPSNIIMYE
FT                   PDLTFIRRVEIHRAIHREMPPNVCFMYYSNSVEEQGHLVSIRKEKDAFTKLIRENSMLS
FT                   HHFEADEDLSHYKNLAERKVKLNKLRRITTRVAGGQAALADFTQDIVIVDTREFNAALP
FT                   GLLYRYGVRVVPCMLTVGDYVITPDICIERKSIADLIGSIQNRRLVSQCKKMRSHYKYP
FT                   TLLIEFEEGQSFSLEPFSERRNYKSKELSTVHPISNKLSQDEIQSELAKLVMRFPGLKI
FT                   IWSSSPLQTVNMILELKIGREQPDPSQSVALGTRRKQEKSEKKAAAKESDQKKYARLLR
FT                   IPGISKVEYFNIRKKVKSYEKLKSLSSQELHDLLGDEDLVDKLCRFLQAEKDDEEDELA
FT                   DSDIE"
FT   gene            complement(<232488..>236063)
FT                   /locus_tag="ZYRO0A02882g"
FT                   /old_locus_tag="ZYRO-ORF9420"
FT   CDS_pept        complement(232488..236063)
FT                   /locus_tag="ZYRO0A02882g"
FT                   /old_locus_tag="ZYRO-ORF9420"
FT                   /product="ZYRO0A02882p"
FT                   /note="some similarities with uniprot|P09547 Saccharomyces
FT                   cerevisiae YPL016W SWI1 Global transcription activator that
FT                   acts in complex with Snf2p Snf5p Snf6p and Swi3p to assist
FT                   gene-specific activators involved in the regulation of
FT                   expression of many genes including ADH1 ADH2 GAL1 HO INO1
FT                   and SUC2 Zinc-finger transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25564"
FT                   /db_xref="GOA:C5DPF3"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR036431"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPF3"
FT                   /protein_id="CAR25564.1"
FT                   /translation="MDFYPSAAASPGINNAALDGNENGDEDDFSSFFDSNGVSGNNNNT
FT                   NEHNGNSVSPQAILARNSISEISRPNSNPGASMSPQQVFTNQAGLPQQILMMNSGTNGG
FT                   NEGATPQQILSNRGSPIAGNDGRSLAGSPASAASEGVLHGNSSVFTDRAATFAALRKKQ
FT                   QQAQAAQQAQAQAQVQAQARAQAQAQAQIQAQARAQAQAQAQAQAQAQAQAQAQAQAQA
FT                   QAQAQAQAQAQAQAQSPAQAPTPTPAQQQGFQGATAAAAAVAAQQQQQRNVLQNLNPDL
FT                   QRRISTELNNKQYELFMKSLIENCKRENMPLQTIPEIAGRKINLFILFMLVQRFGGGEQ
FT                   ISRNKQWGVLAQRLQIPDVQQLTAIYYKILIPYEMYLKSPEGIKESQTKKIFFQQFFQE
FT                   LLKKVQVYSNITNNTNGNSSSNGTSNASPPQPQPQLQPQPQPQPQPQPQPQPQPQPMSM
FT                   NAVNAIKLKQQQLHQQQQQQQQQQQFLQQQQQQQQLAAAALRAKKQKKPRQKKKTKKEL
FT                   ELERRQQEEMMKRQQQALLEQQRQRKILMEQQLQQQQELLKKKYAQEMAKLPKVYKRAV
FT                   TRNYKPITRPIQHAKGYDIGYVSQIGEKIDANKPIFLFPPEIGIINLHALTMSLQSTNL
FT                   GEIKTALDTLLVTSADSVLKLPFERYPDLLDSLCTLGINLLANLAQGNYNIFHTIYCEE
FT                   YDVDSILSSPHTPFSTTEERFNKVFENYVKDLNVENDGNSEPLEARVKVDSLTGTDLEQ
FT                   VPITPAQTPLDWNEDDNETDSVPLKGPRVWEPLPEPLSRRPNQDLTNLHTPSYLQALKS
FT                   VKEEIDNPFTKMNTRGAEDPKVLLNDQISTISMILRNASFSERNSKIMGKNPFVKRFIT
FT                   DLMWLVFIQSDKVSSNRKGLNFKKDTVITLTNISHVYEVESHLDCFFVLMLALSFGEPK
FT                   KFDSGSDHLSYPEYLLKLGKYYGFGVDVLSKLFSLAYPNRSFFKDILLPQIVDNEIEEE
FT                   SKDWITALRLINAYNKGDKYRLFNNVFSLLVSVIPFMQLNTLPTLIEEVGPIISQSLTS
FT                   MLIIVNFLESEDSNKNIKNMPLVWLNSEENIGFNLRRLSEVLCNISIHTDKNLIHLKRM
FT                   FAFISCKCIELTRLLIQKSIDFTPGTEKLQTCRSLASIPGLLPTDTQIFALLSNPLADA
FT                   EISRQAELFGKLNNQILATLVEGAK"
FT   gene            complement(<236681..>237781)
FT                   /locus_tag="ZYRO0A02904g"
FT                   /old_locus_tag="ZYRO-ORF9416"
FT   CDS_pept        complement(236681..237781)
FT                   /locus_tag="ZYRO0A02904g"
FT                   /old_locus_tag="ZYRO-ORF9416"
FT                   /product="ZYRO0A02904p"
FT                   /note="similar to uniprot|P50108 Saccharomyces cerevisiae
FT                   YDR245W MNN10 Subunit of a Golgi mannosyltransferase
FT                   complex also containing Anp1p Mnn9p Mnn11p and Hoc1p that
FT                   mediates elongation of the polysaccharide mannan backbone
FT                   membrane protein of the mannosyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25565"
FT                   /db_xref="GOA:C5DPF4"
FT                   /db_xref="InterPro:IPR008630"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPF4"
FT                   /protein_id="CAR25565.1"
FT                   /translation="MGQFSRFKKPLLVFLTVTFLIFWIRDNGSKTSAADSRSDIAQALK
FT                   NNQNVKYPPNLLNRYLYGNGEGDARVDPTQYMSWWNKLVYKLTNWRREPRIVIILAANE
FT                   GGGVLKWKNEQDWAIERLSINNKKSYAKKHGYGLTIKDQTVAKRYSHEYREGWQKVDIL
FT                   RQAMREFPNAEWFWWLDLDTLIMEPEFSLEEHIFDRLNNVTSRTLQDFNPLNIPLDIPY
FT                   VDYTEELNLLITQDCGGFNLGSFFIRNTEWAHMVLELWWDPALYEQKHMYWEHKEQDAL
FT                   EALYANQGWIRSRVGFLPLRSINSFPPGACSEFQDDKRFFYDDKEKDFIVNMAGCNFGR
FT                   DCWDEMQHYTRLLEDKNRKWFSRLFH"
FT   gene            complement(<238036..>239769)
FT                   /locus_tag="ZYRO0A02926g"
FT                   /old_locus_tag="ZYRO-ORF9415"
FT   CDS_pept        complement(238036..239769)
FT                   /locus_tag="ZYRO0A02926g"
FT                   /old_locus_tag="ZYRO-ORF9415"
FT                   /product="ZYRO0A02926p"
FT                   /note="similar to uniprot|P35056 Saccharomyces cerevisiae
FT                   YDR244W PEX5 Essential for import of proteins with SKL-
FT                   like import signal into peroxisomal matrix 69-kDa protein
FT                   containing tetratricopeptide repeat (TPR)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25566"
FT                   /db_xref="GOA:C5DPF5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPF5"
FT                   /protein_id="CAR25566.1"
FT                   /translation="MNAAECSIGSNPLAQFNKHTQRDRSLQHGSSMSMTHEPSPQQFKS
FT                   TQNGMSDAARFHMQNFMNDGSTSNPQMRLGQQPMALRNATGSSSSVNMTPSVRESPGAP
FT                   LQQNAWSQEFQFKDGSSQQLQQPRQTQQQRNGPSYSYRGMGMQNMPMVTGPRMMMGPSM
FT                   MHPQQQQQQQQQQSHNVDQQKSWDEQFKALESEVAENLNLQDAQTEETPVQEATQENDI
FT                   VGDQYQSEFQQVWDSLQKDADDLLTEDLAGTQEWENDYQRFLNGRVSGNSEYKFEGENQ
FT                   FLHNPNAYEIGCVLMENGAKLSEAALAFEAAVQEDPQHVDAWLKLGEVQTQNEKELSGI
FT                   NALEQCLKLDQHNVEAMKSLAISYINEGYDVSAFTMLNRWVEAKYPDLIENTDGSAIDN
FT                   ETERYKLNVSVRNRFLQIANRLPQVDPDVQLCLGLLFYVDDQFDKTIDCFKAALSVNSN
FT                   DELMWNRLGASLANSSRSEEAIQAYHRALQLKPSFVRARYNLAVSSINIGCYKEAAEHL
FT                   LTALSMHEVSGGATNPSMTVDSNNILETLKRAFVAMDRRDLLERAKPGMDLQSFRNEFN
FT                   F"
FT   gene            <240353..>242026
FT                   /locus_tag="ZYRO0A02948g"
FT                   /old_locus_tag="ZYRO-ORF9412"
FT   CDS_pept        240353..242026
FT                   /locus_tag="ZYRO0A02948g"
FT                   /old_locus_tag="ZYRO-ORF9412"
FT                   /product="ZYRO0A02948p"
FT                   /note="similar to uniprot|P23394 Saccharomyces cerevisiae
FT                   YDR243C PRP28 RNA helicase in the DEAD-box family involved
FT                   in RNA isomerization at the 5' splice site"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25567"
FT                   /db_xref="GOA:C5DPF6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPF6"
FT                   /protein_id="CAR25567.1"
FT                   /translation="MARPPDISQLLSGTDKSANGLQELEKPKFLTKAQRQQLLLNKSQK
FT                   REDIIPTVVKPRNKESEVIQKEDEEYSQTSRPKFNYDTNEQEDTLSNYEPIVSIRAKDL
FT                   MQRPRDSIEQFYMGKHWTEKTRQEMSDRDWRIFKEDFGITIRGGSVENPLRSWYELKNE
FT                   QMADAIVKNLKYHEPTPIQRAAVPNVCNKKFRDLLGIASTGSGKTLAFLIPILMKIDQL
FT                   PSRPLVLKKMDGPLALILAPTRELAQQIEKEAEELIDAWGKNCEVASIVGGHSIEEISL
FT                   QVSQGTDILVATPGRLIDCLENHVLTLGKVETLVLDEADRMIDMGFEEQVTSILGNLTQ
FT                   KRQTMMFTASMTPGTEKIAAGYLKNPVRVTVSGSQGSTPMIRQLVEHIGSEEQRFQRIV
FT                   EFLPQYRAPIIIFINYKRAADWLVQKFYKETQYKVTVLYGSKSQEQREQSLQLLRKGKV
FT                   QIMIATNVAARGLDVPDVSLVINFQLSKTFEDYVHRIGRTGRAGHEGTAITFLDDEDPE
FT                   LVKELYKYLQENNPTGANNFAPRLKEKYRLGKRRIEEVLY"
FT   gene            complement(<242160..>243149)
FT                   /locus_tag="ZYRO0A02970g"
FT                   /old_locus_tag="ZYRO-ORF9411"
FT   CDS_pept        complement(242160..243149)
FT                   /locus_tag="ZYRO0A02970g"
FT                   /old_locus_tag="ZYRO-ORF9411"
FT                   /product="ZYRO0A02970p"
FT                   /note="similar to uniprot|Q12046 Saccharomyces cerevisiae
FT                   YDL209C CWC2 Protein involved in pre-mRNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25568"
FT                   /db_xref="GOA:C5DPF7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR032297"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="InterPro:IPR039173"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPF7"
FT                   /protein_id="CAR25568.1"
FT                   /translation="MSKTWRERSAKVQVKESDLPSSIPPQTGLVFNIWYNKWSQGQGGQ
FT                   SRFVSPFRLDPKLHSGKTLGDKQETQFFCLYFAKGMCCLGKKCQYMHHVPENEDMLRLA
FT                   AKTDVLDCFGREKFAFYRDDMAGVGSFRKHNKTLYVGGISSALGNRPLKSNQIENRIRF
FT                   LFSELGEIDKLHYLESKNCAFIKFKRQCNAEFAKEVVANQSLLIPSDREWEERLQLTGL
FT                   QVKWAHDDPNPRAKREEEEEKRQETLDLMVHLLDKSNETQAAEEVKKGENESAEEKHGR
FT                   IFSGEVLNKLRKRKTNFKSENAKEKRQKTEEPQKASLVDYPSSSSEDE"
FT   gene            complement(<243266..>243351)
FT                   /locus_tag="ZYRO0A02992r"
FT                   /old_locus_tag="Zyro0A.tTyr.GTA.32"
FT   tRNA            complement(join(243266..243301,243313..243351))
FT                   /locus_tag="ZYRO0A02992r"
FT                   /old_locus_tag="Zyro0A.tTyr.GTA.32"
FT                   /note="tRNA-Tyr (GTA) cove"
FT   gene            complement(<244752..>244835)
FT                   /locus_tag="ZYRO0A03014r"
FT                   /old_locus_tag="Zyro0A.tLeu.TAA.31"
FT   tRNA            complement(244752..244835)
FT                   /locus_tag="ZYRO0A03014r"
FT                   /old_locus_tag="Zyro0A.tLeu.TAA.31"
FT                   /note="tRNA-Leu (TAA) cove score=70.82"
FT   gene            <245136..>247739
FT                   /locus_tag="ZYRO0A03036g"
FT                   /old_locus_tag="ZYRO-ORF9409"
FT   CDS_pept        245136..247739
FT                   /locus_tag="ZYRO0A03036g"
FT                   /old_locus_tag="ZYRO-ORF9409"
FT                   /product="ZYRO0A03036p"
FT                   /note="similar to uniprot|P19735 Saccharomyces cerevisiae
FT                   YBR055C PRP6 Splicing factor component of the U4/U6-U5
FT                   snRNP complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03036g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25569"
FT                   /db_xref="GOA:C5DPF8"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR010491"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027108"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPF8"
FT                   /protein_id="CAR25569.1"
FT                   /translation="MELPSFLSQQPPPGYIPGIGRGATGFSTRGDKKGPAKVPKRLQNQ
FT                   DTVKAVDGDSKEQDEDSEADKVFSDLDSKLSSRNRSKKREGDQQSIPHQFADLKRSLAT
FT                   VSEDQWLNIPDAGDYTRKRRRERLDEQLNRKTYAAPDTLLMPHVNLSKLTEEREKMLSR
FT                   QLDSNIFEKEDSNSVNEAQKYLNDLETFEAGPRGDEEDVKKMRTILQSYRNADPKKPEG
FT                   WVAAARLEEKARKLKTARNIIEQGCLECPRNEDVWLENIRLNSADTQRCKTLAAQGIKF
FT                   NPQSLQLWIKAVDLEREVLNKHRVVRSSLQELPLSEELWKLAVKYSADKFEAQRILQKA
FT                   VELIPTSIELCSALVHLQNYQEAKHTLNAARKAMPRELKVWILAAEVEESKGEAVTDER
FT                   ILKLLSKGIKQLKENGLEITLLQLLKEAQSLVKEGGLRTAHALTQAALSEFQDEYEASR
FT                   VVSELSDSIVKVVGFKILLKSNPTKYSFWQSLKKLCEKLNKMDELYNTFETLLFDESEN
FT                   FRILKQNPLLSLMYSKEIWKNGHDIPKSLEILDRAQNILPNSLEVWLAKLKFLCLTDQV
FT                   ELAQKSFAMAMERLRDSQVPHLEKLYYKYISFLRFRRQNTAAIKMLNETCIPKFPNCPK
FT                   FYLQLGQIHYDLGQTEESQMAFERGTKMLPQGIPLWISLARIEEIDLKRPAKARSIFDL
FT                   ALLKNPANETLSLARAQMEARLGNYDQARFIIQQSLQKHSKSATLWAENIRILPLKRAN
FT                   VKKTVFQDALKNTNNSCEILVEIGISFYKELQHETAIKWFERATRSNPSYGDSWVWVAR
FT                   CYKKLNRNIQEIVNQVEIHEPTHGNLWISVSKKPDTQYYSCSKILLTLLESENVV"
FT   gene            <247954..>250164
FT                   /locus_tag="ZYRO0A03058g"
FT                   /old_locus_tag="ZYRO-ORF9407"
FT   CDS_pept        247954..250164
FT                   /locus_tag="ZYRO0A03058g"
FT                   /old_locus_tag="ZYRO-ORF9407"
FT                   /product="ZYRO0A03058p"
FT                   /note="similar to uniprot|P40971 Saccharomyces cerevisiae
FT                   YDR034C LYS14 Transcriptional activator involved in
FT                   regulation of genes of the lysine biosynthesis pathway
FT                   requires 2-aminoadipate semialdehyde as co-inducer"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25570"
FT                   /db_xref="GOA:C5DPF9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPF9"
FT                   /protein_id="CAR25570.1"
FT                   /translation="MSSMLGTSDPGTNKSNSDEVKPLQSSTSANYLSPASLDNGFSLTG
FT                   PSRFTPDLFSKKGSAPPVIGSIELTPSDDKLMATPEALASANGDMGSQKTAGSVSSTVT
FT                   DGEGKVVKRKYSRNGCTECKRRRMKCDETKPTCWQCARLNRECVYILNAKNKKRKPREA
FT                   RIKSTDRNNKKGLAKTNGSIPPAAVAVAAAAAADANTNKLEKDMINNMQVLELPNVISA
FT                   SNMDGYDANLLIQNLNDMVSMKLNDSFSLNEGLKDFHLPDLDIPELMPQSKASENSVPI
FT                   SFLVNNVITFNTRLSSFQLGGVHDKYLEVFFYDCLDSIAPFFQNQGNPLRDIILSFARN
FT                   ESYLLSATLAVGASIAHRNSNKLEDERNYCAYLSHCLSLLGEQFQNESNVMHKIEPITL
FT                   TVIMLAWDCINAMNSQWRSHLKGVTDLFKKINSGNSSKVMNVAKCWFKVMETFASISTV
FT                   LGGSLTDEQDMDLIFNPQDFQYIDSLKFLNIMTPLNEFNLLRGHKEDFDLVIKEVIKAL
FT                   NAIRDQEKEHFVGEEEIFPKNLDYLQWTPEADTKQTLSYFNTQKILVEIDKQLEYEFID
FT                   KSGIIPPESQSHPDNSHIDDNAIDVVVLRSGERIAISWYDISHQTQVLSVLLTVLLKLL
FT                   GIPKESITIQQVVKKIMSFFKFLDSDEAPQNSRTCYSNFAVLIAGFNALDEPTRDLVRA
FT                   YYKLNGGRFRKLTEHNLNRLRKVWYGNDGGNYRLVDEDVLTW"
FT   gene            complement(<250211..>251482)
FT                   /locus_tag="ZYRO0A03080g"
FT                   /old_locus_tag="ZYRO-ORF9404"
FT   CDS_pept        complement(250211..251482)
FT                   /locus_tag="ZYRO0A03080g"
FT                   /old_locus_tag="ZYRO-ORF9404"
FT                   /product="ZYRO0A03080p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25571"
FT                   /db_xref="GOA:C5DPG0"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPG0"
FT                   /protein_id="CAR25571.1"
FT                   /translation="MRLIYTLTLSVATLGRFVSASVLPQHGFEAEVDNTSLVDQLYGDL
FT                   LISREGFEMQSLHSKITPSDEDDEEFRARCGFYNENPVQLPSDGLGSDLVIFAGIVSFA
FT                   HLPIARCFTPGAEDFDIAIVGAPYDTSTSFRPGARFGPNGIRQGSRRLGSGVSPVRGFP
FT                   GSKLRQLDPYNAGYKLVDCGDVPMSPFDNRVALNQLYRGQRTIHKNKSVKDPSQPPKII
FT                   TLGGDHTVTLMNLRSAYEQWGRLAVIHFDSHIDSWDPRVLGGNITKSTALNHGTFLHYA
FT                   HEKGYLAPNNSIHVGIRAPFLGPDDEKHDFECGFEKIVARDIDIVGIKGIVDRIKQHVT
FT                   GWPVYLTLDIDSIDMAVAPGTGTPEPGGFSAREILTILDGLEGLNIVGADVVEVAPAYD
FT                   TNGDITSTIAASVVDSILGLMTID"
FT   gene            <251832..>253292
FT                   /locus_tag="ZYRO0A03102g"
FT                   /old_locus_tag="ZYRO-ORF9402"
FT   CDS_pept        251832..253292
FT                   /locus_tag="ZYRO0A03102g"
FT                   /old_locus_tag="ZYRO-ORF9402"
FT                   /product="ZYRO0A03102p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25572"
FT                   /db_xref="GOA:C5DPG1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPG1"
FT                   /protein_id="CAR25572.1"
FT                   /translation="MVHQQAENETEDSRLIRAGGSYGACPCDELGENEEDFTKITTYFD
FT                   EFIQILRKSLPLALTLLLQNLISSVSLLFVGRLGSLVLGSVTLANVIFNATAVVFLGLA
FT                   TCLDTLCPQAYGAGNYTLVGLYFQRCIIISTIVSIPISFVWIFSKPLLNLVAKDAELIN
FT                   ISSQYLKCMVGCIPGYIVFECGKKYMQAQGDFHTAQMILLIGFPFSILANYIFILNSPL
FT                   GYLGAPLASSLTFTLMGILMACAMLRDRKCWHEFHWKTVIHGWEPLIRLAVPGIIMIEA
FT                   EFLAFESLTVLAARFETTELASQAVATSVQSISFQIPFAVSIAASNRISTHVGRGKIPD
FT                   CQIATRSTLFYMGPAVSMLNLVGLLGGRYFVSSLFTSDPAVIQRAAKLISVIAINQIWD
FT                   AYNVLGAGCLRAQGRQNIGGYLNLVAYYVFGMPLAIYLGFYLDWQAFGFWIGLGFGIFA
FT                   LAIGEMYCVYRSDWPLIMLQSELLHGAA"
FT   gene            complement(<253638..>254234)
FT                   /locus_tag="ZYRO0A03124g"
FT                   /old_locus_tag="ZYRO-ORF9400"
FT   CDS_pept        complement(253638..254234)
FT                   /locus_tag="ZYRO0A03124g"
FT                   /old_locus_tag="ZYRO-ORF9400"
FT                   /product="ZYRO0A03124p"
FT                   /note="similar to uniprot|Q12335 Saccharomyces cerevisiae
FT                   YDR032C PST2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25573"
FT                   /db_xref="GOA:C5DPG2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPG2"
FT                   /protein_id="CAR25573.1"
FT                   /translation="MAIAIILYSLHEHIAALAEIEKEGVELNGIQCDIFQVPETFDADT
FT                   VKELGGKPTNYPIANREVLEKYDAFLLGIPTRFGNMPAQWSAFWDATNTLWIKGSLHGK
FT                   LAGVFVCTGSGGGNENTIASAVTTLVHHGMIYVPLGYYNVMKKLSRMDKVKGGGPWGAG
FT                   TISGPEGEREPSLIEKKIAREQGRKFGKIYWKTTH"
FT   gene            complement(<254352..>255329)
FT                   /locus_tag="ZYRO0A03146g"
FT                   /old_locus_tag="ZYRO-ORF9399"
FT   CDS_pept        complement(254352..255329)
FT                   /locus_tag="ZYRO0A03146g"
FT                   /old_locus_tag="ZYRO-ORF9399"
FT                   /product="ZYRO0A03146p"
FT                   /note="similar to uniprot|P38235 Saccharomyces cerevisiae
FT                   YBR053C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25574"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPG3"
FT                   /protein_id="CAR25574.1"
FT                   /translation="MQVSKQDYSKVEPFVAVPDAVLSEGIVYVSPARTLLWVDIYRAKV
FT                   YRRRMDTGVTDVFHADGSGSIGAVFPILKRSSSDGNDTQVEEFLFAAKEGIAHGQFGGS
FT                   WKYVVKYSESGLDSERLKRLRSNDGNVHGEDLYIGLINDFDQETTDEGVIFKINLVSKK
FT                   IDVFWPRISIPNSLYWVGEYMFVTDSMNSCIWRTKHGFQEREKFIDVTQYSTDPEGNLP
FT                   EPDGSCLSSNGELLFVSIWGHSKVQVFSTKDGALLQEILLPEETPRVSCCAVVGSDLFV
FT                   TTGSEHLGTSKVGQPSKGGCLYRLSDVIPESDEFSTRGIIYRDD"
FT   gene            <255864..>257000
FT                   /locus_tag="ZYRO0A03168g"
FT                   /old_locus_tag="ZYRO-ORF9396"
FT   CDS_pept        255864..257000
FT                   /locus_tag="ZYRO0A03168g"
FT                   /old_locus_tag="ZYRO-ORF9396"
FT                   /product="ZYRO0A03168p"
FT                   /note="similar to uniprot|P38079 Saccharomyces cerevisiae
FT                   YBR054W YRO2 Putative plasma membrane protein of unknown
FT                   function transcriptionally regulated by Haa1p green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery and bud"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25575"
FT                   /db_xref="GOA:C5DPG4"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPG4"
FT                   /protein_id="CAR25575.1"
FT                   /translation="MNQFIDIHKRGGNQAVTINKPYNVDIHITKNGSSWFWAAFCIFTA
FT                   LAMLVIILMFRKPANERLFYYTGFAPVMFMALNYFTLASNLGWIPVKVKYKHATTASEH
FT                   GHLGTRQVFYSRYIGWFMAFPWPIIQASLLGNTPLWQIAFNIGLTEIYVVVMLFGAVVH
FT                   TTYKWGYFVIAIAAGIITCISVMTTTRNLVRNISPIVLKCFRIYFYIVMLFWFLYPISF
FT                   ALSEGGNVMQPDSEGAFYGILDVLFLGFLPVLFIPVASYIGFDKLGLNKTVNHYGQDSS
FT                   PAENAVSRPPAPLPKPPPSSGAKDSSKGPGVKQPGKKTKKVKRVKKVMRPVQKPAERPP
FT                   SEEHVGEKMSEPAEGTSEPTEKVSEPAEKGTPDKSEEY"
FT   gene            <257891..>258490
FT                   /locus_tag="ZYRO0A03190g"
FT                   /old_locus_tag="ZYRO-ORF9394"
FT   CDS_pept        257891..258490
FT                   /locus_tag="ZYRO0A03190g"
FT                   /old_locus_tag="ZYRO-ORF9394"
FT                   /product="ZYRO0A03190p"
FT                   /note="highly similar to uniprot|Q12335 Saccharomyces
FT                   cerevisiae YDR032C PST2 Protein of unknown function with
FT                   similarity to members of a family of flavodoxin-like
FT                   proteins; induced by oxidative stress in a Yap1p dependent
FT                   manner; GFP-fusion protein localizes to the cytoplasm in a
FT                   punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25576"
FT                   /db_xref="GOA:C5DPG5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPG5"
FT                   /protein_id="CAR25576.1"
FT                   /translation="MAPNVAIIIYSLYGHTAILAEAEKRGVEAAGGKADIFQVPETLSP
FT                   EVVKAMGGAPKPDYPIATADTLVNYNAFLFGIPTRFGNFPAQWKAFWDHTGGLWVKGAL
FT                   QGKVAGVFISTGTGGGNEMTVVNSLSVLAHHGIIYVPLGYANAFKELTNLEEPHGGSPW
FT                   GAGTLAAADGSRKPSELELSIHEIQGKTFTETVRKF"
FT   gene            complement(<258599..>258940)
FT                   /locus_tag="ZYRO0A03212g"
FT                   /old_locus_tag="ZYRO-ORF9392"
FT   CDS_pept        complement(258599..258940)
FT                   /locus_tag="ZYRO0A03212g"
FT                   /old_locus_tag="ZYRO-ORF9392"
FT                   /product="ZYRO0A03212p"
FT                   /note="similar to uniprot|Q07789 Saccharomyces cerevisiae
FT                   YDR031W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25577"
FT                   /db_xref="GOA:C5DPG6"
FT                   /db_xref="InterPro:IPR031731"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPG6"
FT                   /protein_id="CAR25577.1"
FT                   /translation="MSQLDQFIMEDVARYCPREFMEYHKCVSSNRDDLQQCAFRQKDLS
FT                   SCIQNKVPSVKRVMEKCGSLMQNYEKCVRDNMDTRSVNNCVPLLEQMRSCASEHALQGT
FT                   RPINEMVKD"
FT   gene            <258942..>260183
FT                   /locus_tag="ZYRO0A03234g"
FT                   /old_locus_tag="ZYRO-ORF9391"
FT   CDS_pept        258942..260183
FT                   /locus_tag="ZYRO0A03234g"
FT                   /old_locus_tag="ZYRO-ORF9391"
FT                   /product="ZYRO0A03234p"
FT                   /note="similar to uniprot|Q12021 Saccharomyces cerevisiae
FT                   YDR030C RAD28 Protein involved in transcription-coupled
FT                   repair nucleotide excision repair of UV-induced DNA lesions
FT                   homolog of human CSA protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25578"
FT                   /db_xref="GOA:C5DPG7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR042238"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPG7"
FT                   /protein_id="CAR25578.1"
FT                   /translation="MNTCLLKYQLNSIGSNYLNHLSVQHEFEKMVESESPRKYQYSKSK
FT                   IGGTSCLQIDPNTGKFLLACGNDGSLGIWSLDDRCQDDELYCKRIKFSARTGSNDEPIA
FT                   IPTNKNAQMVHSFETRKNRFRLYRQSSSPLAPAQSQSRPGHRYGIRSCQWFKLDNGMFF
FT                   TGSNDLSVQLWDTNSLEAVHSVDVGHRVNQIDTTDHCIVVATEDGYPRLIDLRNPTGIT
FT                   HLGSGTMPHEMLTVHCNPQKTHIVATGDSNGSIKLWDLRKRNQLLMEVYHDTPRKRAHL
FT                   SYCQDLAWNSNGSQLASVGADGRIYIWSPFNQSHRASQVGPHDLPRTRHLRRTSQRLLW
FT                   SENYILCNTDYGEIQLLDPVHKKLWTKIEDPEPTSSTSSTTQFSGMALQDKLSNGMGLR
FT                   LYLSTGNSIYEHTS"
FT   gene            <260758..>263997
FT                   /locus_tag="ZYRO0A03256g"
FT                   /old_locus_tag="ZYRO-ORF9390"
FT   CDS_pept        260758..263997
FT                   /locus_tag="ZYRO0A03256g"
FT                   /old_locus_tag="ZYRO-ORF9390"
FT                   /product="ZYRO0A03256p"
FT                   /note="weakly similar to uniprot|Q00816 Saccharomyces
FT                   cerevisiae YDR028C REG1 Regulatory subunit of type 1
FT                   protein phosphatase Glc7p involved in negative regulation
FT                   of glucose-repressible genes involved in RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25579"
FT                   /db_xref="GOA:C5DPG8"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPG8"
FT                   /protein_id="CAR25579.1"
FT                   /translation="MGDNLAAFFADRVSQSQTTPVKSYSAPTTPISGDPLDGGLKKLGK
FT                   TNGNGQDDMGPTVSMAVHANDDDSFHKSTFNLKRTRSMGLLDEYIDPTRKLLGRNDNEN
FT                   HRINHGSKNIPLNETTVRARQVGEDEDEDQADDEGAEDNDVEDEDIDEDEYFDDNRNGR
FT                   RVERTESEWDDANRSMSVSPPPADDASILLPQDDNDLMREPERHVDYLSHEWNESDISN
FT                   SWKYIILKKKKKSSIDQVNAARLENASWRTWAKARNHLRTVSPEIVNWSKDSDVTWLYG
FT                   PIVRESDNHDKDVEMGYGSDDETSKRMSTPRKKQKDSHAPKPILKKRTVQEILKDNSLW
FT                   KLSEARKHKHEGRHSTSAADTSDIMYEPHDAYDDYDALAAKVNAQYYGPKKTNSGAEFN
FT                   SGDGHNKSVDGSSDKPTHTTTTGSSETVPQAEDPLASSVGGEGSNDKALKTILTSSNND
FT                   GTGSKSRPGRDRHIHFNDRVEQCMAIADPDFDSDFIDNESDQGDEDADSYGSTSIIGDR
FT                   SGETLAQAANFGRTSGDSATSSSDDGDADEDDEDNSGLFISPAMPRRTDSATHSPITDN
FT                   SSTGSMKNSKLSLNPIIKLLPATTLNHGSDDEASDDSDYNGYGSSVSHNVNTYRGYDYM
FT                   YDYNSVYTGDTSSFLPVENCDVVDVPEGIGLHSAIAGDNASTYEFNHAALSDLDHEVQA
FT                   DEQQHKIHEQPQAATQQEPNTPSLLNNDFDNSGFDSDEQFIEDSQYHSSDDDEDEEEDL
FT                   GLKRAVSMGRSSSSSSLKDLSNPQPLNTINPQSRTCSFISGKPLNYAPSLPEDNSNFID
FT                   VNDNYDNGNHKNFDTTSNSDDDNSKFDNKNSVISSDGDNQRQKSSHMPLKRAPSSPFIF
FT                   NSESEDEDEDDEADEEDDHNIISCSPKGPNLQHHQEIGDSPKFSLQSHSKTAPPQSSVI
FT                   LPTSGKSATASGPQLSDLSKSIRIKNSLSPAEVGASDVAITGSFSPVNESIKSVVTNEG
FT                   IIGRGASSPFTNNQNTHNNNEIRDVNRNLQDCHIDENRSNGVGEQRDSSESVQKMMQNA
FT                   REIANKYLHSWRKGDGNSQGTKSDNKNSGTD"
FT   gene            <264444..>267179
FT                   /locus_tag="ZYRO0A03278g"
FT                   /old_locus_tag="ZYRO-ORF9388"
FT   CDS_pept        264444..267179
FT                   /locus_tag="ZYRO0A03278g"
FT                   /old_locus_tag="ZYRO-ORF9388"
FT                   /product="ZYRO0A03278p"
FT                   /note="similar to uniprot|Q12071 Saccharomyces cerevisiae
FT                   YDR027C VPS54 Component of the GARP (Golgi-associated
FT                   retrograde protein) complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25580"
FT                   /db_xref="GOA:C5DPG9"
FT                   /db_xref="InterPro:IPR039745"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPG9"
FT                   /protein_id="CAR25580.1"
FT                   /translation="MSKDVKKDERIGENDDLQQANSVESPLNTSTPKMTNSDSSPKLTR
FT                   TPSIDGSLNDDLVSVSGNVGKLLPSSRMSMDSFSVRSLDSSAIGGRISSRPFVFDHSNH
FT                   SGSMEYSPLGNNSIFEIVMNTRRKNWLGYPSVQDIPPVVLTKDIVDPEIQNTVMNYVQS
FT                   IGPECAVFESSNNLKIINRIEQIKQLEIHDNGNNNFGDESETALQNKENLKELEKVPDF
FT                   YFSKNFQLDNPRTFQKVLKNVDLQLGELSIESKPQRDHAYSELRDRLNDYLDAVEGLLV
FT                   GEISKSSHKFFHALGDVDLIQRKAESTVNELDLLVENADILDKEKIQRRIDLLQKTFKR
FT                   KNVQKLEQGLLQVKQVLLRTEECRKLYEKEQYDICLHMIKSIDLLIKGDGSQDKAVQQW
FT                   VQGWPFKLADLKSVPALTETREFLTNMKIEIGGKYSLQLCSVLLGDVRNYCKSVSSKAT
FT                   LNRLQNNTREKKFLDIDEGFRGKVANIVHQLRRCEELASALSLYQDKCIAEIKSIIKSY
FT                   LPQETLPSESSSEDKKIGTPGTQQYPQQQQQQPVNNGSKLSKLIKEQTPMDFQDMLVHI
FT                   FTHASEALRRFYRHQKLLLDLSLNEIVSANDPNENQQSMITQLDIRNGINETIRILQLR
FT                   TGKIIAVRRELTCNLRYDHFLELYSICVLFIQECEAVSGEFLTRYLSDVLAAQIKNFIV
FT                   NQSSKNIRTIQRKIESETWTPFVVDPSVQRDVNDIVSSMELDPIDWIKKSDLVRASEED
FT                   EKNDDDKENEKKEAQAGHKKSVVVEDNTFVASDSLLTNIGLIKEVFILAVNLPSAYLAN
FT                   FEKMCYDLLRYFNIFAVAALNDPAKSSLQSNKNYSIMGESLDCLSRFVHIVQRFFQRLS
FT                   NFNKDYSSLDQSHYNHLLHQYHMSSEKIYMANAPPPPAPV"
FT   gene            <267538..>269544
FT                   /locus_tag="ZYRO0A03300g"
FT                   /old_locus_tag="ZYRO-ORF9387"
FT   CDS_pept        267538..269544
FT                   /locus_tag="ZYRO0A03300g"
FT                   /old_locus_tag="ZYRO-ORF9387"
FT                   /product="ZYRO0A03300p"
FT                   /note="similar to gnl|GLV|KLLA0F04389g Kluyveromyces lactis
FT                   KLLA0F04389g and some similarites with YDR026C
FT                   uniprot|Q12457 Saccharomyces cerevisiae YDR026C
FT                   Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25581"
FT                   /db_xref="GOA:C5DPH0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPH0"
FT                   /protein_id="CAR25581.1"
FT                   /translation="MASNQEKHYRDQPHHLPHEGGSRHESVEEAVFKYVGVGLQNDDDN
FT                   PKDPKSYDKRDGSNVVDTSKPGDGNQGNDMDWLFRNAHNDEDIGGDNNENSPRFQSVAL
FT                   AAIAAAYGSGAGAGSGEHKRRRARDGGEASDGEDDANGNNDNSNNGGRRKSSKKSKKNK
FT                   EKRAKLQLAVDPELATLDDSDVTSHDQLVRKAIMDTDSIAQHPDFQQYLNTDEEPQKSK
FT                   DSMKHKDKNHRPVGDHEDEDEEEEDEEDEDEDEDSRDTRDVDPAVVEAAARDEAEDDNL
FT                   DDVTKQYSELQKDSVMDNPVTKSIQKKDYREVLPKVLSSSDIGVDTDVSHLIQSAASKA
FT                   SAIIGTTSQSSGKSFDQAEEAALEQFITEYQTIKNLDRQQICERIWSNERRKDDFWSNI
FT                   CKVLPYRTRSSIYKHVRRKYHVFEQRGKWTPQEDAELARLCVEKEGQWSEIGRALGRMP
FT                   EDCRDRWRNYVKCGSNRASNKWSPQEEELLKRVITEMLEESQRHHTRGTDHLVQESDEE
FT                   EDVPASDDEKQDFDKKDGRKSNRKTSFKDVINWTIVSERMGGTRSRIQCRYKWNKLVKK
FT                   EAIAKIQSITETDKRWILEKLRDLGFTEDSQVDWEELAALKPGVKWTGTELKLCYERMR
FT                   SGVRYYKQKSINDISKELLEMLDGSVPLEAKSN"
FT   gene            complement(<269848..>270315)
FT                   /locus_tag="ZYRO0A03322g"
FT                   /old_locus_tag="ZYRO-ORF9384"
FT   CDS_pept        complement(269848..270315)
FT                   /locus_tag="ZYRO0A03322g"
FT                   /old_locus_tag="ZYRO-ORF9384"
FT                   /product="ZYRO0A03322p"
FT                   /note="highly similar to uniprot|P26781 Saccharomyces
FT                   cerevisiae YDR025W RPS11A Protein component of the small
FT                   (40S) ribosomal subunit or uniprot|P26781 Saccharomyces
FT                   cerevisiae YBR048W RPS11B"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25582"
FT                   /db_xref="GOA:C5DPH1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR032440"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPH1"
FT                   /protein_id="CAR25582.1"
FT                   /translation="MSTELTVQSERAFQKQPHIFNNPKIKTTKRAKRWYKNAGLGFKTP
FT                   KTAIEGSYIDKKCPFTGMVSIRGKILTGVVVSTKMHRTVIMRRDYLHYVPKYNRYEKRH
FT                   KNVPVHVSPAFRINVGDIITAGQCRPISKTVRFNVVKVAANASAKKQFTKF"
FT   gene            complement(<270791..>271339)
FT                   /locus_tag="ZYRO0A03344g"
FT                   /old_locus_tag="ZYRO-ORF9382"
FT   CDS_pept        complement(270791..271339)
FT                   /locus_tag="ZYRO0A03344g"
FT                   /old_locus_tag="ZYRO-ORF9382"
FT                   /product="ZYRO0A03344p"
FT                   /note="similar to uniprot|P38231 Saccharomyces cerevisiae
FT                   YBR047W FMP23 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25583"
FT                   /db_xref="InterPro:IPR035283"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPH2"
FT                   /protein_id="CAR25583.1"
FT                   /translation="MLFRQVFLRFLSTTRVPLSKTVSGRIIVPPATHFNNQGPKFNRIP
FT                   RHEYKQLPDDSNYIEKFYDELQAFSQEFLEKQLHKKYTDFEDCPEELVFQLEQFIELQV
FT                   IPKHSEPANETGDTRPSFPLRSIQCRNIGDKIIIERYLDFSKGVKLTLMLNGGHTFIFD
FT                   VLLQGKSVFDNMQKNEKKD"
FT   gene            <271779..>272828
FT                   /locus_tag="ZYRO0A03366g"
FT                   /old_locus_tag="ZYRO-ORF9381"
FT   CDS_pept        271779..272828
FT                   /locus_tag="ZYRO0A03366g"
FT                   /old_locus_tag="ZYRO-ORF9381"
FT                   /product="ZYRO0A03366p"
FT                   /note="highly similar to uniprot|P38230 Saccharomyces
FT                   cerevisiae YBR046C ZTA1 Zeta-crystallin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25584"
FT                   /db_xref="GOA:C5DPH3"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPH3"
FT                   /protein_id="CAR25584.1"
FT                   /translation="MLRSTISSVFNKRATMATTTIPKTQKVILINDTGSYDVLKYQDHP
FT                   VPSITDNELLVKNKYSGINFIESYFRKGIYPSEKPLILGRESSGTVVAKGNSVKDFDIG
FT                   DKVAYLSGSAFAQYTKVDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVK
FT                   KGDFILNYAAAGGVGLILDQLLKERGAHTIAVVSTEEKLELAKKHGAEYGIISSKEDIV
FT                   TRVKEITNNQGVDAAFDSIGKDTFETTISALKRKGTFVSYGNASGPVSPFPLTKLTGNI
FT                   KILRPSLFSYIATSEEWKHYSREFVSLVSSGKLKINIGHVFPLSEYPKATQLLEERKTT
FT                   GKLVLEIPQ"
FT   gene            <273072..>274970
FT                   /locus_tag="ZYRO0A03388g"
FT                   /old_locus_tag="ZYRO-ORF9380"
FT   CDS_pept        273072..274970
FT                   /locus_tag="ZYRO0A03388g"
FT                   /old_locus_tag="ZYRO-ORF9380"
FT                   /product="ZYRO0A03388p"
FT                   /note="weakly similar to uniprot|P38229 Saccharomyces
FT                   cerevisiae YBR045C GIP1 Meiosis-specific protein proposed
FT                   to be a regulatory subunit of the protein phosphatase Glc7p
FT                   required for spore wall formation and proper septin
FT                   organization"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25585"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPH4"
FT                   /protein_id="CAR25585.1"
FT                   /translation="MEISLAQENWCSEDCSQNSMSNGDNDNETISSGSVGTGGGKRNSL
FT                   KKWLHKAVLGYDVDDSFDNEDTVVIEEDDDLVFIPTTSDLSNGLFSSNKELSPLLFEQN
FT                   PGRKNYRRQKIKDFKFHLKMRMRLARGDETDKNGEMLYRRQCLMGQDGGGDSGEYNEEE
FT                   LDCYQMFKTQPEHLDALFDYAMKSSLEQTSPSDFADFNYASSPVKELQPFQNLNYDDIN
FT                   LNVEHAAFVPLDVWDIDKESDSKRLDSAEDPRVCGSSNDSKGEEDCPTLSMDSTEMESF
FT                   TTGESTERSLELTPSVYLANELTMKDGATGSDVANDSFNSTEGEVEETSCEDSQDTQNT
FT                   LCSSGSPSIDSVLDSGDSNTIIYTIPTFKQGRGQLNVSGIIQSFKDGTLTEKNLTQMAK
FT                   GSSLGLSFRSKEFYEQPPSSDEDEQAQGRKQEMPMAPSENDNIREAPENYGVEFAGNGE
FT                   GVKFDKYSHILVYRAVKRNVQDKGFSCPSLRTPNNGNSSITSGVSESPSASKPILKKTD
FT                   NERESEEIVRATLCDKVDVKSFLAYFEYFEHQKHSDEVNLSKFREEQLSHYYSKEFFPE
FT                   LLEDIKFKHAFNSEYRKSKMATELNIGRKIGDGDEQHVRRLVNVIEDPTIGSANFK"
FT   gene            complement(<275129..>276508)
FT                   /locus_tag="ZYRO0A03410g"
FT                   /old_locus_tag="ZYRO-ORF9379"
FT   CDS_pept        complement(275129..276508)
FT                   /locus_tag="ZYRO0A03410g"
FT                   /old_locus_tag="ZYRO-ORF9379"
FT                   /product="ZYRO0A03410p"
FT                   /note="highly similar to uniprot|P07284 Saccharomyces
FT                   cerevisiae YDR023W SES1 seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25586"
FT                   /db_xref="GOA:C5DPH5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPH5"
FT                   /protein_id="CAR25586.1"
FT                   /translation="MLDVNQFIEEKGGNPELIRKSQKARGASVEIVDEIIADYKNWVKT
FT                   RFELDELNKQLNKLQKDIGLKFKNKEDASGLLAEKDKLTNEKKELTEKEQKEDNDLKVK
FT                   VNVVGNIVHPSVVVSNDEENNELVRTWGPKDLKEVGPIAAATGKPAKLSHHEVLLRLDG
FT                   YDPERGVKISGHRGYFFRNNGVFLNQALINYGLSFLATKGYTPLQPPVMMNKEVMGKTA
FT                   QLSQFDEELYKVMDGDDEKYLIATSEQPISAYHSGEWFEKPQEQLPVRYAGYSSCFRRE
FT                   AGAHGKDAWGIFRVHAFEKIEQFCLTEPEKSWEEFDRMISLSEEFYQGLNLPYRVVGIV
FT                   SGELNNAAAKKFDLEAWFPYQKEYKELVSCSNCTDYQSRNLEIRCGIKKMGDREKKYVH
FT                   CLNSTLAATQRALCCVLENYQTEDGLVVPEVLRKYIPGEPEFLPFIKELPKNSTSNKGK
FT                   K"
FT   gene            <276731..>276804
FT                   /locus_tag="ZYRO0A03432r"
FT                   /old_locus_tag="Zyro0A.tVal.TAC.5"
FT   tRNA            276731..276804
FT                   /locus_tag="ZYRO0A03432r"
FT                   /old_locus_tag="Zyro0A.tVal.TAC.5"
FT                   /note="tRNA-Val (TAC) cove score=72.06"
FT   gene            <277117..>277560
FT                   /locus_tag="ZYRO0A03454g"
FT                   /old_locus_tag="ZYRO-ORF9378"
FT   CDS_pept        277117..277560
FT                   /locus_tag="ZYRO0A03454g"
FT                   /old_locus_tag="ZYRO-ORF9378"
FT                   /product="ZYRO0A03454p"
FT                   /note="similar to uniprot|Q03939 Saccharomyces cerevisiae
FT                   YDR022C CIS1 Protein involved in microtubule assembly"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25587"
FT                   /db_xref="GOA:C5DPH6"
FT                   /db_xref="InterPro:IPR018621"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPH6"
FT                   /protein_id="CAR25587.1"
FT                   /translation="MHPLTITVYDRNVRHMLSDDNQSSSHHTPDGNSHAMFPTNIKYVF
FT                   EDDDTSLAPTESENDDGIENMIIVNLEESGTLSGVELISDQFEMLSYKGVTSGNDPMVD
FT                   DVELEVVSQFTDLSNLVHDLPLDELIRLYVIQNEQMQTISNSM"
FT   gene            complement(<277585..>278784)
FT                   /locus_tag="ZYRO0A03476g"
FT                   /old_locus_tag="ZYRO-ORF9377"
FT   CDS_pept        complement(277585..278784)
FT                   /locus_tag="ZYRO0A03476g"
FT                   /old_locus_tag="ZYRO-ORF9377"
FT                   /product="ZYRO0A03476p"
FT                   /note="highly similar to uniprot|Q12099 Saccharomyces
FT                   cerevisiae YDR021W FAL1 Nucleolar protein required for
FT                   maturation of 18S rRNA member of the eIF4A subfamily of
FT                   DEAD-box ATP-dependent RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25588"
FT                   /db_xref="GOA:C5DPH7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPH7"
FT                   /protein_id="CAR25588.1"
FT                   /translation="MSFNREDDSRLKFKTSKKLRVSPTFEAMNLKDDLLRGIYSYGFEA
FT                   PSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQVLELKRKDLQALVLSPTRELA
FT                   SQSCQVVSNLGDYLNVKAFALTGGKALKDDLKRIQSSGCHVVSGTPGRVLDLIKRQVVQ
FT                   TRNVQVLVLDEADELLSETLGFKQQIYDIFARLPPGCQVVVVSATMSRDILEVTKKFMS
FT                   DPVKILVKRDEISLEGISQYYVDVSKEEWKFDTLCDLYDSLTITQCVIFCNTRKKVDWL
FT                   SKKLIQSNFAVVSMHGDMKQEDRDKVMNDFRTGHSRVLISTDVWARGIDVQQISLVINY
FT                   DMPEIMENYIHRIGRSGRFGRKGVAVNFITREDSSKLKATEKMYGIKIKPMPANLSELS
FT                   "
FT   gene            <278958..>279647
FT                   /locus_tag="ZYRO0A03498g"
FT                   /old_locus_tag="ZYRO-ORF9376"
FT   CDS_pept        278958..279647
FT                   /locus_tag="ZYRO0A03498g"
FT                   /old_locus_tag="ZYRO-ORF9376"
FT                   /product="ZYRO0A03498p"
FT                   /note="similar to uniprot|Q12084 Saccharomyces cerevisiae
FT                   YDR020C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25589"
FT                   /db_xref="GOA:C5DPH8"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPH8"
FT                   /protein_id="CAR25589.1"
FT                   /translation="MSPSIQQIVVSIGGGHATGVVETGEEIERSLKNLFPSTNVKIINL
FT                   DKLDPNKPRQYNYKDYDFDQVYNEICGAGQKRSSIVGNVEPHMQDPVEIVLLCGCYALY
FT                   DNRINEIVQLKIFLDSDGDKRLINLIHQNHITTREQLAELLAEYLDHLRLEMQKYIKPT
FT                   RAQADLIIPSNFDTTARDIIVDGICKVVEAIKGNQSPPAISKISPLLLDFEAEAMDVEK
FT                   ERYYDLS"
FT   gene            <280162..>281871
FT                   /locus_tag="ZYRO0A03520g"
FT                   /old_locus_tag="ZYRO-ORF9375"
FT   CDS_pept        280162..281871
FT                   /locus_tag="ZYRO0A03520g"
FT                   /old_locus_tag="ZYRO-ORF9375"
FT                   /product="ZYRO0A03520p"
FT                   /note="similar to uniprot|P38228 Saccharomyces cerevisiae
FT                   YBR044C TCM62 mitochondrial protein (putative) chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25590"
FT                   /db_xref="GOA:C5DPH9"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPH9"
FT                   /protein_id="CAR25590.1"
FT                   /translation="MFRRSIHKSVCQSIRTVKTLHTPIYETGQLSTKQSLMQGIKLLDN
FT                   VVNSTTYNKTLLQLSKYNTNPKFITSRDSIRLQNVVRELLDGLRMDEVMTGRERQDHQS
FT                   RLAKIGLQLFCEIHESNILPISTSLTLTLMAEYAKSPNVTTLRAMLDGLEKVRTFLTEN
FT                   IIHISSTVDIDALVDKLTILREDSETVKQVLKALDYKLYSDDLVRIVKGRKTTDEIDVS
FT                   KGWKFPAGILDTNEAYLRSIELPQKKLVSVDDEMLVLIYDGTLRDANAVLPTLHHASKS
FT                   KKSLLLMVTGDCTGDALASIVISNNRNRRQGIKSQTFIIKYDTKANDGISLHENYDLVQ
FT                   FLRLPQGFASVYSPDYSTLVPSKMCANQYYGKLDSLKATTGEAFLYNPIEWSGEEQENP
FT                   FTKMTVTVNVGAQSEIEIDHRRNFLDNLINNTLCHGLSKGFIPGYNVALAKAVPLLEKL
FT                   AFTAQDVDTKMGYEAVIMALAQSLQRSLTNAFGYNKFTSTSLLAETIKDPNFSTAAIEP
FT                   MGDLQELSRSGILDPWDKVDRCLASIASFMRILSSSDKIVAQVFEPPKKRQP"
FT   gene            <282056..>283297
FT                   /locus_tag="ZYRO0A03542g"
FT                   /old_locus_tag="ZYRO-ORF9374"
FT   CDS_pept        282056..283297
FT                   /locus_tag="ZYRO0A03542g"
FT                   /old_locus_tag="ZYRO-ORF9374"
FT                   /product="ZYRO0A03542p"
FT                   /note="similar to YDR019C, uniprot|P48015 Saccharomyces
FT                   cerevisiae YDR019C (GCV1),"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25591"
FT                   /db_xref="GOA:C5DPI0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPI0"
FT                   /protein_id="CAR25591.1"
FT                   /translation="MRWHHNIDCSIKRPSPPKDTAAMIRSVRFNSTQAGLKKTALHDLH
FT                   VELGGNMVPFAGYSMPVAYKGQSHIESHRWTRTHAGLFDVSHMLQSTLQGKDAVNFLHK
FT                   VTPTDFQQLHPGVGTLSVLLNPNGGIVDDTLITKQSAHDFYMVTNAACAERDSQFLVDE
FT                   LKSVADAKWTPITDRSLLALQGPDAHRVLQHVLAWDQSLADLYFGQRRSYKLFNGAYID
FT                   VARSGYTGEDGFEVSIPNEDALQFAQSLLDNEMTKPIGLAARDSLRLEAGLCLYGHELD
FT                   ESITPVEAALSWVISKSRRNITEGVKFNGYDKIIDQINNKTHKSLRVGYRYQTKGPAAR
FT                   TGSKIFLPDGKTEVGHVTSGSASPSLDNINIGQGYVLKPHNKRGTNLLVQVRNKLLPIE
FT                   LVKMPFVPSNYYRG"
FT   gene            <283783..>285837
FT                   /locus_tag="ZYRO0A03564g"
FT                   /old_locus_tag="ZYRO-ORF9372"
FT   CDS_pept        283783..285837
FT                   /locus_tag="ZYRO0A03564g"
FT                   /old_locus_tag="ZYRO-ORF9372"
FT                   /product="ZYRO0A03564p"
FT                   /note="similar to YBR043C, uniprot|P38227 Saccharomyces
FT                   cerevisiae YBR043C (QDR3)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25592"
FT                   /db_xref="GOA:C5DPI1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPI1"
FT                   /protein_id="CAR25592.1"
FT                   /translation="MVDPTNTTAKDGGSVYSYNSYSDSDLSPGKKDEEGGFQDPQAYRG
FT                   PHGEPTASDGAESTGEGFHEGDVKAESEQDENKKVGVWKKLKDRSYWTPRKERRGILPH
FT                   LSLIPEFKDARDYPPHIKKFIVFVIAFSSMMGPMATSIVYPAIDPIKEDYKTTSIMVNV
FT                   SVGVYQISLGVFPLWWSSISEMNGRRTVYVLSFLLLLAFNVGTGLSPNINDFIILRVLS
FT                   GGAAASVQSVGAGTVADLYVPEERGTNIGIYYMGPLMAPLVSPIIGAALVSGFPWKSTQ
FT                   WFMVILSGVNVILLVLFLPETLRKQDSGAAITAILQARRKGSPGVNANQTEDKSGYQTQ
FT                   YNEDTHSISDPSIATHEHGNDADLERVLSRTSNSMTRFNSNNDLDPIAPQLSKIHSYDP
FT                   RQEQMLREYEAKRVENNLEEELSRMETAKSNHTARSDGDKIEQTRFQKYRHLAYLYLIR
FT                   PLKSLYFLEYPPVLLAITFSAISFAVLYFVNMTLEYGYSRPPYNFSPMLIGLMYIPNSV
FT                   TYLLASVFGGMWTDNLLLKYKAKHGEMVPEARISWNIVTAVIAFPISLLIFGWCLDKGE
FT                   HWETPLVGTALFGYANMMTIGATVSYLVDSLPGKGATGVALNNLVRQVLAAAAVFVTDP
FT                   MLDNMTIGWSFTMLAFIIIGATSVLVVLKKYGDHWRENFDLERLYNKLE"
FT   gene            <286088..>287290
FT                   /locus_tag="ZYRO0A03586g"
FT                   /old_locus_tag="ZYRO-ORF9370"
FT   CDS_pept        286088..287290
FT                   /locus_tag="ZYRO0A03586g"
FT                   /old_locus_tag="ZYRO-ORF9370"
FT                   /product="ZYRO0A03586p"
FT                   /note="similar to uniprot|P38226 Saccharomyces cerevisiae
FT                   YBR042C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25593"
FT                   /db_xref="GOA:C5DPI2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR032098"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPI2"
FT                   /protein_id="CAR25593.1"
FT                   /translation="MSLSSGLNNGLRKCKIMVRVIIALVIFVQASLCITSMQVIVRVVY
FT                   HNNVAKRHHGIDFTKKAFISMLISTLHLIAPSAVRVTTDNNSIPKGTFYKDLKNGRIAS
FT                   HLKRKSVIVANHQIYTDWVFLWWLTSTADLAGKVYIILKKSLEYIPILGFGMRNYKFIF
FT                   MCRKWEQDRLTLHNSLGVIDANSRGVGPISGRSPVREDADGEIFWDTTSTNARQESWPY
FT                   CLILFPEGTNLSPITRQRSFNYANKIGKTPFENVLLPHATGARHSLLKLRPSLDVVYDI
FT                   TIGYSGVKKGEYGEALYTLNNVVFKGESPKLVDMHIKAYHINEIPIDDEQQFSDWLYDL
FT                   WAEKDRLMNVYYEKGTFDLDPDPDHTITGEFKISAYPFFSCVVFINSLVCLPFLIWYLL
FT                   R"
FT   gene            complement(<287401..>289416)
FT                   /locus_tag="ZYRO0A03608g"
FT                   /old_locus_tag="ZYRO-ORF9368"
FT   CDS_pept        complement(287401..289416)
FT                   /locus_tag="ZYRO0A03608g"
FT                   /old_locus_tag="ZYRO-ORF9368"
FT                   /product="ZYRO0A03608p"
FT                   /note="similar to uniprot|P38225 Saccharomyces cerevisiae
FT                   YBR041W FAT1 Fatty acid transporter and very long-chain
FT                   fatty acyl-CoA synthetase may form a complex with Faa1p or
FT                   Faa4p that imports and activates exogenous fatty acids"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25594"
FT                   /db_xref="GOA:C5DPI3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030310"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPI3"
FT                   /protein_id="CAR25594.1"
FT                   /translation="MGTKNPVGHVLLNAWLIVFSIVKTALVPVFAILSLCLKGPIEYLD
FT                   RKHRVKEDFYIITFFIKSVAQYFLAVRNHRFQYWYLFSKQVEQNADRLAISYPRPLSKK
FT                   GEFEVESFTYRETYDIVLRLSHILSEQYGVRSGDNIAIDSTNKPLFLFLLLASWNIGAI
FT                   PALLNYNTLGNPLVHSLRISGITQVFVDPQASGPIKSSEKEIKEELPNVRLNYLDETEL
FT                   LKTLKDPETPKFLQEDDLRSPQGLTDYKPAMFIYTSGTTGLPKSAIMSWRKATVGCTLF
FT                   AHIEHMDNNSVVFTAMPLFHSTATLLGVCSVWSKGGCVAISNKFSASNFWKEAYLTKAT
FT                   HCQYVGEICRYLLNTPVSKYENMHSVKVAYGNGLRPDIWQKFRHRFHIEVIGEFYAATE
FT                   APLATTSYQKGEFGVGACRNYGTGIQWFLSLQQTLVRMDPDDDATIYRNSKGLCEKPAV
FT                   GESGEMLMRIFYPKKPETSFQGYVGNKKETESKVLRNVFREGDAWFRTGDLLKSDEYGL
FT                   WYFVDRMGDTFRWKSENVSTTEVEDQIMGSNHDDFAQVVVVGIKVPGYEGRAGFATIKL
FT                   KNPETPESGRIAVLNRMLTHLNRELPKYAHPVFVKLVDHIEMTDTNKISKKIYRNQVLP
FT                   HGANGDETVYWLKDYKEYKQLTDEDWSAIKSQKAKL"
FT   gene            complement(<289607..>290521)
FT                   /locus_tag="ZYRO0A03630g"
FT                   /old_locus_tag="ZYRO-ORF9366"
FT   CDS_pept        complement(289607..290521)
FT                   /locus_tag="ZYRO0A03630g"
FT                   /old_locus_tag="ZYRO-ORF9366"
FT                   /product="ZYRO0A03630p"
FT                   /note="similar to uniprot|P38224 Saccharomyces cerevisiae
FT                   YBR040W FIG1 Integral membrane protein required for
FT                   efficient mating may participate in or regulate the low
FT                   affinity Ca2 influx system which affects intracellular
FT                   signaling and cell-cell fusion during mating"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25595"
FT                   /db_xref="GOA:C5DPI4"
FT                   /db_xref="InterPro:IPR016509"
FT                   /db_xref="InterPro:IPR033481"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPI4"
FT                   /protein_id="CAR25595.1"
FT                   /translation="MILYWKMAWFFLKRMPKVISLVLNLITIFLTVFLLMGCSNLSNDS
FT                   TFLVRYKFDRSSPFYNVIQKSFNQSNGTTQMSGLEQVSIASGYMGVCITNIPKDYDKGV
FT                   KSVCYPRKDLANNPLYNDLSIELFNVPSSDKKSTQKQLPINLNILELAETTSRYVVHPY
FT                   ILMVTVILATLMFLMLIYSTIPALPFKYWVLRATLCVSAFLVLFWGIGAMWTHVGIHAC
FT                   SKLVPSASMGILKIHRGIKAAAMSWVSFAFLLAQLGILWFLYLRDRKNLSEEIDKINNT
FT                   NNNQPPFHNPGDLSDSSTLNYKV"
FT   gene            complement(<290829..>291734)
FT                   /locus_tag="ZYRO0A03652g"
FT                   /old_locus_tag="ZYRO-ORF9364"
FT   CDS_pept        complement(290829..291734)
FT                   /locus_tag="ZYRO0A03652g"
FT                   /old_locus_tag="ZYRO-ORF9364"
FT                   /product="ZYRO0A03652p"
FT                   /note="highly similar to uniprot|P38077 Saccharomyces
FT                   cerevisiae YBR039W ATP3 Gamma subunit of the F1 sector of
FT                   mitochondrial F1F0 ATP synthase which is a large
FT                   evolutionarily conserved enzyme complex required for ATP
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25596"
FT                   /db_xref="GOA:C5DPI5"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPI5"
FT                   /protein_id="CAR25596.1"
FT                   /translation="MLSRVGVNAVRCGAMVPRVPQARNYATLKEVETRLKSIKNIEKIT
FT                   KTMKIVASTRLSRAEKAKVTAKKFDEADSAFYNNAETKPIEDAETAAKDKELVVAVSSD
FT                   KGLCGSIHSALAKRVRQHLADSPNAAVAAVGDKMRTQLMRTHPDNVKIGINGIGKEAPT
FT                   FQLSSAIADTLLGLGAQNYPKITIFFNNPVSSLSFEPSTKDVFNPETIESSPSFSKFEI
FT                   DNDGQVSQDLFEYTLSNKILAALAEGYAAEISARRNAMDNASKNAGDMINRYSILYNRT
FT                   RQAVITNELVDIITGASSLD"
FT   gene            <292801..>295737
FT                   /locus_tag="ZYRO0A03674g"
FT                   /old_locus_tag="ZYRO-ORF9362"
FT   CDS_pept        292801..295737
FT                   /locus_tag="ZYRO0A03674g"
FT                   /old_locus_tag="ZYRO-ORF9362"
FT                   /product="ZYRO0A03674p"
FT                   /note="some similarities with uniprot|Q7LGR2 Saccharomyces
FT                   cerevisiae YDR017C KCS1 Inositol hexaphosphate kinase
FT                   phosphorylates inositol hexakisphosphate (InsP6) to
FT                   diphosphoinositol polyphosphates required for proper
FT                   vacuole morphology and involved in salt stress response
FT                   contains two leucine heptad repeats"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25597"
FT                   /db_xref="GOA:C5DPI6"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="InterPro:IPR038286"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPI6"
FT                   /protein_id="CAR25597.1"
FT                   /translation="MNIGDERTSGDCKFIKDEQEHRQEQEQEHEQEQEHEHDREGEQEE
FT                   DNEPVTSLKDLNISDKKKLSSNVIRGRKASTYLRIFRDDEGLTDNNIHRQIIKQQELNA
FT                   RQEPQPVPQKPQQEVVVHPQQDKKTKKPTSFYDTNYKFSIKPEGKSSRSQNPLASKPYA
FT                   VAKYLESAISEPNKQQQQQMQQTDLGLKPVSSATYYPHKSRGSTRSISDEEPGEGTAIP
FT                   VVPRFQYKGTSVAETEATTLASITHDHVAQSPDGRASGSISEAAVESDEDYYDDNEEDE
FT                   EEKDSVYPLAVELQPFTNNVGGHTAIFRFSKRAVCKALVNRENRWYENIEVNHKELLQF
FT                   MPRYIGVLNVRQHFHNKEDFLRELSSSQRHKQEHRAFPSSRCIKLYQQQRQQLENQDQQ
FT                   HQHQHYDQHQQQQQQQRGQYLPQFQQNNCSRSISCNSSSEMGGLPEVVLSDNRHMVPDS
FT                   MLSMYPSNLCNSSGTGSFLQSTGGSSGKESSGSTTVNTKLKELVLQEVFALSPGEHDII
FT                   EGHLKKVRRPSSIKKSRSSSQDSSSQSTSRRGSNYSLKNVPNQGSGSPLLKKSIRETIS
FT                   HSLNSPSSMMDLRQFQKKELVREKSQLRRASLSSSKDENNPTISPLSLPRDHPLVEEFA
FT                   VENEDDTNFSLDGKENHTNTISTTNSDITNNTSSAGSTSNTSHLAKPSQGKHNESITFE
FT                   EHSDTVVSKFILLEDLTRKLNKPCALDLKMGTRQYGVDAKPSKQHSQRKKCLKTTSKKL
FT                   GVRICGLKIWNQTYYITRDKYFGRRVQAGWQFTRVLARFIYDGLHISSVVRQIPRLTKQ
FT                   LDTLGSEIAHLKGYRLYGSSLLLMFDGNDSGNKRCRVKVNLIDFARCVTKEDLKESYDL
FT                   FRIPPKNPDVEDRGFLRGVRSLKFYLMLIWNYLTNDAPLCNDDEELQTFLQENVEKFDK
FT                   PWDWLDEFDEEDEEEFNSPTSPLRKKWRKYELIFNTEPRFTNDGEMSD"
FT   gene            <296208..>296495
FT                   /locus_tag="ZYRO0A03696g"
FT                   /old_locus_tag="ZYRO-ORF9360"
FT   CDS_pept        296208..296495
FT                   /locus_tag="ZYRO0A03696g"
FT                   /old_locus_tag="ZYRO-ORF9360"
FT                   /product="ZYRO0A03696p"
FT                   /note="similar to gnl|GLV|CAGL0D04394g Candida glabrata
FT                   CAGL0D04394g and some similarities with uniprot|Q12248
FT                   Saccharomyces cerevisiae YDR016C DAD1 Essential protein
FT                   component of the DASH complex involved in spindle integrity
FT                   and kinetochore function interacts with Duo1p and Dam1p
FT                   localizes to intranuclear spindles and kinetochore"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25598"
FT                   /db_xref="GOA:C5DPI7"
FT                   /db_xref="InterPro:IPR013958"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPI7"
FT                   /protein_id="CAR25598.1"
FT                   /translation="MNNDTSARDKEENVPVPTLSAADKYFIEQRDLVLQDINNTMDSIL
FT                   NNLNSLNISLENSIAVGKEFESVAELWKTFYNGLEGTETVSSSQDDELEK"
FT   gene            complement(<296496..>297086)
FT                   /locus_tag="ZYRO0A03718g"
FT                   /old_locus_tag="ZYRO-ORF9359"
FT   CDS_pept        complement(296496..297086)
FT                   /locus_tag="ZYRO0A03718g"
FT                   /old_locus_tag="ZYRO-ORF9359"
FT                   /product="ZYRO0A03718p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25599"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPI8"
FT                   /protein_id="CAR25599.1"
FT                   /translation="MRRSVTTYQPAAHTAGLKRASTTSAVSPLSHVEERLGGLELVEAK
FT                   SDVEEASYEPAQYFSNREDEEFAGIKYTALPGSSGTEQEEANNSSSQNTEVQANCESSF
FT                   HSNNSTLGDPPSSSSEYEGDLEDGSYTDTLSTSVNDSLPPENVHKPLKDLIFKANKEAY
FT                   DVDSNKVRIKVGLSKKVPSLHPRRKINGASSLQ"
FT   gene            <298141..>298905
FT                   /locus_tag="ZYRO0A03740g"
FT   CDS_pept        298141..298905
FT                   /locus_tag="ZYRO0A03740g"
FT                   /product="ZYRO0A03740p"
FT                   /note="highly similar to uniprot|P38075 Saccharomyces
FT                   cerevisiae YBR035C PDX3 Pyridoxine (pyridoxamine) phosphate
FT                   oxidase has homologs in E. coli and Myxococcus xanthus
FT                   transcription is under the general control of nitrogen
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25600"
FT                   /db_xref="GOA:C5DPI9"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPI9"
FT                   /protein_id="CAR25600.1"
FT                   /translation="MSIGLLRQFVSRISCSLPKYRPFIKTMADDIERTQTPIIFAPETY
FT                   QYDKSSLNESQLVKDPIEQFTRWFEEAKSDKSETLPEAITFSSAELPSGRVSSRVLLFK
FT                   ELDHRGFVIYSNWGTSKKARDIQSNPHGAINFFWKDLQRQVRVEGFTEHVNRETSERYF
FT                   KVRPRGSKIGAWSSPQSSTIKSRDELDQLTAANTKKFEGQEEIPCPDYWGGVRVVPLEI
FT                   EFWQGRPSRLHDRFTYRRKSEHEEWEIIRLAP"
FT   gene            complement(<298936..>300639)
FT                   /locus_tag="ZYRO0A03762g"
FT                   /old_locus_tag="ZYRO-ORF9354"
FT   CDS_pept        complement(298936..300639)
FT                   /locus_tag="ZYRO0A03762g"
FT                   /old_locus_tag="ZYRO-ORF9354"
FT                   /product="ZYRO0A03762p"
FT                   /note="weakly similar to uniprot|Q99359 Saccharomyces
FT                   cerevisiae YDR014W RAD61 Protein of unknown function
FT                   mutation confers radiation sensitivity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25601"
FT                   /db_xref="InterPro:IPR031550"
FT                   /db_xref="InterPro:IPR038496"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPJ0"
FT                   /protein_id="CAR25601.1"
FT                   /translation="MKVYGKRSGSLGIYASQNNSSEVELSDYESEPEPILESNERETVI
FT                   DNSTDDIRPMTSDSKMNPSVDSSLVSSVGSNVSNLKAFDFLDKAQAPKKRRRIYHEDHS
FT                   DDTQDKKDTNVDENPLNRTINDLNTFVSSLKSSDETLLQDTFKKELEKSVEDGTSKNTS
FT                   GKLTYDRSRTMLMSKDEEEGLEAEDEEPKPTEDGDTKDGDDSQTYHINELKNMGDMLQY
FT                   QDDLELLLEGTPSRMSRSQFVSHLLNIALAMNGDQEFCRYVNKRQARDMWRRTFHQMDF
FT                   HDDVLLLIQGFLATKFQLPPNELPKFFNEFIQALYKRNRLPINGLSGNKIAQLNYNDFL
FT                   HNTQDRTGQEYVLELCVQYPGVILSCAPLVNRIVQTLVASEALPRGIFPVVEKLASSGN
FT                   TAEDANLLSVVSNKLIDLLPNNCQDDHLIKSLILFTNEETLERNSEVFHTCMKFVLDHL
FT                   PPLGSTDILILHLGLCLNVISGESGISHLENALWLQAQTFFHKLESNDDDSFLLNMFYL
FT                   NFAYMTVLLNKRLPTKVKTGLISHLELFAQESQHYNGSISDKIKYVTDKL"
FT   gene            <300789..>301415
FT                   /locus_tag="ZYRO0A03784g"
FT                   /old_locus_tag="ZYRO-ORF9353"
FT   CDS_pept        300789..301415
FT                   /locus_tag="ZYRO0A03784g"
FT                   /old_locus_tag="ZYRO-ORF9353"
FT                   /product="ZYRO0A03784p"
FT                   /note="highly similar to uniprot|Q12488 Saccharomyces
FT                   cerevisiae YDR013W PSF1 Subunit of the GINS complex (Sld5p
FT                   Psf1p Psf2p Psf3p) which binds to DNA replication origins
FT                   and facilitates assembly of the DNA replication machinery"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03784g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25602"
FT                   /db_xref="GOA:C5DPJ1"
FT                   /db_xref="InterPro:IPR005339"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPJ1"
FT                   /protein_id="CAR25602.1"
FT                   /translation="MYGDLANKLVLEAKRTKQLNGRNNQRYALPMYHEELVQGILREVT
FT                   QLKRNSEFLKDQQQLALVDDKISKCQYFVTLLCMERNKRCLLAYQKVRSDILNSLAWEN
FT                   NGLDIMNGLIGAEQDTSDLSHQEQDYLKEYTDLLTELKSGDLADIDLSGSLTPPSDVFI
FT                   DVRVLKDAGEIQTEYGAFNLIKDSQFFVRQSDVERLIQQGYLQKI"
FT   gene            <301709..>302737
FT                   /locus_tag="ZYRO0A03806g"
FT                   /old_locus_tag="ZYRO-ORF9352"
FT   CDS_pept        301709..302737
FT                   /locus_tag="ZYRO0A03806g"
FT                   /old_locus_tag="ZYRO-ORF9352"
FT                   /product="ZYRO0A03806p"
FT                   /note="highly similar to uniprot|P38074 Saccharomyces
FT                   cerevisiae YBR034C HMT1 Nuclear SAM-dependent mono- and
FT                   asymmetric arginine dimethylating methyltransferase that
FT                   modifies hnRNPs including Npl3p and Hrp1p thus facilitating
FT                   nuclear export of these proteins required for viability of
FT                   npl3 mutants"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25603"
FT                   /db_xref="GOA:C5DPJ2"
FT                   /db_xref="InterPro:IPR025799"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPJ2"
FT                   /protein_id="CAR25603.1"
FT                   /translation="MESATQKSALTQSEQHYFNSYDHYGIHEEMLQDSVRTLSYRNAIA
FT                   QNKDLFKDKVVLDVGCGTGILSMFAAKYGAKHVIGVDMSSIIEMAQQLVDLNGYGDKIT
FT                   LLRGKLEDVQLPFPKVDIIVSEWMGYFLLYESMLDTVLYARDHFLVEGGLILPDKCSLH
FT                   IAGLEDFQYKDEKLSYWQDVYGFDFSPFIPHVMKEPIVDTVESQVVNTTKCELIEFDLN
FT                   TVQLSDLSFTAKFEVQAKRRDWINGIITWFDVKFPAPPGEKPVTFSTGAHAPYTHWKQS
FT                   VFYTADDLECEEGDILKGQIICQPNKFHKRDLDIKLTYDFQAKGVDGDRRCKKNTNYYI
FT                   MH"
FT   gene            complement(<302873..>303961)
FT                   /locus_tag="ZYRO0A03828g"
FT                   /old_locus_tag="ZYRO-ORF9350"
FT   CDS_pept        complement(302873..303961)
FT                   /locus_tag="ZYRO0A03828g"
FT                   /old_locus_tag="ZYRO-ORF9350"
FT                   /product="ZYRO0A03828p"
FT                   /note="highly similar to uniprot|P49626 Saccharomyces
FT                   cerevisiae YDR012W RPL4B Protein component of the large
FT                   (60S) ribosomal subunit, nearly identical to Rpl4A"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25604"
FT                   /db_xref="GOA:C5DPJ3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="InterPro:IPR025755"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPJ3"
FT                   /protein_id="CAR25604.1"
FT                   /translation="MARPQVSVQSLEGKATSSAVPLPAVFAAPIRADIVHSVFTSVNKN
FT                   KRQAYSVSPQAGMQHSAESWGTGRAVARIPRVAGGGTHAAGQGAFGNMCRGGRMFAPTK
FT                   TWRRWNVKVNQNEKRYATASAIAASGVASLVLARGHRVEKIPEIPLVVSNDLESITRTK
FT                   EAVSALKSLGAGADLVKVVRSKKLRAGKGKYRNRRWTQRRGPLVVYAQDNGLVKAFRNV
FT                   PGVETCDVTALNLLQLAPGAHLGRFVIWTEGAFSKLDKVWGSEAVASAKSGYSLPSNII
FT                   STTDVTRIINSSEIQSVVRPAGQANQKRTHVLKKNPLRNKQILMRLNPYAKVFANEKLG
FT                   SKKAPKASVKPSQLFNETLKHD"
FT   gene            complement(<304218..>305774)
FT                   /locus_tag="ZYRO0A03850g"
FT                   /old_locus_tag="ZYRO-ORF9348"
FT   CDS_pept        complement(304218..305774)
FT                   /locus_tag="ZYRO0A03850g"
FT                   /old_locus_tag="ZYRO-ORF9348"
FT                   /product="ZYRO0A03850p"
FT                   /note="similar to uniprot|P38222 Saccharomyces cerevisiae
FT                   YBR030W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25605"
FT                   /db_xref="GOA:C5DPJ4"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPJ4"
FT                   /protein_id="CAR25605.1"
FT                   /translation="MASTISEDLPGVLGFVEDCKGFFPGSKCLVKRSPVGGLGVFAQCD
FT                   LNEGETLLQLPKSAVFSASNSSISNLLVDSELDGMLALTIAFVYETTVFQERSHWWPYL
FT                   KSVKIEEAGSLYLPPNYWPDRDMLKGFTLDTLYQGLDPEPDIQQGFQIALELAHRWNKE
FT                   VGIPIPWKYLDNLEKFVACAYAISSRVFEIDNYHESGLVPIADLFNHHVSTPDVRFVSL
FT                   YDVCSECGEPGMCRHLVAEALEEEQEQEQEREKKPPSKSGDGLIDMQLIKELESQEEEE
FT                   VTNPKEKGLVEGVQPDDCVDIVLTQSVPKGQEIFNSYGDYSNALLLARYGFCVENNPWD
FT                   VAYLGRDLLKLLKDKRLALRARWWKHLGYPLYNKWCALNKEQDEQEEEDKEEEEEDHDE
FT                   EEEDDENDEEDDEPYWLTVMCIDCNGEPSSPMRALLNLLAFNDRDWNKLRSIEQDVEST
FT                   GDKIGLLDKPLSKGARKILLNLVHKRKRPVPQINNAAARIMLESERKILEKAEHYLNSN
FT                   L"
FT   gene            <306295..>307626
FT                   /locus_tag="ZYRO0A03872g"
FT                   /old_locus_tag="ZYRO-ORF9345"
FT   CDS_pept        306295..307626
FT                   /locus_tag="ZYRO0A03872g"
FT                   /old_locus_tag="ZYRO-ORF9345"
FT                   /product="ZYRO0A03872p"
FT                   /note="similar to uniprot|P38221 Saccharomyces cerevisiae
FT                   YBR029C CDS1 Phosphatidate cytidylyltransferase (CDP-
FT                   diglyceride synthetase) an enzyme that catalyzes that
FT                   conversion of CTP phosphate into diphosphate CDP-
FT                   diaclglyerol a critical step in the synthesis of all major
FT                   yeast phospholipids"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25606"
FT                   /db_xref="GOA:C5DPJ5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="InterPro:IPR016720"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPJ5"
FT                   /protein_id="CAR25606.1"
FT                   /translation="MSKKELKRPQSVDKKVNDTAETEPSPTKMPPSQNGVKDGDEKEKK
FT                   KYNFLVRTLWTFVMIAGFFATLAAGHFWCIILILVCQITTFKECIAVTSASGRKRNLPL
FT                   IKTLNWYFLFTTIYYLEGKSLFRFFQSYFLEYKFLATVAANHKFICYCLYLQGFVMFVC
FT                   SLRKGFLKWQFASLCVTHMTLLLVVFQAHLIIKNVINGLFWFLVPCGLVIINDISAYLC
FT                   GITFGKTKLIEISPKKTLEGFLGAWFFTAVASLLLTRLLSPYMYLTCPVKDIRTNFFTS
FT                   VNCELNPVFIPQDYRLPPIIFEKFGISVVTLKPIYFHALNLASFASIFAPFGGFFASGL
FT                   KRTFQVKDFGHSIPGHGGITDRVDCQFLMGSFSNLYYETFISEHRITVETILSTILMNL
FT                   SEKQILELINTLNLIFFRKNLVSANNYDDLINIYKSAADAISEN"
FT   gene            <307915..>309273
FT                   /locus_tag="ZYRO0A03894g"
FT                   /old_locus_tag="ZYRO-ORF9344"
FT   CDS_pept        307915..309273
FT                   /locus_tag="ZYRO0A03894g"
FT                   /old_locus_tag="ZYRO-ORF9344"
FT                   /product="ZYRO0A03894p"
FT                   /note="similar to uniprot|P38070 Saccharomyces cerevisiae
FT                   YBR028C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25607"
FT                   /db_xref="GOA:C5DPJ6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPJ6"
FT                   /protein_id="CAR25607.1"
FT                   /translation="MVFTLDEDIEELCISDDDCEEAPQQLLQPMGAEHVGKHRRKSSVL
FT                   EKFPVVAPLHSRRLSLSVGEGQGQGVDPRLLADFKPVRVLGKGAYGKVVLVKDERTSKL
FT                   YAMKQLQKAEIIIENDESQDVSKRVERIFAERTILSQLDHPNVVKLFYTFHDNSRLYLL
FT                   LQYIPGGELFYHLKERGTLDEDTAAFYAAEISCALKFLHEKGIVYRDLKPENCLLDADG
FT                   HLVLTDFGLSKKSVDDNNSLSAPEDVSVLHSIIGTPEYCAPEILKGEPYTRNCDWYSLG
FT                   CLVYDMLVGKPPYTGVNHKVILNKIQKEKQGPRLPYYLSDGMKDWLGALLKKDCNKRWD
FT                   VDRYWAAQPQAQQAQQQRRRKKKAGQERTSPYTSHFVFRKINWAKIQDGPLQKSEQGPI
FT                   VPIITDLELAENFDEEFTSLPFEENPQGRDIPKSDIFKGFSYKASGSYLEKYF"
FT   gene            <309456..>310571
FT                   /locus_tag="ZYRO0A03916g"
FT                   /old_locus_tag="ZYRO-ORF9342"
FT   CDS_pept        309456..310571
FT                   /locus_tag="ZYRO0A03916g"
FT                   /old_locus_tag="ZYRO-ORF9342"
FT                   /product="ZYRO0A03916p"
FT                   /note="similar to uniprot|P38071 Saccharomyces cerevisiae
FT                   YBR026C ETR1 2-enoyl thioester reductase member of the
FT                   medium chain dehydrogenase/reductase family localized to in
FT                   mitochondria where it has a probable role in fatty acid
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25608"
FT                   /db_xref="GOA:C5DPJ7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPJ7"
FT                   /protein_id="CAR25608.1"
FT                   /translation="MQAFKRFASSVPSQFRSVIYSSHSLEDVTSVLSVHRYTPKESLEN
FT                   SVVVRTLAFPINPSDVNQLQGVYPSKPEKTLDYGTKDPAAIAGNEGVFEVLSVPSNENS
FT                   LKAGDWVIPLYANQGTWSDHRVFKNASDLIKVNGLDLHTAATIGVNGVTAYQLVHDYIK
FT                   WTPGGNEWLIQNAGTSGVSKIVTQVAKAAGINTLSVIRDRDNFDQVAKKLENQLGATKV
FT                   ISESQNNDKLFGKQVLPTILGSNARVRLALNSVGGKSSAAIARKLEKDALMLTYGGMSK
FT                   QPVTLPTSLHIFKGLTSKGFWVTENCRREPNKKLDAVNALVKLYKEGKLISPKDEIVTT
FT                   DVNANGSDQDLLEAVKKGISASGKQLVVFKW"
FT   gene            complement(<310593..>311747)
FT                   /locus_tag="ZYRO0A03938g"
FT                   /old_locus_tag="ZYRO-ORF9341"
FT   CDS_pept        complement(310593..311747)
FT                   /locus_tag="ZYRO0A03938g"
FT                   /old_locus_tag="ZYRO-ORF9341"
FT                   /product="ZYRO0A03938p"
FT                   /note="similar to gnl|GLV|CAGL0I04774g Candida glabrata
FT                   CAGL0I04774g and some similarites with YBR036C
FT                   uniprot|P35206 Saccharomyces cerevisiae YBR036C CSG2
FT                   Endoplasmic reticulum membrane protein required for
FT                   mannosylation of inositolphosphorylceramide and for growth
FT                   at high calcium concentrations"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25609"
FT                   /db_xref="GOA:C5DPJ8"
FT                   /db_xref="InterPro:IPR031581"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPJ8"
FT                   /protein_id="CAR25609.1"
FT                   /translation="MDTRIYWFVAVFSYIIQTKCLSLLQSSARDSERPGIDHQGVAIFL
FT                   LFMYFVPWLLLVPSARLVSIASSMTVSRPGTPELRARGERNGIMDGENNNNSNNGRSYD
FT                   SYDNGVKNNDIIGKVSYVVKLVILSLLLLVPVLTYMNALSLTPAFDVGLIQNTSIFEIT
FT                   SLLYGVCGLSRRKNVFRNFIVMMIALMGIVLVSYTKATCDLLAGKFSINQKTGELEDPF
FT                   LFDRLKSCLLCGLGALTLGPFTVLWNRWFNFSDRITLSHQCQHLTYIASICMAVLLPFL
FT                   PRALSTLAKVPTNKVFWLEALAAFLFGTLPHVFSLSLIQRQTPPSYSTTINLGAIIFMG
FT                   ISDWICEPTQTTIVRWEVIGYIMLSVACVVLSIAYYEKKHLSLH"
FT   gene            <312935..>314116
FT                   /locus_tag="ZYRO0A03960g"
FT                   /old_locus_tag="ZYRO-ORF9340"
FT   CDS_pept        312935..314116
FT                   /locus_tag="ZYRO0A03960g"
FT                   /old_locus_tag="ZYRO-ORF9340"
FT                   /product="ZYRO0A03960p"
FT                   /note="highly similar to uniprot|P38219 Saccharomyces
FT                   cerevisiae YBR025C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03960g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25610"
FT                   /db_xref="GOA:C5DPJ9"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPJ9"
FT                   /protein_id="CAR25610.1"
FT                   /translation="MPPKKKVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQSITRSPL
FT                   GNPANYPFATIEPEEARVIVPSPRFDNLCEIYKPASQVPAHLTVYDIAGLTKGASAGEG
FT                   LGNAFLSHIRAVDSIYQVVRCFDDAEIVHIEGDVDPIRDLQIINEELRLKDIEFAQKAL
FT                   ENAHKIARRGGQSLEVKQKKEETVLIERIIKLLEDGQRVANQEWTPKEVESINSMFLLT
FT                   AKPCIYLINLSEKDYIRKKNKHLLRIKEWVDKYSPGDMIIPFSVCMEEKLSTMSPEEQE
FT                   EELKKIGTQSALPKIITSMRQKLDLISFFTSGPDEVREWTIREGTKAPQAAGVIHNDLM
FT                   NTFILAQIMKYSDMVEYKDENAIKSAGKLLQKGKDYVVEDGDIIYFRSAAGKN"
FT   gene            complement(<314234..>315136)
FT                   /locus_tag="ZYRO0A03982g"
FT                   /old_locus_tag="ZYRO-ORF9337"
FT   CDS_pept        complement(314234..315136)
FT                   /locus_tag="ZYRO0A03982g"
FT                   /old_locus_tag="ZYRO-ORF9337"
FT                   /product="ZYRO0A03982p"
FT                   /note="similar to uniprot|P23833 Saccharomyces cerevisiae
FT                   YBR037C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25611"
FT                   /db_xref="GOA:C5DPK0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017276"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPK0"
FT                   /protein_id="CAR25611.1"
FT                   /translation="MSLLKSSSLVPRLLKLAPKQAGLIRPNYRCFSQFTKLYNERVPPS
FT                   QSPPLKKKPLSRIPIGGSETAPQTTSDGSIEFSTWKAASLFLIVGGGLYYYFTKEKRRL
FT                   EIEKEAEANRGYGKPMVGGPFHLKDCEGNVFSDKDLLGKFSIIYFGFTHCPDICPDELD
FT                   KLGVWLDKLKSKYGSKVQPIFVTCDPNRDTPEVLTQYLQDFHPDIIGLTGTYDQVKNAC
FT                   KQYRVYFSTPPQVQPGQDYLVDHSIFFYLMDPEGNFIEAMGRNYDNETGAERIQEHIKT
FT                   FIPKEEREKRKQKWYSFLF"
FT   gene            <316200..>319076
FT                   /locus_tag="ZYRO0A04004g"
FT                   /old_locus_tag="ZYRO-ORF9336"
FT   CDS_pept        316200..319076
FT                   /locus_tag="ZYRO0A04004g"
FT                   /old_locus_tag="ZYRO-ORF9336"
FT                   /product="ZYRO0A04004p"
FT                   /note="highly similar to uniprot|P14180 Saccharomyces
FT                   cerevisiae YBR038W CHS2 Chitin synthase II requires
FT                   activation from zymogenic form in order to catalyze the
FT                   transfer of N-acetylglucosamine (GlcNAc) to chitin required
FT                   for the synthesis of chitin in the primary septum during
FT                   cytokinesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25612"
FT                   /db_xref="GOA:C5DPK1"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPK1"
FT                   /protein_id="CAR25612.1"
FT                   /translation="MTRNPFMVEPSSGSPVRPLQPQLTRFHTNTSDRTDLYNYPSPTRG
FT                   GNDYYESEDDFDVSKKFQGLPPSPSRAAVRYSPDRRRRSQFYRDSTTSSPLVDRFTANM
FT                   QASPKKPSHTVVPVSEYDGTTEDFTSSYYSHENRQASHLSAPRNNLFGSQLGRQYSAST
FT                   TSTAAMSTATDEKLFRNSYESYDDDRSTITSSNFAETQFELNHPVRKDYVRRANSESKR
FT                   RPIVEDMGKAKAILKLDNPIPRGLLDTLPRRDSPEFTEMRYTACTVDADEYCQEGYSLR
FT                   FAEMNRECQMVICVTMYNEDKFALARTIHSIMRNVAHLCSRQRSQVWGPDGWKKISVIL
FT                   VSDGRTKVNQGALDYLAALGVYQEDMAKESVNGDAVKAHIFELTTQVSIDSNLDYVSKD
FT                   IVPVQMVFCLKEENKKKINSHRWLFSAFCPVLQPSVVTLIDVGTRLNDTAIYHLWKVFD
FT                   MDSNVAGAAGQIKTMKGKYGLKLFNPLVSSQNFEYKVSNILDKPLESVFGYIAVLPGAL
FT                   SSYRYRALENHEDGTGPLNSYFLGETQEGRDQDVFTANMYLAEDRILCWELVAKRNSKW
FT                   VLKYVKEAQGETDVPEEIPEFISQRRRWLNGAMFAALYSQLHFHQIWRTKHSFLRKLFL
FT                   HIEFFYQFVQMLFSWFAIANFVLTFYYLAGSMNNILKHGNALFIFFKYLIYCDLASLFI
FT                   ISMGNRPHGAKHLFILSMIILTICALYALICGFVFAIRTLKEKDNSNNVFVNVVVSLLS
FT                   TYGLYVISAFLYLDPWHIFTSSLQYFVTLPAFTCTLQIFSFCNTHDVSWGTKGSSSNNK
FT                   PLSKAIVMQGPDGKQIVETDWPQEVDKKFIEIKSRLKEVEFEEPVIDEAQKRNDYYRDI
FT                   RTRIVMAWMLSNLIFVMTITQIYSAEHTNNGYLVFILWSVAALAAFRALGSFGFLFMKY
FT                   LRMIVKYKHKAQSTGSWNVRKADVDNKS"
FT   gene            complement(<319151..>320569)
FT                   /locus_tag="ZYRO0A04026g"
FT                   /old_locus_tag="ZYRO-ORF9335"
FT   CDS_pept        complement(319151..320569)
FT                   /locus_tag="ZYRO0A04026g"
FT                   /old_locus_tag="ZYRO-ORF9335"
FT                   /product="ZYRO0A04026p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25613"
FT                   /db_xref="GOA:C5DPK2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPK2"
FT                   /protein_id="CAR25613.1"
FT                   /translation="MASLRSKFLLPCRALSLSMTSSTTTTTAARTTATLNIPAVAPLRI
FT                   NSGRLNDTILETGNQFGAALRWAPEPHGFGLRRLAGTEVDGKVRDWFVNECKALGCTIK
FT                   VDKIGNIFALYKGQDQTGKPPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKENGYV
FT                   PHYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLQEAYQMMSIGEDKPESVFDSLNKIG
FT                   YLGGTPASYKENAIDAHFELHIEQGPILENESKKIGIVTSVQGYQWSKCTVKGVGAHAG
FT                   TTPWNLRKDALLASAKIITRASEISQSHQALFTCGVIDVKPYSVNILPGEASFTLDVRH
FT                   PDDAVVQNVVKEIRKEIERVLNDNVAGPLSYDWEILQLSPAVKFNETCIECVSRSAYAQ
FT                   FKENEVRPISSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNFYEHSSPEEVENGFKVLLQ
FT                   AIVNYDNYRFSRGH"
FT   gene            <321351..>324878
FT                   /locus_tag="ZYRO0A04048g"
FT                   /old_locus_tag="ZYRO-ORF9332"
FT   CDS_pept        321351..324878
FT                   /locus_tag="ZYRO0A04048g"
FT                   /old_locus_tag="ZYRO-ORF9332"
FT                   /product="ZYRO0A04048p"
FT                   /note="similar to uniprot|P29465 Saccharomyces cerevisiae
FT                   YBR023C CHS3 Chitin synthase III catalyzes the transfer of
FT                   N-acetylglucosamine (GlcNAc) to chitin required for
FT                   synthesis of the majority of cell wall chitin the chitin
FT                   ring during bud emergence and spore wall chitosan"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25614"
FT                   /db_xref="GOA:C5DPK3"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPK3"
FT                   /protein_id="CAR25614.1"
FT                   /translation="MNNYGAEDEYYVNFNQDQESLLRSRLGSHRSGSTKRAGSLVRPER
FT                   NRFNNPDNPHYYYVQKAQEQKDHLDIQPSTTGVLPTPGLRRTAESSGSLNSSVNLPSSR
FT                   SRRNLSEVQEDFPMRDMSGKGTRDGNSNSGPNDLHNEDLMELEHEDYLSEENPVLKAPK
FT                   PAAPDLRNKKSKPLSPWMIYCYVVTFWAPAPLLSLFGMPKKERQMAWREKMGLLSVICY
FT                   VGVFVAYLTFGFTKTVCSSSKLRLRNNYVDPGYMIMNGKAFSLDSSSHPAAAGIDAGAN
FT                   VLYPPINGSGKDASFLFQNVNGNCHDLIKPRENCTIPHDDDNNLAWYFPCALFSQDGST
FT                   KPNFTKPRYYDGWACHTSKAARDAYYSLESSADVYFTWDDIRNSSRNLVVYNGHVLDLN
FT                   LLDWLERDQVTYPPMFDDMRHSNLQGYDLSIILATSHEKKVARCLTEIIKVGEVDSKTV
FT                   GCLASDVVLYSSLVFILSVVILKFLVSCYFSWVVARKQGAYAVDNKTMNRQLNNIEDWS
FT                   ENLYSQGPMKKVAPELRPGHRNNPSRQSKFDIFKKRGTRSFGVNEITNEMDNDDDYLFA
FT                   DGSYKGMTTMTTQNANKLQNGNQSSSGSGASKFHVRNQSAMFSSNSMMLGGPSAAPVPV
FT                   PSSIESLDTSIIHPDCVQQPPLNHMPFGYPLIHTMCFVTCYSEDEQGLRTTLDSLSTTD
FT                   YPNSHKLIMVVCDGLIKGSGNDQTTPEIVLGMMDNFVVPPEDVQPHSYVAVASGSKRHN
FT                   MAKIYAGFYKYNDETVPPENQQQVPMITVVKCGTPDEQGSAKPGNRGKRDSQIILMSFL
FT                   QKMTFDDRMTELEFQLLKNIWQITGLMADYYETVIMVDADTKVFPDCLTHMIAEMVKDP
FT                   LVMGLCGETKIANKAQSWVTMIQVFEYYISHHQAKAFESVFGSVTCLPGCFSIYRIKSP
FT                   KGPDGYWVPILANPDIVERYCDNVTDTLHKKNLLLLGEDRFLSSLMLRTFPKRKQIFVP
FT                   KAACKTVAPDEFKVLLSQRRRWINSTVHNLFELVLIRDLCGTFCFSMQFVIFIELIGTL
FT                   VLPLAICFTIYVVIFACVSKPTPIITLVLLAIILGLPALIVVVTATRWSYLGWMFIYLL
FT                   ALPIWNFVLPSYAYWKFDDFSWGDTRTIAGGNGKGGHDENEGEFDHSKIKMRTWREFER
FT                   EERIARAEK"
FT   gene            complement(<325007..>325552)
FT                   /locus_tag="ZYRO0A04070g"
FT   CDS_pept        complement(325007..325552)
FT                   /locus_tag="ZYRO0A04070g"
FT                   /product="ZYRO0A04070p"
FT                   /note="similar to uniprot|P38218 Saccharomyces cerevisiae
FT                   YBR022W POA1 Phosphatase that is highly specific for ADP-
FT                   ribose 1''-phosphate a tRNA splicing metabolite may have a
FT                   role in regulation of tRNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25615"
FT                   /db_xref="GOA:C5DPK4"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPK4"
FT                   /protein_id="CAR25615.1"
FT                   /translation="MSNITYTVGNILPVTGYPRILIHSCNCGGSWGGGIAYQLAARYPK
FT                   AEQVYVDACDKYGNELLGKCLFIPSYKDDDLIICCLFTSAFGGASHDYKRSILNYTEQG
FT                   LKNVRTWVYEGGNAIQDPIEKDINSVLHKLDKPLKDYKLEMPKINSGIFGVPWGETENV
FT                   LKEFGSGNQILNFTVYSL"
FT   gene            complement(<325870..>327897)
FT                   /locus_tag="ZYRO0A04092g"
FT                   /old_locus_tag="ZYRO-ORF9329"
FT   CDS_pept        complement(325870..327897)
FT                   /locus_tag="ZYRO0A04092g"
FT                   /old_locus_tag="ZYRO-ORF9329"
FT                   /product="ZYRO0A04092p"
FT                   /note="similar to uniprot|P05316 YBR021W Saccharomyces
FT                   cerevisiae FUR4 Uracil permease localized to the plasma
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25616"
FT                   /db_xref="GOA:C5DPK5"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPK5"
FT                   /protein_id="CAR25616.1"
FT                   /translation="MRLKFFGKRKQEANDYNEEDRQHGIQQVRSPPHDDLAIMFSRQSH
FT                   VPPVSSRQAEFENVNSSSDKNYVDGDGDGGSSSIDHKDKIAVKEDEAYEGTTGVVEDVW
FT                   EPEIEPQGKWQKFYYNWLVVDKSTIGIPFSRSFLNNSDLKPVESKRRIWGWHNFFYYWL
FT                   ADCFNINTWQVASSGMQIGLNWWQCWISIWIGYLCTGIFVVLASRFGAAYHVCFPVSVR
FT                   ASFGVYFSAWPIVNRIVMAIVWYAVQAWLGGTLVSLLLRSIFGNDLNTKIPNHFGSDNA
FT                   TTFEFMSFFIFWVVSIPFLLIPPHKLKYLFAVKAALVPFAAFGFLIWAVVKSHGHLAMG
FT                   NLSEYHPHGSAFSWVFIRSLINCLANFATLIVNAPDFARFSTTPNSSSLIQLVSIPFLF
FT                   SLTCLIGILVTAAGYKLYGINYWSPIDVLGKFLDSSYSSGTRAGVFLIVFVFIIAQLGT
FT                   NISANSLSCGTDMTSILPRFINIKRGSLFCAAIALCICPWNMMASSSKFTMALSAYAIF
FT                   LSSIAGVVCCDYFLVRRGYIKLMHLYSNQKGSFYMYGNRWGINWRALVAYFLSIAPNLP
FT                   GFIGTVGAPQVTVGVGALRIYYLNYWVGYVIAFLVYGVLCYIWPVPGTPVKNFLREKGW
FT                   YQYWADVEDFEHEWRLTMMKKDLLDDKVDLAEVDPEKIFY"
FT   gene            complement(<328582..>333138)
FT                   /locus_tag="ZYRO0A04114g"
FT                   /old_locus_tag="ZYRO-ORF9327"
FT   CDS_pept        complement(328582..333138)
FT                   /locus_tag="ZYRO0A04114g"
FT                   /old_locus_tag="ZYRO-ORF9327"
FT                   /product="ZYRO0A04114p"
FT                   /note="similar to uniprot|P32568 Saccharomyces cerevisiae
FT                   YDR011W SNQ2 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25617"
FT                   /db_xref="GOA:C5DPK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029481"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPK6"
FT                   /protein_id="CAR25617.1"
FT                   /translation="MKKGNVLETGSSSPIDSNSPISYDGGSLVGVGHTEGNTGANTSGF
FT                   SRGDIERGANDDVELHEMLAKYKSNGQGSTFTPELASKVESLARTLSKRKSADGKFDLS
FT                   SVDDEDGFDAEKILRHFVKNASSQGIDFRKTGITMEDVSATGLDNSFLEGSTFADIALL
FT                   PYTIFKFLKGVRHRRMRKIIRNVNAFALPGEMVLVLGRPGSGCSSFLKTAAGVTDQFAG
FT                   GVEGDIMYDGVPQDTMMKHYRSDVIYNGELDVHFPYLTVKQTLDFAIACKTPAIRVNNV
FT                   SRSEYIRETRDLYATIFGLTHTYDTKVGNDFVRGVSGGERKRVSIAEALAARGTFYCWD
FT                   NATRGLDASTALEYAMAIRIMTNLLNSTAFVTIYQASENIYETFDKVTVLHSGRQIYYG
FT                   SARDAKAYFEKMGYLCPPRQATAEFLTSLTDPNGFHVVREGYENKVPRTAEDLENYWLN
FT                   SEECANLKKAIQEYKASVDPEATKQFFAETMKAEKSKYARDKSYYTVSFPEQIRLCTVR
FT                   GFQNVYGNKAYTVINIAAAVIQAFITGSAFYNSPASTAGAFSRGGVLYFALLYYSLMGL
FT                   ANISFDHRPILQKHKTYSLYHPAAEALGSTFSGAPFRMIGLTLFIIILYFLAGLNRTAA
FT                   SFFRVYWFLAMCSEAIYALFDLIASACDDISQANSIAGLVMFAISMYSTYMIQLPNMHP
FT                   WFKWISYVLPIRYAFEGMLESEFHGRHMACGKGSLVPSGPGYENVPDSERVCAFIGSKK
FT                   GRSWVLGDDYLNVQYQYIYWHLWRNIGIMFAFLIGYNVFKAIITEIKRPVKGGGDALIF
FT                   KKGTRNATAKKNNRPDDLESMDQMNVQDVKDKYSSGSDITPNNDQEIEQSFKDFASKGI
FT                   FIWKNICYVIPYKGGERTLLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAKRVNVGVV
FT                   TGDMLINGKPVDSSFERRTGYVQQQDIHIAEMTVRESLIFSARLRRPQSIPDAEKVADA
FT                   ETVMKLLDMEEYADALVGGLGAGLNVEQRKKLSIGVELVSKPDLLLFLDEPTSGLDSQS
FT                   SWAIVQLLKRISRAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGENSSIVL
FT                   DYFERNGARHCEEKENPAEYILEAIGAGATATVKDDWHEIWQKSDEYGATEQKASEWIE
FT                   KLANQECTNEEIGSAPTKYATDYFYQFKYVWLRTNLMFWRDVPYIFSKCMLQVTAGLFI
FT                   GWTFFNPGKSYVGLQDTMFAAFISVIVAAPSMNQIQARAISSRELFEVRESKSNMFHWS
FT                   LLLITQYMAEIPYHILFSTFFFCASYFPLRVWFEASRSAVFFLNYCIMFQLYYVGLGLT
FT                   ILYMSPNLPSANVIMGLILSMMIQFCGVTQPVSLMPGFWTFMWKVSPFTYFIQNLVAIV
FT                   LHKKPVVCKKKELNYFDPPQGKTCGEYMNGFMKQAQGYIANPDATSNCAYCQVSVGDDY
FT                   MAQRGVYYGNLWRNFGFYWVYIVFNMFAMVGIYYIFSVRGVSIFNPFAVIKRIIKRK"
FT   gene            complement(<333829..>335379)
FT                   /locus_tag="ZYRO0A04136g"
FT                   /old_locus_tag="ZYRO-ORF9323"
FT   CDS_pept        complement(333829..335379)
FT                   /locus_tag="ZYRO0A04136g"
FT                   /old_locus_tag="ZYRO-ORF9323"
FT                   /product="ZYRO0A04136p"
FT                   /note="similar to uniprot|P13045 Saccharomyces cerevisiae
FT                   YDR009W GAL3 Transcriptional regulator involved in
FT                   activation of the GAL genes in response to galactose forms
FT                   a complex with Gal80p and Gal4p to relieve inhibition by
FT                   Gal80p binds galactose and ATP but does not have
FT                   galactokinase activity and similar to YBR020W
FT                   uniprot|P04385 Saccharomyces cerevisiae YBR020W GAL1
FT                   Galactokinase phosphorylates alpha-D-galactose to alpha-D-
FT                   galactose-1- phosphate in the first step of galactose
FT                   catabolism expression regulated by Gal4p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25618"
FT                   /db_xref="GOA:C5DPK7"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPK7"
FT                   /protein_id="CAR25618.1"
FT                   /translation="MYLCNNLTSIPLAMSVPTYSLDRCNEITRRFFETFGEDADFVSRS
FT                   PGRVNIIGEHIDYCNFSVLPMAIDVEMLLAVRVVRGSTSITLANADPKFAPRCFDIPLE
FT                   ESIGIDPALSDWSNYFKCGLLVAQNFCQETGQPMRDVGMQVFCQGSVPTGGGLSSSAAF
FT                   ICATALATIRAVKGSQCEISKQDLTRITADAEHYLGVNNGGMDQCASVCGEKDHALYVE
FT                   FKPVLKATPFPLPASVRFIIANTLVVSNKFETAPTNYNLRVVECTIAASVLAHTHGVSL
FT                   PGEKTPGNLRQVIYTLCERREGTESTAVEINESDKIDKEIQKLQYALRLVEETLGPKSK
FT                   GYTMSEASAALDMTPEEFTREYLTSFPVRFHLLQLYLRAKHVYLEALRVLQCLRLMTSV
FT                   HGTSTDTQQFLRDFGTLMNASQASCRDNYGCSCEGTEQICRIALNNGSLGSRLTGAGWG
FT                   GCTISLCPDEQSVTDIKRALIKQYYNERFPHMPPSELEAAIIVSKPVAGSALYEHLQM"
FT   gene            <335965..>337977
FT                   /locus_tag="ZYRO0A04158g"
FT                   /old_locus_tag="ZYRO-ORF9321"
FT   CDS_pept        335965..337977
FT                   /locus_tag="ZYRO0A04158g"
FT                   /old_locus_tag="ZYRO-ORF9321"
FT                   /product="ZYRO0A04158p"
FT                   /note="similar to uniprot|P04397 Saccharomyces cerevisiae
FT                   YBR019C GAL10 UDP-glucose-4-epimerase catalyzes the
FT                   interconversion of UDP-galactose and UDP-D-glucose in
FT                   galactose metabolism also catalyzes the conversion of
FT                   alpha-D-glucose or alpha-D-galactose to their beta-
FT                   anomers"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04158g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25619"
FT                   /db_xref="GOA:C5DPK8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPK8"
FT                   /protein_id="CAR25619.1"
FT                   /translation="MVSKVLVTGGAGYIGSHAVVELLANGYECVVVDNLSNSSYESLAR
FT                   VQVLAKKYVPFYKVDLIDLEALTKVFEEHSDIESVIHFAGLKAVGESSQIPLQYYQNNV
FT                   SGTLVLLQLMQKYRVKEFVFSSSATVYGDYTRYPGIIQVPETCPLQPTNPYGHTKFTIE
FT                   NILRDVSASGGWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLPYMAQVAVGRREKLSV
FT                   FGNDYDTRDGTPIRDYIHVVDLAKGHVAALKYLQDQENDICEEWNLGSGKGSSVLEMYD
FT                   AFTRSCGIKISKEIVGRRNGDVPLLVAKPTKAELELNWKTELGVKESCEDLWRWVTKNP
FT                   FGYSQHGVIGTTVHKGDYDNRLVTLGHGSRFQLIISNRGASIIDLLVDGQSIVLGPGDP
FT                   GDYSGATIGRYANRIVGGKYDLDGKVHQLTTNDNGNTNHSSVGCYSEKHFLGPLVKTPS
FT                   KGVFIAEYVLLDEQPRDFQSDLQVSVIYTLDVQAKALDIQYQAVLTKGESTPINLTNHT
FT                   YFNLNKVNADTVQGTEIRLATNKAVGLDGTLHQVDVSTFNDKEEEVTILDSVEPRIDHC
FT                   FVVAESTSLDSTKGKLRPVLRASHPESHISLEVLTTEPSFQLYTGDGLTGFTPRSGFAV
FT                   EPARYVNAINDERWKKTVTLSQGDAYRSRIVYRFT"
FT   gene            <338303..>339406
FT                   /locus_tag="ZYRO0A04180g"
FT                   /old_locus_tag="ZYRO-ORF9320"
FT   CDS_pept        338303..339406
FT                   /locus_tag="ZYRO0A04180g"
FT                   /old_locus_tag="ZYRO-ORF9320"
FT                   /product="ZYRO0A04180p"
FT                   /note="highly similar to uniprot|P08431 Saccharomyces
FT                   cerevisiae YBR018C GAL7 Galactose-1-phosphate uridyl
FT                   transferase synthesizes glucose-1-phosphate and UDP-
FT                   galactose from UDP-D-glucose and alpha-D-galactose-1-
FT                   phosphate in the second step of galactose catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04180g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25620"
FT                   /db_xref="GOA:C5DPK9"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPK9"
FT                   /protein_id="CAR25620.1"
FT                   /translation="MTAAFILEDHSHRRYNPLKGTWVLVSPHRAKRPWLGQKEVASKPD
FT                   NPPYDPECYLCPGNSRATGATNPQYDSTFIFVNDFSAVKLDQPHDIGERAGEESLKQRL
FT                   FKTESVRGVCFVICFSPQHNLTIPQMPLNEVVKIVEAWNELYQTVSFEAAQQGKPFKYL
FT                   QIFENKGTAMGCSNLHPHGQAWCLESVPTEVLEELKSIKNYREENHSHLLGDCVELELE
FT                   EKARIVLENDSFIVIVPYWAVWPFETMVVSKSKVASIDKFNEMQRRDLSSILLELTKKY
FT                   DNLFQTSFPYSMGIHQAPLNAQGDDLENSWFHMHFYPPLLRSATVRKFLVGFELLGEPQ
FT                   RDLTAEQAAQRLRDVDGTVHYLERNDV"
FT   gene            <341110..>341191
FT                   /locus_tag="ZYRO0A04202r"
FT                   /old_locus_tag="Zyro0A.tSer.AGA.6"
FT   tRNA            341110..341191
FT                   /locus_tag="ZYRO0A04202r"
FT                   /old_locus_tag="Zyro0A.tSer.AGA.6"
FT                   /note="tRNA-Ser (AGA) cove score=83.48"
FT   gene            <341547..>342860
FT                   /locus_tag="ZYRO0A04224g"
FT                   /old_locus_tag="ZYRO-ORF9317"
FT   CDS_pept        341547..342860
FT                   /locus_tag="ZYRO0A04224g"
FT                   /old_locus_tag="ZYRO-ORF9317"
FT                   /product="ZYRO0A04224p"
FT                   /note="highly similar to uniprot|P40327 Saccharomyces
FT                   cerevisiae YDL007W RPT2 One of six ATPases of the 19S
FT                   regulatory particle of the 26S proteasome involved in the
FT                   degradation of ubiquitinated substrates required for normal
FT                   peptide hydrolysis by the core 20S particle"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25621"
FT                   /db_xref="GOA:C5DPL0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR035244"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPL0"
FT                   /protein_id="CAR25621.1"
FT                   /translation="MGQGLSSGQDKKKKRSNKEKPKYEPPVQPRFGRKKRRGGPATAEK
FT                   LPNIYPSTRCKLKLLRMERIKDHLLLEEEFVTNSEILKPFEKKQEEEKKQLEEIRGNPL
FT                   SVGTLEEIIDDDHAIVTSPTMPDYYVSILSFADKELLEPGCSVLLHHKTMSIVGVLQDD
FT                   ADPMIAAMKIDKSPTENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIRPPKGVILY
FT                   GAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAEHSPSIVFI
FT                   DEIDAIGTKRYESNSGGEREVQRTMLELLNQLDGFDDRGDIKVVMATNRIETLDPALIR
FT                   PGRIDRKILFENPDMNTKKRILGIHTAKMNLSEDVRLDELVTSKDDLSGADIQAMCTEA
FT                   GLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL"
FT   gene            <343452..>344297
FT                   /locus_tag="ZYRO0A04246g"
FT                   /old_locus_tag="ZYRO-ORF9315"
FT   CDS_pept        343452..344297
FT                   /locus_tag="ZYRO0A04246g"
FT                   /old_locus_tag="ZYRO-ORF9315"
FT                   /product="ZYRO0A04246p"
FT                   /note="highly similar to uniprot|P35182 Saccharomyces
FT                   cerevisiae YDL006W PTC1 Type 2C protein phosphatase (PP2C)
FT                   inactivates the osmosensing MAPK cascade by
FT                   dephosphorylating Hog1p mutation delays mitochondrial
FT                   inheritance deletion reveals defects in precursor tRNA
FT                   splicing sporulation and cell separation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25622"
FT                   /db_xref="GOA:C5DPL1"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPL1"
FT                   /protein_id="CAR25622.1"
FT                   /translation="MGVSEEDISGTPTEYQLTYQVGVAENKNAKFRKTMEDVHTYVKNF
FT                   ASRLDWGYFAVFDGHAGSQASKWCGSHLHHVVEQKLLEDETRDVREVLNESFVSVDRQI
FT                   NTKLSGNSGCTAAVCILRWEVPDDVDNQTADFSQHTRKLYTANVGDSRIVLFRKGRSVR
FT                   LTYDHKASDILEMQRIEKSGGLIMKSRVNGMLAVTRSFGDKFFDGLVVGNPFTTSVELT
FT                   RDDEFLIVACDGLWDVIDDQDACELIRDIKEPNEAAKTLVRYALENGTTDNVTAMVVYL
FT                   "
FT   gene            complement(<344524..>345495)
FT                   /locus_tag="ZYRO0A04268g"
FT                   /old_locus_tag="ZYRO-ORF9314"
FT   CDS_pept        complement(344524..345495)
FT                   /locus_tag="ZYRO0A04268g"
FT                   /old_locus_tag="ZYRO-ORF9314"
FT                   /product="ZYRO0A04268p"
FT                   /note="weakly similar to uniprot|Q12124 Saccharomyces
FT                   cerevisiae YDL005C MED2 RNA Polymerase II transcriptional
FT                   regulation mediator Stoichiometric member of mediator
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25623"
FT                   /db_xref="GOA:C5DPL2"
FT                   /db_xref="InterPro:IPR021017"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPL2"
FT                   /protein_id="CAR25623.1"
FT                   /translation="MASKSPEIIPQSPPQNGRLHENKLTQCFDDIMRVAVEMMLHQQLK
FT                   TVQLDSSVVNGFSHNQQRMLSEKIHIFHAILDDMETTLGKSKDYVEAIYELGREKELQK
FT                   EREREELRRRQEEEERKSKEQEELRRHQEMELKAQQEKEQQQQEQQEQQKQQKQDNDVE
FT                   PDLKMKFSMDTPSGLLADFPGASGDMNETGAIPKNSDDKPVSPRQYSTKIKQEQGLPQG
FT                   DLGDLGGMDISMFPNMDTGFDMGSMGGEPDPNKQGGSNDPTAGLPESENANDVAGTLGD
FT                   PGNNGVVDNSDDYLTLNDFNDLNIDWSATGDPGDLDLNGFNI"
FT   gene            complement(<345802..>346446)
FT                   /locus_tag="ZYRO0A04290g"
FT                   /old_locus_tag="ZYRO-ORF9312"
FT   CDS_pept        complement(345802..346446)
FT                   /locus_tag="ZYRO0A04290g"
FT                   /old_locus_tag="ZYRO-ORF9312"
FT                   /product="ZYRO0A04290p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04290g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25624"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPL3"
FT                   /protein_id="CAR25624.1"
FT                   /translation="MQEVLFKEHQYIQRGKSLKRYISKLRNVLKNNRLAGKAKKDLEVR
FT                   SQKKEKPKRNSLSSKRKRSLTSANNTNNITPTRKETQSAKKQDSPKWKRQKRTSRDRGR
FT                   TSSKKRRDPHGNCDLLASEQSENPHNHADSPLSRRSKNSKSYNRRKHSKEAKNLTLDDI
FT                   QEHPMLQQELVANINGSYIQFHLVSVDPKLLLQGPPVITTEPMPSLIWPYD"
FT   gene            <347213..>347692
FT                   /locus_tag="ZYRO0A04312g"
FT                   /old_locus_tag="ZYRO-ORF9311"
FT   CDS_pept        347213..347692
FT                   /locus_tag="ZYRO0A04312g"
FT                   /old_locus_tag="ZYRO-ORF9311"
FT                   /product="ZYRO0A04312p"
FT                   /note="highly similar to gnl|GLV|KLLA0F14773g Kluyveromyces
FT                   lactis KLLA0F14773g and similar to YDL004W uniprot|Q12165
FT                   Saccharomyces cerevisiae YDL004W ATP16 Delta subunit of the
FT                   central stalk of mitochondrial F1F0 ATP synthase which is a
FT                   large evolutionarily conserved enzyme complex required for
FT                   ATP synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25625"
FT                   /db_xref="GOA:C5DPL4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPL4"
FT                   /protein_id="CAR25625.1"
FT                   /translation="MFRLNAARTLTKSVNAVAKRTYAEAAANDFLKLKFALPHETLFAG
FT                   TKVTQVNLPAKSGGVGILANHVPTVEQLSPGVVEIFEGANTKKYFVSGGFASVQPDSTL
FT                   CVTSVEAFPLESFSQENVKSLISDANKNLSSSDEKVAATAAIQLEVLEALQAALK"
FT   gene            <348276..>350102
FT                   /locus_tag="ZYRO0A04334g"
FT                   /old_locus_tag="ZYRO-ORF9310"
FT   CDS_pept        348276..350102
FT                   /locus_tag="ZYRO0A04334g"
FT                   /old_locus_tag="ZYRO-ORF9310"
FT                   /product="ZYRO0A04334p"
FT                   /note="similar to uniprot|Q05325 Saccharomyces cerevisiae
FT                   YDL003W MCD1 Essential protein required for sister
FT                   chromatid cohesion in mitosis and meiosis subunit of the
FT                   cohesin complex expression is cell cycle regulated and
FT                   peaks in S phase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25626"
FT                   /db_xref="GOA:C5DPL5"
FT                   /db_xref="InterPro:IPR006909"
FT                   /db_xref="InterPro:IPR006910"
FT                   /db_xref="InterPro:IPR023093"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039781"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPL5"
FT                   /protein_id="CAR25626.1"
FT                   /translation="MSETHTISISAKNGPLAQIWLAANMSNLGRGQVLQTSISESANEI
FT                   AKASGCDENVTNIEHITLRTSGELLQGIVRVYSKQAAFLLSDIKDTLTKISTLFKSNQR
FT                   INITVNRANTIAAVDQLILEDAVTEKEVLAAPSLDFLDDNQIPEGLMGQETEESHQRRV
FT                   QGAAPWDTSLEFGRRFDPDEDLEYNQSSGLDLDFDIDDGQLSKTAEEGTRQSHDVVSQS
FT                   QEPEHLLMGEDDFPLEDPNNVDWDLGISEEKDQERATSEAGSHDSVELGRRAEERSMTG
FT                   EPIDFGFNLDIEKDAGDEEDQEEPESDEQQQKLQEEERERERKEEAKRERKARKDPALR
FT                   NCKRIQQDVETELDDHSLKTASEEILNGRPETEVQDLPKLNQKRLWGEMIQSLSYLPQE
FT                   TIERLTSLQTSKKPKTQVESENEESFEEPQMDISLGLNDDLLPESSISSSRPPSELGEG
FT                   DHESPMAADIGEHPLDQGQEEHGEPNIEQSTQQDSDEREPSSSQSELDDSEKVKLTTGE
FT                   FASREAVDFAELMRVEFIDNDSLEFENLLTTKKRAQGVEEDTRLTRQEATKGFFDMLSL
FT                   ATADCIDLNQQETFGEINISARPALYERFITA"
FT   gene            <350421..>357890
FT                   /locus_tag="ZYRO0A04356g"
FT                   /old_locus_tag="ZYRO-ORF9309"
FT   CDS_pept        350421..357890
FT                   /locus_tag="ZYRO0A04356g"
FT                   /old_locus_tag="ZYRO-ORF9309"
FT                   /product="ZYRO0A04356p"
FT                   /note="similar to uniprot|P35194 Saccharomyces cerevisiae
FT                   YBL004W UTP20 Possible snoRNA-binding protein based on
FT                   computational analysis of large-scale protein-protein
FT                   interaction data"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25627"
FT                   /db_xref="GOA:C5DPL6"
FT                   /db_xref="InterPro:IPR011430"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPL6"
FT                   /protein_id="CAR25627.1"
FT                   /translation="MAKQKNTPKATNKFRYASFKDKIDDLKIEPVRNLATRAHDYVETS
FT                   HFFASFEHWREINLSSSFTSFAGDVENIVQTLPQILYHEETILSTLLHYIDRHEPLSLQ
FT                   PLLDLLAQFCHDLGPDFLKFYERSVNSMVSLLEAAVSFESSDVFEWTFNCLAYIFKYLS
FT                   RYLTEDLVPTFNLLFPLLSHSKTYLSRFSAEAMSFLIRKSNLKNLVGFVSFAFKKLVEV
FT                   EEANFYDGLLALFTEALVSTQEALHSKCRSILDIFIGEALATSSDRSGSLLCDLWINLA
FT                   RHASFDNLQPVFESVVNKLQNVIDANNMNQATKIITTISFAESGKKVGNWTSVVELVKV
FT                   IISQKDRSKLSPQTLAFLFMVLLRNCDIKNLTHFHKKLYEFYLDEYPDYFTGFFKASVD
FT                   FTADRVYSFNGNRYLQQYLNKHWSTHQEQISLFLLQSSDDSDANRKLVVKTPDEFARSI
FT                   LESLKVYGKHISDDGLFEVCQGSILLSRSQEKNEDVLIPVLENILNASSPVTDFKKDVL
FT                   GYVLDALQPSDQETHYQLLNDTLQQLESYRDSLVFIKSLNKYLLGLGKGPKLGKYLSGL
FT                   DDYIRILSENLTLPDKALRYETLKLITTLMEVQEKEVPQLLNDCKIIEEIPLTLLNARD
FT                   LSIRIRNMGSTFAKVESGSIITSLFFKFLFGLLTIRFSPVWEGVYEVISNAYGKDQQLV
FT                   WDLIKRFLDAPDDHHCLTYYDDFMVGEADIDRWNVRAVRLHEILESFSNTWSGYCFSKS
FT                   TIVETMKARRANLDYPGQLRNQTLKLMLLVPQFVERHSRDIIPYLFNQDESTEIFGLQE
FT                   EKRGDLGSAARWTEADRNLLLKVIGKFKNMKSIYRFQEVHDRLMLLLGSRNTEVQKLAF
FT                   EALLGYHDSVLTKYRDNLRNLLDDTLFKDELLNLISTGDSKLIEDQDEPQLMPYVVRIF
FT                   FGRAQTPGTSGIKKGRKHAVISMLPNLRDEYIVEFLKLGSGKFNYQYFFENGRIIEDSE
FT                   VTATTLRRMLGFVNIVDYALGVLASGYPKVMATTVRPLIYTIHMSYHVSNVEEKEPYMA
FT                   KLAANLRQQSMKCLNNLFQYLGTSSVLNEFIEEICDIVVMPRIEKFENENLQQPSSTLR
FT                   MISSWSTVGELYPFLYFNDYASPSAMMRVLSNPNAKESVVGVILEAANNIVTNPVNTDE
FT                   YADLVTIVAANCLRVLPTLYKKITNPEIVSTSIDLLLNLVYAGYLQDNETRKYLVDSFN
FT                   HIIRDAFKGVSKKDVIKVLQVLAALLKDYDCDWDDVKDLFEAVSGLHAKYSEKQLKEPL
FT                   NDVFASFACRFPDLQKLSNLLSDLNSFSSKHMLEYDFPRILSAFKQFHEVGYREYSEKQ
FT                   WLPILFTCMLYINDEEELAIRTNASHTFCKFFDYLNEKPSPDAADEAVKILKRLILPHL
FT                   RSGLRRTSEVIQAEHISVLSYIVSTGKYFTDLDDLRVLLYNGDVEANFFVNVVHIQLHR
FT                   RLRAVRRLREHGHELSGSSISNYLIPIVEHYVFSKEEKFRNIGNEVLVTIGVLANFLSW
FT                   SQYKGLLRRYIYFLKSRPDNLKESVNLITQLSSALKNSLCYCRHKFNSEVVLKKFPIEL
FT                   EEPDNFVTEEIYPKLTSVLQVRDNETAVARIPLSEALVNFVIGLDEVKLVSLLPGTLTS
FT                   LCQILRSRSEELRDAVRKTLAEVSKILGAEYLPFILKELISALRRGSQVHVLSFTVHHV
FT                   LKTLEAALKPSDLDNSSQLLVNVIMEDIFGFAGEEKESDNYHTTMKEIKVSRSYDTAEM
FT                   LTSNISLPFFYTVLNPVKALLLERMNLKSQNKLNELLRKYALGLNRNVQAASTEVLGLC
FT                   YEIFEQSETVKKHTKSNRPLVSENEEFFLINLNAKSGRVENETSLLNTTLQKFSLDLLR
FT                   TVITRHRSLLEVKYLEGFMPLLKSCVTSENEDVLTIALRVLLVMVKLEFPESSESIFAN
FT                   CARRVLNIIKDSPSTSSEVCQVGLKFLSAVIRHKNIKLKDSALSYVLGRVLPDLNEPNK
FT                   QGLAFNFVKALVYKHIQLPELYDVIDTVRQIMVTNHSKEIRDVSRSVYYQFLMEYDQSK
FT                   GRLEKQFKFMVDNLQYPSQDGRQSVMELINLIVNKANSVLLSKLSSSFFVALANVFFND
FT                   DAPRCREMASLLLSKLLSKLDPESLTTVEKYITAWLKQVQNVTFMNLGLRVYKVYLTSI
FT                   GLEHNAALDELAMNRVKTIISNTDVGSESQWDLVYSALNLFIAYVERSEKSFGVAFRIT
FT                   WDKVIGCILYPHLWVRQSASRLVNLLVNNLDKFEKKFTDLEVQNVVSRTMRQLGAPTVP
FT                   ESLAAISVKTLMKVAMRWKENNVPFVLKESDNAQEVHYSSALDYMIVRAGAIIRSEENP
FT                   ADSFMSKKSCIQLLALLVQILDENQLVEESEKIIMSLFNYLEQGAGDGLNEEQQELGNL
FT                   AQECLQILESKISVSDFTQAYANVKHNVLTRRQERKAKRAVLAVKAPDVAAQKKIKKHV
FT                   RSREKRKHERDEHGFYQRKNKKKRM"
FT   gene            complement(<358062..>358868)
FT                   /locus_tag="ZYRO0A04378g"
FT                   /old_locus_tag="ZYRO-ORF9305"
FT   CDS_pept        complement(358062..358868)
FT                   /locus_tag="ZYRO0A04378g"
FT                   /old_locus_tag="ZYRO-ORF9305"
FT                   /product="ZYRO0A04378p"
FT                   /note="similar to uniprot|Q03435 Saccharomyces cerevisiae
FT                   YDL002C NHP10 Protein related to mammalian high mobility
FT                   group proteins likely component of the INO80 complex which
FT                   is an ATP-dependent chromatin-remodeling complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25628"
FT                   /db_xref="GOA:C5DPL7"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR030483"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPL7"
FT                   /protein_id="CAR25628.1"
FT                   /translation="MSDDNDLKRKADELKENNEVLALGIQRTRLSVKRLKLEYSVLLER
FT                   LESRVDLDPELRYENPLPTLESFKKELLTKPLKKTKSKRQKAKDRDPNMPKRPTNAYLL
FT                   FCEMNKEKVRQQGSQDVSKDLTEAWKNLNEQDRKPYYKLYTEDRERYQKEMEIYSMKND
FT                   HDNENDPDHAKDHDEEYEGDEPENGREGPKHEDDDEEEEGEGEGEGEGEGEGEGEGEGE
FT                   GEAEEDEGEEDEEEEEDQREPESEITQLDEDGDNDEEMADIPTSEI"
FT   gene            <359271..>360647
FT                   /locus_tag="ZYRO0A04400g"
FT                   /old_locus_tag="ZYRO-ORF9303"
FT   CDS_pept        359271..360647
FT                   /locus_tag="ZYRO0A04400g"
FT                   /old_locus_tag="ZYRO-ORF9303"
FT                   /product="ZYRO0A04400p"
FT                   /note="similar to uniprot|Q05210 Saccharomyces cerevisiae
FT                   YDL001W RMD1 Cytoplasmic protein required for sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25629"
FT                   /db_xref="GOA:C5DPL8"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPL8"
FT                   /protein_id="CAR25629.1"
FT                   /translation="MSKQEEEPLLKQTGSTATTGENSNSNNNTTSTSAKYKPKPKPRGN
FT                   GTKNVSSESGADTNLEVGVRHADDVNGGGIYNGEVTQGSLRAPNKQIRTGAQRTSRTAQ
FT                   KLKLLPEEPFQRDEESLDLRDRDVYSQVNRITDKPARRDAEKLGKSHRHLLPRATAYCT
FT                   ASGYSMRELVRWLKECKKIHHTHPKLFDECIYTPFMYNDWRGDKRFEHEDVIRLDDEGG
FT                   DINVSDKQPDLFVFEYGVVVLWGFTEREEKAFLNDIEGFEKEKLAEEDVQIEEFNYYVT
FT                   QSYQPRIYNDFITLRDASNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAS
FT                   SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWSEPQLEPIYQATRGYLEINQ
FT                   RVALLNQRLEVVSDLLQMLKEQLGHSHEEYLEFIVILLVGVEVIISVVNIAADILASKF
FT                   "
FT   gene            complement(<360792..>361190)
FT                   /locus_tag="ZYRO0A04422g"
FT                   /old_locus_tag="ZYRO-ORF9302"
FT   CDS_pept        complement(360792..361190)
FT                   /locus_tag="ZYRO0A04422g"
FT                   /old_locus_tag="ZYRO-ORF9302"
FT                   /product="ZYRO0A04422p"
FT                   /note="similar to uniprot|P04911 Saccharomyces cerevisiae
FT                   YDR225W HTA1 One of two nearly identical (see also HTA2)
FT                   histone H2A subtypes core histone required for chromatin
FT                   assembly and chromosome function DNA damage-dependent
FT                   phosphorylation by Mec1p facilitates DNA repair acetylated
FT                   by Nat4p and similar to YBL003C uniprot|P04912
FT                   Saccharomyces cerevisiae YBL003C HTA2 One of two nearly
FT                   identical (see also HTA1) histone H2A subtypes; core
FT                   histone required for chromatin assembly and chromosome
FT                   function; DNA damage- dependent phosphorylation by Mec1p
FT                   facilitates DNA repair; acetylated by Nat4p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25630"
FT                   /db_xref="GOA:C5DPL9"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPL9"
FT                   /protein_id="CAR25630.1"
FT                   /translation="MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRKGNYAQRV
FT                   GSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTI
FT                   AQGGVLPNIHQNLLPKKTAKPGKASQEL"
FT   gene            <361844..>362242
FT                   /locus_tag="ZYRO0A04444g"
FT                   /old_locus_tag="ZYRO-ORF9301"
FT   CDS_pept        361844..362242
FT                   /locus_tag="ZYRO0A04444g"
FT                   /old_locus_tag="ZYRO-ORF9301"
FT                   /product="ZYRO0A04444p"
FT                   /note="similar to uniprot|P02293 Saccharomyces cerevisiae
FT                   YDR224C HTB1 One of two nearly identical (see HTB2) histone
FT                   H2B subtypes required for chromatin assembly and chromosome
FT                   function Rad6p-Bre1p-Lge1p mediated ubiquitination
FT                   regulates transcriptional activation meiotic DSB formation
FT                   and H3 methylation and similar to YBL002W uniprot|P02294
FT                   Saccharomyces cerevisiae YBL002W HTB2 One of two nearly
FT                   identical (see HTB2) histone H2B subtypes required for
FT                   chromatin assembly and chromosome function;
FT                   Rad6p-Bre1p-Lge1p mediated ubiquitination regulates
FT                   transcriptional activation, meiotic DSB formation and H3
FT                   methylation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25631"
FT                   /db_xref="GOA:C5DPM0"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPM0"
FT                   /protein_id="CAR25631.1"
FT                   /translation="MSAKAEKKPASKAPAEKKPAAKKTASAVESKGRKNKARKETYSSY
FT                   IYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNRKSTISAREIQTAVR
FT                   LILPGELAKHAVSEGTRAVTKYSSSTQA"
FT   gene            complement(<362373..>362693)
FT                   /locus_tag="ZYRO0A04466g"
FT                   /old_locus_tag="ZYRO-ORF9300"
FT   CDS_pept        complement(362373..362693)
FT                   /locus_tag="ZYRO0A04466g"
FT                   /old_locus_tag="ZYRO-ORF9300"
FT                   /product="ZYRO0A04466p"
FT                   /note="highly similar to uniprot|P35195 Saccharomyces
FT                   cerevisiae YBL001C ECM15 Non-essential protein of unknown
FT                   function likely exists as tetramer may be regulated by the
FT                   binding of small-molecule ligands (possibly sulfate ions)
FT                   may have a role in yeast cell-wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25632"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPM1"
FT                   /protein_id="CAR25632.1"
FT                   /translation="MPKIPCLADLCMVPIGTGSASVSDFVTIVERRIRESHLKSTLHSA
FT                   GTTIEGPWDEVFTLIGELHELAHENGYVRIQSSLRVGTRTDKHQTAQEKVDTVLQKLEK
FT                   PH"
FT   gene            complement(<364152..>365624)
FT                   /locus_tag="ZYRO0A04488g"
FT                   /old_locus_tag="ZYRO-ORF9298"
FT   CDS_pept        complement(364152..365624)
FT                   /locus_tag="ZYRO0A04488g"
FT                   /old_locus_tag="ZYRO-ORF9298"
FT                   /product="ZYRO0A04488p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25633"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPM2"
FT                   /protein_id="CAR25633.1"
FT                   /translation="MDDLSSDGNMDSAPPDIHVSRSWFGDNQHDEFKEPSHEELEEIPI
FT                   NGDDGNCRKCVNRQTHRTTLISECTSLYNIEDIGGDSLGLTALCKDMDSFNQMDGKATN
FT                   SDFNYSMGRQNSSQNLLSFCNKGNREDYSDQIIEGVFHAAPSSEPPTGSLLCMQQGHLS
FT                   DRLSYPCSMSAMVANKQFDRCGEGHCFPSAQYEHTEPIFEEDRSSRMADLEYFANMDND
FT                   SWLDAKVDLNLGSSSWINALASRIQPSDPHEYFPTSSGKSNLFLEVGMYYADRLGHDEL
FT                   TVSDQYGITLQDTVMRPPSTVGLNCNSLDESSKGLDAYSHISGSHSGTPWKITSGTTKQ
FT                   SSWDVFSRLDALNSRIQGLFFSVDSALSKSRCEESLAVNIEETGNLDGKLTFSNFPPSE
FT                   FSKDNRFDNESGSIVSSGITSNKEVIDIWTLGMASAESVLSDPEDFELGELYASNKSEV
FT                   LQKANAKAIERLHEGDDHPQRKIKNFVGEKGL"
FT   gene            complement(<365695..>366972)
FT                   /locus_tag="ZYRO0A04510g"
FT                   /old_locus_tag="ZYRO-ORF9296"
FT   CDS_pept        complement(365695..366972)
FT                   /locus_tag="ZYRO0A04510g"
FT                   /old_locus_tag="ZYRO-ORF9296"
FT                   /product="ZYRO0A04510p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25634"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPM3"
FT                   /protein_id="CAR25634.1"
FT                   /translation="MSHTQLNHGFFYKDSGKVNDRDSLEDLSDSAQRYFRIGCTPPKTS
FT                   ERIEIVHQSPQKSKITTSRTFNRKRVCVSRELPLEAKNTKGLTRVLKGAGNRYERNRIQ
FT                   RFEETHASRNGSAYGAYEEFDEENFTSSVSFKSIVSAVFSNSIFQNPLGEHTSNTNPFI
FT                   ENSFGGILDQLDGVNEDHLLICTKNESLNSCFLMRFIERRRRASAAVKEAARMASIRCK
FT                   TRETARINAEEAVIQVHTRNLKLSFRDQEESKDCSQNEVNIIKDLDAPNTSLMEEANLS
FT                   VGADLFFEGDIKQCGFEPTIDACWKLNDGLCPHVEALIYDSVDGDINDLKVKIGDHQPC
FT                   SWLTVLVSQIEIWGTDFQRTDCWDPLLKPDNLQKVTSNAEVSASIEETNCVSKNNIDGG
FT                   VSFSLQSAGGEGNFFFYSTSLKSIVC"
FT   misc_feature    complement(369077..369243)
FT                   /locus_tag="ZYRO0A04532s"
FT                   /old_locus_tag="centromere.zyro0A"
FT                   /note="Centromere Zyro0A"
FT   gene            complement(<369397..>371859)
FT                   /locus_tag="ZYRO0A04554g"
FT                   /old_locus_tag="ZYRO-ORF9293"
FT   CDS_pept        complement(369397..371859)
FT                   /locus_tag="ZYRO0A04554g"
FT                   /old_locus_tag="ZYRO-ORF9293"
FT                   /product="ZYRO0A04554p"
FT                   /note="highly similar to uniprot|P32356 Saccharomyces
FT                   cerevisiae YDR001C NTH1 Neutral trehalase degrades
FT                   trehalose required for thermotolerance and may mediate
FT                   resistance to other cellular stresses may be phosphorylated
FT                   by Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25635"
FT                   /db_xref="GOA:C5DPM4"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011120"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPM4"
FT                   /protein_id="CAR25635.1"
FT                   /translation="MVDPKKSPLEEHARRHSSDGLNSSQTNTFSNAGDLDDLLKSKRES
FT                   MASDESASQHHPSVHFNPKFLGTKSSSAKSESNPQRHRRLSSLNEFHDPFSTADVYYGP
FT                   ETNPNKYSGIKPMNRPRTMSVVDNVSNFKTKSSLDRQLLKRRGSEDDTYLSSKGNRRFF
FT                   IENVDEMLGKLLACEDTDKNFQITIEDTGPKVIKVGTANSGGFKYVNIRGTYMLSNLLQ
FT                   ELTIAKSFGRNQIVLDEARINENPVDRLTRLIHTQFWDNLTRRVDLTNIAQIALDTKID
FT                   APGAKNPRVYVPYNCPEQYEFYVQASQMNPSLSLEVEYLPRDITPEYVKSLNRTPGMLA
FT                   LAMEEHINPSSGELSLVGYPYAVPGGRFNELYGWDSYMIALGLLEGGKTHVARGMVEHF
FT                   IFEIEHYGKILNANRSYYLCRSQPPFLTDMALQVFKKMGGRNNPDAIDFLKRACHAAIK
FT                   EYRTVWVNSPRLDPETGLSCYHPLGLGIPPETEVDHFDSLLAPYHKKYNASREEFAKMY
FT                   NDGKVNEPKLDDFFMHDRGVRESGHDTTYRFEGVCAYLATVDLNSLLFKYERDIADIIE
FT                   EFFENKYHDPWDNSVTDAQYWRDLAQKRRSVITKYMWDDETGFFFDYNTKTKERHSYES
FT                   ATTLWALWAGLATEDQAAIMVEKAIPNLEVLGGIVACTERSRGPLSIKRPSRQWDFPYG
FT                   WAPHQILAWDGLSRYGFVGTATRLAYRWLYIMTKAFVDYNGIVVEKYDVTKGTDPHRVN
FT                   AEYGNQGADFKGVAKEGFGWVNASYVLGLQYMNDHAKRALATCVPPIPFFNSLRPNERK
FT                   NYGLQTHS"
FT   gene            <372682..>373308
FT                   /locus_tag="ZYRO0A04576g"
FT                   /old_locus_tag="ZYRO-ORF9290"
FT   CDS_pept        372682..373308
FT                   /locus_tag="ZYRO0A04576g"
FT                   /old_locus_tag="ZYRO-ORF9290"
FT                   /product="ZYRO0A04576p"
FT                   /note="similar to uniprot|P41920 Saccharomyces cerevisiae
FT                   YDR002W YRB1 Yeast Ran Binder #1 suppressor of FUS1 homolog
FT                   of mouse HTF9a and human RanBP1 nuclear GTPase- activating
FT                   protein for Ran"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25636"
FT                   /db_xref="GOA:C5DPM5"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPM5"
FT                   /protein_id="CAR25636.1"
FT                   /translation="MSDDKSTTKPVEEKKPETESGPKPPTSAVFSMFGGKKENKPSGEE
FT                   ESKKEENEEKKPKEDDDESPESPDVHFEPIVHLEKVDVKTLEEDEEVLYKVRAKLFRFD
FT                   GEAKEWKERGTGDCKFLKNKSTGKVRILMRRDKTLKVCANHIVAPEYVLKPNVGSDRSW
FT                   VYACTADVAEGETQALTFAIRFGSKENADKFKEEFEQAQKLNKKN"
FT   gene            complement(<373651..>374508)
FT                   /locus_tag="ZYRO0A04598g"
FT                   /old_locus_tag="ZYRO-ORF9288"
FT   CDS_pept        complement(373651..374508)
FT                   /locus_tag="ZYRO0A04598g"
FT                   /old_locus_tag="ZYRO-ORF9288"
FT                   /product="ZYRO0A04598p"
FT                   /note="similar to uniprot|P35196 Saccharomyces cerevisiae
FT                   YBR002C RER2 Cis-prenyltransferase involved in dolichol
FT                   synthesis participates in endoplasmic reticulum (ER)
FT                   protein sorting"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25637"
FT                   /db_xref="GOA:C5DPM6"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPM6"
FT                   /protein_id="CAR25637.1"
FT                   /translation="MSMEAETTLSWFSASEWIKNQFSNVIKVSNSAPKHVGFVMDGNRR
FT                   YAKKMDIEVKEGHEAGYMSMSKVLELCYQAGVDTATVFAFSIENFKRSSLEVDNLMQLA
FT                   RERIRQLADKGELAEKYGIRVKVIGDLTLLPKDIYKEVKRTTDLTKNNTRATLNICFPY
FT                   TGREEIFHSVKELISEDVPIDSINEICLEKHLYTGDSPPLDLLVRTSGVSRLSDFMLWQ
FT                   ASNKGVVIELIDRLWPEFGPLNMAWILLKFAFRKSFSVKHELEDEVEDNDELMETLPED
FT                   KKNL"
FT   gene            <374839..>376245
FT                   /locus_tag="ZYRO0A04620g"
FT                   /old_locus_tag="ZYRO-ORF9287"
FT   CDS_pept        374839..376245
FT                   /locus_tag="ZYRO0A04620g"
FT                   /old_locus_tag="ZYRO-ORF9287"
FT                   /product="ZYRO0A04620p"
FT                   /note="highly similar to uniprot|P18900 Saccharomyces
FT                   cerevisiae YBR003W COQ1 Hexaprenyl pyrophosphate synthetase
FT                   catalyzes the first step in ubiquinone (coenzyme Q)
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25638"
FT                   /db_xref="GOA:C5DPM7"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPM7"
FT                   /protein_id="CAR25638.1"
FT                   /translation="MIRRCIRFRICVLNARRGKSSFSAALAAVSRLVTPSIMLRNPVSL
FT                   VSNEMNTLAKNIMALIGSGHPVLNRVTSYYFEAEGKKVRPLLVLLLSRALAEIPLEQRT
FT                   QSLIDSVDVPEDPVYSQPPKSLLFEPPANNLSPLDILHGIKPLNPLTKGPEPIPEANFD
FT                   KERGILPKQRRLAEIVEMIHTASLLHDDVIDHSDTRRGRASGNVAFTNKMAVLAGDFLL
FT                   GRATVAISRLRNPEVVELMSNSIANLVEGEFMQLKNTAVEDISIINQGNKPLPAASKKL
FT                   NNEVHDYRVPRAVGEGISHDQMIETAFDYYLHKTYLKTAALISKSSRAAAILSGVDRTV
FT                   VDQCYEFGKDIGICFQLVDDMLDFTVSAKDLGKPAGADLELGIATAPVLYAWKADPSLG
FT                   PLIQRNFSQPGDVEQTAEAVANSNGVFKTKKLAEKYRDQALQNLRKALPESDARSALEF
FT                   LTNSILTRGK"
FT   gene            complement(<376415..>377695)
FT                   /locus_tag="ZYRO0A04642g"
FT                   /old_locus_tag="ZYRO-ORF9285"
FT   CDS_pept        complement(376415..377695)
FT                   /locus_tag="ZYRO0A04642g"
FT                   /old_locus_tag="ZYRO-ORF9285"
FT                   /product="ZYRO0A04642p"
FT                   /note="similar to uniprot|P38211 Saccharomyces cerevisiae
FT                   YBR004C GPI18 Functional ortholog of human PIG-V which is a
FT                   mannosyltransferase that transfers the second mannose in
FT                   glycosylphosphatidylinositol biosynthesis the authentic
FT                   non-tagged protein was localized to mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25639"
FT                   /db_xref="GOA:C5DPM8"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPM8"
FT                   /protein_id="CAR25639.1"
FT                   /translation="MFCQLSSTFILCKLVQYGLILLTPRDQFDTSTELLLARFVSVADS
FT                   SKFWNSHLWNKLLAWDSVYFMKAMASENGKPAFEHEFAFSQFWIHLVRFLAPNHEFYNL
FT                   LKTGVVLDNILHYLATFILYFLTVKIFSGNLKSSYAKSLAKKTSVLFIFSSAAGFLTGI
FT                   YSEPLSFTLSFLGIWARQSAVFTTLPKHIDCLYSRFPLYLFSAICFSLATLNRSNCIVL
FT                   GIYYVFDLWQLLKNRNYGKALLFPLLSGGILFLTCVLQQYVIPYSIFCPERGSWCNTQI
FT                   LGPFTRQSFYGFLQSHYWNVGFLKYWTPNNIPNFLFALPNIIILLYSSVYFSKIYPYYS
FT                   LRPHIWVTTSLVIIVLLFAHVQIINRISTFIPLHLWYIADRLLKTSNSKDKSTPRGDDR
FT                   IAHYYIIWLIFWIPLQTILFAYFLPPA"
FT   gene            <378082..>378699
FT                   /locus_tag="ZYRO0A04664g"
FT                   /old_locus_tag="ZYRO-ORF9283"
FT   CDS_pept        378082..378699
FT                   /locus_tag="ZYRO0A04664g"
FT                   /old_locus_tag="ZYRO-ORF9283"
FT                   /product="ZYRO0A04664p"
FT                   /note="similar to uniprot|Q03446 Saccharomyces cerevisiae
FT                   YDR003W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25640"
FT                   /db_xref="GOA:C5DPM9"
FT                   /db_xref="InterPro:IPR020999"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPM9"
FT                   /protein_id="CAR25640.1"
FT                   /translation="MIIEKTGLIYARDFYDGDDDVSNESWKWARWTLFVIFILAIVMFI
FT                   VGVVGLNRRRKQVGRAPIRGTAWITPPSYRQSQRDHDRREDSEFVPQYTAKANENDLGY
FT                   YDENGEFHLNSKGEFYPPPSSPPPNETSEEPRSNSSMSLTRPENAVTRDRHNSSDVEAE
FT                   FDRDFGRGRPHTETLYTAATNNSSSVEKQHISTPERAKMAES"
FT   gene            <379317..>380801
FT                   /locus_tag="ZYRO0A04686g"
FT                   /old_locus_tag="ZYRO-ORF9282"
FT   CDS_pept        379317..380801
FT                   /locus_tag="ZYRO0A04686g"
FT                   /old_locus_tag="ZYRO-ORF9282"
FT                   /product="ZYRO0A04686p"
FT                   /note="highly similar to uniprot|P38067 Saccharomyces
FT                   cerevisiae YBR006W UGA2 Succinate semialdehyde
FT                   dehydrogenase involved in the utilization of gamma-
FT                   aminobutyrate (GABA) as a nitrogen source part of the 4-
FT                   aminobutyrate and glutamate degradation pathways localized
FT                   to the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25641"
FT                   /db_xref="GOA:C5DPN0"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPN0"
FT                   /protein_id="CAR25641.1"
FT                   /translation="MSSPQPILQRKDLIRDSAYINGLWVKESEQHFDVTDPATNQVIAQ
FT                   LPDQSVSAVNDAIDAAYEAFHTYKNTTPRQRAIWLRNFYNLMLENINDLGQILTWENGK
FT                   ALADSVGEIRYAASYFEWYAEEAPRVYGTVIQPGNAGNRAFTIKQPIGVCGLICPWNFP
FT                   SAMITRKAAAALAAGCTVVIKPDAQTPLSALALAALAEEAGFPKGAFNVVLADKNTPQV
FT                   GVTLCESPKVKKVSFTGSTRVGKLLMKQASTTMKKLSFELGGNAPFIVFENADLDHAVD
FT                   QAIASKFRGLGQTCVCANRLYVQESVVDKFAELMAAKVRQFVLGHGLHSDTTHGCMING
FT                   QAIEKVEEHKKDAIEKGAKIVLEGGPLKELGPHFYNPAIVSHVPQSAKVSKEETFGPLC
FT                   PIFTFKTTEEVVKYANDTDVGLASYVFSRDINTIYTVSEALEVGMVSCNTGLFSDATIP
FT                   FGGVKESGFGREGSLYGLDDYTVVKVVTIGGLPNKI"
FT   gene            <381043..>382434
FT                   /locus_tag="ZYRO0A04708g"
FT                   /old_locus_tag="ZYRO-ORF9281"
FT   CDS_pept        381043..382434
FT                   /locus_tag="ZYRO0A04708g"
FT                   /old_locus_tag="ZYRO-ORF9281"
FT                   /product="ZYRO0A04708p"
FT                   /note="similar to uniprot|P25301 Saccharomyces cerevisiae
FT                   YDR004W RAD57 Protein that stimulates strand exchange by
FT                   stabilizing the binding of Rad51p to single-stranded DNA
FT                   involved in the recombinational repair of double-strand
FT                   breaks in DNA during vegetative growth and meiosis forms
FT                   heterodimer with Rad55p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25642"
FT                   /db_xref="GOA:C5DPN1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPN1"
FT                   /protein_id="CAR25642.1"
FT                   /translation="MDLYDELPQSSLLCDEEFTSLLDACKKYQVSVVDFLTLPSKELAR
FT                   QLQRSTNEVDKFQKSMIAEYDDQLMNFNEVKPISEVEGPVPFTTTDVGIDEALGGGIYT
FT                   HGITEVFGESSTGKSQLLMQLCLSVQLPTNMGGIKGKCVYISTEGDLPTQRLASMISAR
FT                   EELVKHGVSQENVYTVTCCDLINQDHILNVQLPILLENSRGAIKLIIIDSISHHMRVEL
FT                   PTRDFKDHQDNRFYVDQVAERLLDLANKHALAVVVANQVSDRPLFESPEPYVAELTDYE
FT                   YQLGWWVGWRNSSIIYHQKYNEPKNVNSDYQDNEDLLSDDEDGKLIHDEIARVENLSRT
FT                   KAAKVTVANSEKALPPDKRPIERRSTFPSNKQRFHKKRSVDRRVPNLGLNWAKHLSSRI
FT                   LLSKSYRASPMIRRGELHLYKGSDPTTFWQVKRLFKVVFSAYADSKEIPFMITKRGLES
FT                   SLGDD"
FT   gene            complement(<382739..>383563)
FT                   /locus_tag="ZYRO0A04730g"
FT                   /old_locus_tag="ZYRO-ORF9280"
FT   CDS_pept        complement(382739..383563)
FT                   /locus_tag="ZYRO0A04730g"
FT                   /old_locus_tag="ZYRO-ORF9280"
FT                   /product="ZYRO0A04730p"
FT                   /note="similar to uniprot|P41910 Saccharomyces cerevisiae
FT                   YDR005C MAF1 Negative regulator of RNA polymerase III
FT                   component of several signaling pathways that repress
FT                   polymerase III transcription in response to changes in
FT                   cellular environment targets the initiation factor TFIIIB"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04730g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25643"
FT                   /db_xref="GOA:C5DPN2"
FT                   /db_xref="InterPro:IPR015257"
FT                   /db_xref="InterPro:IPR038564"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPN2"
FT                   /protein_id="CAR25643.1"
FT                   /translation="MSVNENGSPSASFSPNSGVKTNKLNDQNLKELVSNSESRYMSSPS
FT                   PGDSNSNSNPRSFYANRRTSSSTGLQPSKSAINRRRSSAVNDPANSINIGPFGPINETA
FT                   SRRTFAYLIAILNASFPDHDFSSLEPTDFLKISLKSMISKFENSLYSLGKNPEEWMWEI
FT                   INSHLDMPDCVIYQYSPPRSFLDDEPGYLWSLVFFLFNKKRKRVAYLYLISSRLESPTE
FT                   GNVNEDEEREKLNQKRRTVIDDEAADYEGEYDLVYDENAIEDDADDAVEVTS"
FT   gene            complement(<384421..>386655)
FT                   /locus_tag="ZYRO0A04752g"
FT                   /old_locus_tag="ZYRO-ORF9279"
FT   CDS_pept        complement(384421..386655)
FT                   /locus_tag="ZYRO0A04752g"
FT                   /old_locus_tag="ZYRO-ORF9279"
FT                   /product="ZYRO0A04752p"
FT                   /note="weakly similar to uniprot|P38213 Saccharomyces
FT                   cerevisiae YBR007C DSF2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25644"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPN3"
FT                   /protein_id="CAR25644.1"
FT                   /translation="MDTDPLEILSLYQYESGRHSSVVSFQSVQTAERLLDKLELSAEDE
FT                   RLLQLALKEEREKNEAEEKERNRVLQREKDEEADAERQREREKEREQSPLLCLPASGFP
FT                   SLKNRSFVTPRRVLTVSVADPLGQGDKGLCTGAEQHLPTKSRYSYFVEEVDSEDEDNDT
FT                   HDNQPSPRPKKPSLGTNPRKKTVRAEIYGAFNVGVAPIQRSNTTATETAPVSRSTSRKT
FT                   VNFEKYRMDTSKLLSKSPSSKKAKLYENNSNNSSSTEFGQNSLLFRSQQSLSDESEGSI
FT                   DGSSVKRNNSSATTKVSSGKDSTTASPLHIFNTATSYKSDGGDSLQNSNKETPTKATLT
FT                   RDTPTKNTPTKDGNGRSHSKKKTSFHLKNLFRSQKASGRKDSLNSKRSTDDLAEMSAMN
FT                   SANTSATTSVGTSAANSPPKGTPFLNNANKSPLFRKFAFPTNTTEPLEDIPSSLSSSSS
FT                   SAKQGSRMQTRDTQHYRSLSDHHAINKSSSIPTITNANTQPFTPGLRNRKLSLDSRHNA
FT                   GRVSRFDTPLTSDNNNNNSTNNNNNEDRIHDAAGSAIHSSPSLHSKRTNIANLGESARK
FT                   LHDACNDGNAEACFLYGMALRHGYGVIPDQEESFHYLFTATGLKSELHDVFEVEINPFE
FT                   LERNQSIPEIAPEPSAPAIYECAISYLKGYGMDHEDEIKGLKFLEKVASMGHLDAMCLS
FT                   GTIWSKKSSVRRKDLARAAAWFRIAEKRGAHLIGAEWIYKDKYIQMAKNY"
FT   gene            complement(<387338..>390376)
FT                   /locus_tag="ZYRO0A04774g"
FT                   /old_locus_tag="ZYRO-ORF9274"
FT   CDS_pept        complement(387338..390376)
FT                   /locus_tag="ZYRO0A04774g"
FT                   /old_locus_tag="ZYRO-ORF9274"
FT                   /product="ZYRO0A04774p"
FT                   /note="weakly similar to YDR006C, uniprot|P40317
FT                   Saccharomyces cerevisiae YDR006C (SOK1),"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25645"
FT                   /db_xref="GOA:C5DPN4"
FT                   /db_xref="InterPro:IPR008862"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPN4"
FT                   /protein_id="CAR25645.1"
FT                   /translation="MEQARPHRSTIATASSEPQTTSTRNRSLSTTGTTTRTTTATIPQQ
FT                   TDIAKTTSSPKDQHGMNMNTNEEGGNTSSNNTEDRKRLSTCSQEHGPGDTTTQASFQPT
FT                   GSLLVRKYTELVSSIGNHFPNEDDGGIDEGGVDIDVNDEEEQEDVGEEGKEVQSNSEND
FT                   GDDGRAEGVNEEENEDSMGNGLFKQFDHRTGQFLRKDPFLAKEDLGVRRLFGKSDNKFR
FT                   SHSVPAICHSSLKRLTASYCQNHNHYHYRHHNNQQSAVGSVRKKRSGKPHHHHHHRRHQ
FT                   HSPYCFVQAAFSNGSGATASTASSTDSGNSSGASSRESSRCVNGASSGNDTGATSFGND
FT                   PKQPAAAGAAATSTASSGVTTGSVTNEGNVGSNVGKSSTTPSLHRSHHQSKNHSMSTNA
FT                   LRDAILLCHQAQQPLVTKYDELTLHERISAVRDHPGPLPLPPINLQCLKEIDLQEIVKN
FT                   PQLRHDIIFDPLLQFRPNLDGERGLKKKQLSDRYWRDVENEVYVYSQKPQVFQYDHTRL
FT                   VPLFDTLREVLLTIVPQREAHVIHNVLDTELNVQELLRGSLIMTNLSEWLAQLFKHHCA
FT                   PMRDAWVDRMSAKFKEAEQESSLSKLIEGLRLVFQILEAMKLDIANHQIRILRPALLSN
FT                   SVEFEKQYFQSLMNSDRVDLKSSLLWFNRKFNESVNQGTIQRDRAVPRDVYKLCIRSII
FT                   SLLSCRKMVREYPTSLSFDHARLILLRADIRQIVCLLICRLLFKQLVANDTSLDKGAKN
FT                   YIDSSGTQKKLKGEIVSIITDEHGNCRWTKNTMAIAIHLCKTITDLRDEYLSRRVQTGV
FT                   GISSSSNTTGTPPSSTPALAQAKVNFAKSWLSKQTQPLSEVYGVLEDRVFRSLEELIFS
FT                   KSDCTVDGRVRQDFVYLCSTLNKDSTITNTSATAAATTSAATSNGLLVPTGENTSAASS
FT                   SSSSSNTNDTNNNTNASTTSSNSHNTTASTFGTATTTTLQGLDMEEFDSVLRHLYAVVN
FT                   FHWSVFGAHYMDAISDQLGSRVF"
FT   gene            complement(<391929..>392240)
FT                   /locus_tag="ZYRO0A04796g"
FT                   /old_locus_tag="ZYRO-ORF9270"
FT   CDS_pept        complement(391929..392240)
FT                   /locus_tag="ZYRO0A04796g"
FT                   /old_locus_tag="ZYRO-ORF9270"
FT                   /product="ZYRO0A04796p"
FT                   /note="highly similar to uniprot|P02309 YBR009C and to
FT                   uniprot|P02309 YNL030W Saccharomyces cerevisiae, HHF1 and
FT                   HHF2, two identical histone H4 proteins; core histone
FT                   required for chromatin assembly and chromosome function;
FT                   contributes to telomeric silencing; N-terminal domain
FT                   involved in maintaining genomic integrity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25646"
FT                   /db_xref="GOA:C5DPC4"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC4"
FT                   /protein_id="CAR25646.1"
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG"
FT   gene            <392758..>393168
FT                   /locus_tag="ZYRO0A04818g"
FT                   /old_locus_tag="ZYRO-ORF9268"
FT   CDS_pept        392758..393168
FT                   /locus_tag="ZYRO0A04818g"
FT                   /old_locus_tag="ZYRO-ORF9268"
FT                   /product="ZYRO0A04818p"
FT                   /note="highly similar to uniprot|P61830 Saccharomyces
FT                   cerevisiae YBR010W One of two identical histone H3
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25647"
FT                   /db_xref="GOA:C5DPC3"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPC3"
FT                   /protein_id="CAR25647.1"
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG
FT                   TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSL
FT                   FEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
FT   gene            <393280..>393930
FT                   /locus_tag="ZYRO0A04840g"
FT                   /old_locus_tag="ZYRO-ORF9267"
FT   CDS_pept        393280..393930
FT                   /locus_tag="ZYRO0A04840g"
FT                   /old_locus_tag="ZYRO-ORF9267"
FT                   /product="ZYRO0A04840p"
FT                   /note="similar to uniprot|P00912 Saccharomyces cerevisiae
FT                   YDR007W TRP1 Phosphoribosylanthranilate isomerase that
FT                   catalyzes the third step in tryptophan biosynthesis in 2004
FT                   the sequence of TRP1 from strain S228C was updated by
FT                   changing the previously annotated internal STOP (TAA) to
FT                   serine (TCA)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25648"
FT                   /db_xref="GOA:C5DPN7"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPN7"
FT                   /protein_id="CAR25648.1"
FT                   /translation="MLVNVKKTKAMSKMVVKICGLQSVEAAQVAIDNGADLLGVICVPN
FT                   RKRTVDAEVAKSISNLCRSKNVKLVGVFRNQSKEDVAKIAQDYNLNVVQLHGDEDWKEY
FT                   DSFIPLPIIKRLVFPRDVEILSQLQNTDCQPLFDSEAGGTGEKLDWQSIGKWYSDANLS
FT                   NGYILAGGLNPDNVRDALKIPGVIGVDVSGGVESDGMKDNEKIKTFLFNAHSL"
FT   gene            complement(<393985..>394848)
FT                   /locus_tag="ZYRO0A04862g"
FT                   /old_locus_tag="ZYRO-ORF9266"
FT   CDS_pept        complement(393985..394848)
FT                   /locus_tag="ZYRO0A04862g"
FT                   /old_locus_tag="ZYRO-ORF9266"
FT                   /product="ZYRO0A04862p"
FT                   /note="highly similar to uniprot|P00817 Saccharomyces
FT                   cerevisiae YBR011C IPP1 Cytoplasmic inorganic
FT                   pyrophosphatase (PPase) catalyzes the rapid exchange of
FT                   oxygens from Pi with water highly expressed and essential
FT                   for viability active-site residues show identity to those
FT                   from E. coli PPase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25649"
FT                   /db_xref="GOA:C5DPN8"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPN8"
FT                   /protein_id="CAR25649.1"
FT                   /translation="MSYTPRQVGAKNTLDYKVFLEKNGKPVSPFHDIPLYADEEKQIFN
FT                   MVVEIPRWTNGKLEITKEEPLNPIIQDTKKGKLRYVRNCFPHHGYIHNYGAFPQTWEDP
FT                   NVVHPETKAVGDNDPVDVLEIGETIGYTGQVKQVKVLGIMALLDEGETDWKVIAIDVND
FT                   PLAPKLNDVEDVEKYFPGLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALDIVRE
FT                   THESWKQLIHGKVSDNKGIALTNTTVTDSPTYSATAASEVPAASPQEDAPVDKSIDKWF
FT                   FISGSA"
FT   gene            <395206..>395278
FT                   /locus_tag="ZYRO0A04884r"
FT                   /old_locus_tag="Zyro0A.tThr.AGT.7"
FT   tRNA            395206..395278
FT                   /locus_tag="ZYRO0A04884r"
FT                   /old_locus_tag="Zyro0A.tThr.AGT.7"
FT                   /note="tRNA-Thr (AGT) cove score=74.49"
FT   gene            complement(<395608..>396090)
FT                   /locus_tag="ZYRO0A04906g"
FT                   /old_locus_tag="ZYRO-ORF9263"
FT   CDS_pept        complement(395608..396090)
FT                   /locus_tag="ZYRO0A04906g"
FT                   /old_locus_tag="ZYRO-ORF9263"
FT                   /product="ZYRO0A04906p"
FT                   /note="similar to uniprot|Q12157 Saccharomyces cerevisiae
FT                   YDL008W APC11 Catalytic core subunit of the Anaphase-
FT                   Promoting Complex/Cyclosome (APC/C) which is a ubiquitin-
FT                   protein ligase required for degradation of anaphase
FT                   inhibitors including mitotic cyclins during the
FT                   metaphase/anaphase transition"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04906g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25650"
FT                   /db_xref="GOA:C5DPN9"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024991"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPN9"
FT                   /protein_id="CAR25650.1"
FT                   /translation="MKVDIEEVHSVFAWTWHIPKDNKDGSLEADDDDDVCGICRASYNA
FT                   TCPSCKYPGDECSLVVGECNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQLKRGLAINDS
FT                   QLEKFKELQLRKRTNTAGEFADEDDEEAIERAMAQQDQAEVDDQGDVIMDQGLVVR"
FT   gene            complement(<396257..>397012)
FT                   /locus_tag="ZYRO0A04928g"
FT                   /old_locus_tag="ZYRO-ORF9262"
FT   CDS_pept        complement(396257..397012)
FT                   /locus_tag="ZYRO0A04928g"
FT                   /old_locus_tag="ZYRO-ORF9262"
FT                   /product="ZYRO0A04928p"
FT                   /note="weakly similar to Saccharomyces cerevisiae YDL010W
FT                   Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
FT                   cerevisiae YBR014C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25651"
FT                   /db_xref="GOA:C5DPP0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPP0"
FT                   /protein_id="CAR25651.1"
FT                   /translation="MGVTLNKRNLRVLSITSLLLLLVFFVVQNANSVSIGESSSLANAN
FT                   SNEDQTLTSAGTSINKESKEEVVTEKQKAKEKQPEGDSVVDAEIGKIKQEVGIGKTDDL
FT                   ETGSSGSISGGGVVGKGGSASEHAQQTEFDPVKEYAMILDFSPIIVFSKSTCPYSKKLK
FT                   ELLDKEYSFTPSYFVIELDRHHNGAELQKYVEQKTGRSTVPNVIINGKSRGGNDEFRSL
FT                   HNEGKLLSSFKDWSQGTFTVLQLDRPSNN"
FT   gene            complement(<397314..>399170)
FT                   /locus_tag="ZYRO0A04950g"
FT                   /old_locus_tag="ZYRO-ORF9260"
FT   CDS_pept        complement(397314..399170)
FT                   /locus_tag="ZYRO0A04950g"
FT                   /old_locus_tag="ZYRO-ORF9260"
FT                   /product="ZYRO0A04950p"
FT                   /note="similar to uniprot|P38069 Saccharomyces cerevisiae
FT                   YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible for
FT                   addition of the first alpha-1 2-linked mannose to form the
FT                   branches on the mannan backbone of oligosaccharides
FT                   localizes to an early Golgi compartment"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25652"
FT                   /db_xref="GOA:C5DPP1"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPP1"
FT                   /protein_id="CAR25652.1"
FT                   /translation="MPLVTRRYGKALRLALLGLLVCLVFLGTTRYNGDHAAAEEYLRKY
FT                   LSGGQLEHALNSVAAHGSDAAAALRQGVGSDQQAVDQQHTQDHASTQSSTLGPDSTAKL
FT                   KRFYEEVFTHLKNFSPEGKSQRIYKEDCPLHGDIGFRPENYDEWPTLAHDSLENCLEIS
FT                   PEEVTMLKKNHAAYVDVLGSLRLPKNVYKGKGIVTVGGGKFSLLALLVIRSMRELGTTL
FT                   PVEVFIPPSDLGENQFCDEILPQYNAKCVYLSDVLPPNVIANSQFTGYQFKSLSLIASS
FT                   FEDVLFLDADNFPVKRLNDVFDLAPYKTTGFVLWPDFWRRTTQPIYYDIADITVNRRKR
FT                   IRNCFDDLTPPEVYTKNTKSMDDIPFHDFEGTIPDVSTESGQLMISKSTHLPTILLALY
FT                   YNVNGPSWYYPMFSQRAAGEGDKETFLAAANFYGLPFYQVKTATGVEGYHRANNEGFRG
FT                   VAMLQHDLNQDYLRYQAAADAIEAKYGGKTAKSIKYDKLYSLDNFYKTFFGSENSALKE
FT                   CDVMFAHSHAPKFDPYGLWTQNELVQDGKHFRSYTSLEKINNYDLELSAIDSIHKFVCL
FT                   DKVNFKYLSEKIQSKQEHQEMCDYISKRREFLLSTHQQAISK"
FT   gene            <400197..>400653
FT                   /locus_tag="ZYRO0A04972g"
FT                   /old_locus_tag="Zyro0A.mRNA.1120.p"
FT   CDS_pept        join(400197..400235,400324..400653)
FT                   /locus_tag="ZYRO0A04972g"
FT                   /old_locus_tag="Zyro0A.mRNA.1120.p"
FT                   /product="ZYRO0A04972p"
FT                   /note="weakly similar to uniprot|P38216 Saccharomyces
FT                   cerevisiae YBR016W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25653"
FT                   /db_xref="InterPro:IPR028144"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPP2"
FT                   /protein_id="CAR25653.1"
FT                   /translation="MSAQEYYGDSKASYSRPQGPPPSSDYYGGASRGYPQGGGGGGGGY
FT                   YQQPPQQHYQQPPPQYTQPGYHGGGGYPQQGAPHQGGYGGGQQPIYVQQQPPQRGNEDC
FT                   LTACLAVLCVCCTLDMLF"
FT   gene            complement(<400896..>402722)
FT                   /locus_tag="ZYRO0A04994g"
FT                   /old_locus_tag="ZYRO-ORF9255"
FT   CDS_pept        complement(400896..402722)
FT                   /locus_tag="ZYRO0A04994g"
FT                   /old_locus_tag="ZYRO-ORF9255"
FT                   /product="ZYRO0A04994p"
FT                   /note="similar to uniprot|P32828 Saccharomyces cerevisiae
FT                   YDL013W HEX3 Ring finger protein involved in the DNA damage
FT                   response with possible recombination role genetically
FT                   identified by synthetic lethality with SGS1 (DNA helicase)
FT                   and TOP3 (DNA topoisomerase) sporulation role interacts
FT                   with Slx8p and Lin1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25654"
FT                   /db_xref="GOA:C5DPP3"
FT                   /db_xref="InterPro:IPR038886"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPP3"
FT                   /protein_id="CAR25654.1"
FT                   /translation="MDLRGRESPEASQEVHINGRDEDPIIIESDQEEDQRIRDDARPIR
FT                   LHPDGRIHRPRDGLNRFVNSEGTNVATTRSQDNGGSDDEVAIVGEINNTRGNEEGPIGS
FT                   DAEYVDLDADNGPQVIEVNDNNRNNNENSDDDGLVIVQERTTAPRVTLNLPGGESLQID
FT                   ASPTDRPYRRSFEWQQQDRTRRQAMERSARRASRLLFHTSDDDDDDSGNGTVENGRLPP
FT                   SVLQLRRQEEERSRLRNITRRRDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQS
FT                   LYEFRSILQSVAPLTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHE
FT                   RQRRLWHNRRHFRIHMGVGGGFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEEST
FT                   QSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIV
FT                   RDGKEETVVVKDDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKY
FT                   QFHCPYQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKG
FT                   SAHPDNYGPKICPAKGCKSPIRTRGKMREAFF"
FT   gene            complement(<403183..>404142)
FT                   /locus_tag="ZYRO0A05016g"
FT                   /old_locus_tag="ZYRO-ORF9253"
FT   CDS_pept        complement(403183..404142)
FT                   /locus_tag="ZYRO0A05016g"
FT                   /old_locus_tag="ZYRO-ORF9253"
FT                   /product="ZYRO0A05016p"
FT                   /note="similar to uniprot|P15646 Saccharomyces cerevisiae
FT                   YDL014W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05016g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25655"
FT                   /db_xref="GOA:C5DPP4"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR020813"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPP4"
FT                   /protein_id="CAR25655.1"
FT                   /translation="MSFRPGSRGGSRGGPRGGGRGGPRGGGRGGRGAPRGGGRGGPRGG
FT                   GRGAPRGGRGGPRGGRGGPRGGGQGGPRGGAKVVIEPHKHDGIYIARGKEDLLVTKNVA
FT                   PGESVYGEKRVSVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVL
FT                   YLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELIAMAKKRPNVVPIIEDARHPQKY
FT                   RMLLGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFARE
FT                   VQKLREERIKPLEQLTLEPYERDHCVVIGRYMRSGLKK"
FT   gene            <404459..>405370
FT                   /locus_tag="ZYRO0A05038g"
FT                   /old_locus_tag="ZYRO-ORF9250"
FT   CDS_pept        404459..405370
FT                   /locus_tag="ZYRO0A05038g"
FT                   /old_locus_tag="ZYRO-ORF9250"
FT                   /product="ZYRO0A05038p"
FT                   /note="similar to uniprot|Q99190 Saccharomyces cerevisiae
FT                   YDL015C TSC13 ER protein involved in very long chain fatty
FT                   acid synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25656"
FT                   /db_xref="GOA:C5DPP5"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR039357"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPP5"
FT                   /protein_id="CAR25656.1"
FT                   /translation="MVLVKSRSKSLRDTQVDVSPGSKFDDVLTAISKNNKDTSIYRLRL
FT                   TYLKENKQIPVVSDEFFAASDVETLYVKDLGPQISWRMVFICEYLGPIIIHSLFYYLSQ
FT                   KPELRSSGSRYNPYMNRLAYLLILAHYLKREVETIFVHQFSQATMPFFNLFKNCFHYWV
FT                   LNGLIALGYFGKGFFFNDSDLFRAYSFLKINNLSALVAFFTIFELWNFYAHIKLRIWGD
FT                   YQKSLGNTKVRVPLDEGIFKIFVSPNYTLELLSWITFTLIFKLNFFALAFTIVSGTQMY
FT                   LWAQKKNKKYGTRRAFLIPYLF"
FT   gene            complement(<405402..>406886)
FT                   /locus_tag="ZYRO0A05060g"
FT                   /old_locus_tag="ZYRO-ORF9249"
FT   CDS_pept        complement(405402..406886)
FT                   /locus_tag="ZYRO0A05060g"
FT                   /old_locus_tag="ZYRO-ORF9249"
FT                   /product="ZYRO0A05060p"
FT                   /note="similar to uniprot|P06243 Saccharomyces cerevisiae
FT                   YDL017W CDC7 DDK (Dbf4-dependent kinase) catalytic subunit
FT                   required for firing origins and replication fork
FT                   progression in mitosis through phosphorylation of Mcm2-7p
FT                   complexes and Cdc45p kinase activity correlates with
FT                   cyclical DBF4 expression"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25657"
FT                   /db_xref="GOA:C5DPP6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPP6"
FT                   /protein_id="CAR25657.1"
FT                   /translation="MSHEDVPREIKDEMEQLYEDVEGLRDEYVLLDKIGEGTFSSVYKA
FT                   EDIKGKVCQRYSSHFWTPGSRYVALKKIYVTSSPQRIYNELNLLYMLTGCTRVAPLCDA
FT                   TRVRDQVIAVLPYYPHEEFRNFYRDLPIKGIKMYLWEMLQALSFVHSKGIMHRDIKPTN
FT                   FLYNPEIGRGVLVDFGLAEMQPDYDRNEVEEDSLASIRDWRSHEQFCPCIVRDTNKQNA
FT                   SSPMVTIQNGKVVHLNNVNGVDLSKGYPKNETRRIKRANRAGTRGFRAPEVLMKCGSQT
FT                   TKIDIWSVGVILLSLLSRRFPLFQSMDDTDSLLELCTIFGWKKIRKCAALHGLGFEVSG
FT                   LRHITENGFPNALKEFIYKLLDKECTVGTFPDYSVAFETYEYLSQELYDRRSIEPKLPG
FT                   SSNAETTITTEGPQAYELKKYQEEIWSDHYWCFQVLEQCLEFDPQKRSSASELLQSAFF
FT                   NELNEADIYTDVETTDEDQMSEEDQAVDDDLLLIPG"
FT   gene            <407307..>407969
FT                   /locus_tag="ZYRO0A05082g"
FT                   /old_locus_tag="ZYRO-ORF9247"
FT   CDS_pept        407307..407969
FT                   /locus_tag="ZYRO0A05082g"
FT                   /old_locus_tag="ZYRO-ORF9247"
FT                   /product="ZYRO0A05082p"
FT                   /note="similar to uniprot|Q12403 Saccharomyces cerevisiae
FT                   YDL018C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25658"
FT                   /db_xref="GOA:C5DPP7"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPP7"
FT                   /protein_id="CAR25658.1"
FT                   /translation="MQHYLILLILLGIGLCSPVTFELPRGQTECFYTLTPKDHCTINYY
FT                   FAVQGGQSNDNTVNYKIYDPSDKESPMIERSNIRLGEWSFPGELRGEYAFCFQGGNEHN
FT                   KIVDLDIRHSCKNEADIWSERRKARREARHLRDLHNDPLQSSVENSVDKIEEQLYQLEI
FT                   NLMYYKARNKRNHHTVRSTDFRIMLFSIYGILLVIGMGLVEIIILKWFFRESRKYAI"
FT   gene            complement(<408037..>409470)
FT                   /locus_tag="ZYRO0A05104g"
FT                   /old_locus_tag="ZYRO-ORF9246"
FT   CDS_pept        complement(408037..409470)
FT                   /locus_tag="ZYRO0A05104g"
FT                   /old_locus_tag="ZYRO-ORF9246"
FT                   /product="ZYRO0A05104p"
FT                   /note="similar to uniprot|P32375 Saccharomyces cerevisiae
FT                   YIR027C DAL1 Allantoinase converts allantoin to allantoate
FT                   in the first step of allantoin degradation expression
FT                   sensitive to nitrogen catabolite repression"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25659"
FT                   /db_xref="GOA:C5DPP8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPP8"
FT                   /protein_id="CAR25659.1"
FT                   /translation="MPIKAIGSQRCIIDSRETAATLLYSTDSGKIIEIYNELVPSVDDP
FT                   RLKLFDVEDFEDVTPKVILPGLVDSHVHLNEPGRTDWEGFATGTRAASSGGVTTVVDMP
FT                   LNAIPPTINVANFNTKLKAAEGQLWCDVGFWGGLVPGNLKDLIPLVKAGVRGFKGFLMD
FT                   SGVPEFPPIDKCYIENAMSELSNSKAMVMFHAELDTGSQETSHDNHHQETDSCQYDSFL
FT                   ASRPDRFEFDAISLIIDCLKKSMAANSGKGPSVHIVHLASMEAIPLMRQAHKDGLPITA
FT                   ETCFHYLSLAAEKIGKGATFCKCCPPIRNEKNRLALWEGLRDGSITSVVSDHSPCTPEL
FT                   KQLEKGDFMSAWGGISSVGLGLPLLHTVGSTLNPSVSLMEIVKWCCENTAEQVGLQHRK
FT                   GHLRIGYDADFVIFDPNAKQRVTNPTVYFKNKLTAYNGQELIGIVQRTILRGLTIFDVS
FT                   HGGPSKSPLGKPILEPREH"
FT   gene            complement(<409797..>412535)
FT                   /locus_tag="ZYRO0A05126g"
FT                   /old_locus_tag="ZYRO-ORF9245"
FT   CDS_pept        complement(409797..412535)
FT                   /locus_tag="ZYRO0A05126g"
FT                   /old_locus_tag="ZYRO-ORF9245"
FT                   /product="ZYRO0A05126p"
FT                   /note="highly similar to uniprot|P38217 Saccharomyces
FT                   cerevisiae YBR017C KAP104 Transportin cytosolic karyopherin
FT                   beta 2 involved in delivery of heterogeneous nuclear
FT                   ribonucleoproteins to the nucleoplasm binds rg- nuclear
FT                   localization signals on Nab2p and Hrp1p plays a role in
FT                   cell-cycle progression"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25660"
FT                   /db_xref="GOA:C5DPP9"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPP9"
FT                   /protein_id="CAR25660.1"
FT                   /translation="MWAPNLESLLQLAVLLRSSMAPHQEERRGAMDALESFKIQPEFLN
FT                   YLCYILIEGESSEALVSHFSAQELQNNRATAGLLLKNTMLDGDNLTKGSQDIGYVKANI
FT                   IHGLYNSNNSLVTNVTGIVITTLFSTYYRQHRDDPMGVQMISNLVELASNGSEASMKTL
FT                   SKIMEDSAQFFQLEWSGHIKPIDNLIACFLDITANGSTTATNRAEAIKCLNTVIPLQPQ
FT                   SFSLRIDEFLNSIFQLAQTDENDDVRVQVCIAFSSLLKFRPDKLVDNLAGLIHFMLHLI
FT                   STVKEEKVSIEACEFIHSFCTDPNIPEHIIQPFVTDIVPVLLTKMVYNEESIMVLESSN
FT                   DDDASEEDKDEDIKPAAPRIVKKQRGDGEDSDDDDDDDDSGVDESDVDTQWNLRKCAAS
FT                   TLDVMTNILPRDVMYVAFPFLKEHLDSDRWFIREATVLALGAMAEGGMKYFDDQLPQLI
FT                   PFLVDQLKDVWAPVRKITCWSLSRFAPWILKDHTEFLIPVLEPVIGRLMDRKKDVQEAA
FT                   ISSVAVFIESCDAELVETVLYDELLNSFNRCFEFYKKKNLIILYDAVSRFAEKVELDER
FT                   AMKVLLPHLVNKWSLLPDNDKELWPLLECLSYVATSLGEKFMPMAPDVYARAFRILCNC
FT                   VELEATSQQNPAIVAPEKDFIITSIDMIDGLVQGLGSQCQPLLFPPGSDNTLLQIMLQC
FT                   LQDPFHEVRQSTFALLGDIVYFFDPQLLAATLSQFLKFIGTEIMHNDDPDGIPALINAI
FT                   WCLGLISERINLGEYIIDLSRVLLDLFTTQGQILDAAVLENLAITMGRISITLPEVFSN
FT                   GLFASDAMWNRWCNALQDLDSLEEKSSAYMGFMNIVNLVGDHVAISNETLKNIIKGLSI
FT                   NVDPTPFAQSIYTFLMKHAERIQGLKLSQEEVTFLQQFNGN"
FT   gene            complement(<412875..>414935)
FT                   /locus_tag="ZYRO0A05148g"
FT                   /old_locus_tag="ZYRO-ORF9243"
FT   CDS_pept        complement(412875..414935)
FT                   /locus_tag="ZYRO0A05148g"
FT                   /old_locus_tag="ZYRO-ORF9243"
FT                   /product="ZYRO0A05148p"
FT                   /note="weakly similar to uniprot|P27637 Saccharomyces
FT                   cerevisiae YAR014C BUD14 Protein involved in bud-site
FT                   selection diploid mutants display a random budding pattern
FT                   instead of the wild-type bipolar pattern"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25661"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPQ0"
FT                   /protein_id="CAR25661.1"
FT                   /translation="MNQGPSVNAFQGSVSPSLLPAEFGGKLSLEEPDTDLLNDPNLTEN
FT                   YSDLLKVKPHRRMEPEDESNSGSVVVTGGSPAKKMNDSHRNNQYSHNTNDDNSNDNNSN
FT                   SNSNSNSNNYDNNSNAGSEDPNNRDQEYDYSDSDFEENLEKRLQDMETEIPGERRATKN
FT                   ESSGGLGSMYDGLLMALSEDEDDLHLEDDEEDEENMELEDELFEEDELQPLPPPQELDP
FT                   DKLYALYAFSGPDPSHCQLKQDEACTLLNDQDAYWWLVRRYTDSKIGFAPAEILETYPE
FT                   RLARLNCWKNENMSPRKNSDTEEQASQEQYTTTDEHSTDDDDDDDDTTAHENNKLSDDD
FT                   NDGDSNPRLALKGYGKSNKSVSFNDVVSYADRYIQDSDDESDYENDEPTQYDEFSESKL
FT                   RMGRIGEDNDGNVDLDDDMSEANSDASFNTASMVPLNIEKRRQPSPPQPALTPPPRHTE
FT                   VQTGKTGSNEDIAKEINENRNSFIETQGTRDEPQEESQDGLHKIFEAPILPFGRKNSHL
FT                   ETSNSDSISIGEFSPSSSEWTNDSPQHQQLADHHSPRTLPPSRAIQDLTRIVDTEDDSS
FT                   TTIHGDSDPKTKSIEENPRQQQQNRRQQQNRNKETPASSSSSSEEIFMEAERAGSSTSV
FT                   NSASSVSRQLFHSSSVISTTTGKHHPIIDQLYDPIFHRMDDLLKQIDDASK"
FT   gene            <415946..>416869
FT                   /locus_tag="ZYRO0A05170g"
FT                   /old_locus_tag="ZYRO-ORF9240"
FT   CDS_pept        415946..416869
FT                   /locus_tag="ZYRO0A05170g"
FT                   /old_locus_tag="ZYRO-ORF9240"
FT                   /product="ZYRO0A05170p"
FT                   /note="highly similar to uniprot|P27616 Saccharomyces
FT                   cerevisiae YAR015W ADE1 N-succinyl-5-aminoimidazole-4-
FT                   carboxamide ribotide (SAICAR) synthetase required for 'de
FT                   novo' purine nucleotide biosynthesis red pigment
FT                   accumulates in mutant cells deprived of adenine"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25662"
FT                   /db_xref="GOA:C5DPQ1"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPQ1"
FT                   /protein_id="CAR25662.1"
FT                   /translation="MVVSVAKTELDGIIPLVARGKVRDIYEVDPETILFVATDRISAYD
FT                   VIMENTVPDKGVLLTKLSEFWFQYLSKDVRNHLVPIPQGKTIFDFLPSELSQEKYKSQL
FT                   EGRSLLVHKFKLIPLEVIVRGYITGSAWKEYTKTGTVHSLPQPQDLRESQEFPRPIFTP
FT                   STKAEQGEHDENISPEKAAELVGQDIADRVEKLAVTLYGKCKEYAKTKGIIIADTKFEF
FT                   GIDEKTNEIILVDEVLTPDSSRFWNGAHYTVGETQESYDKQFLRNWLTSNKLNGVEGVK
FT                   MPEDIVEQTRAKYIEAYETLTGTKYN"
FT   gene            complement(<416951..>418198)
FT                   /locus_tag="ZYRO0A05192g"
FT                   /old_locus_tag="ZYRO-ORF9238"
FT   CDS_pept        complement(416951..418198)
FT                   /locus_tag="ZYRO0A05192g"
FT                   /old_locus_tag="ZYRO-ORF9238"
FT                   /product="ZYRO0A05192p"
FT                   /note="highly similar to uniprot|P22209 Saccharomyces
FT                   cerevisiae YAR018C KIN3 Nonessential protein kinase with
FT                   unknown cellular role"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25663"
FT                   /db_xref="GOA:C5DPQ2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPQ2"
FT                   /protein_id="CAR25663.1"
FT                   /translation="MYNRRDLLGDFVSPKQMRTPSPPSSSQYQVLEEIGRGSFGAVRKV
FT                   LHVPTKKLMVRKEIKYGHMSSKERQQLISECTILSHLKHENIVEFCNWDFEEQHEILYL
FT                   YMEFCSSGDLSHMIKHYKQEKKYIPEKIIWGILAQILSALYKCHYGDELSPLTTIYDRM
FT                   KPPVKRKNIVIHRDLKPGNIFLSADDSGTSADEIHNVDYSQVVVKLGDFGLAKSLGNSI
FT                   QFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVVFEMCSLHPPFQAKNYLELQNRIK
FT                   SGKFDRIPEYYSNGLNAIVHSMIDTNLKTRPSTFELLQDIQIRTARKSLQLERFERNLL
FT                   DYEKELANIEKILEKQATDYERETAHLREQFVQAVEERAREVLSGKKIGKVPDTIYGYY
FT                   DKRVPKPAYHWRTRYR"
FT   gene            complement(<418443..>421268)
FT                   /locus_tag="ZYRO0A05214g"
FT                   /old_locus_tag="ZYRO-ORF9237"
FT   CDS_pept        complement(418443..421268)
FT                   /locus_tag="ZYRO0A05214g"
FT                   /old_locus_tag="ZYRO-ORF9237"
FT                   /product="ZYRO0A05214p"
FT                   /note="similar to uniprot|P27636 Saccharomyces cerevisiae
FT                   YAR019C CDC15 Protein kinase of the Mitotic Exit Network
FT                   that is localized to the spindle pole bodies at late
FT                   anaphase promotes mitotic exit by directly switching on the
FT                   kinase activity of Dbf2p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05214g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25664"
FT                   /db_xref="GOA:C5DPQ3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPQ3"
FT                   /protein_id="CAR25664.1"
FT                   /translation="MTERINLTPAQQQQALNRSEQSVKQEPQKRNQIQYQLKQVIGKGS
FT                   YGVVYKAINRKTQKLVAIKEVHYENDDELTDIMSEIDLLKNLNHINIVKYHGFIQKSHN
FT                   LYIILEYCSHGSLKNYISRGNGLPESKAKVYVKQTLNGLNYLHEQGVIHRDIKAANLLL
FT                   DSNNVVKLADFGVSTKVNTMTMAMTLAGSLNWMAPEIIGNRGASTLSDIWSLGATVLEV
FT                   LTGNPPFYNLVDINIYYAIENDAFIPPSFISKEAQDFLSTCFQKNMYQRPTAAQLLRHK
FT                   WVAGESPANKLELFKESNNEMDFQWDHDFKEPLHDPSLANPSSQHTSVPTSYLPSLAKT
FT                   RVNYSSASSVSSSSLVTTVTGSSESKTHGDPSTPHRSMHRTAANVEWAKGILDNLGKGT
FT                   VRLTSDVLSILFENLDGEDISQSIIHLLRDSSNENMIISLFEYDKKFNFGNLKKKFISM
FT                   GGVPSVLEYNNIIEQFFLKDNYKVLIQCGILYRTHILKDSITLELAYKFLDIVDSPQFW
FT                   CQWCSKHVKVPNLIANLTNKSTQSIVLKLSSFPEASSWFPKQFIENILKLPPTTEQPMY
FT                   TIFKALTSILIQLHNSTAAEIVAATPSKVPTTTAPSMELPEAFLPWILGFFEDSKFCDE
FT                   ENSYVWKYYMSVIYHATHLNRLLLNQLLNNTNFINLILRLLTTRAKSLQLLHVPLSIVM
FT                   EISTELTEFHPVLVELSLHFLRSHEEFIVGGLEILLNSLQFALHDTTKFISHPDSLAIE
FT                   FPSGSSGKPSVLLTYRDLVEPFFRIKENNLEFGNFITKFMKICLLTPLAFISFKIFSHS
FT                   SFNERLTAFFMLYRNSLLIQIDLLKFVKLIIARSLEYLSTLKERDLSAEVVIKKRLEVM
FT                   MDFLDRNWNHQIEGQVGCDSILIHQLCNDIKSFATASPSSFAIPSVRRQQSKSRFNLSL
FT                   QNDAFDIPDRT"
FT   gene            <422152..>424197
FT                   /locus_tag="ZYRO0A05236g"
FT                   /old_locus_tag="ZYRO-ORF9234"
FT   CDS_pept        422152..424197
FT                   /locus_tag="ZYRO0A05236g"
FT                   /old_locus_tag="ZYRO-ORF9234"
FT                   /product="ZYRO0A05236p"
FT                   /note="similar to uniprot|P80235 YAR035W Saccharomyces
FT                   cerevisiae YAT1 Outer carnitine acetyltransferase
FT                   mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25665"
FT                   /db_xref="GOA:C5DPQ4"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR039551"
FT                   /db_xref="InterPro:IPR042231"
FT                   /db_xref="InterPro:IPR042232"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPQ4"
FT                   /protein_id="CAR25665.1"
FT                   /translation="MPDLPRLPIPPLRETLNRYLARVEPLQEDRQNNKTRECVLSDDNL
FT                   KMMQKLHEHLLEYDKQLAREKPQSSYIEDFWYDAYLMYEASVVLNVNPYFLLEDDRTIK
FT                   NVMGCYGEYTCQVKRAAKLIFSILKFIKEIRHENLRPDVVRGKTPLSMDQYAKLFGCSR
FT                   IPAGPGEKSCHLQVDPTSHHVMVTYKSQFYWFDVLDVNNIPIFSTPEPIEWNLYSIIMD
FT                   SEQSEASRPPFGVFITENRRVWSNVRDYIFHDSDPTNWKNLKIIDSALFVICLDDASFT
FT                   EDNELIKSMLCGTSQIRLGPNDLAKPLDAQHGTCLNRWYDKLQLIVTQNGKAGINFEHT
FT                   AVDGHTVLRLAADIYTDSILGFARGVTKNVPDVFTETSESDSENVNLNLITIPRKLEWK
FT                   VDPFILSSLHFAETRISDSVSQHEFAALDFTKYGSNHIKASFQCSPDALVQQVFQVAYY
FT                   ALYGKFETTYEPAMTKQFTNGRTEAIRSVTSESKKFVKSMFDRYAIDEHRIRFLRRACN
FT                   KHSQIIKECSEGLGQDRHLYALYCIWNEYYKDTMPLPPIFSDKSWSIHNSTVISTSNCG
FT                   NPCLKSFGFGPVTPNGFGIGYIIRDNSISLVVSSRHRQTNRFASLIEHSLLEIDHVFQR
FT                   RSAADSEISAVTPSTRHGFGRLEQQRSDSLVHLLSGYNYFDVNVSG"
FT   gene            <424968..>429614
FT                   /locus_tag="ZYRO0A05258g"
FT                   /old_locus_tag="ZYRO-ORF9233"
FT   CDS_pept        424968..429614
FT                   /locus_tag="ZYRO0A05258g"
FT                   /old_locus_tag="ZYRO-ORF9233"
FT                   /product="ZYRO0A05258p"
FT                   /note="some similarities with uniprot|Q12451 Saccharomyces
FT                   cerevisiae YDL019C OSH2 Member of an oxysterol-binding
FT                   protein family with seven members in S. cerevisiae family
FT                   members have overlapping redundant functions in sterol
FT                   metabolism and collectively perform a function essential
FT                   for viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25666"
FT                   /db_xref="GOA:C5DPQ5"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPQ5"
FT                   /protein_id="CAR25666.1"
FT                   /translation="MDRDSVAIISPGGQSYSSSSNLDPQLDRTRSQSTGNESGEHDVAL
FT                   ASKPLLKLKLLDSLRQGNFKQLEALIKNEFQPVGDPNVEEVRNLVLHYAVQVAPAALIK
FT                   DIVREWANNTRGGITIDINYRDENGDTPLHLSAFQSRGDVIEFLMDQPHVNDCILNNSH
FT                   LQPVEMCRNLSIAHMMQAKRATYVAEIAQEFRTAFNNRDFGHLDSILVNPRNAELLDIN
FT                   GMDPETGDTVLHEFVKKRDVIMCRWLLEHGADPFNRDRQGRLPVDLVGKVNENDSATNT
FT                   KVAIDIELKKLLGKAAKEQSVIDVTNNLHEPPTHKGYLRKWTNFAQGYKLRWFILSGDG
FT                   KLSYYKDQADTRNACRGSLNMSTCYLHLDSSEKLKFEIIGGSNGAIRWHLKANHPIETN
FT                   RWVWAIQGAIRFAKDRELLMKSGTVPPSLAMSRGLNAGGRYDSPLYSSQLQYNQGGGKN
FT                   SQLLDEELGVSDGSAQQGRMPSSSDHRNKRVSTASITSNDLRLNNNLTESGKEYVNRMV
FT                   GNRLDSSSREGRSRTNSNLSHNHANERSGHNSLVGGVAGHPGNSQINNQKRQVNETQGE
FT                   DRLPQQQSQQEEQQYYGHHQTNANVQPKKSTPLEASSTQLTSTARTPEHAGGAFEPAPT
FT                   DSIDSHVPSNEDELDNFSDEEEDNQDRNSNFDVDDEDVKTQYGPYSQRLSMLQRSLSME
FT                   LSSLKELLDTGHPSEEAWGMLRKSLGSISNTFEKLYFLTSSRDKKLGSLLAKQREVNNV
FT                   WIQSVKDLELELIEKSNRLASLDKERRGLKKLLHKKLSEAGASTDGSQFDSTTSRQVDD
FT                   SNATLEGIAKFIEATREEDEESDAEVFFDAEDLVDASDEDEERYPSESTNQTKPDSSEG
FT                   SIPQHGDRSYGNKKEEEGKSQNRDTDYNGKDAEQKFSINEPPSTAPPPVPSTHEDTTSQ
FT                   KVPEEVRPESQYSSSDQTRISSASHNRNPFRETEGQYAAEGASKNNEDIGKETENFERN
FT                   EGQAGGAPSSNELKQLNTKVPDERSRKEPSSTGSPVEMARDKVGTPQEPQVLRPQGKRP
FT                   PKDVGSGAAVAGGVAAGAGGAAGVSKSDSTKNQKEDFGPRHDSNQSSMKKPSANKPEQQ
FT                   DGTAQDNELMNLPMVGETEKQKQKYSVILKEGSFKGYEDGVRKRLRIDDDDRPAISLWS
FT                   VLKSMVGKDMTRMSLPVTFNEPTSLLQRVAEDLEYSDLLDTASTFEDSSLRMLYVAVFT
FT                   ASSYASTVKRVAKPFNPLLGETYEYCRPDKGYRFFTEQVCHHPVVSATWTESAKWDFWG
FT                   ESNVDTGFNGRSFNIKHLGLWYIKMRPDSSEGEELYTWKKPNNTVIGILVGNPQVDNNG
FT                   EVEVVNHTTGDRCLINFRARGWRSQGAYEVTGEVFDKNNNKKWILGGHWNDAIYAKMAT
FT                   PKNDSDIMKTKDTSSTGPKFDGSKFLVWKASPRPEAPFNLTPFAITLNAPQPSLVPWVA
FT                   PTDTRLRPDQREMEDGVYDKAGDEKHRLEQKQRMVRRKRAETGEVHKPVWFHKEVHPVT
FT                   KSEYWQFNGDYWKLRKDHKLKEVCPDIF"
FT   gene            <430218..>431873
FT                   /locus_tag="ZYRO0A05280g"
FT                   /old_locus_tag="ZYRO-ORF9229"
FT   CDS_pept        430218..431873
FT                   /locus_tag="ZYRO0A05280g"
FT                   /old_locus_tag="ZYRO-ORF9229"
FT                   /product="ZYRO0A05280p"
FT                   /note="similar to uniprot|Q6B2F0 Saccharomyces cerevisiae
FT                   YOL055C THI20 Hydroxymethylpyrimidine phosphate kinase
FT                   involved in the last steps in thiamine biosynthesis member
FT                   of a gene family with THI21 and THI22 functionally
FT                   redundant with Thi21p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25667"
FT                   /db_xref="GOA:C5DPQ6"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPQ6"
FT                   /protein_id="CAR25667.1"
FT                   /translation="MTLSISINTPPPYLVLNKNEQLPVVMTVAGSDSSGGAGIEADIKT
FT                   ITAHRCYAMTCMAALTAQTPAKVYSIHPLPKEFISQVLDANLKDMNCDVIKTGMLTANA
FT                   VEALAAKLDSMGSKRPKLVIDPVLVATSGSALSSEELIELVKEKITPLADLLTPNIYEC
FT                   FKLIGSEFELQNVSDLYELARRVSVATKSRNILVKGGHIPWGQDGKNFVTDVLYLSQED
FT                   KFVVYNGPRILTTATHGTGCTLASAIASNLARGYPIAQAVYGGIEYVQSGVSISCQVAS
FT                   SHIKDNGPINHVYAVEVPLEGMVQDECFTARDVIPSTVNQTVSDIIKGDFFEYLISHPK
FT                   VKPHWESYIHHDFVRQVAQGTLPIHKFQFFIEQDYAYLLDYARVHCIAGSKAPSLDDVE
FT                   KELVIVGGVKNEMSQHEKRLKQEFGVSDNSYFDRIERSQALKAYSRYFNDVAKRGNWQE
FT                   LVASLSPCLMGYGEALLHFRSDIVVEEGTVYREWCDTYLSPWYVDGMEQGKSLLNQIAR
FT                   TYPADQLDNLVSIYANVCELETNFWGSALEHRVE"
FT   gene            <432548..>433843
FT                   /locus_tag="ZYRO0A05302g"
FT                   /old_locus_tag="ZYRO-ORF9227"
FT   CDS_pept        432548..433843
FT                   /locus_tag="ZYRO0A05302g"
FT                   /old_locus_tag="ZYRO-ORF9227"
FT                   /product="ZYRO0A05302p"
FT                   /note="some similarities with uniprot|Q03465 Saccharomyces
FT                   cerevisiae YDL020C RPN4 Transcription factor that
FT                   stimulates expression of proteasome genes Rpn4p levels are
FT                   in turn regulated by the 26S proteasome in a negative
FT                   feedback control mechanism RPN4 is transcriptionally
FT                   regulated by various stress responses"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25668"
FT                   /db_xref="GOA:C5DPQ7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPQ7"
FT                   /protein_id="CAR25668.1"
FT                   /translation="MTSTELDLKRTLTDVLEDELYNINYHGQNSRRNVLGLSLPAEFDE
FT                   TMLNGEFWNQQQQPQQQPQQDQQIEWNQSQDENNIFNKYADPSLTTTSSHLKNDNNNVA
FT                   TTPVQGTVNLNSVMKVNNPFLNMRYQLPYDVKITNDYHDEADSIYSPQADEDPIGFDGS
FT                   NNPKMQWPLQDNNMALSNEDARMIFDHEFAADDDDLSDEDDDEDGNEDENQKVFDACDF
FT                   VDGTKGFGAQDSSDQAIMDDEDDDLIDEDELYEPSIRNGRKESVVTTPQAAIVEPSPPI
FT                   TTSTSSSAFTPSDSRSSNNNSRSRRKLPITDTNSNNNNLTSTGSHHNSSSSNNGEIYTC
FT                   LILNNITRQPCSAQFSRSYDLTRHQNTIHAKKKTVFRCSECIRMLGHDGYQKTFSRLDA
FT                   LTRHIKSKHENLSLEQRQEVTKYAKENIGYVV"
FT   gene            complement(<434078..>434983)
FT                   /locus_tag="ZYRO0A05324g"
FT                   /old_locus_tag="ZYRO-ORF9226"
FT   CDS_pept        complement(434078..434983)
FT                   /locus_tag="ZYRO0A05324g"
FT                   /old_locus_tag="ZYRO-ORF9226"
FT                   /product="ZYRO0A05324p"
FT                   /note="highly similar to uniprot|Q12326 Saccharomyces
FT                   cerevisiae YOL056W GPM3 Homolog of Gpm1p phosphoglycerate
FT                   mutase which converts 3-phosphoglycerate to 2-
FT                   phosphoglycerate in glycolysis may be non-functional
FT                   derivative of a gene duplication event"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25669"
FT                   /db_xref="GOA:C5DPQ8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPQ8"
FT                   /protein_id="CAR25669.1"
FT                   /translation="MTIESNTFKLILLRHGQSELNHENIFCGWIDAGLTQKGKDQAKNA
FT                   ANLIIDYCQTHSIPLPQVGYISRLVRTRQTMEVILAEMNLKGSYEVVSGSNYEPKGQLK
FT                   QGYTSVLETWRLNERHYGSWQGKRKPDVLKEYGEDQYMYIRRDYEGKPPHVDLNREMLQ
FT                   EVNDQGSSTGYDFKEPNRHLKYNIEEQIGEELPASESLKDVVQRLEPFIRNVVIPTSQK
FT                   NNLDSSLIIGHGSSVRSILKILQGISDEDIKSVDIANATPLVVELDKQNFTFVRRYYLD
FT                   PEKAKIDAEKVRREGFQSNP"
FT   gene            complement(<435197..>437278)
FT                   /locus_tag="ZYRO0A05346g"
FT                   /old_locus_tag="ZYRO-ORF9225"
FT   CDS_pept        complement(435197..437278)
FT                   /locus_tag="ZYRO0A05346g"
FT                   /old_locus_tag="ZYRO-ORF9225"
FT                   /product="ZYRO0A05346p"
FT                   /note="similar to uniprot|Q08225 Saccharomyces cerevisiae
FT                   YOL057W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25670"
FT                   /db_xref="GOA:C5DPQ9"
FT                   /db_xref="InterPro:IPR005317"
FT                   /db_xref="InterPro:IPR039461"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPQ9"
FT                   /protein_id="CAR25670.1"
FT                   /translation="MVNSVADRDAPISMLSVRDYFPQLSKQKQLYAHYMSKASHAGTRI
FT                   VLRQVSKESESIYDTLLYVHLQLDGNYPDEPETKLYLDYFSQFLSNLGNYKSFGDAKFV
FT                   PGCSKEFFTKILKSASLKLENPPPSGSKDFNTLGQLVDEGIYFINEKIAFLGYPSEGFV
FT                   SSYYLGGKVSAEDMALLKQEVFGRLGILPENTRIEKLKEKEFAIWVASENKTNTLAPTY
FT                   PNSNFTLSNGSTVSFKFGDHSRELGIVASYLQKAKEYAANDTQRHMLDQYIDHFTSGSS
FT                   HAHKEAQKLWVKDISPAIETNIGFIETYREPSGIIGEFESLVAIQNEERTAKFSTLVSN
FT                   AQDFITLLPWDSAFEKNEFHPPDFTSIEVLTFAGSGIPAGINIPNYDDVRLNVGFKNVS
FT                   LGNILSASAKGSSTHPPSFIAPEDRPIYDKCQGDSFEVQVGIHELLGHGSGKLLSETKD
FT                   GFNFDKENPPLGLDGKPVTTYYKLGETWGSKFSSVAGSFEECRAEVIAMYLITNRKLLE
FT                   IFGFKTKEDQDNIIYAGYLQMARAGLLALEYWDPESGKWGQPHMQARFSIMKTFLKHSP
FT                   NPKFLQIEPLDDGKDLVIRLDKSLIETAGHECVKDYLQHLHIYKSTADVENGSKYYNER
FT                   SQVTPDLAKLRDLVVSKRLPRKQFVQANTILTPSGEVELKEYEETPFGLIKSFIERET"
FT   gene            complement(<437507..>438766)
FT                   /locus_tag="ZYRO0A05368g"
FT                   /old_locus_tag="ZYRO-ORF9224"
FT   CDS_pept        complement(437507..438766)
FT                   /locus_tag="ZYRO0A05368g"
FT                   /old_locus_tag="ZYRO-ORF9224"
FT                   /product="ZYRO0A05368p"
FT                   /note="highly similar to uniprot|P22768 Saccharomyces
FT                   cerevisiae YOL058W ARG1 Arginosuccinate synthetase
FT                   catalyzes the formation of L-argininosuccinate from
FT                   citrulline and L-aspartate in the arginine biosynthesis
FT                   pathway potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25671"
FT                   /db_xref="GOA:C5DPR0"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPR0"
FT                   /protein_id="CAR25671.1"
FT                   /translation="MSKGKVCLAYSGGLDTSVILAWLLEQGYEVVAFLANVGQEEDFDA
FT                   AREKALKIGASKFVCVDCREDFVKDILFPAVQVNAVYEDVYLLGTSLARPVIAKAQIDV
FT                   AEAEGCFAVSHGCTGKGNDQIRFELGFYALKPDVKVIAPWRLPEFFERFAGRKDLLEYA
FT                   ASKGIPVTQTKSKPWSTDENQAHISYEAGILEEPDTTPPKDMWKLITDPEDAPNKPQDL
FT                   SIDFQEGLPVKVTYQDSEGKSHTVTSPSDIFLTVSNLGRANGVGRIDIVENRYINLKSR
FT                   GCYEQAPLTILRKAHVDLEGLTVDREVRHLRDQFVTPTYSKLLYNGAYFTPECEYVRSM
FT                   IKPSQTTVNGTVRMRLYKGNAMVLGRSSSTENLYDPTESSMDELTGFSPIDTSGFINIQ
FT                   AIRIKKYGESKKSKNQKFTL"
FT   gene            complement(<439160..>440329)
FT                   /locus_tag="ZYRO0A05390g"
FT                   /old_locus_tag="ZYRO-ORF9222"
FT   CDS_pept        complement(439160..440329)
FT                   /locus_tag="ZYRO0A05390g"
FT                   /old_locus_tag="ZYRO-ORF9222"
FT                   /product="ZYRO0A05390p"
FT                   /note="highly similar to uniprot|Q00055 Saccharomyces
FT                   cerevisiae YDL022W GPD1 NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase key enzyme of glycerol synthesis essential
FT                   for growth under osmotic stress expression regulated by
FT                   high-osmolarity glycerol response pathway homolog of Gpd2p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25672"
FT                   /db_xref="GOA:C5DPR1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPR1"
FT                   /protein_id="CAR25672.1"
FT                   /translation="MAATDRLNQTSDILSHSMKKTDSSMSIVTAENPYKVAVVGSGNWG
FT                   TTIAKVVAENTKEKPELFQGRVDMWVFEEQIDGTPLTQIINTKHQNVKYLPNIDLPENL
FT                   VANPDLISTTKDADVIVFNVPHQFLGRIVSQMKGQIKPDARAISCLKGFEVGPKGVQLL
FT                   SDYVTQELGIQCGALSGANLAPEVAKEHWSETTVAYQVPDDFKGEGKDIDHRVLKQLFH
FT                   RPYFHVNVIDDVAGISIAGALKNVVALGCGFVTGLGWGNNAAAAIQRVGLGEIIKFGRM
FT                   FFPESKVETYYQESAGVADLITTCSGGRNVRVATEMAKTGKSGEQVEKDILNGQSAQGL
FT                   ITAKEVHQWLESSGHTEEYPLFEAVYQITYENVPMKELPSMIEELDIVE"
FT   gene            <441743..>442381
FT                   /locus_tag="ZYRO0A05412g"
FT                   /old_locus_tag="ZYRO-ORF9218"
FT   CDS_pept        441743..442381
FT                   /locus_tag="ZYRO0A05412g"
FT                   /old_locus_tag="ZYRO-ORF9218"
FT                   /product="ZYRO0A05412p"
FT                   /note="highly similar to uniprot|Q12314 Saccharomyces
FT                   cerevisiae YOR021C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25673"
FT                   /db_xref="GOA:C5DPR2"
FT                   /db_xref="InterPro:IPR007364"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPR2"
FT                   /protein_id="CAR25673.1"
FT                   /translation="MKYVIEHMEHGFSEWVTLEYAQIIREVGSENLILSSLPQGTETKD
FT                   IPQQLLELGLRWTTCDLLHLRESFQDLVPLSNGRVCLLDPRASQDIQPDESASFDYFVF
FT                   GGILGDHPPRDRTSEIKNQYPNLVVGRRLGDKQMTTDTAVRTTQLIVEKKVALDKIRFI
FT                   DYPEFRFNANEATEMPFRYVIDEKGEPILPAGMMELIKKDSEQSLDDLL"
FT   gene            <443422..>443739
FT                   /locus_tag="ZYRO0A05434g"
FT                   /old_locus_tag="ZYRO-ORF9216"
FT   CDS_pept        443422..443739
FT                   /locus_tag="ZYRO0A05434g"
FT                   /old_locus_tag="ZYRO-ORF9216"
FT                   /product="ZYRO0A05434p"
FT                   /note="highly similar to uniprot|P38910 Saccharomyces
FT                   cerevisiae YOR020C HSP10 Mitochondrial matrix co-
FT                   chaperonin that inhibits the ATPase activity of Hsp60p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25674"
FT                   /db_xref="GOA:C5DPR3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPR3"
FT                   /protein_id="CAR25674.1"
FT                   /translation="MSTLLRSAKSIAPLLDRVLVQRIKAQPKTASGLYLPEKNVEKLNQ
FT                   AKVLAVGPGFTDNNGNKVTPQVQAGDQVLIPQFGGSTIKLQSDEEVLLFRDTEILAKIN
FT                   E"
FT   gene            complement(<443792..>445051)
FT                   /locus_tag="ZYRO0A05456g"
FT                   /old_locus_tag="ZYRO-ORF9215"
FT   CDS_pept        complement(443792..445051)
FT                   /locus_tag="ZYRO0A05456g"
FT                   /old_locus_tag="ZYRO-ORF9215"
FT                   /product="ZYRO0A05456p"
FT                   /note="weakly similar to uniprot|Q03338 Saccharomyces
FT                   cerevisiae YDR473C PRP3 Splicing factor component of the
FT                   U4/U6-U5 snRNP complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25675"
FT                   /db_xref="GOA:C5DPR4"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR013881"
FT                   /db_xref="InterPro:IPR027104"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPR4"
FT                   /protein_id="CAR25675.1"
FT                   /translation="MPAKKDDSAKGRNRGLQTEINPLLLSSNPNLIRRQYRGQNPYLST
FT                   YGVEDKKIRKRFEKGLKFHEKGEISANIERERELLKAEKEQELKRREFEAQRREEVRKK
FT                   VECGELPDTSIGEEKFAPREVPIVEWWDKPFLDDQLNILSKYTADTIAADDEESEDEDD
FT                   ERPSIRYVEHPVPIKADSSRPVAKVYLTKSEQKRIRRNRRKLQREEHETRIKMGLEPKL
FT                   EPKVSLRNMMSVYENNQNITDPTAWESTVRQQVASRKRKHEEMNAARHEEAQQNKKAKN
FT                   ETITPGDHCKVFRFQNLSNPRIRFKLKTNAQQLSLKGLCLRVGENGSGIIVIVGSEKSC
FT                   KFYDKLVTRRIHWDETFENKETHETADMSGNHAEKVWEGEWEGPSWGPFFMKICQDRQE
FT                   MEELLRQRNAEHLITSINGK"
FT   gene            complement(<445269..>447572)
FT                   /locus_tag="ZYRO0A05478g"
FT                   /old_locus_tag="ZYRO-ORF9213"
FT   CDS_pept        complement(445269..447572)
FT                   /locus_tag="ZYRO0A05478g"
FT                   /old_locus_tag="ZYRO-ORF9213"
FT                   /product="ZYRO0A05478p"
FT                   /note="some similarities with uniprot|Q99248 Saccharomyces
FT                   cerevisiae YOR019W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25676"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPR5"
FT                   /protein_id="CAR25676.1"
FT                   /translation="MSVQNDNDDVLKNAYRHIKLYADLSEVNAKHPKYNPNDERQFRPC
FT                   VSFNTVPLTLGSSALDDPLADFPGVQIPPEFSLDDLCSNEGIARTVANTHNDYYSPRGP
FT                   ASQNKRLTHKSLAESFKRSENGKIVRVDYPSEPAIFNDALILTKSKNQWHHLWNEKKAY
FT                   FAAKLDEKYKWFQYPTILFPPTGTKSAVMSSDGFIPLSKEQRRKEKVLNLKLGHLPNPR
FT                   TILCHISGRRHTWVALDWALRQLAQDTDYIVVVASLPRFSSSVNDRSRSKIRGGSSQYR
FT                   SLSVGPNSGENETIHQNFIGWSSGYNRYDVESKIMDIFEYIKVILPPKLAVKITVDVVV
FT                   GKTKKVMVDAVNCYTPDFCVEGTLKWERTDKLVVYKSRFLKDVLCTKFSVPVFIVPAKR
FT                   LYDFEAKMEREFLPKVTDVGGITAEELKPSPLTMETLSRTKTEPSNFDSRDSLVLNYSS
FT                   AEKSSVDYDTDDDSGEDSGDYSDKDDMTVSEKLSSARLIHRKNMMKELQSVESNDKLDY
FT                   AQKKVGALDSIIKETLEFSEELKSITEEDFKGDEGEELNQLKRVITGSTRVLPNSKKSM
FT                   LDVLDTPGPDSPDHHKRSTAPRRKPRSGQIKFAPNVNAKDGNKALGNSRGKGYLDVARP
FT                   SLGSQSYSYNQIDGAGKPYNEEELRRVSTGDGTVPLRKVVSANNVARVKSNDSNSLLPI
FT                   HSSGSVPGSRSSSSRRNRHSKKSSGGGGLLSFLIPSGSRSHSHSRRSSSDSDGERSSVK
FT                   SPQEGKKKRSFFGW"
FT   gene            complement(<448060..>448785)
FT                   /locus_tag="ZYRO0A05500g"
FT                   /old_locus_tag="ZYRO-ORF9211"
FT   CDS_pept        complement(448060..448785)
FT                   /locus_tag="ZYRO0A05500g"
FT                   /old_locus_tag="ZYRO-ORF9211"
FT                   /product="ZYRO0A05500p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25677"
FT                   /db_xref="GOA:C5DPR6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPR6"
FT                   /protein_id="CAR25677.1"
FT                   /translation="MMDWGCLKSWFEHIWYKVASIFLFQKELSIAVIGLQNSGKTTFVQ
FT                   LLSGKPFQVDTVPTLGIQSEKFTLGNNSVNVYDLAGQTRFQPLWERCFDKVDLIVYMID
FT                   LSDLHSLEESFTKLTKVIQMTNDDRIPLLIMGNKTDAIPDAIANQNYSTRCLPETLLTD
FT                   YNYDTIECCKLEPSNLHQLKSVESLSKQLGIDLRNRLLHVPFGSATEPLPLDRDIAIFT
FT                   VSCKTGGFIKDVMDWIVQL"
FT   gene            complement(<448960..>449613)
FT                   /locus_tag="ZYRO0A05522g"
FT                   /old_locus_tag="ZYRO-ORF9210"
FT   CDS_pept        complement(448960..449613)
FT                   /locus_tag="ZYRO0A05522g"
FT                   /old_locus_tag="ZYRO-ORF9210"
FT                   /product="ZYRO0A05522p"
FT                   /note="similar to uniprot|Q03362 Saccharomyces cerevisiae
FT                   YDR476C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25678"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPR7"
FT                   /protein_id="CAR25678.1"
FT                   /translation="MAVGNVQDLLANMNKKHKLALEDYLYVFGGVSSSEKVLNVRLLNL
FT                   DSQCMTILFNHKDIEYDIEKIIIFEPPLEDRSEATARLNRMAREAAAKRHLAHFQINDM
FT                   VYPQSFIEYLVLLGVFLPMLCYKFRPLLYWLPIPLHIRQWLDNDVILRTIMLLEVLMHL
FT                   AETLIFLRPKLQFYRVPPDFLIEWYLFGILEGFAPVKRLSRMAARVEATGNIEN"
FT   gene            <450809..>452704
FT                   /locus_tag="ZYRO0A05544g"
FT                   /old_locus_tag="ZYRO-ORF9207"
FT   CDS_pept        450809..452704
FT                   /locus_tag="ZYRO0A05544g"
FT                   /old_locus_tag="ZYRO-ORF9207"
FT                   /product="ZYRO0A05544p"
FT                   /note="highly similar to uniprot|P06782 Saccharomyces
FT                   cerevisiae YDR477W SNF1 Protein serine/threonine kinase
FT                   required for release from glucose repression invertase
FT                   expression sporulation and for expression of catabolite-
FT                   repressed genes when glucose is limiting regulates Adr1p-
FT                   dependent transcription primarily at the level of chromatin
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25679"
FT                   /db_xref="GOA:C5DPR8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013896"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR028375"
FT                   /db_xref="InterPro:IPR032270"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPR8"
FT                   /protein_id="CAR25679.1"
FT                   /translation="MNGSAAVSSSGTGSSSERHHRHHHHRHHHHGQGNGHSQQNLLADG
FT                   SHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGRIEREISYLR
FT                   LLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEEEARRFFQQIISAVEY
FT                   CHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGK
FT                   LYAGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSEGAAGLIKR
FT                   MLIVNPLNRISILEIMQDDWFKVGLPTYLIPPELKQQEQEQQQQQEQHDDGTKNNSEEI
FT                   DDELVTALSKTMGYDRDEIYESLESRDRTSVLNEIREAYMLIKENKSLIKDLKSDRDRS
FT                   DELDTFLAQSPPTFQQRGDQNLPPVPPLQLQSSPQQHQPNVSRKIATQQRAYNVAPFND
FT                   TNNEEDSTISILPTSLPQIHRANMLAQGLPAASKISPLVNKKSKTRWHFGIRSRSYPLD
FT                   VMGEIYIALKNLGAQWAKPSEEDLWTIRVRWKYDVGQNHNERIPDLMKMVIQLFQIETN
FT                   NYLVDFKFDGWESSSGEVAHNPNLSEDEMSTFSAYPFLHLTTRLIMELAVNSQGG"
FT   gene            <453204..>454574
FT                   /locus_tag="ZYRO0A05566g"
FT                   /old_locus_tag="ZYRO-ORF9204"
FT   CDS_pept        453204..454574
FT                   /locus_tag="ZYRO0A05566g"
FT                   /old_locus_tag="ZYRO-ORF9204"
FT                   /product="ZYRO0A05566p"
FT                   /note="similar to uniprot|P53687 Saccharomyces cerevisiae
FT                   YOR025W HST3 Member of the Sir2 family of NAD( )-dependent
FT                   protein deacetylases involved along with Hst4p in telomeric
FT                   silencing cell cycle progression radiation resistance
FT                   genomic stability and short-chain fatty acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25680"
FT                   /db_xref="GOA:C5DPR9"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPR9"
FT                   /protein_id="CAR25680.1"
FT                   /translation="MVSLLLSQSSRESSFDESDASMGSRLTPQKNQTTSPKLDLRTERL
FT                   YVIKELDTNDEKLIQINKMLNRSRKITVLTGAGISCNAGIPDFRSSSGLYEMVKKQFPE
FT                   ISMRSGQEMFDISLFRDELKISMFATFMEKLYSSVKLAQPTKTHRFIAHLKNRNKLLRC
FT                   YTQNIDGLEENLGLEMSTNEQDPGVIGTSFNARWKNYDVVQLHGDLKTLACTRCFHVFP
FT                   WNRYWCRSFRRGELPTCPQCEEKNFKRCQEGKRQIDNTGCLRPNIVLYGENHPSSDSIA
FT                   QGLNLDISRGRSDFFIILGTSLKVDGIRKVVRQIAKQVHERGGIVLLINKTSIGDSSWH
FT                   GLIDYQILTDCDSWVAHLQEQLPDFFKTQETIDRQKMLKRESSDLRKKKAAEQLAKNHI
FT                   KTPPATPSRVKSEQEETSKNSIQNVKKRLLNVNDEIPSKKSRTNQAPIESPSTYANP"
FT   gene            <454740..>455297
FT                   /locus_tag="ZYRO0A05588g"
FT                   /old_locus_tag="ZYRO-ORF9203"
FT   CDS_pept        454740..455297
FT                   /locus_tag="ZYRO0A05588g"
FT                   /old_locus_tag="ZYRO-ORF9203"
FT                   /product="ZYRO0A05588p"
FT                   /note="some similarities with uniprot|P40993 Saccharomyces
FT                   cerevisiae YDR478W SNM1 Subunit of RNase MRP which cleaves
FT                   pre-rRNA not shared between Rnase MRP and nuclear Rnase P
FT                   in contrast to all other Rnase MRP protein subunits binds
FT                   to the NME1 RNA subunit of Rnase MRP"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25681"
FT                   /db_xref="GOA:C5DPS0"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPS0"
FT                   /protein_id="CAR25681.1"
FT                   /translation="MSMNRSQAEKFKDIHLNHKYNLIHMLPSTEVPALSGFYLKSFYNG
FT                   TKRYRLRLPESIVEPDSKFCGNCGAVRIPLFNTDMSITESNNEATSESTRTLQYTCLHC
FT                   KNQAQVAPVRVQKQTPVNVKQSVGAKEEEQKQDKVNKKTSSARERAKKRKKSTLSDMLS
FT                   QKNEEKKSKSFSLSLESMIQND"
FT   gene            complement(<455364..>456959)
FT                   /locus_tag="ZYRO0A05610g"
FT                   /old_locus_tag="ZYRO-ORF9202"
FT   CDS_pept        complement(455364..456959)
FT                   /locus_tag="ZYRO0A05610g"
FT                   /old_locus_tag="ZYRO-ORF9202"
FT                   /product="ZYRO0A05610p"
FT                   /note="similar to uniprot|Q03370 Saccharomyces cerevisiae
FT                   YDR479C PEX29 Peroxisomal integral membrane protein
FT                   involved in regulation of peroxisome size and number
FT                   genetic interactions suggest that Pex28p and Pex29p act at
FT                   steps upstream of those mediated by Pex30p Pex31p and
FT                   Pex32p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25682"
FT                   /db_xref="GOA:C5DPS1"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPS1"
FT                   /protein_id="CAR25682.1"
FT                   /translation="MSVKLGSGKPSGSSSGGATSTGSSSAGNGSGSSLSSAGIQKLLTD
FT                   NLVEKIMRMALPPGSDVAINSLAKRKQFAKDRPGLSVNTMSRNFRLMNARLSQPFAILD
FT                   EIIEVFSWANPAYTISIMLIYTHAVMKPLPTLTSLPIFYLLFGVMVPHYLYMHKPNYSM
FT                   YLDGNPTPAQGLPLRKPVVPKPVPELSQEFILNLTDLQNHMMIYVSFYDFISVWLTKFA
FT                   YFTNEKISTAVFFILLVVGLINALFLDTLSKHLPVKGFFVAFGWFLAFMLHPKFREWFL
FT                   SRVNSEETRLRVLTLTNRFENIINEHLRYTEVRENKLVSVFEIQKFSEKDKCWVLVGFS
FT                   NDDYTLFSDLRIEQEDIALHCAPTLEEVKPPVEWEWVEAEDSWALDLEPIEWVEQGFIQ
FT                   YVDIDMGTKWVYDLTLEGKRGGYRRRMWTNVCARQMDYHYVDTNGEEEEVVEEDDMVNL
FT                   ARVENYSHGHRRVSRDSMSGSSTHSEETKPAIDRSESNNSINSVISPASPKKLPKGESF
FT                   SGLGSLTDLLNMTV"
FT   gene            <457286..>458269
FT                   /locus_tag="ZYRO0A05632g"
FT                   /old_locus_tag="ZYRO-ORF9200"
FT   CDS_pept        457286..458269
FT                   /locus_tag="ZYRO0A05632g"
FT                   /old_locus_tag="ZYRO-ORF9200"
FT                   /product="ZYRO0A05632p"
FT                   /note="similar to uniprot|P26449 Saccharomyces cerevisiae
FT                   YOR026W BUB3 Kinetochore checkpoint WD40 repeat protein
FT                   that localizes to kinetochores during prophase and
FT                   metaphase delays anaphase in the presence of unattached
FT                   kinetochores forms complexes with Mad1p-Bub1p and with
FT                   Cdc20p binds Mad2p and Mad3p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25683"
FT                   /db_xref="GOA:C5DPS2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPS2"
FT                   /protein_id="CAR25683.1"
FT                   /translation="MAVHDVVEVDEVAEDYLSDVVIMGSLRQLVVTAWDGTLSIYDYDE
FT                   QERRVSLNTVLRHAFPLLSCCVLFPSGGYKPEIYCGDVQGQVLLVDLELGKFIPMGGNT
FT                   AQLGISSLCSYKNQVICGSWDGFLQVIDCRSQNVVYQQRLNDKILSIDAHGDKLVVATT
FT                   KNTVLWWKLPLQASDFGAEVESGLKFQTRRIKLTPRGDGYVSSSLDGRVAVEFFQDDTK
FT                   KFAFRCHRMNLADTSFVFPVNALAFVPNSTILYTGGSDGCVSCWNLATRKKVDQLAKFN
FT                   ENSVVQLDCDGKILCVATSDDSFKTNAVVNQDTELQASRLYLVFLN"
FT   gene            complement(<458280..>459764)
FT                   /locus_tag="ZYRO0A05654g"
FT                   /old_locus_tag="ZYRO-ORF9199"
FT   CDS_pept        complement(458280..459764)
FT                   /locus_tag="ZYRO0A05654g"
FT                   /old_locus_tag="ZYRO-ORF9199"
FT                   /product="ZYRO0A05654p"
FT                   /note="similar to uniprot|Q07015 Saccharomyces cerevisiae
FT                   YDR257C SET7 Nuclear protein that contains a SET-domain
FT                   which have been shown to mediate methyltransferase activity
FT                   in other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25684"
FT                   /db_xref="GOA:C5DPS3"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPS3"
FT                   /protein_id="CAR25684.1"
FT                   /translation="MMASFDEATDGFYHWLVSSARIEISPKIFVGDLRSVNQGRCVLAS
FT                   QDIGSDEVLFEIPRSSVLNVATSQLVRDFPQLKDVFWQELGHWEGLILCMVYEIKVMGQ
FT                   QSFWWNYLQVLPKSQDLNTLVYWSADQLAALEPSLVVGRLGADESQEMYRQILKYIQNF
FT                   GPEFQSKIGQLTFEEFVHVASVIMSYSFDVDLKGEDDEDDEDEDEGEEEEGESNVAHDK
FT                   YMKSMVPLADTLNADTKQFNAHLVYDKESLKMVSVKPIKMGQQVYNFYGEHPNAEILRR
FT                   YGYVEWDGSQFDFGELPLSCITQVLQREAPEEFFQICLQLLQNDETILEHLDQEQIVLE
FT                   SYDCFIDGQVIPECLLLLQVLTVILQIPNVGENLERELQRVVKKCLQLVESGRLTIKCL
FT                   KLFEHCIDERLRQYPNHSFREVTPIHQYVHDVDVQRGIMAQRVLQSEVESLQNCYLSLG
FT                   EKFQVIDDVKLMDNILKKRVAPAQKTKNESKRKRTH"
FT   gene            <459999..>461717
FT                   /locus_tag="ZYRO0A05676g"
FT                   /old_locus_tag="ZYRO-ORF9197"
FT   CDS_pept        459999..461717
FT                   /locus_tag="ZYRO0A05676g"
FT                   /old_locus_tag="ZYRO-ORF9197"
FT                   /product="ZYRO0A05676p"
FT                   /note="highly similar to uniprot|P15705 Saccharomyces
FT                   cerevisiae YOR027W STI1 Heat shock protein also induced by
FT                   canavanine and entry into stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25685"
FT                   /db_xref="GOA:C5DPS4"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPS4"
FT                   /protein_id="CAR25685.1"
FT                   /translation="MSADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRS
FT                   ACYASNKKFEEALKDAEECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSS
FT                   NKAAKDGLEHVQSAKAGPQMPDLGLSQMFNDPNLIQNLKNNPKTADMMKDPQLVAKLEG
FT                   YRNNPQSISQDLFTDKRLMTIMAALLGIDLNMGDPSAGSEAQESAKPKEPESNPEPRKE
FT                   PKQEPKQEPEAMEVDEEPNSRVAAEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITY
FT                   LNNRSAAEFEKGDYDTAIKTLNDAVEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAI
FT                   EHYNRSLTEHRTAEVLNKLRSTEKELKKAESEAYVNPEKAEEARLQGKEFFTKGDWPNA
FT                   VKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRKATAQ
FT                   IAVKEFAAAIETLNIAREKDAQVNKGANVREIDQLHAKASSQRFQPASDNETPEQTYER
FT                   AMRDPEVASIMKDPVMQSILSQAQQDPAALQEHIKNPEVFNKIQVLIQAGIIRTR"
FT   gene            <463894..>463966
FT                   /locus_tag="ZYRO0A05698r"
FT                   /old_locus_tag="Zyro0A.tAla.TGC.8"
FT   tRNA            463894..463966
FT                   /locus_tag="ZYRO0A05698r"
FT                   /old_locus_tag="Zyro0A.tAla.TGC.8"
FT                   /note="tRNA-Ala (TGC) cove score=78.27"
FT   gene            <464185..>464257
FT                   /locus_tag="ZYRO0A05720r"
FT                   /old_locus_tag="Zyro0A.tArg.ACG.9"
FT   tRNA            464185..464257
FT                   /locus_tag="ZYRO0A05720r"
FT                   /old_locus_tag="Zyro0A.tArg.ACG.9"
FT                   /note="tRNA-Arg (ACG) cove score=73.40"
FT   gene            <464812..>465633
FT                   /locus_tag="ZYRO0A05742g"
FT                   /old_locus_tag="ZYRO-ORF9194"
FT   CDS_pept        464812..465633
FT                   /locus_tag="ZYRO0A05742g"
FT                   /old_locus_tag="ZYRO-ORF9194"
FT                   /product="ZYRO0A05742p"
FT                   /note="highly similar to uniprot|Q05016 Saccharomyces
FT                   cerevisiae YMR226C NADP( )-dependent dehydrogenase acts on
FT                   serine L-allo-threonine and other 3-hydroxy acids"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05742g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25686"
FT                   /db_xref="GOA:C5DPS5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPS5"
FT                   /protein_id="CAR25686.1"
FT                   /translation="MSQGVKAAERLAGKTVFITGASAGIGQATAKEYLDASNGQIKLIL
FT                   AARRLEKLHEFKEQTTKSYPSAQVHIGKLDVTAIDTIKPFLDKLPKEFQDIDILINNAG
FT                   KALGTDKVGDIADEDVEGMFDTNVLGLIKVTQAVLPIFKRKNSGDVVNISSVAGREAYP
FT                   GGSIYCATKHAVKAFTESLRKELVDTKIRVMSIDPGNVETEFSMVRFRGDTEKAKKVYQ
FT                   DTVPLYADDIADLIVYATSRKQNTVIADTLIFSSNQASPYHLYRGSQDKTN"
FT   gene            complement(<465717..>466409)
FT                   /locus_tag="ZYRO0A05764g"
FT                   /old_locus_tag="ZYRO-ORF9193"
FT   CDS_pept        complement(465717..466409)
FT                   /locus_tag="ZYRO0A05764g"
FT                   /old_locus_tag="ZYRO-ORF9193"
FT                   /product="ZYRO0A05764p"
FT                   /note="similar to uniprot|Q12012 Saccharomyces cerevisiae
FT                   YOR289W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25687"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPS6"
FT                   /protein_id="CAR25687.1"
FT                   /translation="MSLELSGTSPYAFYAFYTLYNYLNNNNKSHSLNSTKNFLKICQTL
FT                   YPDYRVNPVERTSLFITWNKKSKKSDKYSLRGCIGTFARPALVHGIEKYSLVAALQDNR
FT                   FPPISKKELQLLKCSCNILQNFTTIYEGSKGDINDWEIGLHGIELFFKDPGSGITLSAT
FT                   FLPEVMSEQNWDKEETFLNLIYKAGVSSHLQEVLDHYEQYFVQVIRYEGNKSAITYEQF
FT                   ESQLEKLE"
FT   gene            <466591..>467526
FT                   /locus_tag="ZYRO0A05786g"
FT                   /old_locus_tag="ZYRO-ORF9192"
FT   CDS_pept        466591..467526
FT                   /locus_tag="ZYRO0A05786g"
FT                   /old_locus_tag="ZYRO-ORF9192"
FT                   /product="ZYRO0A05786p"
FT                   /note="similar to uniprot|Q12404 Saccharomyces cerevisiae
FT                   YOR288C MPD1 Member of the protein disulfide isomerase
FT                   (PDI) family overexpression suppresses the defect in
FT                   maturation of carboxypeptidase Y and defects in other
FT                   essential Pdi1p functions caused by PDI1 deletion"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25688"
FT                   /db_xref="GOA:C5DPS7"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPS7"
FT                   /protein_id="CAR25688.1"
FT                   /translation="MIKMWVFKVLIFFMIQCSNLVWAQNFYDEDPHLIELTPKNFDKVI
FT                   HRTNYTSVVEFYAPWCGYCKQLKPVMKKVAKKLDGIVQVASVNCDLPKNKQLCAEHRIQ
FT                   GFPTLMVFRPPKIDMSKPHSQRVELRNHAGEVYKGERKMAPIIDFAVSRMKNYVKRLLN
FT                   VNKLEEIFKKSTRPSMVLFSKKDKLSPVYKSIALDWLGVFNCFIIPNGKLDSLSSDDNL
FT                   AKSYPNIYGFLQSIAHDQKNSEKSLLVVFDPHNDQYHVFQGDSLVKPQVSKFLTGSIGR
FT                   NPQEGPGSKRQQFVDAVKSGKNKRVNHDEL"
FT   gene            <467735..>468128
FT                   /locus_tag="ZYRO0A05808g"
FT                   /old_locus_tag="Zyro0A.mRNA.1307.p"
FT   CDS_pept        join(467735..467792,467890..468128)
FT                   /locus_tag="ZYRO0A05808g"
FT                   /old_locus_tag="Zyro0A.mRNA.1307.p"
FT                   /product="ZYRO0A05808p"
FT                   /note="similar to uniprot|P19956 Saccharomyces cerevisiae
FT                   YMR225C MRPL44 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25689"
FT                   /db_xref="GOA:C5DPS8"
FT                   /db_xref="InterPro:IPR019716"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPS8"
FT                   /protein_id="CAR25689.1"
FT                   /translation="MITKYFSKVVVKFNPFSKEAKTARLLLSSIPPAQRQLGTQIQNEV
FT                   LTNASNKAPVIKVTFKDKKTMEVDPTKYTFQELANYFDTHSRQLSLKETIENS"
FT   gene            <468586..>469485
FT                   /locus_tag="ZYRO0A05830g"
FT                   /old_locus_tag="ZYRO-ORF9190"
FT   CDS_pept        468586..469485
FT                   /locus_tag="ZYRO0A05830g"
FT                   /old_locus_tag="ZYRO-ORF9190"
FT                   /product="ZYRO0A05830p"
FT                   /note="similar to uniprot|Q12481 Saccharomyces cerevisiae
FT                   YOR287C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25690"
FT                   /db_xref="GOA:C5DPS9"
FT                   /db_xref="InterPro:IPR009292"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DPS9"
FT                   /protein_id="CAR25690.1"
FT                   /translation="MSYYFKNIKPGVESESDEGEDLERLLRRNNQDDADESSDDELRTL
FT                   SFGSLKKADTMMKKEEDGDRKLNRKIKDKPSKQVKYESEQESAPEQESESESGSSDSEF
FT                   FEEESSKKNGDQKKKKKRSKHAPAEQSAKKRVSKVREIPGLHLSKSQNPNLYQDIRFDK
FT                   STGGPTDSSVIRRRYGFLDEYRQKEIEEMESILHDRKLTSKLPPEEVESIERRLKSTKS
FT                   RLQTMKSKDLEQNIVKDYEQTMNKDNKNKFHLKRSERRKLVQKWKFEHMKSKQREKVME
FT                   RKRKKRLGKEFKQFEFNK"
FT   gene            complement(<469523..>469963)
FT                   /locus_tag="ZYRO0A05852g"
FT                   /old_locus_tag="ZYRO-ORF9188"
FT   CDS_pept        complement(469523..469963)
FT                   /locus_tag="ZYRO0A05852g"
FT                   /old_locus_tag="ZYRO-ORF9188"
FT                   /product="ZYRO0A05852p"
FT                   /note="similar to uniprot|Q08742 Saccharomyces cerevisiae
FT                   YOR286W FMP31 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25691"
FT                   /db_xref="GOA:C5DPT0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPT0"
FT                   /protein_id="CAR25691.1"
FT                   /translation="MFRSLSVQKASLQSPARTLIRTMSSAGPKPYNFQDVKKLVQHPEQ
FT                   GKVLVDVREPREVEMYKMPTALNLPFQTTPSALSLPEEEFEEQFQVPKPKNNEELIFFC
FT                   AKGMRARAAEELARSYGFKNTGIYEGSVNDWLANGGDKIKPE"
FT   gene            complement(<470083..>470460)
FT                   /locus_tag="ZYRO0A05874g"
FT                   /old_locus_tag="ZYRO-ORF9187"
FT   CDS_pept        complement(470083..470460)
FT                   /locus_tag="ZYRO0A05874g"
FT                   /old_locus_tag="ZYRO-ORF9187"
FT                   /product="ZYRO0A05874p"
FT                   /note="weakly similar to uniprot|Q12305 Saccharomyces
FT                   cerevisiae YOR285W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25692"
FT                   /db_xref="GOA:C5DPT1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPT1"
FT                   /protein_id="CAR25692.1"
FT                   /translation="MTHKIYEYEHIKFLSQNPNSRVVLIDVREPEEFQETNIPTSINVS
FT                   YRSYPNGLAMDSETFFNTFKTRKPEYDKELVLLCASGRRASEALKVALEAGYSEVSLYP
FT                   GSMKDWTYREKGGSTTLACPI"
FT   gene            complement(<470581..>471261)
FT                   /locus_tag="ZYRO0A05896g"
FT                   /old_locus_tag="ZYRO-ORF9186"
FT   CDS_pept        complement(470581..471261)
FT                   /locus_tag="ZYRO0A05896g"
FT                   /old_locus_tag="ZYRO-ORF9186"
FT                   /product="ZYRO0A05896p"
FT                   /note="similar to uniprot|Q12040 Saccharomyces cerevisiae
FT                   YOR283W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05896g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25693"
FT                   /db_xref="GOA:C5DPT2"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPT2"
FT                   /protein_id="CAR25693.1"
FT                   /translation="MTVSSFSEACDGNVVRLFVIRHGQTDYNIRQIMQGHKDIELNQTG
FT                   FEQATLLGKRLVEDSLTFDSVASSDLIRCKQTVATALATSNQNLPVTYYYELRERCMGV
FT                   IEGMQIDQAEKFAVEQGKKSFRDFGETPQEFIGRFATCFVSVAEQAAANNHKNVAIFTH
FT                   GGSIRSLLSWLHYNTSSKIPNTSVTVIDYHKDTKQFEVKVVADDMHLTGGSGSMRFVGD
FT                   SRVL"
FT   gene            <471425..>473431
FT                   /locus_tag="ZYRO0A05918g"
FT                   /old_locus_tag="ZYRO-ORF9185"
FT   CDS_pept        471425..473431
FT                   /locus_tag="ZYRO0A05918g"
FT                   /old_locus_tag="ZYRO-ORF9185"
FT                   /product="ZYRO0A05918p"
FT                   /note="similar to uniprot|P32829 Saccharomyces cerevisiae
FT                   YMR224C MRE11 Subunit of a complex with Rad50p and Xrs2p
FT                   (RMX complex) that functions in repair of DNA double-
FT                   strand breaks and in telomere stability exhibits nuclease
FT                   activity that appears to be required for RMX function
FT                   widely conserved"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25694"
FT                   /db_xref="GOA:C5DPT3"
FT                   /db_xref="InterPro:IPR003701"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR007281"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR038487"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPT3"
FT                   /protein_id="CAR25694.1"
FT                   /translation="MEYPDADTIRILITTDNHVGYNETDPIAGDDSWKTFHEIMMLAKN
FT                   YNVDMVLQGGDLFHVNKPSKKSFYQVMKSLRMGCMGDKPCELELLSDPSQVFHYNDFTD
FT                   VNYEDPNFNVAIPVFAIAGNHDDATGESLLCPMDLLQVSGLVNHFGKVLEADKITVKPL
FT                   LFQKGITKLALYGMASVRDERLFRTFKEGNVTFEIPSMREGEWFNLMCVHQNHTGHTNT
FT                   AFLPEQFLPEFLDLVVWGHEHECIPHLVHNPSKQFDVLQPGSSVATSLCDAEAQLKNVF
FT                   ILQLRHDQSPELIPIPLTTVRTFLMRSVSLQDVNYLRPHDKEGISKYLASQVEELIAEA
FT                   NTATKAKLGDALDEMDEQQLPLPLIRLRVDYSGPDSDQTTIDYQVENPRRFSNRFVGRV
FT                   ANGNNVVQFYKRRGKHNLSSKRGPNSAVNDADVERLINERGGELEVNTLVNDLLHKMQL
FT                   SLLPEVGMNEAVKKFVDKDEKSALKDFIDKEIENEVDMLVSSGGGLHSDNPEQIKSLIR
FT                   QVKKANYVVDSSSSPNHETPVTAVPPPPLTHTETRELDITPTPELSMPTRKRKELPKRK
FT                   ASPPISESIAISDDDEEDGDEIVLSDDDNEDNGMDTQKQRTSKSSKPNTSKPPSRKSRQ
FT                   TTTVGKSSSGSRSKSTKTPKTDILSSLLARKRK"
FT   gene            <473644..>474480
FT                   /locus_tag="ZYRO0A05940g"
FT                   /old_locus_tag="ZYRO-ORF9182"
FT   CDS_pept        473644..474480
FT                   /locus_tag="ZYRO0A05940g"
FT                   /old_locus_tag="ZYRO-ORF9182"
FT                   /product="ZYRO0A05940p"
FT                   /note="similar to uniprot|Q12017 Saccharomyces cerevisiae
FT                   YOR281C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05940g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25695"
FT                   /db_xref="InterPro:IPR024253"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPT4"
FT                   /protein_id="CAR25695.1"
FT                   /translation="MQNDPLVQVQVDESEDTEWNDILRQKGVIPEKPPSPTAQLEEALE
FT                   EALNKQHENRLDDKDLSDLEELEDEEDEEFLNMYKQKRLKDIAKLQEKSKFGDVFEINK
FT                   PEYHSEITEASMGGAKSGHENVEDAEGVYVFVHLSLQSKLQSRIVNHLFKSLAAKYREI
FT                   KFVEINAHRAIENYPESNCPTILVYYKGDVLKNLITLLELGGNDTNLNDFEQFMVRVGA
FT                   LNEKDSRLIMNQDDEETREARKLNFAGKSIRSGIQGKFNLGTGAASDDEDEDDFFD"
FT   gene            complement(<474545..>475942)
FT                   /locus_tag="ZYRO0A05962g"
FT                   /old_locus_tag="ZYRO-ORF9180"
FT   CDS_pept        complement(474545..475942)
FT                   /locus_tag="ZYRO0A05962g"
FT                   /old_locus_tag="ZYRO-ORF9180"
FT                   /product="ZYRO0A05962p"
FT                   /note="similar to uniprot|P50102 Saccharomyces cerevisiae
FT                   YMR223W UBP8 Ubiquitin-specific protease that is a
FT                   component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
FT                   acetylation complex required for SAGA-mediated
FT                   deubiquitination of histone H2B"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25696"
FT                   /db_xref="GOA:C5DPT5"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR037798"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPT5"
FT                   /protein_id="CAR25696.1"
FT                   /translation="MLGCQHIDQVFQNEKSKDGVIRTCNAARFMLSHFTKREKYTHVMK
FT                   CSDCHEINAGSNFMCLQCGFCGCWNGNHFGQHSKKVGHVFGINSSNGLLFCFKCGDYIG
FT                   SNELIAASMLNKYWDDVVTKTQIPKLERRDGLQGLLNMGSTCFMSSIVQCLIHNPYFFQ
FT                   FSINQLHSQRCPLQDPLSCISCALDRMVWEFYGHPELIKNGEDDSNNSRTSDEYAGFIG
FT                   LFVSSWKINENLAGYFQQDAHEYWQFLLNQLHNDYMVSHNKSPDETNFAELCDCIAHST
FT                   FQGSLKSSIVCPECKMDSKTTKDPFMDLSLDIKDKSNLYECLDSFHKMEQLHDFNYHCD
FT                   RCNTTQNAIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDD
FT                   VPDIIFELIGIIAHRGTVNEGHYIAFTKVTTGHWFKFNDSMVSSITEEELLQEQAYLLF
FT                   YVVNQVN"
FT   gene            <476157..>476840
FT                   /locus_tag="ZYRO0A05984g"
FT                   /old_locus_tag="ZYRO-ORF9179"
FT   CDS_pept        476157..476840
FT                   /locus_tag="ZYRO0A05984g"
FT                   /old_locus_tag="ZYRO-ORF9179"
FT                   /product="ZYRO0A05984p"
FT                   /note="similar to uniprot|Q05015 Saccharomyces cerevisiae
FT                   YMR222C and similar to uniprot|Q99369 Saccharomyces
FT                   cerevisiae YOR280C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25697"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPT6"
FT                   /protein_id="CAR25697.1"
FT                   /translation="MAKKILMLHGIAQTGEYFYHKTKGLRTEFEKLGYELYYPTANNTM
FT                   PPADVPNCASDEVVASGVNDVSTWIQIDTAKADYSILPSTLDYLRQYVIENGPFDGLLG
FT                   FSQGAIVGSYLMTDFNVLLNLTHEQQPPFKFFIAFSGFKFETARCASQYVEHPINVPSL
FT                   HVRGELDTVTEAEKVHALYEACTPETRTFISHPGGHYVPNSRCFSKKVTEWLKTIDPSL
FT                   EKSKY"
FT   gene            <476965..>477816
FT                   /locus_tag="ZYRO0A06006g"
FT                   /old_locus_tag="ZYRO-ORF9178"
FT   CDS_pept        476965..477816
FT                   /locus_tag="ZYRO0A06006g"
FT                   /old_locus_tag="ZYRO-ORF9178"
FT                   /product="ZYRO0A06006p"
FT                   /note="similar to Saccharomyces cerevisiae and to YMR222C
FT                   uniprot|Q05015 Saccharomyces cerevisiae FSH2 Serine
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25698"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPT7"
FT                   /protein_id="CAR25698.1"
FT                   /translation="MPPLPRKKILMLHGFVQSGKIFSSKTGGLRKTLNKIGYDLLYPTS
FT                   PMGITKEELMAQHNIKPGEDSDKEVASQFNTTTDGQDVYYGWWKRSSSCFQDFDIGQDV
FT                   WDYLRGYILENGPFEGIMGFSQGGAFAGYLLTNFHKLLNLTYEQQPPLKFFVTFSGFRL
FT                   EASQFQSDYDKQPLSVPSLHVQGEQDTVVSEARILSLYNSCQEDKRTLLRHPGGHYVPN
FT                   SKQYVSQVCNWIQWIESQGKTSSQEESKDDAPKKQDTAKPDLGDDLMGTIDSMMGATRL
FT                   KD"
FT   gene            <477825..>479477
FT                   /locus_tag="ZYRO0A06028g"
FT                   /old_locus_tag="ZYRO-ORF9177"
FT   CDS_pept        477825..479477
FT                   /locus_tag="ZYRO0A06028g"
FT                   /old_locus_tag="ZYRO-ORF9177"
FT                   /product="ZYRO0A06028p"
FT                   /note="similar to uniprot|Q04991 Saccharomyces cerevisiae
FT                   YMR221C FMP42 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25699"
FT                   /db_xref="GOA:C5DPT8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPT8"
FT                   /protein_id="CAR25699.1"
FT                   /translation="MFKYHLKNSKSLPRRRTHRPKVGGTARSDKVKDERYLTLYTTYHL
FT                   ATKVTAMSSKAVKVVQIGCASVYCLLSAGVIFGFAAFKAVLLAEDVYGEYCPADSARPC
FT                   TEQDLKLNFIFTLAAGVTNVAALPVGWVLDHYGPRISGIVGSLWITVGAAMYIWAQQFS
FT                   HILDPYLIGYSMFAIGGPFVFISSFQLANTFPKKSGFILSLITGTFDCSSALFLFYRLG
FT                   YQHSGKGWHLSQFFGVYMIVPLFILLSQLTVMPNDSYKTQGTIEKISAEHLDENGRLLE
FT                   GDSISAFCTDDEERRSLVNEEALDRNEELRTRRGRRKSVVELHVERKLEQKSGGIFGIL
FT                   HDKSVKEQISNPMFYLMVVFTTICMLRINYYVATIRSQEEYLLKDPELALKLNSIFDVL
FT                   LPLGGVVAIPLTGAILDHMKTFDILVTLVTSSVVVGVLGLIPRSFTLHLIGILILVVYR
FT                   PFVYTVISDYTSKVFGFDTFGTVYGLLISISGMFNMVQSILDTLTHKTFNMNPTPLNSI
FT                   LVLITIISGLTLLWDVRRQLRLRTLHKSDQEDN"
FT   gene            <479754..>480818
FT                   /locus_tag="ZYRO0A06050g"
FT                   /old_locus_tag="ZYRO-ORF9176"
FT   CDS_pept        479754..480818
FT                   /locus_tag="ZYRO0A06050g"
FT                   /old_locus_tag="ZYRO-ORF9176"
FT                   /product="ZYRO0A06050p"
FT                   /note="weakly similar to uniprot|Q12192 Saccharomyces
FT                   cerevisiae YOR279C RFM1 DNA-binding protein required for
FT                   repression of middle sporulation genes specificity factor
FT                   that directs the Hst1p histone deacetylase to some of the
FT                   promoters regulated by Sum1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25700"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPT9"
FT                   /protein_id="CAR25700.1"
FT                   /translation="MVEYNLDNIQHNLNTDKESPNGFEHFSPSTFSIHNDNNSDNGTQR
FT                   DDKNLSEEAAKISKFDNEFLPNLDDDIPIETGFSPRNNDKITWRKIVESSNKRQEIFTK
FT                   FKEASQQINPIEFESYHDFFVLNTFKKGKSVSGYVDIENVMKNNAQHHRRSKRNNHDPS
FT                   VREPITSPGSSSLSDDGDYDENDDGNREIEKLSRSRESPVDEIEEGPKKRRSRTQVPVT
FT                   SDDHLQIDEAELSLSTNPPGGERRSTRLLNKANNNNSSSNPDSEDSSDEHGEALIKDLY
FT                   ESIVPKVEQPYRRSDWVLPSRLRYTPDKQMRTKPEFEKVNLSELISVEKIQRVLSKFEG
FT                   GLKGIRKTNWNSMG"
FT   gene            complement(<480838..>482379)
FT                   /locus_tag="ZYRO0A06072g"
FT                   /old_locus_tag="ZYRO-ORF9175"
FT   CDS_pept        complement(480838..482379)
FT                   /locus_tag="ZYRO0A06072g"
FT                   /old_locus_tag="ZYRO-ORF9175"
FT                   /product="ZYRO0A06072p"
FT                   /note="similar to uniprot|P24521 Saccharomyces cerevisiae
FT                   YMR220W ERG8 Phosphomevalonate kinase an essential
FT                   cytosolic enzyme that acts in the biosynthesis of
FT                   isoprenoids and sterols including ergosterol from
FT                   mevalonate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06072g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25701"
FT                   /db_xref="GOA:C5DPU0"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR016005"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPU0"
FT                   /protein_id="CAR25701.1"
FT                   /translation="MSSIDYVFYTLFYNMIDSYDYYVVLGCGYQYFFLSMALKARTVRT
FT                   SMHELRSVLDKENIKMTMNSVERVRAFSAPGKALLAGGYLVLDPSYRSYVVALSARMHA
FT                   VVKTSDLEQNAHFELKISSSQFNNDYWTYTLGAKDGYNILETDGKKNPFIEMVLFNLFN
FT                   YFKPQQGKKILIEIFSDDGYHSQSNSVRKGNAYKEFSYHANSITKVPKTGLGSSAGLVT
FT                   VLTTVLVSVFKSELDVQNNKDLQLIHGLAQVAHCQAQGKIGSGFDVAAATFGSIVYRRF
FT                   APELISGLPEHSDVNYSIKLRSLIDDTDWKISNTRVRLPDGLRLVMGDVNNGSETTKLV
FT                   SKVKAWYTSNPSKGLEVYQNINSNNEKVMAALTEMDALNQKTPTAYSKLIEALDAQDEA
FT                   LINQSPELVKIRNAVNEIRNNFRQVTKESGADIEPPVQTALLDNCSKLKGVLTGVVPGA
FT                   GGYDAIALIATEQSNLQLQTQGKKEFAAVTWLDLHQEDVGVKQENPVHYQNLVKL"
FT   gene            complement(<482390..>486925)
FT                   /locus_tag="ZYRO0A06094g"
FT                   /old_locus_tag="ZYRO-ORF9174"
FT   CDS_pept        complement(482390..486925)
FT                   /locus_tag="ZYRO0A06094g"
FT                   /old_locus_tag="ZYRO-ORF9174"
FT                   /product="ZYRO0A06094p"
FT                   /note="some similarities with uniprot|Q03661 Saccharomyces
FT                   cerevisiae YMR219W ESC1 Protein localized to the nuclear
FT                   periphery involved in telomeric silencing interacts with
FT                   PAD4-domain of Sir4p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06094g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25702"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPU1"
FT                   /protein_id="CAR25702.1"
FT                   /translation="MTSKKGGPNSSRLKLAAPRRGLKRPRSVFIERSGSNGRNNDMRYR
FT                   VNKTSRTDISQDTGHALDWLDSLIRKGRGILDSLEEEETSFKRELGEEKQRIRIQEQLI
FT                   ENALNGGSEDVFEKENIGIDTSSFRRLEDSVRNTKTEYDDEEEEEEEEEEEGDNSDLYD
FT                   EVQDMQDREDKHQPVFEQEEIVILSDEDEDEGETQKPEKSEEEDSEQLFGDEQEIDLMS
FT                   SDENVEEDHEAKEDEYEEEEAPERQELDEEESQVGSEEIEGQEEEIDQSEKKSESNDEQ
FT                   EEGSVEMAKDLESRFFPSSTQSSQEKFKDGLNADTQTPSPDETSYYDASDREETDNFES
FT                   EHESIRNLENGDEPVSTQDGGINEFNLAGNDEAVLIDGDTEEQEVEQSLESEQEYEFEG
FT                   KGQDDLELEQDQERDLEDQEREYEQEEEPRNDEGEYEQDEQEQYGEGEQAEEPEQESAY
FT                   VSAEASLQVPDYLYDYRMIANQAVQQLLQTTDGQAVSSESTGNESFNDTKYETPEASVP
FT                   LQEDKGDQQNINETANDFKEIPGVSVPLQDDKGDQKDINETVNGIKEEPEIVGHSGRIL
FT                   DTTGNRKNSLLEQLFKPKLQAGDANASTSSLEDDSTVYYSTEEPSIVEEPSDLKADNQT
FT                   YLSAKKTEGTNNVPSRYEILFCESAYSTTSNEDNAQVIEPFGSYVSPFSKDTFSTTQKA
FT                   EDPKELLRRTLESLGESFDSESEDEVMVDANDFNSSSSEEFFSQTSDININDDVDVDVD
FT                   VEEDEDTGNDDETVKGSEISDGNNTDTTDTPGKGTPLERYEQIDITQGPDIDPIHSPDA
FT                   FDDAEFLVFGPNEPDWIEEAESEQSIQDQEGLVLEDVSSGVDQEEIALVASEPIIEFNS
FT                   EPLNFADIILDEFTAPDLVEEASDTESRADNILLEEIEDLQALDVIHVISTEPIVEQPE
FT                   PLSFANVEIFELTENDSDDTDEVMVDVGPSSFDENASFQMRTERGFNVGALAGNSSSES
FT                   HESEYSVDGAEEESNEHRSGSVASKIFSSPIRALGRVISGVKDVGNVLADFVNTIDTTN
FT                   AQTDTDVGSSSPEEHNEDSQSEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEA
FT                   EPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAGRSVEHDLRNFLDEE
FT                   GFKLEYPSENNGSEFTGNDREPLFENNSNNKELLSEVVAIQKLARELESRPISAFRDSS
FT                   PSTDDNEAEKEEINISVKNDNDPELDIGEEDSFLKSTEDDVLQKSSGNEGTKDKCDKDE
FT                   DARDDVKHIEVEEEDLDGMKEKYVKDLPANEEGDVKGQQARVNPEEIDIVGKRSNDAVK
FT                   SEDFASKREGIEIYENKEVESGKNSSSVLVKPIEVDANYSDEAPFQHEEVHKKKDESNS
FT                   PTREVQVRDENEDAIQIPVEIEDEETKIPPENKDMPKEKGSEPTQSGSKKKRGRKRKHA
FT                   SPISESNKRKGPGSSKTQNKRTKGPITRSRTTPSSTERKTRGNTRSKKTR"
FT   gene            <487142..>490417
FT                   /locus_tag="ZYRO0A06116g"
FT                   /old_locus_tag="ZYRO-ORF9164"
FT   CDS_pept        487142..490417
FT                   /locus_tag="ZYRO0A06116g"
FT                   /old_locus_tag="ZYRO-ORF9164"
FT                   /product="ZYRO0A06116p"
FT                   /note="similar to uniprot|Q03660 Saccharomyces cerevisiae
FT                   YMR218C TRS130 Component of the targeting complex (TRAPP)
FT                   involved in ER to Golgi membrane traffic"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25703"
FT                   /db_xref="GOA:C5DPU2"
FT                   /db_xref="InterPro:IPR022233"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPU2"
FT                   /protein_id="CAR25703.1"
FT                   /translation="MSSQTSSRAVTISYFDPFDVFESIKGEFLQIFPFQNIHWKSPGGA
FT                   VRTVRQLPVNLVIESEASELNIDDVNHFVRFIVVNCISVDDYRGKVRPLLRQWLPVSDK
FT                   TSVDVDSVETPKPIVLLYANSEVVDSNLFKSISLIDKFAKDFPGLKTLVLRSVYKSPTD
FT                   REDFWNQMGNKIKSCLLDIFQKRLTNYRKKLSNPKNADEELGLREKILELYLAFNMHEE
FT                   ATTQLNEIRDNVVSKRENSLPNGELETPFNFAQNENVDDGSIAKMLLENKLTKFQYFKY
FT                   FFVKRFRVLNMGKTNVPRLLQLYRLIRDFLHCIESIFRDSPQILEFKYCFIDDILKYIN
FT                   DGGIPIFLEMKAELSLLKRDCWVQGVLANTDFKLIDKSFPKSNVKFTFDRLKESYKDEN
FT                   TFHENFVKSTSLLLALYNKSSDKKRRIVDILSLEIGMLHYQRGEYEKAVSLFDSCYEYY
FT                   METGWDIIGLKIVQMYYDSLIHCPQIKYLKRDDEDVSVSIVLSNAFLNILRISKDEDEK
FT                   RQIWKKFFELQKEMESPSLVYQTDGLFCIALSDLSYLSEANVYKIDVTIRNLAFLEPIT
FT                   ADSIKLILKNSDDQFVEFKLSSVNFAPSTNHYALEATEISFGEFQPVSIEIKVGNATFL
FT                   EGFVNENHPIFIEPLYHPENISCSVQQSKRLNLGEYAIDLIHQNVKGLESFAVEIMVEP
FT                   NLGSFPISFSQDQDLYRKRVVDIKNDTTIRYFPKDSINSFRLKVKTSFTKKDNPREFSE
FT                   IRHFTISCYLPLSVSVEDIFKKDAFIFKFLLNSSTEEEPIILYSSKLRAPENSERYTLF
FT                   GDFEPNDLIYLTADPNESALNCYQVTTKDKFDHNDLFQLKVTYNTLKEQINGLVTDSIM
FT                   LQGDMEWYQEFELWKHLWENKILPLFQYDYNAFIQSCTITTMPGTLNITDICDYLLKLS
FT                   VSKPVTKRIIETLKKIVRGVELTDIDIYAYVKNLTPRTLIVPVELPQMDYFFYVEFSKT
FT                   LEEQYQVGSPMLIKIRVENLSGKWGSQEVSDAFVLEVASSNEWLAHGKKRMLIRSEINE
FT                   FELYVIPLKKGYLNYPRIEISSVETGVPTRIDNPNASETLLVL"
FT   gene            complement(<490489..>491241)
FT                   /locus_tag="ZYRO0A06138g"
FT                   /old_locus_tag="ZYRO-ORF9163"
FT   CDS_pept        complement(490489..491241)
FT                   /locus_tag="ZYRO0A06138g"
FT                   /old_locus_tag="ZYRO-ORF9163"
FT                   /product="ZYRO0A06138p"
FT                   /note="similar to uniprot|P06174 Saccharomyces cerevisiae
FT                   YOR278W HEM4 Uroporphyrinogen III synthase catalyzes the
FT                   conversion of hydroxymethylbilane to uroporphyrinogen III
FT                   the fourth step in the heme biosynthetic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06138g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25704"
FT                   /db_xref="GOA:C5DPU3"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPU3"
FT                   /protein_id="CAR25704.1"
FT                   /translation="MQRAILLKNKTAQQDKYEIEFQSNGFEPVFIPLISHTHIPQGLLK
FT                   LLEDDAYLKDLQDIIVTSQRTVECLYESVLPQLHASTRQLFLEKTVYAVGPSTKDFLIR
FT                   IGFKNVKGGEDAGNGSILSDIIISDYREQGKNSEPLLLVGEIRRDIIPKKLSSNGIQVK
FT                   EVITYKTENLPDNLTRFQAMARENSWVVFFSPQGTEEIIESIKNGSNHRVASIGPTTEE
FT                   FLQRKGLEPDVVSLKPDERNLVNAILSI"
FT   gene            complement(<491453..>493024)
FT                   /locus_tag="ZYRO0A06160g"
FT                   /old_locus_tag="ZYRO-ORF9162"
FT   CDS_pept        complement(491453..493024)
FT                   /locus_tag="ZYRO0A06160g"
FT                   /old_locus_tag="ZYRO-ORF9162"
FT                   /product="ZYRO0A06160p"
FT                   /note="highly similar to uniprot|P38625 Saccharomyces
FT                   cerevisiae YMR217W GUA1 GMP synthase an enzyme that
FT                   catalyzes the second step in the biosynthesis of GMP from
FT                   inosine 5'-phosphate (IMP) transcription is not subject to
FT                   regulation by guanine but is negatively regulated by
FT                   nutrient starvation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06160g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25705"
FT                   /db_xref="GOA:C5DPU4"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPU4"
FT                   /protein_id="CAR25705.1"
FT                   /translation="MSEEVSKVFDTILVLDFGSQYSHLITRRLREFNIYAEMLPCTQKI
FT                   SELSWKPKGVILSGGPYSVYEDGAPHVDHDVFALNVPILGICYGMQELAWINGKQVARG
FT                   EKREYGPATLNVVDKECPLFQGVDHSRVWMSHGDKLHGLPTGFKVIATSDNSPYCGISH
FT                   ESKSIYGIQFHPEVTHSTHGKILLKNFAVDICHAAQNWTMENFIDTEIQRIRNLVGPTA
FT                   EVIGAVSGGVDSTVASKLMTEAIGDRFHALLVDNGVLRLNEAAMVKETLGDGLGINLTV
FT                   VDASEEFLTKLKGVEDPEKKRKIIGNTFIHVFEREAAKIKPRDGKDIEFLLQGTLYPDV
FT                   IESISFKGPSQTIKTHHNVGGLLEDMKLKLIEPLRELFKDEVRHLGELLGIPHDLVWRH
FT                   PFPGPGIAIRVLGEVTESQVQIARLADYIYIEEIKKAGLYNKIAQAFACLLPVKSVGVM
FT                   GDQRTYEQVIALRAIETSDFMTADWFPFEHDFLKRVASRIVNEVDGVARVTYDITSKPP
FT                   ATVEWE"
FT   gene            <493846..>496062
FT                   /locus_tag="ZYRO0A06182g"
FT                   /old_locus_tag="ZYRO-ORF9159"
FT   CDS_pept        493846..496062
FT                   /locus_tag="ZYRO0A06182g"
FT                   /old_locus_tag="ZYRO-ORF9159"
FT                   /product="ZYRO0A06182p"
FT                   /note="similar to uniprot|Q03656 Saccharomyces cerevisiae
FT                   YMR216C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06182g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25706"
FT                   /db_xref="GOA:C5DPU5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPU5"
FT                   /protein_id="CAR25706.1"
FT                   /translation="MMESSKYTGFNHDSTGIPMPIRHEDEPSRCAEIEIQVSADEYQPP
FT                   VPKVQPQVELQKVRSGTNGNANDAKLFKKYFVEKVKSSSPSGNRGDNSSLSRAGGTKSN
FT                   LSLALKQSDMASSSVKATPPLLHKGLTNQGDMDMEAESDSGSSDSSCDEKNEESFRDYR
FT                   PGGYHPAFKGERYKDGRYVLVRKLGWGHFSTVWLAKDLHDVNATQHVAMKIVRSDKVYS
FT                   EAAQDEIKLLKRIRSQTEKGHVGSDYILKLLDNFYHAGPNGDHIVMVFEVLGENLLALI
FT                   KKYEHRGIPLVYVKQISKQLLLGLDYMHRKCGVIHTDIKPENVLMEIGDVEGIVEMVEL
FT                   MDKQKKNIKRFQRKYSQDFSTAVSPMGVPNSPSSSHLNKVKRDVSGSAIASDYSTNHPR
FT                   IPSGRRARRHTVITSSQPLPSPLASANFKEMKNQFINGGNSSSSVSSQWGAHSLHSKGS
FT                   FPTQTTGGGNDFNGYSMGSASTTLHPSVSENVDSGSGPMNEGQLANSLSSFEISQNEEN
FT                   GPLSSYVPSNSAIFPNNSDSNTIQIKIADLGNACWYDEHYTSSIQTREYRSPEVLLGVP
FT                   WGCSADIWSAACLIFELITGDLLFEPDEGHSYTKDDDHIAQIMELLGELPPYLLAQGRY
FT                   ARTFFNSRGKLRNISKLKHWPLKSVLHEKYNFSVSESRDIADFLIPMLEMDPRKRADAG
FT                   GLVNHPWLSDTHAMQDVSVADRKLYCSGADIPGWYQEVTGHPKH"
FT   gene            complement(<496891..>498471)
FT                   /locus_tag="ZYRO0A06204g"
FT                   /old_locus_tag="ZYRO-ORF9156"
FT   CDS_pept        complement(496891..498471)
FT                   /locus_tag="ZYRO0A06204g"
FT                   /old_locus_tag="ZYRO-ORF9156"
FT                   /product="ZYRO0A06204p"
FT                   /note="similar to uniprot|Q03655 Saccharomyces cerevisiae
FT                   YMR215W GAS3 Putative 1,3-beta-glucanosyltransferase has
FT                   similarity to Gas1p localizes to the cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25707"
FT                   /db_xref="GOA:C5DPU6"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPU6"
FT                   /protein_id="CAR25707.1"
FT                   /translation="MLSLIQILVLVLAVPVRAVLPLQIQNHRFIKATSAENNARDNEIY
FT                   FVKGIDYQPGGSSGFNSYGVHDTLSEPSQCARDIYAFQQLGINTIRIYQLNPYLNHDEC
FT                   MTMLNNAGIYVILDVNSGNVGEHLNRADPEGTYNADYLSRVFKFIESFKNYPNVLGFFS
FT                   GNEVINDDKDYAEIDPPFLRALQRDMKQYISRHCDRTIPVGYSAADNTALRLATFKYLQ
FT                   CNSWDGTSVSEELDESRSDFYGLNSYQWCSGSSNWQNSGYRELAQTFNDPKIPVIFSEY
FT                   GCNQNSPRTFDEVSQGLYDGLKDTFSGGLIYEFSEEANSYGVVCIDDEDKSLTYKKDFE
FT                   NLAYQFSQLDLPRTKQFQLSNSSVSKCDAAAIKAVYKKFGTKDFEIPDQPADITFMIEH
FT                   GVGDVTPGSIIGNYSNPKKLDYEVKDVKGKRVDATLTWEKSNKINEFYHKAGTSNRTFK
FT                   APIITSSVFQRRNSSTRPSTTSLSSKELRTTTLKATTSEIKKSKAQAAELQVTGGTIIG
FT                   LVAVLLSIV"
FT   gene            complement(<499313..>500446)
FT                   /locus_tag="ZYRO0A06226g"
FT                   /old_locus_tag="ZYRO-ORF9153"
FT   CDS_pept        complement(499313..500446)
FT                   /locus_tag="ZYRO0A06226g"
FT                   /old_locus_tag="ZYRO-ORF9153"
FT                   /product="ZYRO0A06226p"
FT                   /note="similar to uniprot|P25303 Saccharomyces cerevisiae
FT                   YMR214W SCJ1 dnaJ homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25708"
FT                   /db_xref="GOA:C5DPU7"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPU7"
FT                   /protein_id="CAR25708.1"
FT                   /translation="MLFLLLISQLLTVLALAQDYYSILGLNKDASDKDVKSAYRQLSKK
FT                   YHPDKNPGDESAHQRFIEVGEAYEVLSDPEKRGIFDQYGADGLKNGAGGGGGPGGGFGG
FT                   FHDPFDIFEQMFNRGGGGGGFGGGFGGMHRGKGPSLRVHEELSLKDYYSGTGVEFELML
FT                   NDICDHCEGSGSEDGKVETCPDCGGQGILIQIIRMGIMTQRIQQPCGRCSGRGHIIKNQ
FT                   CKACGGHKVVKKPKSFQVEVPAGAPRDHVEVRHQEADQSTDMEAGDIFVEFTESDKNNM
FT                   GYRRRGDHLFRTEVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGF
FT                   GMPKGSSGKSFGDLFVEYAVVMPAQFKQTNQWIRDEL"
FT   gene            complement(<500653..>501123)
FT                   /locus_tag="ZYRO0A06248g"
FT                   /old_locus_tag="ZYRO-ORF9151"
FT   CDS_pept        complement(500653..501123)
FT                   /locus_tag="ZYRO0A06248g"
FT                   /old_locus_tag="ZYRO-ORF9151"
FT                   /product="ZYRO0A06248p"
FT                   /note="similar to uniprot|P12962 Saccharomyces cerevisiae
FT                   YOR276W CAF20 Phosphoprotein of the mRNA cap-binding
FT                   complex involved in translational control repressor of cap-
FT                   dependent translation initiation competes with eIF4G for
FT                   binding to eIF4E"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25709"
FT                   /db_xref="GOA:C5DPU8"
FT                   /db_xref="InterPro:IPR031456"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPU8"
FT                   /protein_id="CAR25709.1"
FT                   /translation="MVRYTIEELLQLKPSEALTPNFDAVEFRAMIEKVKHLQALKEEEF
FT                   GHFGHFNRRRSSHHHGKPKVKHTKPKVTIDSDGWSTFEANKKGSGDEEEQEKPARESAP
FT                   QPTIAQETIKVKPNNKNISSTKPADAKDIVADKPIQSFNAFAALESEEEDDE"
FT   gene            <502230..>503411
FT                   /locus_tag="ZYRO0A06270g"
FT                   /old_locus_tag="ZYRO-ORF9148"
FT   CDS_pept        502230..503411
FT                   /locus_tag="ZYRO0A06270g"
FT                   /old_locus_tag="ZYRO-ORF9148"
FT                   /product="ZYRO0A06270p"
FT                   /note="highly similar to uniprot|P32468 Saccharomyces
FT                   cerevisiae YHR107C CDC12 Component of the septin ring of
FT                   the mother-bud neck that is required for cytokinesis
FT                   septins recruit proteins to the neck and can act as a
FT                   barrier to diffusion at the membrane and they comprise the
FT                   10nm filaments seen with EM"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25710"
FT                   /db_xref="GOA:C5DPU9"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPU9"
FT                   /protein_id="CAR25710.1"
FT                   /translation="MTIESAPLPSIGISNLPNQRYKIVSDNGGSLTIMVCGESGLGKTT
FT                   FINTLFQTTLKHGEGHGNRKHHPVKRTVEIDILRALLEEKNFTLRVNVIDTPGFGDNVN
FT                   NNRAWQPIVDFIDDQHDSYMRQEQQPYRDVKYDLRVHAVLYFIRPTGHGLKPLDIETMK
FT                   RISTRANLIPVIAKSDTLSAAELQSFKLRIRQVIEAQEIRIFTPPLNRDEGSVLSQDAA
FT                   AVEHARQLIESMPFAVIGSEEKYDNGSGSLVSGRRYPWGLVEVENDLHCDFRKLRSLLL
FT                   RTNLLDLILTTEELHYETYRRLRLEGHAEDNDPALPVRAPARKLSHNPKYKEEENALKK
FT                   YFTDQVKAEEQRFRQWEQNIVNESIRLNGDLEEMQNKLKKLEEQVRKLQLQKH"
FT   gene            complement(<503607..>504644)
FT                   /locus_tag="ZYRO0A06292g"
FT                   /old_locus_tag="ZYRO-ORF9147"
FT   CDS_pept        complement(503607..504644)
FT                   /locus_tag="ZYRO0A06292g"
FT                   /old_locus_tag="ZYRO-ORF9147"
FT                   /product="ZYRO0A06292p"
FT                   /note="highly similar to uniprot|P29509 YDR353W
FT                   Saccharomyces cerevisiae TRR1 Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06292g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25711"
FT                   /db_xref="GOA:C5DPV0"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPV0"
FT                   /protein_id="CAR25711.1"
FT                   /translation="MLVNSGRTLFSRASSTTSTTNTIIKRMVHNKVTIIGSGPAAHTAA
FT                   IYLARAEIKPTLYEGMMANGIAAGGQLTTTTDIENFPGFPQGLLGSELMDRMKEQSVKF
FT                   GTEVITETISKVDLSSKPFKFWTEFNEDGPANTTDAMILATGASARRVNLPGEETYWQQ
FT                   GISACAVCDGAVPIFRNKPLAVIGGGDSACEEAGFLTKYGSKVYLLVRKDHLRASTIMQ
FT                   RRVQKNDKIEILYNTVAVEAKGDGKLLNTLRIKNVKENQESDLQVNGLFYAIGHTPATS
FT                   IVQGQVTTDESGYIKTIPGTAETNVPGFFAAGDVQDSKYRQAITSAGTGCMAGLDAERY
FT                   LSSLE"
FT   gene            complement(<505151..>505651)
FT                   /locus_tag="ZYRO0A06314g"
FT                   /old_locus_tag="ZYRO-ORF9145"
FT   CDS_pept        complement(505151..505651)
FT                   /locus_tag="ZYRO0A06314g"
FT                   /old_locus_tag="ZYRO-ORF9145"
FT                   /product="ZYRO0A06314p"
FT                   /note="similar to gnl|GLV|CAGL0I01144g Candida glabrata
FT                   CAGL0I01144g and some similarities with uniprot|P38815
FT                   Saccharomyces cerevisiae YHR105W YPT35 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06314g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25712"
FT                   /db_xref="GOA:C5DPV1"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR037917"
FT                   /db_xref="InterPro:IPR039358"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPV1"
FT                   /protein_id="CAR25712.1"
FT                   /translation="MNKVDILMPEPISLMDDESQVRNLNQIYSLQRCQVSDCTIVNGEN
FT                   GTKFAVWKITLLLHPQDTASQQVYYPRVETFRRYSDFCQLREQLIKRCIDEQRPNIDVP
FT                   ELPPGVKWYDVWRYQEINLNRKWLSKRRQGLEFFLNHVLLNGELISLARDLVVKFLEPP
FT                   QTD"
FT   gene            complement(<505818..>506801)
FT                   /locus_tag="ZYRO0A06336g"
FT                   /old_locus_tag="ZYRO-ORF9144"
FT   CDS_pept        complement(505818..506801)
FT                   /locus_tag="ZYRO0A06336g"
FT                   /old_locus_tag="ZYRO-ORF9144"
FT                   /product="ZYRO0A06336p"
FT                   /note="highly similar to uniprot|P38715 Saccharomyces
FT                   cerevisiae YHR104W GRE3 Aldose reductase involved in
FT                   methylglyoxal d-xylose and arabinose metabolism stress
FT                   induced (osmotic ionic oxidative heat shock starvation and
FT                   heavy metals) regulated by the HOG pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06336g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25713"
FT                   /db_xref="GOA:C5DPV2"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPV2"
FT                   /protein_id="CAR25713.1"
FT                   /translation="MASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDG
FT                   AQDYGNEKEVGEGVRRAIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDY
FT                   LDLFYIHFPIALKPVSFEEKYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGL
FT                   IKSIGVSNFSGSIMLDLLRGARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFG
FT                   PQSFVDIGSEVAKATPPLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKER
FT                   LRQNLLVDQEVTLTGDEIKEISGLNKNLRFNDPFTWSEKTPFPIFD"
FT   gene            complement(<507164..>508054)
FT                   /locus_tag="ZYRO0A06358g"
FT                   /old_locus_tag="ZYRO-ORF9142"
FT   CDS_pept        complement(507164..508054)
FT                   /locus_tag="ZYRO0A06358g"
FT                   /old_locus_tag="ZYRO-ORF9142"
FT                   /product="ZYRO0A06358p"
FT                   /note="similar to uniprot|Q06328 YDR352w Saccharomyces
FT                   cerevisiae Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06358g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25714"
FT                   /db_xref="GOA:C5DPV3"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPV3"
FT                   /protein_id="CAR25714.1"
FT                   /translation="MSCSHSVWPWVSSANGVASFALSFVSLFPQIIETYRDKTVAGLSP
FT                   LFLLAWVCGDITSLLGAVLTNQLTFQIVLAFYFLLNDLFVCGQYYYYGILHGNQLATAG
FT                   HESKISYQEGTQNNDDHHHHHHSPTQRSSSPGLWQRFLSTFFLIGVSNALPLVYQEPGN
FT                   APPSAPLPSPESPLGTTLSWVGASFYVGARIPQLIKNYRRKSTDGISPLLFGTTLLCNL
FT                   TYNFSILSSCDFIDSSDKSAFLWNAAPFIAGSAGTVAFDVLYFYQHYVLYSDDLHYREA
FT                   LTNHHEDDERAPLLE"
FT   gene            complement(<508452..>510998)
FT                   /locus_tag="ZYRO0A06380g"
FT                   /old_locus_tag="ZYRO-ORF9139"
FT   CDS_pept        complement(508452..510998)
FT                   /locus_tag="ZYRO0A06380g"
FT                   /old_locus_tag="ZYRO-ORF9139"
FT                   /product="ZYRO0A06380p"
FT                   /note="similar to uniprot|P38814 YHR103W Saccharomyces
FT                   cerevisiae SBE Protein involved in the transport of cell
FT                   wall components from the Golgi to the cell surface"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06380g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25715"
FT                   /db_xref="GOA:C5DPV4"
FT                   /db_xref="InterPro:IPR031403"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPV4"
FT                   /protein_id="CAR25715.1"
FT                   /translation="MTSKLETLREVSPPDLTRDLKNNSTTGTTNSSTGTNNNKMVGLGL
FT                   GRRPSDNLLLNMTALEGLDLNEKDFSALSTPPPKKNFIQKSERPISNDSIATRTTELFS
FT                   ATSSDVNSGSSSIDNEQDIKERTAETIVPTMDQEVSQADESMVSTDGDDSHNSPPRPFL
FT                   QQQQQQHHHHQQQHHQEPQKPILPPTQQQQRNQYIFSNGNRAKSQVALRPPPLHREMME
FT                   MAQPPQVPMGPSLYGHSNSTSAILPNKTPLTPSQRYRLRKAQNESALRKSIRKKEKFYD
FT                   EQETNSQLKNDNFDASLVWNVPMASFSNSSFLEVADLQVGHHNHHNPHPHNHPHNHNIH
FT                   NMNKNTNNTNPHRTNNRSKHTRNLSDPFHENSNKSMTSNGAGNNKIHPHHHSYPKGLPQ
FT                   PGANLSFLNFYDMPTSPIPGLSKTSDFEYMQQTSSNLTNIYENSSHNLSKSKLTERTAS
FT                   TDFLPLEFKTASDLGFEDLLLVSENKLEVTSHSRPSWLPPKSPEERKMHEEQISKSTSM
FT                   ASIEQLDRNKEKEGRIIKNETNRQKYVLLLDRGITRNSSLQSLRKIVWETALTDEVRYN
FT                   VYDEVLQSDARAVTAHYLEPYQDMMDLLNKMDFPTAKEKEIEQLIDSGVRNKLSGQQDE
FT                   ISPELLLMLKLKSISRQGLQPGDELLFHHFLQSNSFTDLQQVWEMGNLVQMICFNDICK
FT                   EKYDSRILNPRGIVAHYLLRSDDFKEEFNATALNSTTWWNVLQRVSHKLFMWIIDIIVV
FT                   ANNQCFKKYPIVKEDFQGKSWEYYRSKRVVNNYKILLAFALNVLLNYHFGFNDLKLLSS
FT                   LDDPNFAIPMPLDHLLDADAINSMFIRKWLHYYKKF"
FT   gene            <511531..>512086
FT                   /pseudo
FT                   /locus_tag="ZYRO0A06402g"
FT                   /old_locus_tag="pseudo-Zyro0A-511531-512086"
FT   gene            <512858..>512929
FT                   /locus_tag="ZYRO0A06424r"
FT                   /old_locus_tag="Zyro0A.tGlu.CTC.10"
FT   tRNA            512858..512929
FT                   /locus_tag="ZYRO0A06424r"
FT                   /old_locus_tag="Zyro0A.tGlu.CTC.10"
FT                   /note="tRNA-Glu (CTC) cove score=60.59"
FT   gene            complement(<513126..>515957)
FT                   /locus_tag="ZYRO0A06446g"
FT                   /old_locus_tag="ZYRO-ORF9133"
FT   CDS_pept        complement(513126..515957)
FT                   /locus_tag="ZYRO0A06446g"
FT                   /old_locus_tag="ZYRO-ORF9133"
FT                   /product="ZYRO0A06446p"
FT                   /note="weakly similar to uniprot|P38692 Saccharomyces
FT                   cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
FT                   kinase family required for cell integrity possibly through
FT                   regulating 1 6-beta-glucan levels in the wall physically
FT                   interacts with Cdc31p (centrin) which is a component of the
FT                   spindle pole body"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25716"
FT                   /db_xref="GOA:C5DPV5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPV5"
FT                   /protein_id="CAR25716.1"
FT                   /translation="MMKKSSNEASGSSSLAVQRPDNQDVTSVFKRTEVIGTGKFGVVYK
FT                   GHHARTKQVYAIKVLNLDSDEDEVEDVQREVQFLASMKQTPNITHYYGSYLKDTTLWII
FT                   IEYCAGGSLRTLLRPGKIDEKYIGIIMREVLIALKYIHKDNVIHRDIKAANVLITNEGH
FT                   VKLCDFGVAAQLNQSSLKRQTMAGTPYWMAPEVIMEGVSYDTKVDIWSLGITTYEIATG
FT                   NPPYCDVEALRAMQLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKERLSADDLLKSKL
FT                   IKHHRTASTTVLKELITRYLLFRDKTKSKRSSVSISEADQPVNDADDDATDSQDEDAEE
FT                   SSDPNAMQVEMRWDFDSLSSSDYIMANDINVEEIPEESAVDWKSHFDQFNFAYPDEERH
FT                   YYQTGNNTGKLVYQGTTMGKSHPSMGVSNSTLNAFPTNNNSTAQPGKMFKSSHTNSTGI
FT                   NGSHNSNTANNSSKKTEAKAPKKLMELFEDNDVINEEEDGDPKELSRINKNLPNDLAGR
FT                   PHAVLMNGAAYHSQSTPALPQLQTKFNKPPKGPTSAVTTTAPTPIEIEIPEELPTSTTT
FT                   PSAIPSALPSSLSSVSMDPLAQPQPVVATNLTKPRSSTVSSHKQPSSISGRIPGGRDMP
FT                   GKIPEEIPRRASGGAENSSDGSISSGMHGVNNGTAAMKLPLRTPSPSKVLNNYMNSPTK
FT                   KPGSSPTGSGPPPTMKPVGTNNETKDVLLQPLNNGNPTSSNNANTGTADKETSRVNRDF
FT                   KRNNPNLKLHMPLPTPMVATKLLDSTDLQSAGPPSSDNINQFGFNTSTVSNVPVSMTPI
FT                   SEKHMDFGNRTRRSQSVANRKNSQSADPVLPVTTSITNANNNATGSSPAVATPLNSMAS
FT                   QLIPPPSDFLSLDLFLDMNTDAGGYTFIDRKPSMLDKLESLLKMYEDGLPVLEDALKKQ
FT                   LLSMDTTYEDSGH"
FT   gene            <516399..>518438
FT                   /locus_tag="ZYRO0A06468g"
FT                   /old_locus_tag="ZYRO-ORF9131"
FT   CDS_pept        516399..518438
FT                   /locus_tag="ZYRO0A06468g"
FT                   /old_locus_tag="ZYRO-ORF9131"
FT                   /product="ZYRO0A06468p"
FT                   /note="weakly similar to uniprot|P50273 YDR350C
FT                   Saccharomyces cerevisiae CM10 Mitochondrial inner membrane
FT                   protein required for assembly of the F0 sector of
FT                   mitochondrial F1F0 ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06468g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25717"
FT                   /db_xref="GOA:C5DPV6"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPV6"
FT                   /protein_id="CAR25717.1"
FT                   /translation="MLRSWNCLRPSCVRFLSDLSSRHEITESSFQRAIGFLETVDIRDI
FT                   VRPNSLQATQLLKVINSVQDGHEMRKLRNRMKKQFGQNYHLIYPRLRQLSDDSLRLQMS
FT                   LFRNSGRRQYDSFLKCLINILNRKDLIDTDKRQRLYDIITFQHEMYPGKNANSAMILPN
FT                   EVHKWFWEHVPRQESFNHYYFLIKNDVYLSWPRYSWKFVKRMMQGSELELQLASFQLFL
FT                   YQGNHQSIFHEKFHKLYSFHAMLLILHRVFKANDLRFAKVYVAVLLRSMETREPSELSF
FT                   FRFNNFLLYYLSQTGDIELFFQAFSVELQFIKNVSKNGASLKILHRPLLFVLKLLRRQG
FT                   YHEEFFTILSILQKVSLGQSQTFKQHAFTELITLLRSFNDCKLTSQYVMSGFDRESTGL
FT                   LLNELGLWNAAFHGNAAVLDSLELQSEIDSLESLLPSSMSLKGQPSMAVMTELYRLVLS
FT                   TNAKVLNVDQYRDLLMTLYSNYTRVLQERKFIHPRHDTGILNVFLYHARYELRDCKLSL
FT                   ALLQNFYASGLARNIRVTSNKCPFSIVVYQNNEITQAEINQLLILMHDAKIPVHFQFCT
FT                   SMVLRYLQLNNQEEAHAWYQRILHAGFKVEHRLLIKAIRDNNWQYPAGFDKVLVEKLDD
FT                   DDGGMVQDDAFFLEEEDSNTTTSIQDNQGHKASLQHIIGLLKTL"
FT   gene            <518601..>519669
FT                   /locus_tag="ZYRO0A06490g"
FT   CDS_pept        join(518601..518707,518772..519669)
FT                   /locus_tag="ZYRO0A06490g"
FT                   /product="ZYRO0A06490p"
FT                   /note="similar to uniprot|P38813 Saccharomyces cerevisiae
FT                   YHR101C BIG1 Integral membrane protein of the endoplasmic
FT                   reticulum required for normal content of cell wall beta-1
FT                   6-glucan"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06490g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25718"
FT                   /db_xref="GOA:C5DPV7"
FT                   /db_xref="InterPro:IPR037654"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPV7"
FT                   /protein_id="CAR25718.1"
FT                   /translation="MLFLWSVLNLLLAVVSSAEELVEQTHVPVLMWSHHLIPALHKYLG
FT                   KFDNSLELPLSTLFQVVREFTEDCETSAFIFINQPGLRKDDLVEYEEEFVNLERYLRKS
FT                   STALAFEQVELMPDDTFEQLTEYVQEICRIDKLLYVEGDNLESFQPYIDIEKRIIRIEY
FT                   PPLPEDPELRGQAILTFDSNLKKMLAQVPSPAHRVIYTSLEPNTDVLESTGRIFQHIFQ
FT                   DKDREIPIERNNHHLDIPPQFNDYKPKFEGMTGEYLSIFDADFIQENKQLLIAITTSLF
FT                   GFLILQLVPSRSPTTTGTTKDKNPAEDIKIADKKPLEPPKINLETSDETDSSN"
FT   gene            <519847..>520407
FT                   /locus_tag="ZYRO0A06512g"
FT                   /old_locus_tag="ZYRO-ORF9128"
FT   CDS_pept        519847..520407
FT                   /locus_tag="ZYRO0A06512g"
FT                   /old_locus_tag="ZYRO-ORF9128"
FT                   /product="ZYRO0A06512p"
FT                   /note="similar to uniprot|P38812 Saccharomyces cerevisiae
FT                   YHR100C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25719"
FT                   /db_xref="GOA:C5DPV8"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR027706"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPV8"
FT                   /protein_id="CAR25719.1"
FT                   /translation="MNISGTLNAFRVVYNPRICMPQLAVPTFNDLPIPINPNIKAVVLD
FT                   KDNCFAYPRENQVWHAYSDKWLDLKKKYPGAALLVVSNTAGSNDDRDYREAQLLEKDLG
FT                   TCVLRHSVKKPGCGQEVMKHFYENKIVESPDQVAVVGDRLFTDVMMANLMGSYSVWIRD
FT                   GVKISSNPIVKFEKALYSMFKPS"
FT   gene            complement(<520491..>531740)
FT                   /locus_tag="ZYRO0A06534g"
FT                   /old_locus_tag="ZYRO-ORF9127"
FT   CDS_pept        complement(520491..531740)
FT                   /locus_tag="ZYRO0A06534g"
FT                   /old_locus_tag="ZYRO-ORF9127"
FT                   /product="ZYRO0A06534p"
FT                   /note="highly similar to uniprot|P38811 Saccharomyces
FT                   cerevisiae YHR099W TRA1 Histone acetyltransferase component
FT                   putative ortholog of human TRRAP which is an essential
FT                   cofactor of c-Myc"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25720"
FT                   /db_xref="GOA:C5DPV9"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033317"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPV9"
FT                   /protein_id="CAR25720.1"
FT                   /translation="MSLSAQIDHFVTKFGGEGISLPARHSALSELSDIVEFVSNPEEYQ
FT                   ALLKVIIPLLLGQLQEINVSFDVGSPENKLRNSILKVFNRLPINQNFEPYVNQVLQVIM
FT                   GALPNENEENGVLCMKILTTLFKSFKAPLQDEVEEFIKIILRIYKNTPETVTKTFQNVN
FT                   GTGASSDDDMRDEQMLNDEVDGGENNSTQDGSSVSVSSISGAGGATKTSDPKDSKAAMY
FT                   SFKVLSECPITMVTLYSSYKQLTTSSLPEFMPLVMDLLNMQVEQQRKAREEVESRGERY
FT                   TTVSPDIRNREAYCEFILAQIKATSFLAYVFIRGYTPDFLQNYVGFIPDLIIRLLQDCP
FT                   SELSSARKELLHATRHILSTNYKRLFLPKLDYLFDEKVLIGTGFTTHETLRPLAYSTVA
FT                   DFIHNVRTELQLDDIEKTIQMYTRYLLDQSLALTVQIMSAKLLLNLVERILKLGKENPQ
FT                   EAPRAKKLLMIIIDAYVSRFKVLNRQYDTIMKYHKKHEQTKTAKTKYLQEAILVDNKDS
FT                   NELMDHILQPAGPVASINGKTKETDTKVDESKMEIDGESNEDNDQEEPVDDNCSMYDIK
FT                   NYAPILLIPVSTNDPIKDAFYLYRTLMSFLKTIIHDLKVFNPPPAEYTIANPKLWVSVS
FT                   RVFSYEEVLVFKNLFHECIIGLRFLSSNVGKPPQPVKKHFDITMPSLPVSATKDGRELM
FT                   DYLAFMFMQMDSSTFNEIIESEMEFMYESMLEDSALLHVAQSFLTSEITSPNFAGILLR
FT                   FLKSKLKDLGNVDFNKSNILIRLFKLSFMSVNLFPTINEIVLLPHLNDLILDSLKYSTT
FT                   AEEPLVYFYLIRTLFRSIGGGRFENLYRSIKPILQVLLQSLNGMILTACLPHERELYVE
FT                   LCITVPVRLSVLAPFLPYLMKPLVYALQGYPDLVSQGLRTLELCIDNLTAEYFDPIIET
FT                   VVEDVSKALFKLLKPQPFNHTISHTAVRILGKLGGRNRRFLRPASDLESQNELDIEINA
FT                   FFKMNGLTEEVPLSVTPGVKSALEILADYRADAGYKVSAFKYLSSVLLLFVKSSTNFDE
FT                   NYDALLETAVHTVTLEKIEIKPDFTAEPVKNNRTFHSQEKLFIKLLQAMFFSYTVPELK
FT                   EDSSKLLNWLIDHFSLLQVNNTLLDKRNYSSVFNIDLKQPGVMIDSRVLVEAISYSLSS
FT                   YITEIRNIAISGIKRVYERGKLIYGEELVFTHSLVFALFRRFIHNCYEEAFYDKRAGVI
FT                   GIKTLIEIGISAKFLKRSQFELIDGLLFVLKDTPSETPADITESAEELLLQVLRTTLSD
FT                   VNELNSKISQNTITDIVCELSNPKAKVRQACQRCLAVISEATNVPIVNLMEHSKHFLLS
FT                   PIFAKPLRALPFAMQIGNVDAVTYCLGLPNTFLNFNEELYRLLQEAIVLADAEDESLSS
FT                   LQRATEYRTSEQLVQLRVSCIKLLAFALKNEEFAAAQQGNIRFRILAVFFKTMLKTSPE
FT                   IIDTTYHALEGVLAENSRLPKELLQNGLKPMLMNLSDHQKLTVPGLEALSKLLKLLIAY
FT                   FKVEIGRKLLDHLNAWCRVEVLDTMFGQDICEQTPTKIIVGIINIFHLLPPQADMFLND
FT                   LLLKVMLLERKLRIQLDSPFRAPLAKYLNRFHVSFMEYFKKNMALRQLILFMCSIIQKS
FT                   EARDLADDFEKEMDTFYEYYITNIPTNQVRVVSFFTNMLDLFSTLVKIRGKEWLKGKGE
FT                   MVLKLKDMLDLVLRTIRKNAFYIDKLQLNQAIERYQGIYLDFISFYPEEQNLLLDFIEF
FT                   AISHGFELSHRFKLFIFENVVSTDNREQQAAYLTSSLNFALSDKNLDAGVFVLQNIVNA
FT                   TFIYEGSRNKSLKSFSVNNVRPEWLDLIYQKIWKSSNEVLLSNVAGRYDVYRFELLQLS
FT                   SVFIKWAPEMITDIRKDVIKFNWHFLKLGDTLVKQAAYLVTSYFIAQFEFPLKVVTQVF
FT                   VAILRCSHAEARYLVKQSLDVLAPVMHERMISAGTPNAWIIWVKRVLFENDSGQNNTLY
FT                   EFLINHPDLFFESRELFISNIIHHMSKVTFISNSSPDNHTLAIDLASLILYWEDRAQDI
FT                   EQSKKQDQDGDVIMDETPEVENDESGKSTSPPKKESNQTVSMNLRETCVAFLIRYVCSS
FT                   NHRASETELGLRAMKILSSLLSEKHWSNVNVKLFYFEKFLMYQDLGSENILYYSMNALD
FT                   VLYVFFKNKSADWVMENLTTIQNLLDKCLKVDHHDIQEVLQKVLTVILKAIKQKNVIND
FT                   NEEETPGKNFVNTVIATIGQDLQGTSSIAAGVMLLWTLFMVFPHSVDPLLGPIMKTFSK
FT                   LCKDHLSTPQPRDAAGVEEARITTRLLEKVLCLLSMKVSSLGDSRRPFLSTVALLIDRS
FT                   MDQNFLRKIVNIARGWVFNNEVFPTVKEKAAILTKMLAFEVRGEPSLSKLFYEIILDLF
FT                   DQKHFNNTEITVRMEQPFLVGTRVRDVSIRRRFMTILDNSLERDIKERLYYVIRDQNWE
FT                   FISDHPWLNQALQLLFGAIEKDRPLTLIDAYGLSSPKILGEFLPDNVTVSSESKNKDLS
FT                   SFVKEHVVSLESFCNITAANIFDPLVEIFYQNPTAIHKTWVSVFPQAYKCIPRNEKYGF
FT                   VRSLIALLSKPYHSRQTNSKANVISTLLDSISRVDSLELPPHLVKYLAISYNSWYQCIK
FT                   ILESIQNNTSIDNSKIVEANEDALLELYVNLQEEDMFHGLWRRKAKYTETNTALSYEQI
FT                   GLWDKAQQLYEVAQVKARSGALPYSESEYALWEDNWILCAEKLQHWDILTELAKHEGFT
FT                   DLLLECGWRVADWNSDREALEQSVKSVMDVPTPRRQVFETFLALQNFADTRKGDQDVRR
FT                   LCDEGIQLSLHKWASLPERYSPSHKYLLHSFQQYIEFLEATQIYANLHTTTAQNLDAKA
FT                   QEVKRVLQAWRDRLPNIWDDVNMWNDLVTWRQHAFQVINNAYLPLIPSLQHANSNSNVN
FT                   THAYRGYHEIAWVINRFAHVARKHNMPDVCISQLARIYTLPNIEIQEAFLKLREQAKCH
FT                   YQNMNELTTGLDVISNTNLVYFGTVQKAEFFTLKGMFLSKLRAHDEANQAFATAVQIDL
FT                   NLAKAWAQWGFFNDRRLSEEPNNISFASNAISCYLQAAGLYKCAKTRKLLCRILWLISM
FT                   DDASGSLANAFESFRGEVPVWYWITFIPQLLTSLSHKEANMVRQILIRIAKSYPQALHF
FT                   QLRTTKEDFAVIQRQTMAVMGDRIDNQNSSNDGPRQPWEHLQELNNILKTAYPLLALSL
FT                   ESLVAQINERFKTTTDEDLFRLINVLLIDGTFNYNRLPFPRGNPKLPANTENNLIRFSE
FT                   TLLAPHIRPKFNADFIDSKPDFETYIKRLRYWRRRLENKLDRAPKVENLEKLCPHLSNF
FT                   HHQKFEDIEIPGQYLLNKDNNLHFIKIARFLPSVDFVRGTHSSYRRLVIRGHDGSIHYF
FT                   AVQYPSVRHSRREERMSQLFRLFNSSLSKNVQTRRRDIQFTVPIAVPLSPQVRIMNDSP
FT                   QFTTLHQIYDEYCAQKGINPDSIQDFVTEQLNIAHDKALPTPDLTVVKVEIFSSIQSMF
FT                   LPTTVLMDYFISLFTEFEDFWLFRKQFASNYGAFVFMTYMMMINGRTPHKIHVDKQSGD
FT                   VFTLEMLPSRYPYERVKPLMKNLELNLPPDTPIFHNNEPVPFRLTPNIQKLIGESALEG
FT                   IFAVNVFAISRALIEHDSELNTYLTLFIRDEIISWFSNLHRPIVENPQLREMVQANVDL
FT                   IIRKVAQLGHFSSSPAVTTQFILDCISSAVNPRNLAKTDANYLPWF"
FT   gene            complement(<532685..>532757)
FT                   /locus_tag="ZYRO0A06556r"
FT                   /old_locus_tag="Zyro0A.tMet.CAT.30"
FT   tRNA            complement(532685..532757)
FT                   /locus_tag="ZYRO0A06556r"
FT                   /old_locus_tag="Zyro0A.tMet.CAT.30"
FT                   /note="tRNA-Met (CAT) cove score=71.12"
FT   gene            <533368..>535530
FT                   /locus_tag="ZYRO0A06578g"
FT                   /old_locus_tag="ZYRO-ORF9122"
FT   CDS_pept        533368..535530
FT                   /locus_tag="ZYRO0A06578g"
FT                   /old_locus_tag="ZYRO-ORF9122"
FT                   /product="ZYRO0A06578p"
FT                   /note="similar to uniprot|Q66RD4 Saccharomyces cerevisiae
FT                   YDR349C YPS7 Putative GPI-anchored aspartic protease
FT                   located in the cytoplasm and endoplasmic reticulum"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25721"
FT                   /db_xref="GOA:C5DPW0"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPW0"
FT                   /protein_id="CAR25721.1"
FT                   /translation="MIRNGFGPSMIKIWLFLLIWLPCIIAKGGHAGGGHAGGGHAGGGH
FT                   VGGGHGSESGSDGKKGSGDSESTTEVSSSDSESESSPNSNSHSGSKPGSNSNSHPDSKP
FT                   GGKAGSKPAASSRVNEEGPSASQHKKTAIGHHTSAYAVCNGNSKSSSSHQRRSTVQQVL
FT                   PTISLNRDNNSLYYTNVSIGTPGQKQPLVIDIVEPYNWVTHNHFESHDPISSNSSGSYQ
FT                   SNLSRTSQQVDGSHVFHLDFVDLDDINATAMMDKISFESLSLKNQSSHTINNTQNDGSG
FT                   ALYNSHSLTLSNSSFFEINDTTSSKGVLGLGGKINDKGTDIDSSQFDSSFFLLESLRDN
FT                   GIIESLSYSLWLGGDTRPYYDVGRNVPDEINCGKLILGGVDPYYYSGPLKKFNNLIFLD
FT                   SRTDMLSRGYPVLPMRTINVVSATGNSINVTNENFLTPVLLDSRYSFSHLPAETIVQIA
FT                   VQVNAIYMKEVDMFVVSCKIADMGVNIQFEFGDVSIDVPFKDFLMSTHNPETNSTMKFS
FT                   GGDEACFMTMVSSEETGFNILGTSFLRNVYLAVDHDDQSIAIAQARRKYTTLITPDGAG
FT                   TSATASISHYLSPSLSSTGKATPIASGYIPYAVSSNETLSMTLSPSQPPETRIPDQFTA
FT                   TVFSNGLISTGRSFYNTYRSTSSSSTVPTDFASFTVTSAQRTSSTGQQGNKGSNAYRLK
FT                   PPEIANKYWISHIFLLAGSIMLVMIW"
FT   gene            <535933..>538773
FT                   /locus_tag="ZYRO0A06600g"
FT                   /old_locus_tag="ZYRO-ORF9121"
FT   CDS_pept        535933..538773
FT                   /locus_tag="ZYRO0A06600g"
FT                   /old_locus_tag="ZYRO-ORF9121"
FT                   /product="ZYRO0A06600p"
FT                   /note="similar to uniprot|P38810 Saccharomyces cerevisiae
FT                   YHR098C SFB3 Member of the Sec24p family forms a complex
FT                   with Sec23p that is involved in sorting of Pma1p into COPII
FT                   vesicles peripheral ER membrane protein potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25722"
FT                   /db_xref="GOA:C5DPW1"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036174"
FT                   /db_xref="InterPro:IPR036175"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPW1"
FT                   /protein_id="CAR25722.1"
FT                   /translation="MEPDALAKDVSSLSLDQTGSRNTGKKGRRPNRAYHNLGSGAGTPN
FT                   TTPFLNASASQESFQFGAQPPQAPFAGASAGAGSVGNGFDTQSSPVPMTVPGFPPGSPA
FT                   IMAQERERVATAVDSPASPWFPKGNTPVQSSSHFVTTQRWEDQLLHLPKTFETARDSVP
FT                   PLPTTAFYAIDQGACDPRLLSLSMYNIPVDEHLRSATKLPLGLTIQPFATTIPDEPLPL
FT                   IDQRTETGPLRCKRCRAYINPGFKFGFDATATCNICGVKLRLPSDEFISPGISLQGPDI
FT                   SFKPELQKGSVEFLVPQIYNAVQDQPALPLHYVFLMDLSLFSNENRSSLAVVEGIRTSI
FT                   EHIAGSQPNCKVAIMAYDNKIRFFNLRPDSESAQEYVVSDIDDVFLPFCNGLFVRPQES
FT                   MRLIDMTLNKIVEYITVDKFSHVAPVCYGSALEAAKLAIDTVTGGQGGKIICTLNSLPT
FT                   VGNGNLALKKDDAARKKLNCDNDFYKKIGNQFLRSYISLDLFVTSPGFVDMATIGYPVE
FT                   ATSGNLKWYSNFNHENDAFTLINDMSNAVTSIVGYQALIKVRCSTGLNVSQYYCESSEY
FT                   SDRDPMIPVLTKNTTLDVLLKYDQKLPVGKNIAFQMALLYTDINGVRKVRSINTNGAVS
FT                   DNIREVFKFLNQNVAQRIMIKDVVQHLGDCDFPAIRKTIDDKMVEILTQYKALVGGSLT
FT                   SQLVLPEALKTLPSYMLAFEKSELMLPNNHSTRGNARIYDLFRYKTLSSAQLHYKLYPQ
FT                   IVPLHVLLSEDDLSFYDANEKMLQVRPESVESLSVRNGHQHLTNGGCYLIFQGDTVYVW
FT                   INENTNRMLLQDLLQADEEVPVSQISLFGGSLPEVGTEVNQKALDLIKNWSQLVSQPYL
FT                   PVVLLRPNVDPYYAQVMNQLLCEDRAVNRIESLDNYLIAMHRRIQEKLKKDDYIKVQTN
FT                   HNAEQDGSLLQKFVQF"
FT   gene            <540195..>541724
FT                   /locus_tag="ZYRO0A06622g"
FT                   /old_locus_tag="ZYRO-ORF9117"
FT   CDS_pept        540195..541724
FT                   /locus_tag="ZYRO0A06622g"
FT                   /old_locus_tag="ZYRO-ORF9117"
FT                   /product="ZYRO0A06622p"
FT                   /note="similar to gnl|GLV|KLLA0F22154g Kluyveromyces lactis
FT                   KLLA0F22154g and some similarites with YDR348C
FT                   uniprot|Q66RD5 Saccharomyces cerevisiae YDR348C Protein of
FT                   unknown function green fluorescent protein (GFP)-fusion
FT                   protein localizes to the cell periphery and bud neck
FT                   potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25723"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPW2"
FT                   /protein_id="CAR25723.1"
FT                   /translation="MLSRKSTSPSTNPFLDDVENENLNRGSRSSSQNGYTPPRYPKTSP
FT                   TTAAYPSAEEEKQMLRDRYRETEDMDNSGYGDADADADADLPPSYDEVAGPTKSNAPYR
FT                   REKASVSSNAAHTPSSPKDPLINSNRESDPRRRYSHYRGPVPSRAGGSGGNNERSVPTA
FT                   PMVAAPEPRRRYDRDHTPVQPRDRYKERDYSDREHREHREHRDRERSHHHPHRHRSHRH
FT                   RDHAPSSSKDKKSSNGTKPQPKNVDKIDKMDVTALFGSSFHHDGPFDAVTPHRNKNAKA
FT                   PPVLAFPADGPNNSIGGAPTKKNAMNEVFGRMDPEDDDDIYQARPKSSPRTTVFGVSSD
FT                   PSSANGSSTTLDAVKPGAKDLTAFDPRGRVQAVEGPTTDGLGSTTFLDGAPASNKAIGE
FT                   DVRAHARQTRLGGVQRKPSLSQKLTSTVRGGSSSGPSSSYGNGSGSGTVYSRNLAPEKP
FT                   LSLTRSHSGHLENGDDDEDVYLGLPSSELSRKKSTGTRLMRRVRSMKVGRK"
FT   gene            complement(<541958..>542881)
FT                   /locus_tag="ZYRO0A06644g"
FT                   /old_locus_tag="ZYRO-ORF9113"
FT   CDS_pept        complement(541958..542881)
FT                   /locus_tag="ZYRO0A06644g"
FT                   /old_locus_tag="ZYRO-ORF9113"
FT                   /product="ZYRO0A06644p"
FT                   /note="similar to uniprot|P10662 Saccharomyces cerevisiae
FT                   YDR347W MRP1 Mitochondrial ribosomal protein of the small
FT                   subunit MRP1 exhibits genetic interactions with PET122
FT                   encoding a COX3-specific translational activator and with
FT                   PET123 encoding a small subunit mitochondrial ribosomal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06644g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25724"
FT                   /db_xref="GOA:C5DPW3"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPW3"
FT                   /protein_id="CAR25724.1"
FT                   /translation="MFRSSLSFLRTSRSYITPTLEHLNSGSGLKGLFSPQGLDNGWFSR
FT                   AEHYTNKLNSLTNGIEEIPLEKLIYENAKSGVKRNIVNYATLLYNLKFAFSTLHGCPKE
FT                   LPNASDIDVKELLKTPELTLKYANEPLDTGKEKLHSALVSSFGSIVEFRTLLLNSNNAI
FT                   SGDGFTWLVARRVASQDFDSQKLEFDRLFILNTYNAGSPFNFNKKGHMDELKNQYEKAS
FT                   KELDQEQQEFNAPLRSKSVEEARQMESFKDTEYLPLLAIDASPKAWLYDYGPYGKQMYL
FT                   DRVWESIEWDLVESRLPEKSQSHQLL"
FT   gene            <544036..>545427
FT                   /locus_tag="ZYRO0A06666g"
FT                   /old_locus_tag="ZYRO-ORF9110"
FT   CDS_pept        544036..545427
FT                   /locus_tag="ZYRO0A06666g"
FT                   /old_locus_tag="ZYRO-ORF9110"
FT                   /product="ZYRO0A06666p"
FT                   /note="similar to uniprot|Q05515 Saccharomyces cerevisiae
FT                   YDR346C SVF1 Protein with a potential role in cell survival
FT                   pathways required for the diauxic growth shift expression
FT                   in mammalian cells increases survival under conditions
FT                   inducing apoptosis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25725"
FT                   /db_xref="GOA:C5DPW4"
FT                   /db_xref="InterPro:IPR013931"
FT                   /db_xref="InterPro:IPR033394"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPW4"
FT                   /protein_id="CAR25725.1"
FT                   /translation="MLKWIQGGISAVTGIAEPEYGSDYIHSVADRVKGKQPYKETSRED
FT                   LYWLNPDYTNVETATFYFTNIKTGVLGFAQIIHSNIIGLHTQAQFTFRVYNAKEGKEAL
FT                   NLWTSTKLENFRIDGPNFYADNLSVELDQDSKTYHFKSDVNEKSKVDLTFTKLTPGCKV
FT                   GDDPSTYYGDNIEEPWGRMRHVFWPRNKVTGKIDIKVPVKQQASEEHKDIKGEQTSQDT
FT                   RQKDRESAEEKGTSEENEEEEEEEELEDLHIKFTDESPALSMFVMAFQGMKPHHAAKAW
FT                   NFLYFHSEDHTAVLMEFITPKSYANTKVSVGIITSKNEVLSVSVNNDFRHLNSSVDSVG
FT                   WNVPKNLSVKFNGFKSTAPDEKIAAITNSPTKQEKYDNDTQLHATVEGKLDQLVERIDV
FT                   MNEIPNFVKSIVSGVAGTKPYIYQYADEFTLQFQDASKEKGLAWVEVTFISEGETVTDE
FT                   SYNEA"
FT   gene            <546489..>548204
FT                   /locus_tag="ZYRO0A06688g"
FT                   /old_locus_tag="ZYRO-ORF9107"
FT   CDS_pept        546489..548204
FT                   /locus_tag="ZYRO0A06688g"
FT                   /old_locus_tag="ZYRO-ORF9107"
FT                   /product="ZYRO0A06688p"
FT                   /note="highly similar to uniprot|P39003 Saccharomyces
FT                   cerevisiae YDR343C HXT6 High-affinity glucose transporter
FT                   of the major facilitator superfamily nearly identical to
FT                   Hxt7p expressed at high basal levels relative to other HXTs
FT                   repression of expression by high glucose requires SNF3"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25726"
FT                   /db_xref="GOA:C5DPW5"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPW5"
FT                   /protein_id="CAR25726.1"
FT                   /translation="MSKSEEHNETAITPEFSPELSPTESPSPSGGLPAKLEDEALKDYV
FT                   LHPEDEEPIIDLPKKPASAYISVAIMCVMIAFGGFVFGWDTGTISGFVNQSDWIRRFGT
FT                   QRSDGTYYLSKVRMGLVVSIFNVGCAIGGLTLSKIGDIYGRKIGLISVVVVYVVGIVIQ
FT                   IASVDKWYQYFIGRIISGLGVGGTAVLSPMLISEVSPKHIRGSLVSCYQLMITAVIFLG
FT                   YCTNYGTKNYTNSVQWRVPLGLCFAWALFMIGGMTFVPESPRFLISVGKIEEAKRSLSK
FT                   SNKISTEDPGLLAELENIQASVEEEKLAGSASWSEMFSPKTKVLQRMIMGIALQSLQQL
FT                   TGDNYFFYYGTTIFKSVGLEDSFQTSIIIGVVNFFCTFLSLFTVDRFGRRKCLLWGAIG
FT                   MVCCFAVFASVGVTRLWPNGQGNGSSKGAGNCMICFTMFYIFCFATTWAPLCYVIVSES
FT                   YPLRVKSKGMALATAANWLWGFLISFFTPFITDAINFYYGYVFMGCLVFAYFYVFFFVP
FT                   ETKGLTLEEVNEMWMDNVLPWKSPDWVPSSRRNVDYDANAMSHDDKPFYKKLLG"
FT   gene            <548548..>550488
FT                   /locus_tag="ZYRO0A06710g"
FT                   /old_locus_tag="ZYRO-ORF9105"
FT   CDS_pept        548548..550488
FT                   /locus_tag="ZYRO0A06710g"
FT                   /old_locus_tag="ZYRO-ORF9105"
FT                   /product="ZYRO0A06710p"
FT                   /note="highly similar to uniprot|Q05506 Saccharomyces
FT                   cerevisiae YDR341C Cytoplasmic arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25727"
FT                   /db_xref="GOA:C5DPW6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPW6"
FT                   /protein_id="CAR25727.1"
FT                   /translation="MWKRITSSLFQRFTLPLYHRKFPIKKLSIKRELSTLQPIKMSNTF
FT                   AQHLQKLSINDPPVFEGSHPEANVVDLMRNYVAEELSKVSGVDAKQIYPALEWTNTLER
FT                   GDLLIPVPRLVRQKGINPREIAQEWAEKFPQGELISNVEANGPFVQFFFNPQFLFHTVV
FT                   PDILTRTEDYGACKYVENKKVLIEFSSPNIAKPFHAGHLRSTIIGGFLSNLYEKCGWEV
FT                   IRMNYLGDWGKQFGILAVGYERYGDEKKLAEDPIDHLFQVYVRVNKDIEQESDSLPESE
FT                   STDGQSRAYFKRMEDGDPAAIKLWQKFRELSIEKYIGTYARLNIHYDVYSGESQVSKES
FT                   MEKALKLYDEKGLVHIDRGAKLIDMTRFNKKLGKVIVQKSDGTTLYLTRDIGAAIDRYN
FT                   KYHFDKMIYVIASQQDLHTAQFFELLKQMGFEWAKNLHHVNFGMVQGMSTRKGTVVFLN
FT                   NILEETKDNMHEVMKKNEVKYAQVENPDEVADLVGISAVMIQDMQGKRINNYEFKWERM
FT                   LSFEGDTGPYLQYAHSRLRSMERNVPDITVADMKNADFKLLQEPAAIALVRLLSQYPDV
FT                   LRNALKTHEPTTVVTYLFKLTHQVSSCYDVLWVAGQTKELATVRLALYAATRQVLFNGM
FT                   KLLGLTPVERM"
FT   gene            <550669..>550768
FT                   /locus_tag="ZYRO0A06732r"
FT                   /old_locus_tag="Zyro0A.tSer.GCT.11"
FT   tRNA            join(550669..550705,550724..550768)
FT                   /locus_tag="ZYRO0A06732r"
FT                   /old_locus_tag="Zyro0A.tSer.GCT.11"
FT                   /note="tRNA-Ser (GCT) cove"
FT   gene            <550964..>551533
FT                   /locus_tag="ZYRO0A06754g"
FT                   /old_locus_tag="ZYRO-ORF9102"
FT   CDS_pept        550964..551533
FT                   /locus_tag="ZYRO0A06754g"
FT                   /old_locus_tag="ZYRO-ORF9102"
FT                   /product="ZYRO0A06754p"
FT                   /note="highly similar to uniprot|Q05498 Saccharomyces
FT                   cerevisiae YDR339C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25728"
FT                   /db_xref="GOA:C5DPW7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR037503"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPW7"
FT                   /protein_id="CAR25728.1"
FT                   /translation="MGKAKKTRKFGLVKRTLNAKKDPRLKQNQDKKPQKADPELTRNIP
FT                   QVSSALFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMA
FT                   ELEKLGPKYRIALKLARDPRIKRLSCTHKGTYADDCLVNRVMQHKCYIVATNDAPLKQR
FT                   VRKIPGIPLMSVGGHSYVIEKLPDAF"
FT   gene            <551779..>552669
FT                   /locus_tag="ZYRO0A06776g"
FT                   /old_locus_tag="ZYRO-ORF9101"
FT   CDS_pept        551779..552669
FT                   /locus_tag="ZYRO0A06776g"
FT                   /old_locus_tag="ZYRO-ORF9101"
FT                   /product="ZYRO0A06776p"
FT                   /note="similar to uniprot|P38806 Saccharomyces cerevisiae
FT                   YHR090C YNG2 Yeast homolog of mammalian Ing1 NuA4 histone
FT                   acetyltransferase complex component"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25729"
FT                   /db_xref="GOA:C5DPW8"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR024610"
FT                   /db_xref="InterPro:IPR028651"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPW8"
FT                   /protein_id="CAR25729.1"
FT                   /translation="MDPSSVLDQTIQDVSNLQAEFTHILGEIRASDTQLLDQRKKYMQK
FT                   DSQIHKFIRQHGSLQEHPKEQELSEKIREKMSACKNLQEQKCTMANTALYLVAKHLSRL
FT                   EKNIGLLEEDGLLAPVDEDADSSTEFSRESSSVSGTGERRRKAASSSSHEPSHVKRRRT
FT                   GRASSPNQTAHTPSVPPPATSLSQPVASREDESHENTEGSPLPVVEKDVNFDLQDYNDD
FT                   LFSGYNNNEEEDRTLYCFCQSVSYGEMVACDGPNCKYEWFHYSCVNLKEPPKGQWFCPD
FT                   CRQEMAKDKLKKKKI"
FT   gene            <553122..>555185
FT                   /locus_tag="ZYRO0A06798g"
FT                   /old_locus_tag="ZYRO-ORF9098"
FT   CDS_pept        553122..555185
FT                   /locus_tag="ZYRO0A06798g"
FT                   /old_locus_tag="ZYRO-ORF9098"
FT                   /product="ZYRO0A06798p"
FT                   /note="similar to uniprot|Q05497 Saccharomyces cerevisiae
FT                   YDR338C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25730"
FT                   /db_xref="GOA:C5DPW9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPW9"
FT                   /protein_id="CAR25730.1"
FT                   /translation="MVTALISKALSEVHPTLRTNGMGIGNTHRRISLGFLPVNKKNPLV
FT                   RKYRRRNGRADQRSYQSLGEDFGSSAREPDFFLNEAIEEEDYLNDTDGGELSRTISLPS
FT                   RVSETPDVSQLDNDWILQEHERRYSSAYNSDHEEQEELDIMGRYPGRELDYDEFMQRLQ
FT                   VQKQMYENERANFGMKPRRPSFISVTSRGTVPIVYEEYDENAPTERFTNVTFQSESKVI
FT                   ASYSFPLIFTFLLEQMFPMVCSLTVGHLGSNELAAVSLASMTSNITLAIFEGIATSLDT
FT                   LCPQAYGSGRFYSVGIHLQRCIAFSHVVFIPFAIFWFYSEPILSLVVPEKELVALTAKF
FT                   LKVLILGAPPYIFFENLKRFLQAQGIFDAGIYILSICAPLNVLVSYTLVWNRYIGVGFI
FT                   GAAIAVVINFWMMFIMLLLYTMFIQGKKCWGGFTRKAFTHWGDLARLAISGIIMLEAEE
FT                   LSYELLTLFSAYFGTKYLAAQSAVSTTAALLYMVPFAVGISTSTRIANFIGAKNQVAAD
FT                   IASRVGLTFSFAAGLSNCCFLVFGRHIVARIFSRDETVLNLMSSLLPLVGIVQNFDSLN
FT                   AVAGACLRGQGMQALGSIVNLVVYYIIAIPLGMFLSYFLDWKLYGLWVGIGIGMLLIGL
FT                   IESYYVLFPDWDSIMTYAEMLKETEEDDESDDDSDYRDSDEEPDETSPLLRL"
FT   gene            <555383..>556831
FT                   /locus_tag="ZYRO0A06820g"
FT                   /old_locus_tag="ZYRO-ORF9096"
FT   CDS_pept        555383..556831
FT                   /locus_tag="ZYRO0A06820g"
FT                   /old_locus_tag="ZYRO-ORF9096"
FT                   /product="ZYRO0A06820p"
FT                   /note="weakly similar to uniprot|P08465 Saccharomyces
FT                   cerevisiae YNL277W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25731"
FT                   /db_xref="GOA:C5DPX0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPX0"
FT                   /protein_id="CAR25731.1"
FT                   /translation="MRSLMGLIKPNLVLLRAKRFNSSGSTNPAMMFPCLDKMERVSEEL
FT                   RTTTVGTQGQNEPVYGKVKSGFEIFKSNRPFYTDYGGVLPNFQIAYETWGTLNEDKSNA
FT                   ILIHTGLSASSHAHSTNLNQQPGWWEKFIGPGNVCLDTNKWFLICTNVLGGCYGSTGPS
FT                   SPDPADGLPYATRFPMLSVHDMVRAQKRLINEHFGIEKLYASLGSSMGGMQSLSYAQQF
FT                   PSEVNKVISVSACARSHPSSIAMRHAQRQVLMGDPNWNRGFYYPTAAEPNKIPPHVGMK
FT                   LAREIATVTYRSGPEWESRFGTERLDDERSPVLCPDFLIETYLDHQGEKFSLEYDANSF
FT                   LYISKTMDLFDLSLSHKERSIRRRARAKELYESGTLNEAQDPLLDRTSDKKRHRTSTVE
FT                   QSYQDLKQGCKPLLDNDVLVVGVKSDGLMPCWQQREIYSLLDGDTNPNVAHVELQESES
FT                   YFGHDTFLLDLEHIGRSIGQFLCK"
FT   gene            complement(<556881..>557750)
FT                   /locus_tag="ZYRO0A06842g"
FT                   /old_locus_tag="ZYRO-ORF9095"
FT   CDS_pept        complement(556881..557750)
FT                   /locus_tag="ZYRO0A06842g"
FT                   /old_locus_tag="ZYRO-ORF9095"
FT                   /product="ZYRO0A06842p"
FT                   /note="similar to uniprot|P21771 Saccharomyces cerevisiae
FT                   YDR337W MRPS28 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25732"
FT                   /db_xref="GOA:C5DPX1"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPX1"
FT                   /protein_id="CAR25732.1"
FT                   /translation="MFAACGFVVHDLRQSFRPIMSISRSFSCSRPTQGVKAVKFLKSQR
FT                   KKQANLARQSELSSSVDAVDPVLGRRDTPFINRVVAELREPGVLSHGYQQNEVEKLMSA
FT                   LESTKRRTLELSSLNSELVEPESLESLEARREAISRILSMRNADSKNSLKMALKLAREE
FT                   FQRFPGDTGSSEVQASCMTIRIHNLVKHIKDHQKDYANIRILRMLVQQRQSILRYLKRD
FT                   NPERYFWTLEKLGLTDSVVMQEFNMDRRYMQDFKMFGDKILIKDSKKVADQKRRELRKQ
FT                   RRVAGPSI"
FT   gene            <558027..>558638
FT                   /locus_tag="ZYRO0A06864g"
FT                   /old_locus_tag="ZYRO-ORF9093"
FT   CDS_pept        558027..558638
FT                   /locus_tag="ZYRO0A06864g"
FT                   /old_locus_tag="ZYRO-ORF9093"
FT                   /product="ZYRO0A06864p"
FT                   /note="some similarities with uniprot|P28007 Saccharomyces
FT                   cerevisiae YHR089C GAR1 Protein component of the H/ACA
FT                   snoRNP pseudouridylase complex involved in the modification
FT                   and cleavage of the 18S pre-rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25733"
FT                   /db_xref="GOA:C5DPX2"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPX2"
FT                   /protein_id="CAR25733.1"
FT                   /translation="MSFRGNLRGGRGGMRGGRGNGRPNGRFVPQGPPDTVLEMGQFMHP
FT                   CEGDIVCKSINTKIPYFNAPMYLENKTQVGKVDEILGPLNEVYFTIKCTEGVHATSFKD
FT                   GDKFYIGSDKLLPIERFLPKPKVAGPPKPRKKKAPMRGGPSFGRGGSSFGRGGSSFGRG
FT                   GPSGGRGGFGARGSSRGGFRGGGRGASRGGFGRGRGGKRF"
FT   gene            complement(<558674..>559645)
FT                   /locus_tag="ZYRO0A06886g"
FT                   /old_locus_tag="ZYRO-ORF9092"
FT   CDS_pept        complement(558674..559645)
FT                   /locus_tag="ZYRO0A06886g"
FT                   /old_locus_tag="ZYRO-ORF9092"
FT                   /product="ZYRO0A06886p"
FT                   /note="similar to uniprot|Q05473 Saccharomyces cerevisiae
FT                   YDR336W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25734"
FT                   /db_xref="GOA:C5DPX3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPX3"
FT                   /protein_id="CAR25734.1"
FT                   /translation="MMSLWTKRWFSTTSSLTNRAADIGKIVLNTKVQQPFKSDGGRKQR
FT                   QVAKTKKPARDSNPPAWYTLNQKYSSLFSEPSATEINSVNHFFNSSDVRYEWSAAHFID
FT                   VPGERLKEKVSNESNGKKFQGKTYVPFELVNGLPEVAFLGKSNAGKSTLLNSLTTDLKQ
FT                   TSLGEYARASKRAGFTKTLNSFNIGNKFRIVDTPGYGYNSSAEQGNLTMEYVSQRQQLA
FT                   RCFLLISGEQGFNDMDLQIVEFLSSIGKPFEIVFTKMDKVKDLKGFQNMNLHELPGLPG
FT                   IIFTNSLISKTCPKRYGVDLLRRLIFQSCGLQIGTKPSRQRK"
FT   gene            complement(<559934..>563608)
FT                   /locus_tag="ZYRO0A06908g"
FT                   /old_locus_tag="ZYRO-ORF9091"
FT   CDS_pept        complement(559934..563608)
FT                   /locus_tag="ZYRO0A06908g"
FT                   /old_locus_tag="ZYRO-ORF9091"
FT                   /product="ZYRO0A06908p"
FT                   /note="highly similar to uniprot|P52918 Saccharomyces
FT                   cerevisiae YDR335W MSN5 Karyopherin involved in nuclear
FT                   import and export shown to be responsible for nuclear
FT                   import of replication protein A and for export of several
FT                   proteins including Swi6p Far1p and Pho4p cargo dissociation
FT                   involves binding to RanGTP"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06908g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25735"
FT                   /db_xref="GOA:C5DPX4"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040018"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPX4"
FT                   /protein_id="CAR25735.1"
FT                   /translation="MDSDGASQVVTALGVIYDPKSNNQQRLEAQKFLDDVKSKEESPYW
FT                   GYQIALNNPTDFILKHFGLGLLADAIKKKWNDYDEDKRLALRKWIMELNYRVLNTDPRY
FT                   IKQKLAFLWVEITKRTWGEALKEESPSEQELLNSWADMDSNLTELWNISEASRELTLLI
FT                   FKILFEDVFLLVDLTVLKRMTVIQPLCVMIVCPMDVFATKYKFTEKWTLFKANREGWFA
FT                   LWVSELNEALIQNNSSYVVRLLETLKTCLNWPLSEVIIENDIFSTSLQCFLSNIPEAQS
FT                   MALDSMHILLTRPYSNDEHYQAVIDKVFNSMDLLERVYDYLQFDPKEGIDEVKYPIVKK
FT                   CVDMISCLYVCVFKIKDNNQQIEKYLRLVLKATFHPSLIVSGLTLDLWCSCLRNDDFLP
FT                   LLDRYVMSDLLQFAADALIYYEQIEGHVSKNFVDIDFQSNSEFQNFCSTYRKRIRDIIR
FT                   LISCVKLDYTYDWLNNRLNSFFSSPYGQEVLNSTFLDRKGEPYLSALSQFMIIECFING
FT                   CIRWKIWYPSGSDYSEKLDGILTKLEILSNQLIALNIREPLLLKKQIQNFALFLTMLKD
FT                   NVLFTLLEKIITSATMEYPEIDLEERSAEADAVRDLRYACGIELNRMALLMPESLMAIF
FT                   PDLENVVAKILPNLSYHERISFKSFLLTIVLKSSLDRKQERFSAIVDSELMAWSDQTTV
FT                   VGLSELPWFMERLGIVQIAEYFQRHNINETSDLLSIPIDDEGKRLKFDLTKRWQALFPV
FT                   RATRMFIHYSMQSVKKDDEFKMLQDIWRPRIVPILPYIMRLLYQLQAYHDPANWSQLPI
FT                   VVQSFVKYSTIERFWEAGASNKSKDEFIDEHMRAMQTLRDFADSVGHIVRYTREYTLLV
FT                   INAISSLGSVFFDIDEAPHLLIDSIAIFKPDTNEISPGVSTHGWKHIMNVAIRPLLKNC
FT                   PEECIPKFMSAFLPKLFETLDLLLCQKWSLYMNDIDVNPIPMDDEEMTEDILEENLLRQ
FT                   LTTVVVRIMVDCVGQASTNPQTSKPKFTSHQLNMRSTIFGNLNVLAPFLKLLNHLMSFR
FT                   DSKCSFNAILVMKCCLNDVLVREDSVDEFFTVEVMKNLLLNVLCQSSFKDSFYEALNVF
FT                   TVLFLTLCKEYKPARAYLYEISHGYDIDALYDQLRSVDHYRNQRALMIEFIDWIKTANG
FT                   NNDDEDSENSPEHKRQERRAAILQRANERLVKKNKDAGDILDDPNTEDAAFGNLFGSS"
FT   gene            complement(<564255..>565136)
FT                   /locus_tag="ZYRO0A06930g"
FT                   /old_locus_tag="ZYRO-ORF9088"
FT   CDS_pept        complement(564255..565136)
FT                   /locus_tag="ZYRO0A06930g"
FT                   /old_locus_tag="ZYRO-ORF9088"
FT                   /product="ZYRO0A06930p"
FT                   /note="highly similar to uniprot|P38805 Saccharomyces
FT                   cerevisiae YHR088W RPF1 Nucleolar protein involved in the
FT                   assembly of the large ribosomal subunit contains a
FT                   sigma(70)-like motif which is thought to bind RNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25736"
FT                   /db_xref="GOA:C5DPX5"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPX5"
FT                   /protein_id="CAR25736.1"
FT                   /translation="MAAEELKIKNKMLRQQIIADLKDQKNKERHKMRAQRAKEEREDPT
FT                   AKEKRLAENVPKTIEGMRVYDETIGQKDEADEEDLMQLFNNNGEPPKILLTTSINAKRN
FT                   AYEFANVLIEIFPNVTFVKRKFGLTMKDIVEASSKRNFTDIIIINEDKKKVTGLTFMHL
FT                   PEGPSFYFKVSSYVDVKKIVGHGRPTSHIPELILNNFSTRLGKTVGTLFQSIFPKNPDF
FT                   EGRQVITLHNQRDYIFFRRHRYVFENEKKVGLQELGPQFTLKLRRLQRGIKEETEWEYR
FT                   PEMDKEKKKFYL"
FT   gene            <565557..>566516
FT                   /locus_tag="ZYRO0A06952g"
FT                   /old_locus_tag="ZYRO-ORF9087"
FT   CDS_pept        565557..566516
FT                   /locus_tag="ZYRO0A06952g"
FT                   /old_locus_tag="ZYRO-ORF9087"
FT                   /product="ZYRO0A06952p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25737"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPX6"
FT                   /protein_id="CAR25737.1"
FT                   /translation="MNSNIQGPQRSYTDGSRFDNESPVLPILDFNTSKINTPIQLLPIN
FT                   VVLPELKYWQEQFSNTSEEDIWKRRNLRFQQRHQLKPLIRPNRRQDRTPHLKRDSKLST
FT                   ETKMSNFGEYIKDMKSHGHTQILMRTRVITELGITRAKLQSPTLIMNNWGGTMNSIQVQ
FT                   TRALSLGQETFRTEHALSCQRTTRDQVIELHFGPVSQSPADYQFAVYSTAVRQPHGGYR
FT                   WFHYVKGATYVNLAIFLLGSDFNYSINDNLVEPTIGNDLKVISAKKRCISRLRSHAKSS
FT                   MIANPCPGNNDTGGSIMEIQHVHPKLYKLLHHHTFLQL"
FT   gene            complement(<566600..>566908)
FT                   /locus_tag="ZYRO0A06974g"
FT                   /old_locus_tag="ZYRO-ORF9086"
FT   CDS_pept        complement(566600..566908)
FT                   /locus_tag="ZYRO0A06974g"
FT                   /old_locus_tag="ZYRO-ORF9086"
FT                   /product="ZYRO0A06974p"
FT                   /note="similar to uniprot|P38804 Saccharomyces cerevisiae
FT                   YHR087W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25738"
FT                   /db_xref="GOA:C5DPX7"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="InterPro:IPR036786"
FT                   /db_xref="InterPro:IPR039100"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPX7"
FT                   /protein_id="CAR25738.1"
FT                   /translation="MSSAVKYFYKGKETDLIVFATSIEDVNEYLKEPSIGKLSQVVEVF
FT                   KVFSNDQGSGAEGNLGEASKAQVQNEFGRKKIEEIIDLILKEGKPNASVGQVKKSFN"
FT   gene            complement(<567369..>571958)
FT                   /locus_tag="ZYRO0A06996g"
FT                   /old_locus_tag="ZYRO-ORF9084"
FT   CDS_pept        complement(567369..571958)
FT                   /locus_tag="ZYRO0A06996g"
FT                   /old_locus_tag="ZYRO-ORF9084"
FT                   /product="ZYRO0A06996p"
FT                   /note="some similarities with gnl|GLV|CAGL0M01188g Candida
FT                   glabrata CAGL0M01188g and some similarites with
FT                   uniprot|Q05471 Saccharomyces cerevisiae YDR334W SWR1
FT                   Swi2/Snf2-related ATPase component of the SWR1 complex
FT                   required for the incorporation of Htz1p into chromatin"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25739"
FT                   /db_xref="GOA:C5DPX8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPX8"
FT                   /protein_id="CAR25739.1"
FT                   /translation="MTRDNGKYNQRDNEKYSNLAQLKFEYDLLSNELFHLKEYISLVEF
FT                   DPSYVNDTESYNRFIQDQGLSLENVHLQNHKEPSVDIPVRRRNLRAATAVGGGSSSSPE
FT                   NGVGSWLKEVETLVRDKYEELGEQFDKGRSIKRPAVSKPKAVKKPKIQNRAPKSPDGPL
FT                   NERIEFDDMHQEEFDGNSDNYYFTTSSEDEDDNRRKPPRKKPRIKLVVNPPRQTVTNPV
FT                   HVLKPHYKSLHNYLESFKSMDEDVSIEEYENYIKEQKDVFKAIRRGLENGALRYDPETD
FT                   SIQPITTKEARLIQSHRPDPVTFFYKEQNLQTYQEYLINHGVYMSKLFQNSKKARIARA
FT                   RKVSQMIEQYFKHIAGAEERKAKEEEKRKKGLARAAMQAVKKRWTLAERAYKILRSDEE
FT                   EKLKKIRGKEHLSKMLEQSTQLLGAQLNQNVEESVSESDVDDSDDDLGETDSNRDDDDD
FT                   RDDDNISSSEDDSEHEDMSSEGQETATTTSPPPMDSAPENGKTIPFSNRSSPEPLSEHD
FT                   GSSESDDSLVSTESSSEEEGASSDGEDATPATSNGLGLSSLFDDHIEDEEKDEEDYEMS
FT                   GSQSESEAEDKVKRETREVFEDEIKGKDKESVNTNNHTSDDSQNGNSDLGLTKEKKPLM
FT                   DEGYLENKGFEMDDKTVEETTPEQEVKPEEEKTKVAERANNVLDKAVPEADPLSVVDVP
FT                   VPFLLRGSLRIYQKQGLNWMASLYNNNTNGILADEMGLGKTIQTISLLAYLACEKENWG
FT                   PHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWNGPNAFHICIVSYQL
FT                   VVQDQNSFKRKKWGYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNIAELW
FT                   SLLYFLMPQTITDGAGFSGFADLDAFQQWFGRPVDKLIETGQDPAQDAETKKTVAKLHQ
FT                   VLRPYLLRRLKCDVEKQMPAKYEHVVYCRLSKRQRFLYDDFMSRAQTKATLASGNFMSI
FT                   VNCLMQLRKVCNHPDLFEVRPISTSFSMDHCVAYDYSDLNKYVLRLLGQNERDRKVDFD
FT                   FMNLSFTNNDAKMTTHRAQSISKLQCIQEFQRQVDLLREQNSLKSSEDEQLPSNLRHAE
FT                   EFFRQLGQQKGQRAIDSLQFLQYVNRSKCEKKPLYGQNLINLLRVGPTKEAGPQAQCLE
FT                   EMLTPLQTRITKHKNLIENYAVLTPNVVALDLRELSLGLNETNSVDSYSQAQLLSQFQS
FT                   MTNPLHHLQTKLAIAFPDKSLLQYDCGKLQKLAILLQNLKDHGHRALIFTQMTKVLDVL
FT                   EQFLNYHGYLYMRLDGATKIEDRQVLTERFNTDPRITAFILSSRSGGLGINLTGADTVI
FT                   FYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSDHTIESNILKKANQKRQLDNVVIQE
FT                   GDFTTDYFTKFSVKELLGPEVPNVMGVNDKPLLQESSQASKDPRRLEKLLAQAEDEDDV
FT                   KAAHLAMKEVDADDNDFAENVNPDGTEGQKPITSKVDDDAQDEFDEYEGTNHVEEYMIR
FT                   FIANGYYYS"
FT   gene            complement(<573135..>574811)
FT                   /locus_tag="ZYRO0A07018g"
FT                   /old_locus_tag="ZYRO-ORF9081"
FT   CDS_pept        complement(573135..574811)
FT                   /locus_tag="ZYRO0A07018g"
FT                   /old_locus_tag="ZYRO-ORF9081"
FT                   /product="ZYRO0A07018p"
FT                   /note="some similarities with uniprot|Q00539 Saccharomyces
FT                   cerevisiae YHR086W NAM8 RNA binding protein component of
FT                   the U1 snRNP protein mutants are defective in meiotic
FT                   recombination and in formation of viable spores involved in
FT                   the formation of DSBs through meiosis-specific splicing of
FT                   MER2 pre-mRNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25740"
FT                   /db_xref="GOA:C5DPX9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPX9"
FT                   /protein_id="CAR25740.1"
FT                   /translation="MSFKMNSGSNFYPRSGTTSGQRPFRYNSNINGTGSPVNAVGNRGS
FT                   QLYMGDLDPSWDENTIRQIWGSLGESNVVIRLMLHNNVSGSGTMGPRNNLGYCFLEFPS
FT                   TVHASNALLKNGMQIPNFVHKRLKLNWASSSHSSAGAFNEYSVFVGDLAPNVTESQLFE
FT                   LFISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLEMQGIFLSGRAIRVSNA
FT                   GHLQNSADGKSKATGAASASNANAVGGINTGNNSGLMSGSQFMYPVQPQPALNSFTDPN
FT                   NTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRISAETAIAKMQG
FT                   FPIGNSRVRLSWGRSAKQAATVQQALINNALQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
FT                   QQQQQQQLQQLHQHQQPLLQQPTYGYMPASSSAASTPMSSLYDEMSYLAAGKSISPLPN
FT                   YAPSLSSAKMLLPGYQNIDYFGFPQSASGLASTSNHDYLTTNPMQSNSDSMQSQTTGGV
FT                   PFYNGLNQPQVALQNNDRGFINGKTASLDRLENGSNGFVFA"
FT   gene            complement(<575254..>576435)
FT                   /locus_tag="ZYRO0A07040g"
FT                   /old_locus_tag="ZYRO-ORF9080"
FT   CDS_pept        complement(575254..576435)
FT                   /locus_tag="ZYRO0A07040g"
FT                   /old_locus_tag="ZYRO-ORF9080"
FT                   /product="ZYRO0A07040p"
FT                   /note="similar to uniprot|P30775 Saccharomyces cerevisiae
FT                   YGL143C MRF1 Mitochondrial polypeptide chain release factor
FT                   involved in stop codon recognition and hydrolysis of the
FT                   peptidyl-tRNA bond during mitochondrial translation lack of
FT                   MRF1 causes mitochondrial genome instability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25741"
FT                   /db_xref="GOA:C5DPY0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPY0"
FT                   /protein_id="CAR25741.1"
FT                   /translation="MFRTFRIARWVLPRRIGLLGCRFQSTLEFKELHPSLLKKAHQSVQ
FT                   EIVQLDQALSKGDGFDAETQKTYSRVSSIRSMYEEYQELLDNLKGLQEMIQTDPSLKDD
FT                   AKSEFDNSLPQFRQVSNNLLRKLLPPHPFAEKACILELRPGVGGTEAMIFTQDLLNMYI
FT                   GYAQYHHWKYHVIAQNENQSGNGLVDAILSIDEPGAYDKLKYESGVHRVQRIPATETKG
FT                   RTHTSTAAVIVLPQIVESVKDAEQSERSFRPDEIRIDVMRAGGKGGQHVNTTDSAVRIT
FT                   HFPSGIVVAMQDERSQHKNKAKAFAVLRARLAERERKEKENSERAARKDQVTTTDRSDK
FT                   IRTYNYPQNRITDHRCNFTLYDIEGVTSGVKLDEVIDSMAARDFEERSKSLIE"
FT   gene            <576600..>577561
FT                   /locus_tag="ZYRO0A07062g"
FT                   /old_locus_tag="Zyro0A.mRNA.1873.p"
FT   CDS_pept        join(576600..576615,576675..577561)
FT                   /locus_tag="ZYRO0A07062g"
FT                   /old_locus_tag="Zyro0A.mRNA.1873.p"
FT                   /product="ZYRO0A07062p"
FT                   /note="highly similar to uniprot|P06242 Saccharomyces
FT                   cerevisiae YDL108W KIN28 Serine/threonine protein kinase
FT                   subunit of the transcription factor TFIIH involved in
FT                   transcription initiation at RNA polymerase II promoters"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25742"
FT                   /db_xref="GOA:C5DPY1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR037770"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPY1"
FT                   /protein_id="CAR25742.1"
FT                   /translation="MEYTKEKKVGEGTYAVVYLGTKQSTARRIAIKEIKTSEFKDGLDM
FT                   SAIREVKYLQEMQHQNVIELVDIFMASENLNLVLEFLPSDLEMIIKDKSILFTPADIKS
FT                   WMLMTLRGVHHCHRNFILHRDLKPNNLLIAPDGQIKVADFGLARTMPLAHEILTSNVVT
FT                   RWYRAPELLFGAKHYTSAIDLWSVGVIFAELMLRIPYLPGANDVDQMEITFRALGTPTD
FT                   REWPEVSTFPSYNKLQIYPPPSREELRRRFIAASENALNLMCGMLTMNPQKRWDAVQCL
FT                   ESAYFREAPAPTEPSAIKM"
FT   gene            complement(<577593..>578798)
FT                   /locus_tag="ZYRO0A07084g"
FT                   /old_locus_tag="ZYRO-ORF9078"
FT   CDS_pept        complement(577593..578798)
FT                   /locus_tag="ZYRO0A07084g"
FT                   /old_locus_tag="ZYRO-ORF9078"
FT                   /product="ZYRO0A07084p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25743"
FT                   /db_xref="GOA:C5DPY2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPY2"
FT                   /protein_id="CAR25743.1"
FT                   /translation="MNCLGLRNAGLSGINRFFKRSLSAQYSHALIGGGVVGLAIAAELS
FT                   KVKSNRVILLEKNDRIGMDVSSHNSEVIHAGLYYPPDSLKSKLCIQGKKIIYNELDPVK
FT                   TGVNWINCGKWIVAQTDYEDAVLEGLYYKCKNELGVDVEMMTSLEAMKKEKFIQVQRSV
FT                   LNSPTTGIIDSHSLMEYLLAIIEANDGEVIYGSEVVNLQYEAGCGYTVTVKDHFSDSQE
FT                   LTDVSTENLVNAAGLYADRISKMLLPPERHLKQYYAKGNYFKLTSAGFPGVRRLIYPVP
FT                   PKNGKSLGTHLTIDMDYQMKFGPDLEYVDSPTDYAANGASIPTAFKAISRYYPYIGPDD
FT                   LEVVGSGIRPKLAAPGDGEFKDFYIKQEEGFPGFVNLLGIESPGLTSSVAIGRYVKDIY
FT                   HT"
FT   gene            <579004..>580134
FT                   /locus_tag="ZYRO0A07106g"
FT                   /old_locus_tag="ZYRO-ORF9077"
FT   CDS_pept        579004..580134
FT                   /locus_tag="ZYRO0A07106g"
FT                   /old_locus_tag="ZYRO-ORF9077"
FT                   /product="ZYRO0A07106p"
FT                   /note="similar to uniprot|P40990 Saccharomyces cerevisiae
FT                   YDL107W MSS2 Peripherally bound inner membrane protein of
FT                   the mitochondrial matrix required for export of C-terminal
FT                   tail of Cox2p through the inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25744"
FT                   /db_xref="GOA:C5DPY3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPY3"
FT                   /protein_id="CAR25744.1"
FT                   /translation="MLRFIRIAKCYSTASLSRQRPQFHEVFPQKRTVNRILFELDSKHT
FT                   FGKLYPVYDNIYQNMQKGIDTEIPKGISPSDLMIMKKVLEKIRHRTKSINPHLLALENA
FT                   LLDRSAELGNNDAISLLAFDVLRDPGHNNPEDVDYGKKLIKELYKKNHHLTMKLLGDLS
FT                   LKSGNDTEACKYYLKFLDLEDRTFLAGEVYGKLGQINFRKPDLRKAEQFFLKAIKLSPL
FT                   EYSVHSHFYLAQIYMNSDPLRARVLMENCATQGFRESFKTLGFLEMNYFEDFFKAQEWF
FT                   RLGLELFQIECFIGFFDCCAKLKNWTGANKCYETMLKLQEVNANYKEIIDKFVTNRQAE
FT                   VKEAMKYSSKPLSDPKTFESAAKKDPFVSKENKWGL"
FT   gene            complement(<580129..>581784)
FT                   /locus_tag="ZYRO0A07128g"
FT                   /old_locus_tag="ZYRO-ORF9076"
FT   CDS_pept        complement(580129..581784)
FT                   /locus_tag="ZYRO0A07128g"
FT                   /old_locus_tag="ZYRO-ORF9076"
FT                   /product="ZYRO0A07128p"
FT                   /note="similar to uniprot|P30777 Saccharomyces cerevisiae
FT                   YGL142C GPI10 Integral membrane protein involved in
FT                   glycosylphosphatidylinositol (GPI) anchor synthesis
FT                   putative alpha 1 2 mannosyltransferase required for
FT                   addition of the third mannose onto the GPI core structure
FT                   human PIG-Bp is a functional homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25745"
FT                   /db_xref="GOA:C5DPY4"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="InterPro:IPR039521"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPY4"
FT                   /protein_id="CAR25745.1"
FT                   /translation="MALKAVDKHHRLILLGLFGWRLFNALITRTFFQADEFWQALEPAH
FT                   FKAFGYGGLTWEWNNGLRSYAFPFLLEIAYRLARLVSKGCQYHWGEDRGDKVEYYCVII
FT                   FPKVMMAFIAALGELYTILFVKKLYLLTFDKTDDKKPHDDWNVEKITIILSVTNFFNCF
FT                   LITRTFINSFEMSLTSAALYYWDWTGGDEVFTTNFTKSLCIAVFACLQRPTNGLIWIIF
FT                   GSRLIWNLFVKSQYGKVLRLIGKVAFWFALVCSINMIIDYHFYNENIFPPLNFLRFNVL
FT                   SPLSTFYGANQWHFHITQSLPLILNYTIPLFCLGLTYGRHSDVLTQIKIVIGFNLIAYS
FT                   MLSHKEFRFVYPLQPLLVLISTFGALKLQENNVLKHCFLLLAPLGSIIAAFLLCWYHES
FT                   GTIAVMKYLHDRPVVDSIGFIMPCHSTPWQSYLHRNDIKSLWAITCDPPLHLMGDPDAS
FT                   AKLPYYMDESDFLYDDISGFIERNFPLLDINSSKRHTYQYEWPRLLVVFQHLENAYIKE
FT                   HLKDNAYVEETRFFNSLVHWDSRREGDVIVYRKL"
FT   gene            <581984..>584734
FT                   /locus_tag="ZYRO0A07150g"
FT                   /old_locus_tag="ZYRO-ORF9075"
FT   CDS_pept        581984..584734
FT                   /locus_tag="ZYRO0A07150g"
FT                   /old_locus_tag="ZYRO-ORF9075"
FT                   /product="ZYRO0A07150p"
FT                   /note="similar to uniprot|P53119 Saccharomyces cerevisiae
FT                   YGL141W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25746"
FT                   /db_xref="GOA:C5DPY5"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPY5"
FT                   /protein_id="CAR25746.1"
FT                   /translation="MLNFTGHTRRRNINLGNRSATTKQDLLIKAKQERDRRAQERQNEG
FT                   AVRVIQTHLRKYITCDYVIKHWNQGLTPMEEKEQIKHLVLAYGPRIYEHLNPPQVFDIL
FT                   QRSQPILSSYPGLLGNIQLCRMLGNYKDDTLVVITLSAMNAKFRTNKEFVEGLTSFLRH
FT                   TKSLSATTCNPLCEVLNVWGLNRTEELQPLFELNSNELTFYRPLLEFYQCLGSLNILPK
FT                   ITNPTSILLENLSYIYATGSRSDDLIYCIASCFRDIVHSPANPQLQESFSKLYEKSFID
FT                   KLARMVEEDQHEEINPGTIVYFMQSAPEENLKNSILMTLLSRPLFFKKLFQDVQRTTLD
FT                   LNSLHLSASYSIFIKLLEMHLMISTDHELLSENSGFTIQQLVTFTTYLKDFVFDSLWNS
FT                   ANDVKSEIVDETLSLLHKIYLRDSRLHFCSTKAEPDYWSNKDQEFLNVGIFKYIEDYER
FT                   LYRDFAERREEMYTNDEDQAVVDEMSSIKFKILDQLSTSFKHTVSTRQFRKLQILIRAP
FT                   FFIPFEQRVDLFYAFISLDKQRLMLDEDSTIMNMFMPWGMPGMGRQSATISREHMLEDA
FT                   CNAFNSIGERFKAKLAVTFVNEFGPEVGIDGGGITKEFLTSVSDEGFNSDKYGLFQSND
FT                   NYELYPSTSVDSQQLRYLWFLGKVLGKCLYDHVLIDVTFADFFLKKLLNYSTRFTSSID
FT                   DMCSLDPTLYSNLVKLLSMSAEEIASLDLTFEITTDNGPVELIPNGSKTRVQKETVLYY
FT                   IVKVSDYKLNRSLFKQIFNFHGGMSMIIAPHWMEMFNSVELQMLISGKGKDVDLQDLKN
FT                   NTEYGGFSQTDPTIRHFWQILEEFEREERFSFIKFVTSVPRAPLQGFKSLEPKFGIRNA
FT                   GSELERLPTASTCVNLLKLPDYRDKELLKKKLLYAINSGARFDLS"
FT   gene            <585252..>587033
FT                   /locus_tag="ZYRO0A07172g"
FT                   /old_locus_tag="ZYRO-ORF9072"
FT   CDS_pept        585252..587033
FT                   /locus_tag="ZYRO0A07172g"
FT                   /old_locus_tag="ZYRO-ORF9072"
FT                   /product="ZYRO0A07172p"
FT                   /note="similar to uniprot|P32343 Saccharomyces cerevisiae
FT                   YKL124W SSH4 Suppressor of SHR3 confers leflunomide
FT                   resistance when overexpressed (putative) involved in ER
FT                   functions"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25747"
FT                   /db_xref="GOA:C5DPY6"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR035780"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPY6"
FT                   /protein_id="CAR25747.1"
FT                   /translation="MINSIAPSLASFIGLLGFSNGYVIPRTEVVHDDTAGVMYILDGDG
FT                   QYEGLSGQFGDDELDMDIMIFSLITIIFIYISICFVYITIRFVVKRILTRNARATLLQD
FT                   GDEVRRTRRTIENLNARWPSALDDEDAVRDKLARLSPEEQFYYKQGEEYIRQNPPLIIP
FT                   HALSSHDHVEDPVIDDAARQFINEEGAWAWEFQPDPNLPNDTILVENKSEISFLNYNYE
FT                   ASVCTNLPIPRINRVYYCEFKIFELNTQDGSGHHLGENELISFGLSTSPYPYFRLPGKH
FT                   HHSIAYESTGARRFNDSFELEPKLATLFPRLEKGDVVGIGYRSNSGTVFFTRNGKKLKE
FT                   DTVGGHVKGWKFKYVYPIVGANIPCKIHVNFGTYGFVYIEANVKKWGYAKSNGMKLPPP
FT                   SYEEYNQDTLLESGCEDEVSDNESVSSANEGDIVDSQGELLPPPPGFEFSTSPNAHSHI
FT                   DREEITLDSLPMEPPSYSDDERSASINPKVGNSTSSGKHPPRLHHLGKSQYDHVSGEDA
FT                   LERERLVDDEEYDDEDDYYEYEDLEYDEEQDEDGDGEGRERAEYEAEGTNGESRNEGYG
FT                   AHENIHDNTVTNQFLQN"
FT   gene            complement(<587457..>588950)
FT                   /locus_tag="ZYRO0A07194g"
FT                   /old_locus_tag="ZYRO-ORF9070"
FT   CDS_pept        complement(587457..588950)
FT                   /locus_tag="ZYRO0A07194g"
FT                   /old_locus_tag="ZYRO-ORF9070"
FT                   /product="ZYRO0A07194p"
FT                   /note="similar to uniprot|P07269 Saccharomyces cerevisiae
FT                   YDL106C PHO2 Homeobox transcription factor regulatory
FT                   targets include genes involved in phosphate metabolism
FT                   binds cooperatively with Pho4p to the PHO5 promoter
FT                   phosphorylation of Pho2p facilitates interaction with
FT                   Pho4p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25748"
FT                   /db_xref="GOA:C5DPY7"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPY7"
FT                   /protein_id="CAR25748.1"
FT                   /translation="MDYQYDENFDSHFPQDLALLSGQGADSHGTHNGSLEGSNGQTGME
FT                   EVNAAVSFPNSSSTSPQEDRKSATITANSVISNSDNSSSKPKRTRARGEALDILKREFE
FT                   TNPNPTSQRRKKLSEMTGLPEKNVRIWFQNRRAKLRKDDRAGVRDGSGGLTGDNTGDSN
FT                   AFYSYDNGENSTLFDQIPLNINNNYYFIDICSITVGSWNRMKSGALRKSNWSTVKDLSN
FT                   LSPISINEIMSNATDLMVLISKKNFEINYFFSAMANNTKILFRIFFPINSVVNCSLSLE
FT                   ANDIIEPRNSDQQDDENGESSLGDDNRSSNEDSEKLGELKINVSRPPNFAVYFLEAPDE
FT                   ATNNQWSICEDFSEGRQVNDAFIGGSNLPHALKGLQNSLRFMNSLILDYNSTNQIIPPP
FT                   PPQPFVMDSNPLSMHHPSATAPTPFFDQYDDTSNDVLGLEKDPTTTIKDAGSHNSSNNN
FT                   MNTSNDGSNLLSLSHDNQLQGMPDFFKSPPELTDDTRWL"
FT   gene            complement(<589193..>590704)
FT                   /locus_tag="ZYRO0A07216g"
FT                   /old_locus_tag="ZYRO-ORF9068"
FT   CDS_pept        complement(589193..590704)
FT                   /locus_tag="ZYRO0A07216g"
FT                   /old_locus_tag="ZYRO-ORF9068"
FT                   /product="ZYRO0A07216p"
FT                   /note="similar to uniprot|P47771 Saccharomyces cerevisiae
FT                   YMR170c ALD5 and similar to uniprot|P54114 Saccharomyces
FT                   cerevisiae YMR169c ALD4"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07216g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25749"
FT                   /db_xref="GOA:C5DPY8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPY8"
FT                   /protein_id="CAR25749.1"
FT                   /translation="MSLYQEIVLPSGQKYSQPLGLFIDNEFVPSSNGSTLTTENPGTGE
FT                   VITSVQAADPVKDVDRAVKSARNGFKPWKAVSLVEKRDLFLKLAQLVEDNVDLLSQVES
FT                   LDSGKPIKTNAAGDVESVSATLKYLAGWIDKTSGDAFSPAKGKLCYTLHQPLGVVGCII
FT                   PFNFPLAMMSWKWTAIAAGNTAVFKSAHQTPLSILVFAQLVVKAGFPPGVFNVVSGEGE
FT                   TVGNALVSHLDVNKIAFTGSTRVGQLVQKNAAINLKPVTLECGGKSPIMVFEDADIDEA
FT                   VKWAAFGIFCNMGQICSGTSRCFVQRSKYNEFLTKLVAYTKENFPTGVPEDPEVVVGPQ
FT                   ITRDQQTRVFNYIDGAVAEGCRVVLGGSGLPETVASDEKHNGGFYASPTILADAEPHFK
FT                   IAQEEVFGPVLSVGQFDDYEDALKIANDSQYGLGASVFTQNIAQAHEFADEVESGMVWI
FT                   NSSNDLDFHMPFGGVKMSGHGRELGSYGLLNFTNVKAVYVNYCKF"
FT   gene            <591382..>592896
FT                   /locus_tag="ZYRO0A07238g"
FT                   /old_locus_tag="ZYRO-ORF9066"
FT   CDS_pept        591382..592896
FT                   /locus_tag="ZYRO0A07238g"
FT                   /old_locus_tag="ZYRO-ORF9066"
FT                   /product="ZYRO0A07238p"
FT                   /note="similar to uniprot|P47771 Saccharomyces cerevisiae
FT                   YMR170C ALD2 Cytosolic aldehyde dehydrogenase that uses NAD
FT                   as the preferred coenzyme expression is induced in response
FT                   to high osmotic stress"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25750"
FT                   /db_xref="GOA:C5DPY9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPY9"
FT                   /protein_id="CAR25750.1"
FT                   /translation="MFTPIHIPQVGITYKQPIGLFINNEYVKSKDGSLIDTFNPATGEK
FT                   ITSFYAAGTADIDEAVQAARNAYEDVWSKTTPSERSELLWKLASLVERDKKLLAAMETL
FT                   DSGKPYHSNALGDLDQIISVTKYYAGVVQNLTQGKQIPVSHDKFAVTFEVPYGVVGQVV
FT                   PWNYPLAMASWKMQGCLAAGNTIVIKPAENTSLSLLYFAQLFVEAGFPPGVVNIVPGHG
FT                   AQAGTALAAHPDVDKVAFTGSTKVGQAVMEAAGKSNLKPVTLECGGKSPAVVFEDAEIE
FT                   QAAEWCALGIFYNSGQNCTANSRIYVQESIYEKFLQEFKAQAAKAWKFGAKRDPFDEEC
FT                   TLGPVISEVQQKRVKSYIEHGVKEGLNIETLHELPADVKGFFVQPTFFTNVPQSSKLNR
FT                   EEIFGPVAVISTFKNESEALKLANDTNYGLASAVFTQNIGVATRFVRDIKAGTVWVNSS
FT                   NDEEISVPFGGFKMSGIGRELGEAGLGSYLQTKSAHFNLSVSAHKL"
FT   gene            <592998..>594788
FT                   /locus_tag="ZYRO0A07260g"
FT                   /old_locus_tag="ZYRO-ORF9064"
FT   CDS_pept        592998..594788
FT                   /locus_tag="ZYRO0A07260g"
FT                   /old_locus_tag="ZYRO-ORF9064"
FT                   /product="ZYRO0A07260p"
FT                   /note="similar to uniprot|P40969 Saccharomyces cerevisiae
FT                   YMR168C CEP3 Essential kinetochore protein component of the
FT                   CBF3 complex that binds the CDEIII region of the centromere
FT                   contains an N-terminal Zn2Cys6 type zinc finger domain a
FT                   C-terminal acidic domain and a putative coiled coil
FT                   dimerization domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25751"
FT                   /db_xref="GOA:C5DPZ0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR031760"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPZ0"
FT                   /protein_id="CAR25751.1"
FT                   /translation="MEIGLKKSKHPCGVCARRKVKCDRLIPCTNCIKRGQENECVDTGK
FT                   RDAEKKDYNSELIKFWHTYEYYVLDVGLFKLQLTDSNGKLEDFSSRWGDVQSIMDLVDL
FT                   DQSFQLLDYSMERLGPLFFGCLSDIGEIYVKLDDYWGRRDEGVPSNLDECYWDALLWAI
FT                   FTMAVYYMTPEKLATVFSEDQLQKWVGQESKNTQLNLLPAFTECTIMQLYNANFMANPD
FT                   IKLIQIYLILCNTNFNWSNTHLSSTLLILCLHVAKMFHIDDFRSLINDSTAMKLSKLTC
FT                   EKLWYRLCTYDYLQSSPQRSISCHGEISSLLQHAAYLEDLPNTDVNQSEDNFEVLYWKL
FT                   ISLDRDLDQYLASPTKPPLKTLDAIQRQTEIFQTKISNMVEEESFSSAFEKFLAIFLLR
FT                   SVCWKLHKMYFIFYDTSDSLTASIHHAKSLIALLVNNVRAKKRIFFNKHPIVLMTFSRV
FT                   ASFYAFANIFMQKLTVEEIHADLKELLAHLPPTFGYKLENLTYLVDRLDQLKSIWEKII
FT                   LIDSKNPFQHPIMLILKNDVERIYQILQRGPSLIRGTGLQSPKRLFQDDYEFNMDDNNK
FT                   EIALIVIEFEKKFDIGGILT"
FT   gene            complement(<594796..>597015)
FT                   /locus_tag="ZYRO0A07282g"
FT                   /old_locus_tag="ZYRO-ORF9063"
FT   CDS_pept        complement(594796..597015)
FT                   /locus_tag="ZYRO0A07282g"
FT                   /old_locus_tag="ZYRO-ORF9063"
FT                   /product="ZYRO0A07282p"
FT                   /note="similar to uniprot|Q2I041 Saccharomyces cerevisiae
FT                   YMR167W MLH1 Protein required for mismatch repair in
FT                   mitosis and meiosis postmeiotic segregation and spore
FT                   viability forms a complex with Pms1p and Msh2p to repair
FT                   mismatched DNA human homolog is associated with hereditary
FT                   non-polyposis colon cancer"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07282g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25752"
FT                   /db_xref="GOA:C5DPZ1"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR032189"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPZ1"
FT                   /protein_id="CAR25752.1"
FT                   /translation="MVSKIKPLDESVVNKIAAGEIIISPVNALKEMMENSIDAGASSLD
FT                   ILVREGGIKLLQITDNGSGISKEDLPILCHRFTTSKLAKFEDLEKIATYGFRGEALASI
FT                   SHIARLTITTKTGDDRCAWRVSYSDGKMIGEPKPVAGKDGTVILVENLFYNMPSRLRAL
FT                   RSSSEEYSKILDVVGRYACHSEGIAFSCKKFGDSQFALTVRANLSTVERIRCVFGSTVS
FT                   SKLLDLELGPLEEFGVQKVVGKVSNLDLSFKKSISPVFFINNRLVTCNPLARALRQIYS
FT                   TYLPKGDKPFMYLSILINPEILDVNIHPTKREVRFLHEEEIIEAISSKLNEELSKIDTS
FT                   RTFKTSSIVTPQPLKETFESTKGPKGSVSKAPHTPVQNKQSPLGNSIKRYENKLVRTDA
FT                   SQSKITSFMANQSTPPIALRSTEKVVAEGIEGREGIENARESPWNDNNETTKVESSPLR
FT                   GRGSNVHGYTIVPKERVDVNLTSIKRLLEAADSSAHKDLTDIFANMTYVGVVDGERRLA
FT                   TIQHDLKLFLLDYGAVCYELFYQICLTDFANFGVINLQSGNDSSLNLVHILSHFENLDE
FT                   KSIKAIISKIWEMREMLSEYFSINIAGNTDAEDENTQLESVKITSIPLLLKGYLPPLSK
FT                   LPFLIYRLGTKVNWEEEQPCLDGIMRQLALLYVPEIIESIDLEESDIPEDKKAAFVDKT
FT                   KELSVVLDDVVFPCIKKRFLAPRHLTKDIVEIANLPGLYRVFERC"
FT   gene            <597220..>598392
FT                   /locus_tag="ZYRO0A07304g"
FT                   /old_locus_tag="ZYRO-ORF9061"
FT   CDS_pept        597220..598392
FT                   /locus_tag="ZYRO0A07304g"
FT                   /old_locus_tag="ZYRO-ORF9061"
FT                   /product="ZYRO0A07304p"
FT                   /note="similar to uniprot|P43124 Saccharomyces cerevisiae
FT                   YDL105W NSE4 Nuclear protein that plays a role in the
FT                   function of the Smc5p-Rhc18p complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07304g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25753"
FT                   /db_xref="GOA:C5DPZ2"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="InterPro:IPR027786"
FT                   /db_xref="InterPro:IPR029225"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPZ2"
FT                   /protein_id="CAR25753.1"
FT                   /translation="MAVRSDKRRRDSQDDSSRQVDKRLRLEGGSQGTQGTAVNEVEFEV
FT                   LQGYRKFSEAVAEDRARMARTGDIDIAVKNLQAVDSLFNQLTGSRNNGLFAHDSRAMLS
FT                   ISELAQISVRNLKFDNFRSLVNLEDVLNSLKKYMLRDYFEWNGISEGNAASSMMNQSQN
FT                   GARDGEEVGGDDNDDEEEEQSDNIRQTEMRKCHLKQYSGYEDFYQLNWFKLGGLFNNLS
FT                   RKVSTVDHLLGPFSMQRKTRAPVVRKEQDTVGALTTAEKVTQSSLNSTQQITTPEQVKR
FT                   MFKILERKNGKRQINLFKFVINPQSFSKSVENLFYVSFLIKEGRVVLEEDQDGFPSIRI
FT                   RGGPPTDPKAREIEIRKRREASENHIIFQMDMPTWKKLIEKFDIRSAFVE"
FT   gene            complement(<598428..>599573)
FT                   /locus_tag="ZYRO0A07326g"
FT                   /old_locus_tag="ZYRO-ORF9059"
FT   CDS_pept        complement(598428..599573)
FT                   /locus_tag="ZYRO0A07326g"
FT                   /old_locus_tag="ZYRO-ORF9059"
FT                   /product="ZYRO0A07326p"
FT                   /note="similar to uniprot|P43122 Saccharomyces cerevisiae
FT                   YDL104C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25754"
FT                   /db_xref="GOA:C5DPZ3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPZ3"
FT                   /protein_id="CAR25754.1"
FT                   /translation="MFTLSKAFPVGHTVAKRWYKVLAIETSCDDTCVAILDRKSSIEPP
FT                   RTIVHLKETLNSASAGGIIPTKAHLHHQQQIGPVTHRALQSAGMPNIDLVCVTRGPGMP
FT                   GSLSGGLDFAKGLAVAWKKPFVGVHHMLGHLLIPRMLNNGQNPRFPFVSLLVSGGHTVL
FT                   VLSRSCVDHEILCDTLDIAVGDSLDKCGREIGIRGNMIAKEMEKFINQEPLQLNVPMQL
FT                   PNPLRNKSTRVDVQAFSFAPFITALKGNLTKPLSEYQVHEVRSMAYQMQEAIFHHIVTK
FT                   LKLVIRLNKEKFEGVSSFVLSGGVGANARLRNLLETEFGDTFDNFCYPPLELCSDNAIM
FT                   IGWAGIELFEKHCLTTDLQATPVRKWPLTHLLEVPCWDSTK"
FT   gene            <599958..>601049
FT                   /locus_tag="ZYRO0A07348g"
FT                   /old_locus_tag="ZYRO-ORF9058"
FT   CDS_pept        599958..601049
FT                   /locus_tag="ZYRO0A07348g"
FT                   /old_locus_tag="ZYRO-ORF9058"
FT                   /product="ZYRO0A07348p"
FT                   /note="similar to uniprot|Q03829 Saccharomyces cerevisiae
FT                   YMR166C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07348g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25755"
FT                   /db_xref="GOA:C5DPZ4"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPZ4"
FT                   /protein_id="CAR25755.1"
FT                   /translation="MWSLTSSLPIVHAPHHHGHPHAIPPPTTGGAGGDGGNRPSPPAID
FT                   DEMEATNSPILHCILAGGFGGAIGDTSMHSLDTVKTRQQGAPNVAKYKNMLAAYRTIFV
FT                   EEGIFRGLYGGYSAAMLGSFPSAAIFFGTYEFSKRKLINEWGFNDTLTHLFAGFLGDLV
FT                   SSFIYVPSEVLKTRLQLQGRYNNSHFDSGYNYKNLRDCITTVVKTEGPVALLFGYKATL
FT                   ARDLPFSALQLAFYEKFRQAAFKLEYKQIGQDHLSIMSELSTGALAGGVAGVLTTPLDV
FT                   IKTRVQTQQTSPTSELGKPASLSSSLFSSLRIVYKSEGLIGFFSGVGPRFIWTSIQSSI
FT                   MLFLYQYTLGRLNTIFPSNNGLG"
FT   gene            <601469..>603958
FT                   /locus_tag="ZYRO0A07370g"
FT                   /old_locus_tag="ZYRO-ORF9055"
FT   CDS_pept        601469..603958
FT                   /locus_tag="ZYRO0A07370g"
FT                   /old_locus_tag="ZYRO-ORF9055"
FT                   /product="ZYRO0A07370p"
FT                   /note="similar to uniprot|P32567 Saccharomyces cerevisiae
FT                   YMR165C SMP2 Protein involved in respiration and plasmid
FT                   maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25756"
FT                   /db_xref="GOA:C5DPZ5"
FT                   /db_xref="InterPro:IPR007651"
FT                   /db_xref="InterPro:IPR013209"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR026058"
FT                   /db_xref="InterPro:IPR031315"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPZ5"
FT                   /protein_id="CAR25756.1"
FT                   /translation="MQYVERAIGSVSKTWSSINPATLSGGIDVIVVEHPDGTLACSPFH
FT                   VRFGKFQILKPSQKKVEVIVNGKSTNIPMKLGDSGEAYFVFETSTDVQGIPEELLSSPV
FT                   MSATSSPPQSPRPDGQVEESDKLEEGVEVSKKLEEPDFLDINDSESSTDTSNGTGIPLP
FT                   TMSRTKTFQEKLNRRLTQIHIPSKLDNNGDLLLDMEGYKPNKDKVQDTDNQLKQLLKDE
FT                   LGNDLDISGFVKEDSNGNIRIVNPFENHPHHHYPVSPPESPPMTANEPGLSLDFSGDSS
FT                   TLSGFTSSNTEADTNTNTNTDSKGSSTSSDGKFFIKTLRLSSEQLKCLDLKYGENDLTF
FT                   SVDQGRALVSSKLFVWRWSVPIVISDIDGTITKSDALGHVMTMFGKDWTHIGVAKLFSE
FT                   IAKNGYNIMYLTARSTGQADSTRSYLRSIVQNGNRLPVGPVILSPDRTIAALRREVILK
FT                   KPEVFKIACLNDMRSLYFDRHGHFKGEAEDRRHEKENEERVLEQEQLSLEEMEEKPTPF
FT                   FAGFGNRITDALSYRTVGVPSSRIFTINPDGEVHMELLELAGYRSSYVFINELVDHFFP
FT                   PVNNDDDDRSIRSAGPGSPINKSIDTDANIESNLYLRSKQEEKFTDVNFWREPIPDLEE
FT                   LTDTSNSDGEDAKSKDARDGNYNSNDGRSSMLDKSLSHDHLQLSSPISFKNGTPKERSP
FT                   STESGRNIKGTSLFRSISPESIDEEDHNASHPQLSTPGRDKTRPPTREEIGQQIYLELG
FT                   SPLRQPQLLETTREDVPGTPASEISRLNISESEGPRDSGKDTASCEQESDQDGDDEEEE
FT                   EDDDEEDDDEFDEDEFT"
FT   gene            <604410..>605009
FT                   /locus_tag="ZYRO0A07392g"
FT                   /old_locus_tag="ZYRO-ORF9053"
FT   CDS_pept        604410..605009
FT                   /locus_tag="ZYRO0A07392g"
FT                   /old_locus_tag="ZYRO-ORF9053"
FT                   /product="ZYRO0A07392p"
FT                   /note="some similarities with uniprot|Q03825 Saccharomyces
FT                   cerevisiae YMR164C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25757"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPZ6"
FT                   /protein_id="CAR25757.1"
FT                   /translation="MVRQASTFEGIYSTNKPEYPDFGGAGGPAVDMSGDSKYGTKSGNI
FT                   MPSSNTELDSTTTVVSDANASDPRQLLHAHVYNYLVKNGHYATARQFLKEADLPLDNKN
FT                   ANEIINNSVNTNINNDNEDQQLPPGLLPTRLQVDSEETLLFEWWNSLCRLHDHVEQTPV
FT                   EELRSTPQKVPTPFLPRVRQPFTEDQQDNVGASVSK"
FT   gene            <605335..>605408
FT                   /locus_tag="ZYRO0A07414r"
FT                   /old_locus_tag="Zyro0A.tVal.AAC.12"
FT   tRNA            605335..605408
FT                   /locus_tag="ZYRO0A07414r"
FT                   /old_locus_tag="Zyro0A.tVal.AAC.12"
FT                   /note="tRNA-Val (AAC) cove score=67.58"
FT   gene            <605660..>607582
FT                   /locus_tag="ZYRO0A07436g"
FT                   /old_locus_tag="ZYRO-ORF9052"
FT   CDS_pept        605660..607582
FT                   /locus_tag="ZYRO0A07436g"
FT                   /old_locus_tag="ZYRO-ORF9052"
FT                   /product="ZYRO0A07436p"
FT                   /note="weakly similar to uniprot|Q03824 Saccharomyces
FT                   cerevisiae YMR163C Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cytoplasm in a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25758"
FT                   /db_xref="GOA:C5DPZ7"
FT                   /db_xref="InterPro:IPR026235"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPZ7"
FT                   /protein_id="CAR25758.1"
FT                   /translation="MGVDHLTSSVDTLLEKSMLSPIGWKCENFQSNIHPSAPTVVNGGE
FT                   WEYQFEIPNKWNQLIDRVFSRLPSVANEHFLEEFHYTVVSSDLLNASNPWRLSKMSTSG
FT                   LLPTIIPDKSKTIRIRNFPYMTTILHVRKILNRLKFSNGSRRRVVITLLIALYLTYQQE
FT                   FHKMQSSRQNALSILKSMLDSLQRLTVLQHNYFAAHKEISNQCGSDRIGLVVTDLLGSS
FT                   LDLLFYSMTNATQDLLTISNSSELSKYCGIYGVPLSELYYRLTEPANDMESRWTRLKVM
FT                   RSFMLCCLLSQNHSGGRVGNNSTCDLEMCNFLRKIFPNYNLTQNSLINQSNRWKLITTN
FT                   MQQLQNLTVSMTASMLRHTELINNHRNSVPNARSVKRYSKFYLPPEDKKSSSQGPIRLS
FT                   TTLHGLRELEKLLIVTNEETTTTDSTIELVRQRLIDLLALWQTDDNDEVVSQGRKNGIS
FT                   KTKFGNRGLSLDVVQNPRESIIKCGGPHLNLSPKLKDHVVFTPVDETQSDIEQDSDYEL
FT                   QKTAATETSNDEEAVNSKKTLRSSDKTLIDQRIAKFQSLSDDELRLKLEEGISKFAQEN
FT                   KKGRQKLRSQKSFELLRKPHNKEFMSVQGALRQISSASEITLNNTFSTEETIPMYYELQ
FT                   KILDK"
FT   gene            complement(<607607..>609028)
FT                   /locus_tag="ZYRO0A07458g"
FT                   /old_locus_tag="ZYRO-ORF9050"
FT   CDS_pept        complement(607607..609028)
FT                   /locus_tag="ZYRO0A07458g"
FT                   /old_locus_tag="ZYRO-ORF9050"
FT                   /product="ZYRO0A07458p"
FT                   /note="highly similar to gnl|GLV|CAGL0L07370g Candida
FT                   glabrata CAGL0L07370g and similar to uniprot|P43123
FT                   Saccharomyces cerevisiae YDL103C QRI1 UDP-N-
FT                   acetylglucosamine pyrophosphorylase catalyzes the formation
FT                   of UDP-N-acetylglucosamine (UDP-GlcNAc) which is important
FT                   in cell wall biosynthesis protein N- glycosylation and GPI
FT                   anchor biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07458g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25759"
FT                   /db_xref="GOA:C5DPZ8"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039741"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPZ8"
FT                   /protein_id="CAR25759.1"
FT                   /translation="MSVIDLYKSAGQEQLFQHLDQLNETDKSQFLSNLEAASRRISPQK
FT                   LVDDCKKAISQSAENARDSSSVEPLPATSYQSVIDNASAQEEYYKIGLESVTNGEVAVV
FT                   LMAGGQGTRLGSSAPKGCYDIGLPSHKSLFQIQAEKLISLQRLSGTKSPIPWYVMTSKP
FT                   THNTTKDFFEKHNYFGLESSQVVFFNQGTLPALDLQGEKLLLSSPTDLVESPDGNGGLY
FT                   RAIKDNQLLQDFEKKGIKHVYMYCVDNVLSKLADPVFIGFAIKHGFELATKVVRKRDAN
FT                   ESVGLIATKDNKPCVIEYSEISPELAAEKDSSGLLKLRAANIVNHYYSVELLKRDLDQW
FT                   CEHMPYHIAKKKIPCYDNTTGESLKPTEPNGIKLEQFIFDVFPGVSLDKFGCLEVDRAQ
FT                   EFSPLKNAPGTANDNPETSRAAYLELGGNRLKKIGAQIADGVSVEVSSKLSYAGENLSQ
FT                   YKGKVFDKDNTVLEN"
FT   gene            <609274..>614082
FT                   /locus_tag="ZYRO0A07480g"
FT                   /old_locus_tag="ZYRO-ORF9048"
FT   CDS_pept        609274..614082
FT                   /locus_tag="ZYRO0A07480g"
FT                   /old_locus_tag="ZYRO-ORF9048"
FT                   /product="ZYRO0A07480p"
FT                   /note="similar to uniprot|Q12674 Saccharomyces cerevisiae
FT                   YMR162C DNF3 Non-essential P-type ATPase that is a
FT                   potential aminophospholipid translocase localizes to the
FT                   trans-Golgi likely involved in protein transport"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25760"
FT                   /db_xref="GOA:C5DPZ9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DPZ9"
FT                   /protein_id="CAR25760.1"
FT                   /translation="MPDTPSKRKRAASLRTQLFNKHMYELFNGNNGQDIELAYVNEMDG
FT                   DENQQLEDEDELEEDDIEEDNNQFENKGRPTLFTKLMDVLLNRKRIVRSKDGRQIPISL
FT                   DHETAEYRRYAYKNGNLLIDERTEQPYVDNQITSSRYTVYSFLPRQIYAQFSKLANIYF
FT                   FLIAILQMIPGWSTTGSYTTIIPLCVFMGISMTREAFDDFKRHQLDREENDKTVKVLRK
FT                   TNGGYNNFMATSQNFTELNNNRSKLPAQGTLDTRFHNFELLSERHGVNIEKRKWKDLRV
FT                   GDFVLLNQDDWVPADLLLLASDGENNECFIETMALDGETNLKNRQPSAQLSKLAGAASG
FT                   LANINAKVIVEDPNIDLYNFEGNLDLENDQTGESIKHPLGLDNVVLRGSILRNTENVVG
FT                   MVIFTGEETKVRMNAIKNPRLKAPKLQRKVNLIVIFMVIVVTAMSLFSYLAHIINNRRY
FT                   INGDQAWYLFQQDAGTAPTIMSFIIMYNTIIPLSLYVTMEIIKLIQSKLMEWDIDMYHP
FT                   VTDTPCETRTATILEELGQVSYIFSDKTGTLTENKMLFRKFSLCGSSWIHKADPSANED
FT                   QLPSIQLTTDVETVSPEGNEITGDHSDEFLSRQSFANDAAKTSVKYKGNSGAIYSGRPS
FT                   MRSLAGEEEQSLHSRSSNTTSRPTNLKSSLDLIKFIQLHPNSLFAHKARFFILSLALCH
FT                   SCLPKRCNIKDDGETNEDPIEYQSSSPDELALVTAARDLGYIVLNRNGKILTIKSFPNG
FT                   FEKEPLLEDYEIMETIDFNSNRKRMSVLVKTPNEPNRILLVCKGADNVILERLPNHKDA
FT                   RQKMEEFNISTKERKEAEAEVVLQQRRSLERNATDDDVASNRLRSSLSSMPKGSLSLKA
FT                   MKKSFSNKSHHGEFQVNSIGQFLDTIKKADEEIDDVILHSRKSVQKHQQKRYGDIKSIP
FT                   YAGPQQAIPWENSCSSHDQNMWDYIGSDELISNEGYLLERTLQAIDEFSTEGLRTLLYG
FT                   YKWIDSSDYMEWEMRYRTAKTSLTDRRAKVEKVGEEIEDNLELIGATAIEDRLQDGVAE
FT                   SIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIYDYSTVVILTENDENIISKMNAVSQE
FT                   IDSGNIAHCVLVINGATLAIFESNPILLSVFVELCTKTDSVICCRASPSQKALMVTNIR
FT                   NINKDQVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSSDYSIAQFRFLIKMLFVH
FT                   GRYNYIRTSKFVLCTFYKELTFYMTQMIFQRYTMFSGSSMYESWALSMYNTLFTSLPVL
FT                   CIGMFEKDLKPMTLLAVPELYTAGRLDKAFNLPIFCQWIILGTLNSLLITFLNVTAWGE
FT                   SALKDNTLYPLGVVNYTSIVILVNLKCQFVETHDRNWLAFASVAISIIGWFVWCCILPL
FT                   VYTDGSIYDVSTGLYHHFGRDITFWCAVLVLAASSVMVDVIYKTVKVMLWPTDTDIFKH
FT                   LEQKDEIRKKLEFGAYNEMKQGWTWERDPSTLSVYKDKVFPSSRSRANSQQSSNKEGSS
FT                   HKNKHNNNSDTLVSETTHTLDLNYDDKRYEMLPSGKLIKRQELEEEQKTNHLLPKKLRF
FT                   NMKNTESNENIRAIVEQRMHDLE"
FT   gene            complement(<614282..>614998)
FT                   /locus_tag="ZYRO0A07502g"
FT                   /old_locus_tag="ZYRO-ORF9046"
FT   CDS_pept        complement(614282..614998)
FT                   /locus_tag="ZYRO0A07502g"
FT                   /old_locus_tag="ZYRO-ORF9046"
FT                   /product="ZYRO0A07502p"
FT                   /note="similar to uniprot|P48353 Saccharomyces cerevisiae
FT                   YMR161W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25761"
FT                   /db_xref="GOA:C5DQ00"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ00"
FT                   /protein_id="CAR25761.1"
FT                   /translation="METYTSEQEQIALEVLSKDKHQFYEILKVERTANDNEIKKSYRKL
FT                   AIRLHPDKNPHPRASEAFKLINRAFEVLGDSEKRSLYDRLGRDPDDRSVPSAASSAFNG
FT                   DTGFENMFFRRRREPSEDLFDILFNMRGGGGGGAFGGPFGGSPFGGSPFGGPFGGSPFG
FT                   GSPFMDGGGSTFTFAGPDGFRVYTSGPRGAQTRQRQHQRQQFEAEQEQDLYQSIKVLLP
FT                   LLILFLVPIIERFLFG"
FT   gene            <615902..>619174
FT                   /locus_tag="ZYRO0A07524g"
FT                   /old_locus_tag="ZYRO-ORF9042"
FT   CDS_pept        615902..619174
FT                   /locus_tag="ZYRO0A07524g"
FT                   /old_locus_tag="ZYRO-ORF9042"
FT                   /product="ZYRO0A07524p"
FT                   /note="highly similar to uniprot|P15436 Saccharomyces
FT                   cerevisiae YDL102W CDC2 Catalytic subunit of DNA polymerase
FT                   delta required for chromosomal DNA replication during
FT                   mitosis and meiosis intragenic recombination repair of
FT                   double strand DNA breaks and DNA replication during
FT                   nucleotide excision repair (NER)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25762"
FT                   /db_xref="GOA:C5DQ01"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR025687"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ01"
FT                   /protein_id="CAR25762.1"
FT                   /translation="MVADLKRPGEEEEYGSEKKLRLQSFDHGVGSEPVSHLEIVPSDSY
FT                   AKHKSKGFKADESDIRGSQQASLFEEQLSLMDHKEAEVGEHKEKYGRDPLPKDFNPETH
FT                   EISFQQLEAEQSTLPFSKDEGTSTIVRFFGVTKDGHSILCNVTGFKHYLYVPVPSAPEA
FT                   QDPNEVASFTKYLNENFENSVDRIDIVSKQSIWGYEGESMLPFYQVFVTNPNTVNKMRT
FT                   AFEKGYLSHKSWFSAGTTTYDNIAFTLRMMIDCGISGMSWITLPKGEYQLVPEHERVST
FT                   CQLEVTINYRKLVSHPAENEWSQASPLRILSFDIECSGRPGIFPEPETDPVIQIANVMS
FT                   VAGAKKPFIRNVFTVDTCSPITGSQIYSHATEEEMLKHWRDFVVAADPDIIIGYNTSNF
FT                   DFPYLINRAKALKVESFPYFGRLFNVKQEITSSVFSSKAYGTKESKNINIDGRLQLDLL
FT                   QFIQREYKLRSYTLNAVSAHFLGEQKEDVHHSIITSLQKGDSETRRRLAVYCLKDAYLP
FT                   LRLMEKLMALVNYTEMARVTGVPFSYLLSRGQQIKVISQLFRKCLQIDTVIPNMQSQAS
FT                   DEQYEGATVIEPIRGYYDIPIATLDFSSLYPSIMMAHNLCYTTLTSKSTVEKFNMKLDE
FT                   DYIMTPNGDYFVTSKVRRGILPTILEELIGARKRAKKDLKNETEPFRKDVLNGRQLALK
FT                   VSANSVYGFTGATVGKLPCLAISSSVTSFGRNMIMLTKQAVEEKYSIKNGFKHDSLVVY
FT                   GDTDSVMVKFGTTDLKEAMKLGAEAAAYVSTLFKHPINLEFEKAYFPYLLINKKRYAGL
FT                   FWTNPDKYDKIDQKGLASVRRDSCPLVSIVMNKVLKKILIERNVEGALGFVKEIIDDIL
FT                   HNKADISKLIISKTLAPNYTNPQPHAVLTERMKKRDGVGPNVGDRVDYVVIAGNDKLYN
FT                   RAEDPLYVLEHNMQIDSRYYLTNQLQNPIISIVAPILGEKQANAMFVVKSIKINTGNMK
FT                   GGLMGFVKKVDSCKNCKGPLKKGEGPLCSNCQAKSGELYIKALYNVRDLEEKFGRLWTQ
FT                   CQRCAGSLHNEVLCSNKNCDIFYMRVKMKKELQENIENLSKW"
FT   gene            complement(<619278..>620847)
FT                   /locus_tag="ZYRO0A07546g"
FT                   /old_locus_tag="Zyro0A.mRNA.4825.m"
FT   CDS_pept        complement(join(619278..620747,620833..620847))
FT                   /locus_tag="ZYRO0A07546g"
FT                   /old_locus_tag="Zyro0A.mRNA.4825.m"
FT                   /product="ZYRO0A07546p"
FT                   /note="highly similar to uniprot|P39009 Saccharomyces
FT                   cerevisiae YDL101C DUN1 Cell-cycle checkpoint serine-
FT                   threonine kinase required for DNA damage-induced
FT                   transcription of certain target genes phosphorylation of
FT                   Rad55p and Sml1p and transient G2/M arrest after DNA damage
FT                   also regulates postreplicative DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25763"
FT                   /db_xref="GOA:C5DQ02"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ02"
FT                   /protein_id="CAR25763.1"
FT                   /translation="MSVKRENSNENVESSKRHQTIQAGNSDQVIAKLISLIPGKEQSID
FT                   LMGNAVVTVGRSRHCDVVLKEVDISTIHCQLYTIQVDLDRERRKLINIVDKSRNGTFIN
FT                   GNRLIKRDYLLKNGDRIVFGKSTSFLFKYTENSDEIEGNANSSNNDGVFKKPQMAASSS
FT                   QTSLRKKLKPRPTSVFDKYLLERELGSGHYATVKEGINKKTGEVVAVKIFHPQQNDDQK
FT                   KSNQFREETNILMRVHHPNIVKMLDSFVEPVSKSQIQKYLVLEKINDGELFDRIVKKVC
FT                   LRQNETQALFKQILEGIKHLHSQNIIHRDIKPENILLNITRRQSPNEMQLGPWDQDEID
FT                   VQVKIADFGLAKFTGEIQFTNTLCGTPSYVAPEVLLKSDYSSKVDMWSAGVLLYVCLCG
FT                   FPPFSDSLGPPSMREQILQGKFAFYSPYWDEIDDSVLHLISNLLVVNASERFSVVETMN
FT                   HPWFRNADYETIPMEPERLQISQEKIPKTYSELSKI"
FT   gene            complement(<621018..>623360)
FT                   /locus_tag="ZYRO0A07568g"
FT                   /old_locus_tag="ZYRO-ORF9039"
FT   CDS_pept        complement(621018..623360)
FT                   /locus_tag="ZYRO0A07568g"
FT                   /old_locus_tag="ZYRO-ORF9039"
FT                   /product="ZYRO0A07568p"
FT                   /note="similar to uniprot|Q03823 Saccharomyces cerevisiae
FT                   YMR160W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25764"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ03"
FT                   /protein_id="CAR25764.1"
FT                   /translation="MSELNDSRPQRGRWVSWWYSRGSSDTNGEANPSTGSNSNNSGNNN
FT                   NNNNNDNNNNDNDTKAIHDEGRNVEFQGSADSEMPNEVAKEQPTGWYSSIMSKMPSIPF
FT                   VRNRQEALVIDSNARYSQLNDPQVEYLEVEAKETIVRRNNTWCWYENLTDITAECSTWG
FT                   DRPGVVSVYSTGSAHCPLPLPHYPISDGCRGYHVYIKNSLILPSDSPSQTLHEQSWLSK
FT                   AATEVKNYYNFPNEKHLYLKKITEGLLRERKVVIISLVGNLPEKYKKLTLGDQRSAHYL
FT                   ATKLALSLQREMPSKIESLSFECPLDSKDLTIVFQECIELLKNWTHILHDADAIFVESV
FT                   YHAVPLAISLTKYILQNHESFQFRPTIPVGILAIESSLQGYRFWDHSVDLSNSSEQDYH
FT                   KIQQNREKQLFQGASKVERETLSKLTSYRKLNSDESRLVQKDLNWLLTNWGTFRLNLFG
FT                   KLFDNFMTVSQKLAIDYVHPKIFRHLWCDGRSLGLDTRNPEELGIPDVNIRTPEYENNV
FT                   SVPKNRRFEISLIGNILLALNLGNTKFVPILKLISPFFISRSFNENTISPTLRKATQQE
FT                   LKIWTQEMDARWKILNSSDQIPDELPEEVSTVYKFLKFSHYQNLKNPDIMTLYCEIYDD
FT                   DCVYKTFIENTMKTRSPLNRKHLVLLNDHSTPQSILNTVNQYDLVWKFHECLSDYMKLR
FT                   NLPSQMHLPNLFFVISLDRWFWKPAQSNPTSFRKDNSEALARLQQLWESYQDWDPPTRG
FT                   LKQLRNILSVLSLYSDSTEMLHDIEHK"
FT   gene            <623505..>623888
FT                   /locus_tag="ZYRO0A07590g"
FT                   /old_locus_tag="ZYRO-ORF9036"
FT   CDS_pept        623505..623888
FT                   /locus_tag="ZYRO0A07590g"
FT                   /old_locus_tag="ZYRO-ORF9036"
FT                   /product="ZYRO0A07590p"
FT                   /note="similar to uniprot|Q03818 Saccharomyces cerevisiae
FT                   YMR159C ATG16 Protein that interacts with the Atg12p-Atg5p
FT                   conjugate during formation of the pre-autophagosomal
FT                   structure essential for autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25765"
FT                   /db_xref="GOA:C5DQ04"
FT                   /db_xref="InterPro:IPR013923"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ04"
FT                   /protein_id="CAR25765.1"
FT                   /translation="MDSALLERLLQRDRIESRFQELFIEPKPGPNTQSDRELTSNDTLT
FT                   ITLARLRKELKGKELQIASLREVINVKNKDSEKLNDEIISLNIENNLLQKRFGELEEEH
FT                   NKLVKRWLDKVQQDVEKLNANLQ"
FT   gene            <625358..>625430
FT                   /locus_tag="ZYRO0A07612r"
FT                   /old_locus_tag="Zyro0A.tMet.CAT.13"
FT   tRNA            625358..625430
FT                   /locus_tag="ZYRO0A07612r"
FT                   /old_locus_tag="Zyro0A.tMet.CAT.13"
FT                   /note="tRNA-Met (CAT) cove score=71.12"
FT   gene            complement(<625564..>626625)
FT                   /locus_tag="ZYRO0A07634g"
FT                   /old_locus_tag="ZYRO-ORF9034"
FT   CDS_pept        complement(625564..626625)
FT                   /locus_tag="ZYRO0A07634g"
FT                   /old_locus_tag="ZYRO-ORF9034"
FT                   /product="ZYRO0A07634p"
FT                   /note="highly similar to uniprot|Q12154 Saccharomyces
FT                   cerevisiae YDL100C ARR4 ATPase involved in resistance to
FT                   heat and metal stress active as a dimer normally localized
FT                   to the cytosol but appears to localize to late endosomes
FT                   under stress conditions"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25766"
FT                   /db_xref="GOA:C5DQ05"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027542"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DQ05"
FT                   /protein_id="CAR25766.1"
FT                   /translation="MDLVVEPNLHSLINSSTHKWIFVGGKGGVGKTTSSCSIAIQMAQS
FT                   QPHKQFLLISTDPAHNLSDAFGEKFGKDARRVTGMNNLSCMEIDPSAALKDMNDMAVSQ
FT                   ANENGAQGDDGLGGLLQGGALAELTGSIPGIDEALSFMEVMKHIKNQEKGEGERYDTVI
FT                   FDTAPTGHTLRFLQLPNTLSKLLEKFGEITGRLGPMLNSLAGAGNVDISTKLNQLKESV
FT                   ETIKDQFTNPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFADDDQE
FT                   HNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLENLRKFSRFLNKEYNPA
FT                   MDNKIIYELENKK"
FT   gene            <626809..>627747
FT                   /locus_tag="ZYRO0A07656g"
FT                   /old_locus_tag="ZYRO-ORF9033"
FT   CDS_pept        626809..627747
FT                   /locus_tag="ZYRO0A07656g"
FT                   /old_locus_tag="ZYRO-ORF9033"
FT                   /product="ZYRO0A07656p"
FT                   /note="weakly similar to uniprot|Q12191 Saccharomyces
FT                   cerevisiae YDL099W Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cytoplasm in a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25767"
FT                   /db_xref="GOA:C5DQ06"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ06"
FT                   /protein_id="CAR25767.1"
FT                   /translation="MSEVSADEKRAKQLEEARKRVEELKKKNKKKGKKGKKTEDDNDSS
FT                   QAATADEATPELEKESSPAAAVTEESVKPTESDEKEHEATTKKGQSQGENPKEEKPTES
FT                   EEEKPEASKEDQPRGEESKAQEKSTQPPKDQSEDKEPETAEKVTSEQQDVQDLFQGDEG
FT                   SDFLDTIQKQKEEGELQTVKSQLEKVTADLKRLKFVNIEQETTIDELNQQINILQTQLQ
FT                   SSQQELETSREELQKFKQTTSTPPPLQFAPFNVPPQQQQQAQPHQYQQQQNPSFVSQPT
FT                   HIDRTALDKWRNWNIDMTTWRSIGSGPIVEF"
FT   gene            complement(<627809..>628276)
FT                   /locus_tag="ZYRO0A07678g"
FT                   /old_locus_tag="ZYRO-ORF9031"
FT   CDS_pept        complement(627809..628276)
FT                   /locus_tag="ZYRO0A07678g"
FT                   /old_locus_tag="ZYRO-ORF9031"
FT                   /product="ZYRO0A07678p"
FT                   /note="highly similar to uniprot|Q03799 Saccharomyces
FT                   cerevisiae YMR158W MRPS8 Mitochondrial ribosomal protein of
FT                   the small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07678g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25768"
FT                   /db_xref="GOA:C5DQ07"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ07"
FT                   /protein_id="CAR25768.1"
FT                   /translation="MSLVKLANTCAHLQNCSRVRTSLTSIPYTKLHLQFAYNLYTHGFL
FT                   SSLQKGSTKGPDDIPEDVTPDNISTRRLWVGLKYRDTKSVLSSCRLVSKPNLRIHLSHN
FT                   EMKKLCSGVPVRLIKPLQPGELMMVRTKESVIDINEAVLKKLDGEVLCRVK"
FT   gene            <628437..>629153
FT                   /locus_tag="ZYRO0A07700g"
FT                   /old_locus_tag="ZYRO-ORF9029"
FT   CDS_pept        628437..629153
FT                   /locus_tag="ZYRO0A07700g"
FT                   /old_locus_tag="ZYRO-ORF9029"
FT                   /product="ZYRO0A07700p"
FT                   /note="similar to uniprot|Q03798 Saccharomyces cerevisiae
FT                   YMR157C FMP39 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25769"
FT                   /db_xref="GOA:C5DQ08"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DQ08"
FT                   /protein_id="CAR25769.1"
FT                   /translation="MLPFRRILLRRGPLTGRAALFSPAFRTLGGVSREYASKPAKPAAR
FT                   NNTGPGFAMIFALAIIGTVIFNETAKNLDKNKPRNTFTEEEYEHVMQGLKRRVAMFPDG
FT                   QLDVQFSLQKDSTQLKKLLGDSKLYIDPGQVVENYRSDREDPYEPLLNEVYSKYGPEYL
FT                   KYLPQGLLVSLLGRYMKAHCRQGDHVVILDFPHSIKDAIKFENEVSSASKLLVPKESLD
FT                   SDVCKYYQTVQKSQQL"
FT   gene            complement(<629192..>629758)
FT                   /locus_tag="ZYRO0A07722g"
FT                   /old_locus_tag="ZYRO-ORF9028"
FT   CDS_pept        complement(629192..629758)
FT                   /locus_tag="ZYRO0A07722g"
FT                   /old_locus_tag="ZYRO-ORF9028"
FT                   /product="ZYRO0A07722p"
FT                   /note="similar to uniprot|Q12368 Saccharomyces cerevisiae
FT                   YDL098C SNU23 23 kD U4/U6.U5 snRNP associated protein
FT                   Putative RNA binding zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25770"
FT                   /db_xref="GOA:C5DQ09"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR040107"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ09"
FT                   /protein_id="CAR25770.1"
FT                   /translation="MANFGRRTWDREEYAQLAQEEPLSHEETLKSSLSDAKLQQLKNKY
FT                   TDHNRLVRQSMHDLNKKVLATGISSYKRGKQFGFYCELCDLTHKDTAQYIDHLNHKTHQ
FT                   LKFEAIFGEDLVADKRDNDDIPPEEFSKEYKTLVSRFVKQHASKPKATSTGTRIGKSQN
FT                   VNAPSNPPSAIHQSMGFSTFGSTKM"
FT   gene            <629851..>630471
FT                   /locus_tag="ZYRO0A07744g"
FT                   /old_locus_tag="ZYRO-ORF9027"
FT   CDS_pept        629851..630471
FT                   /locus_tag="ZYRO0A07744g"
FT                   /old_locus_tag="ZYRO-ORF9027"
FT                   /product="ZYRO0A07744p"
FT                   /note="similar to uniprot|Q03796 Saccharomyces cerevisiae
FT                   YMR156C TPP1 DNA 3'-phosphatase that functions in the
FT                   repair of endogenous DNA damage functionally redundant with
FT                   Apn1p and Apn2p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25771"
FT                   /db_xref="GOA:C5DQ10"
FT                   /db_xref="InterPro:IPR006551"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ10"
FT                   /protein_id="CAR25771.1"
FT                   /translation="MSHRLKVLPYLIKHTPKAPILSQNLIQVYAFDLDHTLIQPISSST
FT                   FSKTAEDWQFVKYGNRNSIDTLLQLVRDEPNSLIVVFSNQGGVLASPPDSKSCIKYLTK
FT                   IELVLKHIATMAQGDQLLNRLWIYASPKAPARIADRSMFIDMRKPATGMMNQFQQDIGS
FT                   LPIELKYYCGDAAGRPTDFSDSDVKFAHNLHTIFKLPEDLFIT"
FT   gene            complement(<630468..>631733)
FT                   /locus_tag="ZYRO0A07766g"
FT                   /old_locus_tag="ZYRO-ORF9026"
FT   CDS_pept        complement(630468..631733)
FT                   /locus_tag="ZYRO0A07766g"
FT                   /old_locus_tag="ZYRO-ORF9026"
FT                   /product="ZYRO0A07766p"
FT                   /note="highly similar to uniprot|Q12377 Saccharomyces
FT                   cerevisiae YDL097C RPN6 Essential non-ATPase regulatory
FT                   subunit of the 26S proteasome lid required for the assembly
FT                   and activity of the 26S proteasome the human homolog (S9
FT                   protein) partially rescues Rpn6p depletion"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25772"
FT                   /db_xref="GOA:C5DQ11"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040773"
FT                   /db_xref="InterPro:IPR040780"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ11"
FT                   /protein_id="CAR25772.1"
FT                   /translation="MSLEQARQLVQSKQYAEAETIYLNLLNKDESSVTDSRKNEQEACL
FT                   LELGSLYATTHDKTKLRNFIPNSTEYMLQFAKSKTAKVLKTLIEKFGEVPDSLDDQIYV
FT                   CQKSIEFAKKEKRQFLKHSLSIKLATLYYQKTQYKDSLDLINSLLKEFKKLDDKPSLVD
FT                   VHLLEAKVYHKLRNLTKAKGASTASRTAANSIYCPTATVAELDLMSGILHCEDRDYKTA
FT                   YSYFFESFENFHHLSTHNSYGKACRVLKYMLLSKIMLNLISDVNNILNAKYTKETYQSR
FT                   DIDAMSAVAEAYNSRSLLQFNAALRQYKEELMGDELIRSHFNALYDTLLESNLCKLIEP
FT                   FECVEVSHISKMIGLDAKQVEGKLSQMILDKVFFGVLDQGKGWLYIYDTPHQDATYDSA
FT                   LELVGELDKVVDQLFEKASVLY"
FT   gene            <632639..>634924
FT                   /locus_tag="ZYRO0A07788g"
FT                   /old_locus_tag="ZYRO-ORF9025"
FT   CDS_pept        632639..634924
FT                   /locus_tag="ZYRO0A07788g"
FT                   /old_locus_tag="ZYRO-ORF9025"
FT                   /product="ZYRO0A07788p"
FT                   /note="similar to uniprot|P33775 Saccharomyces cerevisiae
FT                   YDL095W PMT1 Transfers mannose residues from dolichyl
FT                   phosphate-D-mannose to specific serine/threonine residues
FT                   of proteins in the secretory pathway acts in complex with
FT                   Pmt2p dolichyl phosphate-D-mannose:protein O-D-
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25773"
FT                   /db_xref="GOA:C5DQ12"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ12"
FT                   /protein_id="CAR25773.1"
FT                   /translation="MSALNEKRLKSEELNQDPVVDLDIKQGPSRPYVSSEPPEKLSKLR
FT                   TVHTKNERLLVATLAIITGAVRLYNLSWPNSVIFDEVHFGKFASYYIRNNFFMDVHPPL
FT                   AKMMFAWIASLVGFEGDFDFDTIGKAIPANAPYVLMRSLAATSGALTVIMLYFTLRASG
FT                   VRVWIAFASALCFALENSYVTISRYILLDAPLIFFISASVYCFKRYELYPSGTCQSLKY
FT                   LVATGICLGLASSAKWVGLFTVAWVGVLCLWRLWFFIGDLSKPVCSTFKIAAAKGSILL
FT                   GIPVLLYTFFFYLHFQTLDKDGEGAGFFSPEFRTSLKGNTIPQNVMAEVGTGSIITLRH
FT                   TGTMGGYLHSHPHDFPAGSQQQQITLYPHLDANNEWYVMLYDQPNSTVTSFENLTDGTK
FT                   IRLLHPLTSRRLHSHDHKPPVSENSDWQKEVSCYGFEGFDGDANDDWVIEIDKEASAPG
FT                   PAQERVRALETKFRLRHAMMNCYLFSHEIKLPKWGYDQQEVTCAYSGLPSLTLWAVEQS
FT                   YNEFLPEDTEIISYKPSSFWQKLVEYHEKMWHINNNLVDSHVYESMPSSWPFLMRGIGY
FT                   WSQHYRHVYLLGNAILWWSVTAFIFIFGLVAVAELVAWQLGKPILQDSRLVNFHIQVIQ
FT                   YLLGYAIHLAPSFLMQRQMFLHHYLPAYYFGILAFGHALDILVTYVFRRQRTVGYIIVG
FT                   AFVLSCLYFFKNYSPIIYGLPWTKQLCEKSQWLSGWDYSCANYLNTYEEYSTVDLNEGL
FT                   IPEATAAL"
FT   gene            complement(<635126..>637057)
FT                   /locus_tag="ZYRO0A07810g"
FT                   /old_locus_tag="ZYRO-ORF9023"
FT   CDS_pept        complement(635126..637057)
FT                   /locus_tag="ZYRO0A07810g"
FT                   /old_locus_tag="ZYRO-ORF9023"
FT                   /product="ZYRO0A07810p"
FT                   /note="some similarities with uniprot|Q03795 Saccharomyces
FT                   cerevisiae YMR155W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25774"
FT                   /db_xref="GOA:C5DQ13"
FT                   /db_xref="InterPro:IPR010658"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ13"
FT                   /protein_id="CAR25774.1"
FT                   /translation="MARPERSRLIKTFIGSNIVAIGAGTPYVYSFYAPQLLAQCHIPVS
FT                   KVSTLSLSLNLGSSLLGFIAGMVIDKNPALSCLIGTLCTFIGYATLDYCYQTQLSSVLL
FT                   ISTALCLIGYGSISGFYASVKCCTTNFPHHRGTAGAFPVSLYALAGMMYSSLCSELFGD
FT                   DMGKVFKFLTLVCSLAIFTGCLTLEILVHPKTQRSHSRQSSGVRDTALDRSQPISVANQ
FT                   PDFPAATAGNKQDQASLASGSSTASSSQSMWSTQGTDSYVWSTELSGSLPFWGWGRERD
FT                   LPAGSPAPNVPNTGATPESPRIPTPSYSRPGLSYSATNQSRRMDTLPLNNTRRDSFKRN
FT                   DSDGPDARGTLSAQPPVRLDTTPTTAAPTKPKKWTENYVLHTITTPRFLTYYIILATLQ
FT                   GLGQMYIYCVGFIVQTQVNSLPAGRYNLNPERIQSIQVSIISILSFAGRLSSGPISDLL
FT                   VKKLDAQRMWNIVLAGFLMFWGSGQMLHQIPGAAVSTATNLPQSLTNISFCSAIFGFAF
FT                   GVLFGTYPAIIADSFGTAAFSTIWGISTSGGLPSIKIFAAILGKDLDKHTDPSETVCKK
FT                   GIDCYKHTFHVTQICCSLIVLLTLSLIAVTYWKARHKKLDPLDDSRAQHLLEEDENTLQ
FT                   SNDRQLDA"
FT   gene            <637431..>637504
FT                   /locus_tag="ZYRO0A07832r"
FT                   /old_locus_tag="Zyro0A.tIle.AAT.14"
FT   tRNA            637431..637504
FT                   /locus_tag="ZYRO0A07832r"
FT                   /old_locus_tag="Zyro0A.tIle.AAT.14"
FT                   /note="tRNA-Ile (AAT) cove score=71.64"
FT   gene            <637801..>638217
FT                   /locus_tag="ZYRO0A07854g"
FT                   /old_locus_tag="ZYRO-ORF9021"
FT   CDS_pept        637801..638217
FT                   /locus_tag="ZYRO0A07854g"
FT                   /old_locus_tag="ZYRO-ORF9021"
FT                   /product="ZYRO0A07854p"
FT                   /note="similar to uniprot|P38985 Saccharomyces cerevisiae
FT                   YDL092W SRP14 Signal recognition particle subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25775"
FT                   /db_xref="GOA:C5DQ14"
FT                   /db_xref="InterPro:IPR003210"
FT                   /db_xref="InterPro:IPR009018"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ14"
FT                   /protein_id="CAR25775.1"
FT                   /translation="MVDGGHLENEEFLVKVPQFFHIANEKHITVRLSTKRLVKHDSVEG
FT                   NAEFDAVNRPHYDVSQKSQNLKIDDNSKDVYQLLVRMSYGSKAQKTKCSTVVDSNNLDK
FT                   FWQDYSNAVKNGMSGLIKKKKKKSKAKNGKTHKK"
FT   gene            complement(<638258..>639580)
FT                   /locus_tag="ZYRO0A07876g"
FT                   /old_locus_tag="ZYRO-ORF9020"
FT   CDS_pept        complement(638258..639580)
FT                   /locus_tag="ZYRO0A07876g"
FT                   /old_locus_tag="ZYRO-ORF9020"
FT                   /product="ZYRO0A07876p"
FT                   /note="similar to uniprot|Q12229 YDL091c Saccharomyces
FT                   cerevisiae UBX3 UBX domain-containing protein that
FT                   interacts with Cdc48p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25776"
FT                   /db_xref="GOA:C5DQ15"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR006577"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ15"
FT                   /protein_id="CAR25776.1"
FT                   /translation="MDLLRRAMHGGDPPFTPIPGSFPEETTTIHDSRMEGNVEDTSSGH
FT                   SSRRNRWNRKAILITLVRIPFVLLYYIMVWTIVILSLLKPLCNISGFYKKKNSRLSDPK
FT                   SQLNNLLETLDHESQRTLNPSVQDVNTPTYTFESLYSLEHGSLAPDIVQGGYADLLNAC
FT                   SEQCKFAIIYLHDSLLDNSMQYVNELLCSEKFATLIKKYQVLLWFSEVTVSEGLQAANA
FT                   LKVRQFPFLGVLCLKAEKKIEVIGRLEGNLDKYGTNALENVLTKGHNKLVQIRQQRQNL
FT                   ALQRLIREQQDSRYSESLRRDQELARQRNAQRQAALEQERQELLRKQWLLWRKSILRPE
FT                   PTSTGGSACRIAIRTDGGARIVRKFDSNLTIDEIYAYVELSMEGLLDSAEVNNSPPLGY
FT                   EHHYRFLLLTPVPRKELDPGTTIGDEPAIYPSGNIVMEPLT"
FT   gene            complement(<639798..>641066)
FT                   /locus_tag="ZYRO0A07898g"
FT                   /old_locus_tag="ZYRO-ORF9018"
FT   CDS_pept        complement(639798..641066)
FT                   /locus_tag="ZYRO0A07898g"
FT                   /old_locus_tag="ZYRO-ORF9018"
FT                   /product="ZYRO0A07898p"
FT                   /note="similar to uniprot|P22007 Saccharomyces cerevisiae
FT                   YDL090C RAM1 essential for processing of ras proteins beta
FT                   subunit of farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25777"
FT                   /db_xref="GOA:C5DQ16"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR026872"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ16"
FT                   /protein_id="CAR25777.1"
FT                   /translation="MTSQDNGSKNPAAKLLGRKRSPIERVVPSEEESSSESEQSIVAMV
FT                   KEMETETTEARDKLIHECRILLERDDLNTLDKEFHKKFLDSPFSHQLPPGMVALDASAP
FT                   WLLYWVANGLRVMNPSWLERETQRRIQEKVFRINPHGGPFGGGMGQLPHLAGTYAIVNA
FT                   LAICDNTDGCWDKINRSSIYNWLLTLKREDGGFQTCFRVGEYDTRGVYCAISVASTLGL
FT                   LTQELCENVVEFLVHCQNYEGGFGGVPHEDEAHGGYTFCAVASLAILGALDTINVEKLA
FT                   DWCSQRQYNDEKGLSGRSNKLVDVCYSFWVAGTAAILEAYGHGNCIDKAGLKEYILKCC
FT                   QMTTRPGIRDKPGTKPDFYHTNYGLLGVAITENTFQLDPSVPNALKINSSAINPDDNSG
FT                   LESINPVYGLPSRDLETFYKHFK"
FT   gene            <641244..>643334
FT                   /locus_tag="ZYRO0A07920g"
FT                   /old_locus_tag="ZYRO-ORF9017"
FT   CDS_pept        641244..643334
FT                   /locus_tag="ZYRO0A07920g"
FT                   /old_locus_tag="ZYRO-ORF9017"
FT                   /product="ZYRO0A07920p"
FT                   /note="similar to uniprot|Q03792 Saccharomyces cerevisiae
FT                   YMR154C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25778"
FT                   /db_xref="GOA:C5DQ17"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ17"
FT                   /protein_id="CAR25778.1"
FT                   /translation="MDDWRLLDELRHLIYLGNGLQGREEDLNRLISVASKSNDMELIKS
FT                   VLILKEDSDNLSPKQKLLWLTSKLRDRLYPPLAVDIAGPLPWNNDLSLSNTNVHYCYER
FT                   HLKGDLEVLGLSQCRDLEDCSFVASLISIKNQRVPFPRIKQVNDHLYHVNLHFNGCDRR
FT                   LVSVDTSKVPTNDEGYQLSLLSDKIMDKIVEMAYLQVKSGSYATTGSNTAVDTFLLTGY
FT                   VPEVKSTDNISSIQEAVSCFKTGSCLLALGTGQQATNLDAPLIRNHDYPVIDVDLRQGI
FT                   AVLQDPLDPYLHLQTALEDFIENYEQLYVNWCTDKLFAFEKTLEFFYNFAKCDKFNTAM
FT                   NKQLFLLENGSDSEQDVWLLLESHLQSEKSIAYLQELPRDVLSSAGAPHEGACDIGLQL
FT                   LKLKLSPRSTKRFFCHSSKSNAFTIHLYSNSSSVNIVRWSADKCTKILECKANNLEQCY
FT                   MGSPFYYKNPTFQLEIVHSEARQFPLNLQLLSENCQDMVNLQLYHLKDHSLQKPIFADP
FT                   NYTQQRYDKSFVLLSTNVPYKLVCSSYSNKSEHSYRLQVSPSDDQLLLPHIQIKQIYMQ
FT                   FGGLPFQLERKIPCTKNKVLIPFATSTNTTCFIRVVPPTFSSLMRMRLAVCDKCGNPLR
FT                   SAQFSQPPAPGGMVIDDWKSTGPAQYILVIDFDGPETDLSSSHFTMCIGSSKKIMIDGR
FT                   YC"
FT   gene            <643465..>645000
FT                   /locus_tag="ZYRO0A07942g"
FT                   /old_locus_tag="ZYRO-ORF9016"
FT   CDS_pept        643465..645000
FT                   /locus_tag="ZYRO0A07942g"
FT                   /old_locus_tag="ZYRO-ORF9016"
FT                   /product="ZYRO0A07942p"
FT                   /note="weakly similar to uniprot|Q12066 Saccharomyces
FT                   cerevisiae YDL089W Protein of unknown function interacts
FT                   with meiotic division protein Csm1p green fluorescent
FT                   protein (GFP)-fusion protein localizes to the nuclear
FT                   periphery potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25779"
FT                   /db_xref="GOA:C5DQ18"
FT                   /db_xref="InterPro:IPR018819"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DQ18"
FT                   /protein_id="CAR25779.1"
FT                   /translation="MSLRISKDVSVSVNTADLLPEDDGFDRVDGDNRGWFSVFLGLFNT
FT                   HPSDWNIALNEAIETIDWDSKSITLAQPLGNFFTFAFYVVRLLQLSLIKPNLSRINEKT
FT                   DHFDLSKSEMLKKYEYLYHFTNDKNQSVGNVYYRFLGRLGKFFDICIVLLTFTNGFITY
FT                   KFFWGNFKMYCLFYLKKGPHLRNVTKASLQKLGQDDDDGSLWSSLRYFWNGTKDKEGST
FT                   DDRDDDDGDIHYKLFKWTPSQFITMLFVSFAPTAVVFLLFTEVSFLTLIAVIVHQWVLH
FT                   RLVIDCYGNRLVHESVIASANLAEVEAKFVKPRMSKKVQDVAIDCTPHGDGMVKFYPAL
FT                   TTNRSHIFQTHSLTGELITETFNPSTKEFEDLQTEGTTHNVIRTAPYAAGDLLHRDPYW
FT                   YQRNMIMRDVAHRPYFHSREVSPTRYHPSRISPRPGQYSPLVSSTSGMSTPLMRPDRSP
FT                   FLNTRPSLGEREELFHRGNSRSPLRQPIENFKSLDRSSDSQSPIRRHNGDSDA"
FT   gene            complement(<645073..>646500)
FT                   /locus_tag="ZYRO0A07964g"
FT                   /old_locus_tag="ZYRO-ORF9015"
FT   CDS_pept        complement(645073..646500)
FT                   /locus_tag="ZYRO0A07964g"
FT                   /old_locus_tag="ZYRO-ORF9015"
FT                   /product="ZYRO0A07964p"
FT                   /note="similar to gnl|GLV|KLLA0F07227g Kluyveromyces lactis
FT                   KLLA0F07227g and weakly similar to uniprot|Q05166
FT                   Saccharomyces cerevisiae YDL088C ASM4 Nuclear pore complex
FT                   subunit part of a subcomplex also containing Nup53p Nup170p
FT                   and Pse1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25780"
FT                   /db_xref="GOA:C5DQ19"
FT                   /db_xref="InterPro:IPR007846"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ19"
FT                   /protein_id="CAR25780.1"
FT                   /translation="MFATQNPSANGSRFANVSVNFPQQQPQQLQQQNPYQPLNPTTTSQ
FT                   QQPQSLLSVSGSSTNGLQTQREPEWFNNPKKRAIPQSIVKRTTKRSPSADSSQADNDSG
FT                   SSTVRSGFNSIAFGTKRNAGGFQSSQIAKPTTNVEKNTGILIDSNEAPPSISLYDWQRE
FT                   DEFGTTLPQLNSNSLLPNDTQVASQSSSSSIKKGISTGTEFNAFDKGSVAKTNTQIRPE
FT                   SGGNDVGENLGQTHNESAVIVFGYPESISNLIITHFSKFGYILEDFEVLRSSSGINTAT
FT                   LRLHGSKPGRKYPIFTGDGWVKLTYDSPPSALRALEENGLVYGGSLIGCVPYNKRAVEQ
FT                   LASCKIEKEDDIGNLNFSVAPSTLADNGPDVFENGEDVSSVTSPQQFVNGKQDRKGLSP
FT                   TKNTANNLLDHSKVAHPTRRLDIKDGKSLFVHNGAADNHYFLRSLEQKMRQQEENNRKQ
FT                   SSVLHKVNNWLFGWNEL"
FT   gene            complement(<646729..>647823)
FT                   /locus_tag="ZYRO0A07986g"
FT                   /old_locus_tag="ZYRO-ORF9014"
FT   CDS_pept        complement(646729..647823)
FT                   /locus_tag="ZYRO0A07986g"
FT                   /old_locus_tag="ZYRO-ORF9014"
FT                   /product="ZYRO0A07986p"
FT                   /note="similar to uniprot|P28625 Saccharomyces cerevisiae
FT                   YMR152W YIM1 Mitochondrial inner membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25781"
FT                   /db_xref="GOA:C5DQ20"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DQ20"
FT                   /protein_id="CAR25781.1"
FT                   /translation="MSKVINRAVTFINNKTPATITTKELDLDRCFKDTEIVIKIHAASL
FT                   NPIDVMVHNLAFKLPFNSSPKTFSRDYAGVIVKAGDKVDPEWKINDRVVGNFAHIYGEQ
FT                   GTLSDYLILDPSVQKAIAHIHDTTKLDTKYDPFTLNAAWPLVFGTAHTALFDYGQKLGP
FT                   DSKILVIGASTSVSYALVHIAKNVLNVGTVVGICSSQSFEHNKAAGFDHLVPYDQGPLT
FT                   EEVGKLLVGTLRNEKFDLIFDSVGNNDFFPVMDKFLKPKSENSYYISISGDYKNNFNKH
FT                   PFNISSARSLFRAANPFRGYNYALETLPCKREYMDLGAKLIADGKYAPKIDSVYNFDDY
FT                   QKAMDRLKSNKAKGKVVIKINGEK"
FT   gene            complement(<647965..>648702)
FT                   /locus_tag="ZYRO0A08008g"
FT                   /old_locus_tag="ZYRO-ORF9013"
FT   CDS_pept        complement(647965..648702)
FT                   /locus_tag="ZYRO0A08008g"
FT                   /old_locus_tag="ZYRO-ORF9013"
FT                   /product="ZYRO0A08008p"
FT                   /note="highly similar to uniprot|Q07508 Saccharomyces
FT                   cerevisiae YDL087C LUC7 Essential protein associated with
FT                   the U1 snRNP complex splicing factor involved in
FT                   recognition of 5' splice site"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25782"
FT                   /db_xref="GOA:C5DQ21"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ21"
FT                   /protein_id="CAR25782.1"
FT                   /translation="MGSSATEQRKLLKQLMGRDPNKIQNRPSYGYKRRDLGLYDPKICK
FT                   SYLVGECPYDLFQGTKQSMGRCPQIHLAKHKLQYERERKRGKQFPEFEQEYYAILHKFI
FT                   YDCNGQVAIALKKLEHTPEERARIQEVTSELDVLDSRIGLMIQEIESLIRANEVSQAMI
FT                   QARNLQELQSKRVEVGKKVKNMTENVGQSAQQKLQVCEVCGAYLSRLDTDRRLADHFMG
FT                   KIHLGYVKMRSELDSMDQRLKNS"
FT   gene            <649194..>650048
FT                   /locus_tag="ZYRO0A08030g"
FT                   /old_locus_tag="ZYRO-ORF9012"
FT   CDS_pept        649194..650048
FT                   /locus_tag="ZYRO0A08030g"
FT                   /old_locus_tag="ZYRO-ORF9012"
FT                   /product="ZYRO0A08030p"
FT                   /note="similar to uniprot|Q03085 Saccharomyces cerevisiae
FT                   YPL033C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25783"
FT                   /db_xref="GOA:C5DQ22"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ22"
FT                   /protein_id="CAR25783.1"
FT                   /translation="MISQKLYKFANLIYGIVGSGKKLESTDTVLILGGSNGLGKDICTQ
FT                   LCQNEIKVINVDTQDTSIPLMGKCYTFIPCKSFAETHSVQEAMQAVKSLVQPITILINN
FT                   VQRDFKSVYQMEEPLSPLDESIDQFKECVAANLTNVMIATKFFLEQLVPQSVCLTGNKS
FT                   QDYYLVNLSSILTLNVPEQASHYVSSKAALNQFHDSLTSELKSSRHKKVHYKTLLVFLP
FT                   FSKDYLIWNQSTSCLSQQLIDCLHDGRKGDVLLRIDDSPLTAFKVSASGSCRFSNMVSK
FT                   WKQ"
FT   gene            <650137..>650709
FT                   /locus_tag="ZYRO0A08052g"
FT                   /old_locus_tag="ZYRO-ORF9011"
FT   CDS_pept        650137..650709
FT                   /locus_tag="ZYRO0A08052g"
FT                   /old_locus_tag="ZYRO-ORF9011"
FT                   /product="ZYRO0A08052p"
FT                   /note="similar to uniprot|P28627 Saccharomyces cerevisiae
FT                   YMR150c IMP1 protease, mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25784"
FT                   /db_xref="GOA:C5DQ23"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR026730"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ23"
FT                   /protein_id="CAR25784.1"
FT                   /translation="MNSTIQAWLKTGSYAVRAVCFVHIIHTYVYEFTETRGESMLPTLA
FT                   ASNDYVHAFKKYKDGKNCKMGDCIVAVKPSDPDHRVCKRITGMPGDVILVDPSMGTQLD
FT                   RLPSDVDEIDEDENFNTYIKVPKGHVWVTGDNLSHSLDSRTYNSLPMGLIRGKIVAAND
FT                   FNQPFWSGSKGNFWGFRKIGNSFVNED"
FT   gene            complement(<650765..>651595)
FT                   /locus_tag="ZYRO0A08074g"
FT                   /old_locus_tag="ZYRO-ORF9010"
FT   CDS_pept        complement(650765..651595)
FT                   /locus_tag="ZYRO0A08074g"
FT                   /old_locus_tag="ZYRO-ORF9010"
FT                   /product="ZYRO0A08074p"
FT                   /note="similar to uniprot|Q02795 Saccharomyces cerevisiae
FT                   YMR149W SWP1 oligosaccharyl transferase glycoprotein
FT                   complex delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25785"
FT                   /db_xref="GOA:C5DQ24"
FT                   /db_xref="InterPro:IPR008814"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ24"
FT                   /protein_id="CAR25785.1"
FT                   /translation="MKFLKALGLLALASWGQALTIKDANFAFPDTDTRGIMVGPIDHET
FT                   KKLNKPLTLDTLDQTVELNFASDSRLTQATLLLGLPDRGLEQAIQATLTENQGLLLYRV
FT                   RIPINQLSQHLLHLAVNEKQLLAGSLVLANEDEGFLLSLFDIKLDVNETAFEYVKPERL
FT                   EAKPEIHHVFNAEPQTVPWSFAQIFSFLIVLVTFGLVVSWMSAGALTWSGLPKGLNTIY
FT                   FLAFVGSVIGFEFIFVRYYTGTSIFETLRCTFLLSIPSLWLGTHFLRSWGKELR"
FT   gene            complement(<651760..>652167)
FT                   /locus_tag="ZYRO0A08096g"
FT                   /old_locus_tag="ZYRO-ORF9009"
FT   CDS_pept        complement(651760..652167)
FT                   /locus_tag="ZYRO0A08096g"
FT                   /old_locus_tag="ZYRO-ORF9009"
FT                   /product="ZYRO0A08096p"
FT                   /note="some similarities with uniprot|P40219 Saccharomyces
FT                   cerevisiae YMR148W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25786"
FT                   /db_xref="GOA:C5DQ25"
FT                   /db_xref="InterPro:IPR031430"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DQ25"
FT                   /protein_id="CAR25786.1"
FT                   /translation="MATLSSVYFLIYFVSFLAIAAVASFFIIPLLGISFLFASAVVVFG
FT                   FLSDITFKFAQSLYIKTDHRLKSTLSKMGNQKKGTNNSQAGNSPPPTPQPSVEPQLGPN
FT                   ANVWDAPGAETSTTSAIARSLEAREDVRVTN"
FT   gene            complement(<652540..>653166)
FT                   /locus_tag="ZYRO0A08118g"
FT                   /old_locus_tag="ZYRO-ORF9008"
FT   CDS_pept        complement(652540..653166)
FT                   /locus_tag="ZYRO0A08118g"
FT                   /old_locus_tag="ZYRO-ORF9008"
FT                   /product="ZYRO0A08118p"
FT                   /note="some similarities with uniprot|P40218 Saccharomyces
FT                   cerevisiae YMR147W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25787"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ26"
FT                   /protein_id="CAR25787.1"
FT                   /translation="MGVNTTPKFKERNSNSFRKLQKSQGKSQEPEPIKSNLKLNSTAHM
FT                   KFAALPDREAENSKQPFSPIIDVKFSPRPSESSGASAAKPLSLKEQIKTLEPINEIPNE
FT                   KVEKLADSIKGPFTESEVQELLLSYTYTSGMIDGGGSGSTVAGKRGAYLKSQLRKKWTS
FT                   VALKAVDSIDKLQSKLYEYFWLGAIYLNVWFPKLTSFVRYVLDCS"
FT   gene            complement(<653497..>654045)
FT                   /locus_tag="ZYRO0A08140g"
FT                   /old_locus_tag="ZYRO-ORF9006"
FT   CDS_pept        complement(653497..654045)
FT                   /locus_tag="ZYRO0A08140g"
FT                   /old_locus_tag="ZYRO-ORF9006"
FT                   /product="ZYRO0A08140p"
FT                   /note="some similarities with uniprot|Q03083 Saccharomyces
FT                   cerevisiae YPL034W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25788"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ27"
FT                   /protein_id="CAR25788.1"
FT                   /translation="MYHSLVTRSVADIDWLYLDESILSARGKRRHWSSNDQILCKIGMT
FT                   TRSSVNTRLLEWQNTCKHPVINLTPERIHLLYESGRNSRTLTKILSKLSLNGSKVRPSN
FT                   PKLQTYNNGGFYTNGKGPKTLAMIENTIHRQLWQRYGQGLIWCYGCDPEGHTRHKEWFR
FT                   VPIKDLPLLARYIDRVCGG"
FT   gene            <654330..>655148
FT                   /locus_tag="ZYRO0A08162g"
FT                   /old_locus_tag="ZYRO-ORF9005"
FT   CDS_pept        654330..655148
FT                   /locus_tag="ZYRO0A08162g"
FT                   /old_locus_tag="ZYRO-ORF9005"
FT                   /product="ZYRO0A08162p"
FT                   /note="similar to uniprot|Q07505 Saccharomyces cerevisiae
FT                   YDL086W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25789"
FT                   /db_xref="GOA:C5DQ28"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ28"
FT                   /protein_id="CAR25789.1"
FT                   /translation="MLITETFEDVKTSYGTDLRVYIFTPKVHGYPHAKFPGVVLYSEIY
FT                   QVTGPVRRFAQKIASKGYVVAAPDIYHNFVSPGPLAYDAKGTDDGNEYKIKKPLESYDE
FT                   DNRLCVDLLYRLPQFGGRIGATGMCLGGHLAFRALLDKRVTCATCFFPTDVHSKTLGLG
FT                   KNDDTLQRVSQEANADQELVLIFGTWDTHVPPEGRDLIRDQLRKSGVAFSFLEVHAAQH
FT                   AFIRDESSKGRYDAEITDSCLGFLFEQFNRKLNLTLGEFVPERGELKHVC"
FT   gene            <655686..>656726
FT                   /locus_tag="ZYRO0A08184g"
FT                   /old_locus_tag="ZYRO-ORF9004"
FT   CDS_pept        655686..656726
FT                   /locus_tag="ZYRO0A08184g"
FT                   /old_locus_tag="ZYRO-ORF9004"
FT                   /product="ZYRO0A08184p"
FT                   /note="highly similar to uniprot|P40217 Saccharomyces
FT                   cerevisiae YMR146C TIF34 Subunit of the core complex of
FT                   translation initiation factor 3(eIF3) which is essential
FT                   for translation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25790"
FT                   /db_xref="GOA:C5DQ29"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR027525"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ29"
FT                   /protein_id="CAR25790.1"
FT                   /translation="MRPIMLVGHERPITQVKYNREGDLVFSCSKDNVASVWFSINGERL
FT                   GTLEGHQGSIWSIDVDQYTQLCTTGSADYSVKVWNVSDGKTVHTWKSPVPVKWVEFSPC
FT                   GRYVLAILDDVMKYVGSVNIYEIKRDPKTHQVLEFVEEPVARIETHEGLAAAQVAGWSS
FT                   EGKYILVGHKDGSISKYDTTKNYEFCGSLPLHKGNVSDIQFSPDRSYFITSSRDSNSYI
FT                   VDVDQLQVLKKYEADCPLNSACITPLKDFVILGGGQAARDVTTTAAREGKFEARFYHKI
FT                   FEEEVGRVRGHFGPLNCVAVNPQGTSYTSGAEDGFVRIHHFEKSYYDFKYEVEKAAEAK
FT                   EHMLAA"
FT   gene            complement(<657779..>658909)
FT                   /locus_tag="ZYRO0A08206g"
FT                   /old_locus_tag="ZYRO-ORF9003"
FT   CDS_pept        complement(657779..658909)
FT                   /locus_tag="ZYRO0A08206g"
FT                   /old_locus_tag="ZYRO-ORF9003"
FT                   /product="ZYRO0A08206p"
FT                   /note="highly similar to uniprot|Q08911 Saccharomyces
FT                   cerevisiae YOR388C FDH1 NAD( )-dependent formate
FT                   dehydrogenase may protect cells from exogenous formate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25791"
FT                   /db_xref="GOA:C5DQ30"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR033689"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ30"
FT                   /protein_id="CAR25791.1"
FT                   /translation="MANGTVLLVLYEGGKHAVEQERLLGAIENELGIRKFIESNGYQLL
FT                   TTIDKDPEPTSAVDRHLADAEIVITTPFYPAYITESRIAQAPNLKLAITAGVGSDHVDL
FT                   DAANERKITVAEVTGSNVVSVAEHVLTTILVLIRNYNGGHDQAVTGEWDIAGVAKNEYD
FT                   LEDKVISTVGAGRIGYRVLERLVAFNPKKLLYYDYQDLPVDAIKRLNDVSQLLNGRGDI
FT                   VQRVEKLEDMVSQSDVVTINAPLHEGTKGLFNKELISYMKDGAYLVNTARGAICVAQDV
FT                   ADAVKSGKLAGYGGDVWDVQPAPKNHPWRSMNNKDQVGNAMTVHISGTSLDAQQRYAEG
FT                   VKNILESYFTKKFDYRPQDVIVKDGKYATRAYGQKK"
FT   gene            <661528..>663150
FT                   /locus_tag="ZYRO0A08228g"
FT                   /old_locus_tag="ZYRO-ORF8998"
FT   CDS_pept        661528..663150
FT                   /locus_tag="ZYRO0A08228g"
FT                   /old_locus_tag="ZYRO-ORF8998"
FT                   /product="ZYRO0A08228p"
FT                   /note="similar to uniprot|P40215 Saccharomyces cerevisiae
FT                   YMR145C NDE1 Mitochondrial external NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25792"
FT                   /db_xref="GOA:C5DQ31"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ31"
FT                   /protein_id="CAR25792.1"
FT                   /translation="MNKMFRSLAGFARRSPSLKTTVQSRCFASGKTAEAAAAAGAKPSL
FT                   LRRGGKLALHAALYSALAGTAYVSYELYRESNPLPQVAQSATFADGSPRKTIVILGSGW
FT                   GSASLLKNLDTSLYNVVLVSPRNYFLFTPLLPSTPVGTVELKSIVEPIRSIARRAPGEV
FT                   HYYEAEALDVDPQDKTVKIQSVNKDQEYTLDLKYDYLVYGVGAQPTTFNTPGVYENASF
FT                   LKEISDAQEIRVKIMTAIEKAATLSPSDPERQRLLTFVVVGGGPTGVELAAELKDYVDQ
FT                   DLKKWMPGLSKEIKVTLAEALPNILNMFDRSLVEYAQDLFKQEKIDLWLNTMVKSVDKT
FT                   HIRAKCGDEMIEVPYGVLVWATGNAPRDVTKNLMNKLEPQDSRRGLLINEKLQLLGAED
FT                   SIFAIGDCTFYPGLFPTAQVAHQEGEYLAKALKKIHGVDQLKWQIAQAAEEDKQMLESR
FT                   LDKLQGDFEHFKYNHMGALAYIGKEKAIADVSFGQSQYKLAGSFTFLFWKSAYLAMCLS
FT                   FRNRVLVAMDWCKVYFLGRDSSV"
FT   gene            <663381..>665177
FT                   /locus_tag="ZYRO0A08250g"
FT                   /old_locus_tag="ZYRO-ORF8997"
FT   CDS_pept        663381..665177
FT                   /locus_tag="ZYRO0A08250g"
FT                   /old_locus_tag="ZYRO-ORF8997"
FT                   /product="ZYRO0A08250p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25793"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ32"
FT                   /protein_id="CAR25793.1"
FT                   /translation="MMDTTTADRVLKLPIDSPFDTHRQPERNDDPNQNSDKRPLVTTVT
FT                   DQSLSAAAAAVASVQDTWGENFNEPLPTNKEDRIKQALEFMRGERQAFAADKNIKKHSI
FT                   RQIAMFFQVPKSTLYDRLKNKSVDPQVSDGRIYMGPAYSVSSRAHSQQMKLSPEKEVAL
FT                   LDQLHHLCHALGNTLNLTHIRDFIVSLVDGISLGKKWVHNFNRRHDDAIIYGTTSSHYN
FT                   VRMFNSKSSRSNFENLWKCFVPLLQERIRQIPPSQPFYYITRACFHQASMSSIFTCFKI
FT                   MPEDASISLLCPPRVIVFPDYFGKVYLQLRDLKNDENHFRDVDEDVEDHSSASSSSVSE
FT                   SGGRGDKLEKDHSNVDHNRINSQEKLQKEFKHKKLNDVFQRIYTECCSQGSNQDDVPLV
FT                   IFEGFEDRYNWDPITCRSMVVLGKFLALPWNQQVLQRLVITELQPVVEELAQSASITAT
FT                   QLPSMELDLGRMELDLDPFMHSLRRLLQSHTEVLPTSLNHNGVLVNDLFSSALPQSPPP
FT                   PPQTAATASTTTTTAPTTDHHQAENSTSGNIFEDSTLSQLQEVLGLIEHNESQIYRELP
FT                   DGSSSKAVIQQIFNKIRGILPQ"
FT   gene            <665522..>666853
FT                   /locus_tag="ZYRO0A08272g"
FT                   /old_locus_tag="ZYRO-ORF8996"
FT   CDS_pept        665522..666853
FT                   /locus_tag="ZYRO0A08272g"
FT                   /old_locus_tag="ZYRO-ORF8996"
FT                   /product="ZYRO0A08272p"
FT                   /note="highly similar to uniprot|Q07478 Saccharomyces
FT                   cerevisiae YDL084W SUB2 Suppresses the cold-sensitive snRNP
FT                   biogenesis brr1-1 mutation RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08272g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25794"
FT                   /db_xref="GOA:C5DQ33"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ33"
FT                   /protein_id="CAR25794.1"
FT                   /translation="MSHEGEEDLLEYSDNEQEIQVANKAEGGADAAGGEGTNGAEGTNG
FT                   DADKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAK
FT                   SGLGKTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVKTAVFY
FT                   GGTPISKDADLLKNKETAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELD
FT                   MRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQY
FT                   YIKLDEKEKNRKLAQLLDDLEFNQVIIFVRSTARANELTKLLNASNFPAITVHGHMKQE
FT                   ERIARYKAFKDFEKRICVSTDVFGRGIDIERINLALNYDLTTEADQYLHRVGRAGRFGT
FT                   KGLAISFISSNEDEEVLNKIQERFDVKIAEFPEEGIDPSTYLNN"
FT   gene            complement(<667023..>668105)
FT                   /locus_tag="ZYRO0A08294g"
FT                   /old_locus_tag="ZYRO-ORF8995"
FT   CDS_pept        complement(667023..668105)
FT                   /locus_tag="ZYRO0A08294g"
FT                   /old_locus_tag="ZYRO-ORF8995"
FT                   /product="ZYRO0A08294p"
FT                   /note="some similarities with uniprot|P40214 Saccharomyces
FT                   cerevisiae YMR144W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25795"
FT                   /db_xref="GOA:C5DQ34"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ34"
FT                   /protein_id="CAR25795.1"
FT                   /translation="MVDTSTTTNDNTRDISTSSQTSFHWENENENGVSNEELQMAIASG
FT                   MKLMRVFEQQDSENETSSSNLQDQENSKQVLNGILDAKYDKFIPPRDINAVVSSLIHVL
FT                   NQSVRQNQQLKLKNMILKSNSGDVQSRYEVEENLKKQQFERKKCQLFLEREHLIKRIQT
FT                   KDGKVAKYKNKIIEKNREINRLMRILNEHSISDTPKINDDNSNNNNKNNNNSKNQNSNN
FT                   SAPNRVLKPSSASNTPTAVSSTSNKEKASDMLRTLGMLASQVLNDEVDEDSANQTTIQA
FT                   NNSGLKGPADCNTTEPEILHSPNVSVAIPNSESINGQSGEPRSTSTGNGNHSNFLKQLP
FT                   IQMPKMKRFSTVDGTVKDIE"
FT   gene            complement(<668561..>669088)
FT                   /locus_tag="ZYRO0A08316g"
FT                   /old_locus_tag="Zyro0A.mRNA.4641.m"
FT   CDS_pept        complement(join(668561..668968,669065..669088))
FT                   /locus_tag="ZYRO0A08316g"
FT                   /old_locus_tag="Zyro0A.mRNA.4641.m"
FT                   /product="ZYRO0A08316p"
FT                   /note="highly similar to uniprot|P40213 Saccharomyces
FT                   cerevisiae YMR143w RPS16A or uniprot|P40213 Saccharomyces
FT                   cerevisiae YDL083c RPS16B"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25796"
FT                   /db_xref="GOA:C5DQ35"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ35"
FT                   /protein_id="CAR25796.1"
FT                   /translation="MSAVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILR
FT                   FKVYEPLLLVGLDKFANVDIRVRISGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNE
FT                   LKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR"
FT   gene            <669862..>670461
FT                   /locus_tag="ZYRO0A08338g"
FT                   /old_locus_tag="ZYRO-ORF8991"
FT   CDS_pept        669862..670461
FT                   /locus_tag="ZYRO0A08338g"
FT                   /old_locus_tag="ZYRO-ORF8991"
FT                   /product="ZYRO0A08338p"
FT                   /note="highly similar to uniprot|Q12690 Saccharomyces
FT                   cerevisiae YDL082w RPL13A ribosomal protein or
FT                   uniprot|P40212 Saccharomyces cerevisiae YMR142c RPL13B"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25797"
FT                   /db_xref="GOA:C5DQ36"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ36"
FT                   /protein_id="CAR25797.1"
FT                   /translation="MAVHHNQPILNPHFRKHWQERVKVHFDQAGKKASRRDTRIAKAAQ
FT                   IAPRPLDLLRPVVRAPTVKYNRKVRAGRGFTFQEVKAAGLTPTYARTVGIAVDHRRVNR
FT                   NQEIFDANVQRLKEYQSKLIVFPRNGKAPEANQVLSTAATFPIVQPATDVEARAVEDDG
FT                   KSAFRTLRLARSDKKFKGIREKRAKEKAEAEAEKKK"
FT   gene            complement(<670714..>671040)
FT                   /locus_tag="ZYRO0A08360g"
FT                   /old_locus_tag="ZYRO-ORF8987"
FT   CDS_pept        complement(670714..671040)
FT                   /locus_tag="ZYRO0A08360g"
FT                   /old_locus_tag="ZYRO-ORF8987"
FT                   /product="ZYRO0A08360p"
FT                   /note="highly similar to uniprot|P05318 Saccharomyces
FT                   cerevisiae YDL081C RPP1A Ribosomal protein P1 alpha a
FT                   component of the ribosomal stalk which is involved in the
FT                   interaction between translational elongation factors and
FT                   the ribosome accumulation of P1 in the cytoplasm is
FT                   regulated by phosphorylation and interaction with the P2
FT                   stalk component"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25798"
FT                   /db_xref="GOA:C5DQ37"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ37"
FT                   /protein_id="CAR25798.1"
FT                   /translation="MSVETALSYAALILADSEVEISSDKLLTLTSAANVPVEAIWGDIY
FT                   SKALEGQDLKELLVNFSVGPAAAGGAAAAGGAAAAEGAEAAEEKKEEEAKEESDDDMGF
FT                   GLFD"
FT   gene            complement(<671669..>673087)
FT                   /locus_tag="ZYRO0A08382g"
FT                   /old_locus_tag="ZYRO-ORF8983"
FT   CDS_pept        complement(671669..673087)
FT                   /locus_tag="ZYRO0A08382g"
FT                   /old_locus_tag="ZYRO-ORF8983"
FT                   /product="ZYRO0A08382p"
FT                   /note="similar to uniprot|P40210 Saccharomyces cerevisiae
FT                   YMR140W SIP5 Sip5p facilitates the interaction between the
FT                   Glc7p phosphatase and the Snf1p kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25799"
FT                   /db_xref="GOA:C5DQ38"
FT                   /db_xref="InterPro:IPR039301"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ38"
FT                   /protein_id="CAR25799.1"
FT                   /translation="MGNTFAKLDENENAFKGRSTSVGSGTMRPNNIAERRRGVSMGLSN
FT                   NVRSRANSTGSQLMYKKKSTRERDLIKESFAKQLVVRYDESVDGGYLAPHGCYTFEKLD
FT                   YDPSLVRSLITARKLAPFYIPLQDFDESWTRDELIKIVDGLPLHAAVNENPEEFEDIPI
FT                   GNLKRQNFDELIDKSLSKKEQRKQRSKIFKARLHRKRIMWQEQENVAFLEQKLESKREP
FT                   NPSKRNLALPSPDLNHTIYKKGIECPICFLYYPEPLNYSRCCLQPICTECFVQIKRGDP
FT                   HFPHEEVDPTKPVTSDDEKDPNLLISEPASCAYCATPNFGITYQPPTNRKTGIGGMPPG
FT                   SYKAPRDDEINVNDGSDSEEGPRTPSKSPEDPEVVTSDMIRPDWKAKLDKERLRLARRS
FT                   ANATAIHVSNQLVDPDHPSRRDSNTDSGPTPTTARSQRLVPNPMAELENQMVEQAIRLS
FT                   LVDEEERKSSQRHR"
FT   gene            complement(<673433..>674830)
FT                   /locus_tag="ZYRO0A08404g"
FT                   /old_locus_tag="ZYRO-ORF8980"
FT   CDS_pept        complement(673433..674830)
FT                   /locus_tag="ZYRO0A08404g"
FT                   /old_locus_tag="ZYRO-ORF8980"
FT                   /product="ZYRO0A08404p"
FT                   /note="weakly similar to uniprot|P18544 Saccharomyces
FT                   cerevisiae YOL140W ARG8 Acetylornithine aminotransferase
FT                   catalyzes the fourth step in the biosynthesis of the
FT                   arginine precursor ornithine"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08404g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25800"
FT                   /db_xref="GOA:C5DQ39"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ39"
FT                   /protein_id="CAR25800.1"
FT                   /translation="MTSHVFHSSIAKPKAIAKDGKGVFMTIEKNGKEHKQVLDAITGAA
FT                   VGSLGWGDPDVHKIMADAALHHTYSFPGYIVNEAAEELARFYIDKTPKGVFRSCLWTCS
FT                   GSESNENALKIVRQYQLERGRPEKLKIISREGAYHGFTLGAMSIGDGPRGIPFKDIMID
FT                   QENVCLKMPMFYPYRRMREGETVEQYAQRLLDSLEKMIIENDPNTVSVVCVETMSGSSI
FT                   GTPVPPKNYLKGIRDICNKYDLIFMVDEVMCGTGRINDGKLCCWENFLAPEDAPDIQTV
FT                   GKTLGSGYVTIAGVLVGPKIYDAFEKGSGVVVGAQTYHSHEFNCRVALQIQQKIFAQGL
FT                   TSNVFKMGNLMGAKLQKALLSDSSNIVGDVRGLGGFWTIELVKNKSTKEPFDQSLHIGS
FT                   RFADLALNNGANVMGLTGGNTKGEHWDIVVLGPAFIISEQEVELLCSKLEQTVKDLTKT
FT                   LQDEGLR"
FT   gene            complement(<675104..>676858)
FT                   /locus_tag="ZYRO0A08426g"
FT                   /old_locus_tag="ZYRO-ORF8978"
FT   CDS_pept        complement(675104..676858)
FT                   /locus_tag="ZYRO0A08426g"
FT                   /old_locus_tag="ZYRO-ORF8978"
FT                   /product="ZYRO0A08426p"
FT                   /note="similar to uniprot|Q07471 Saccharomyces cerevisiae
FT                   YDL080C THI3 Probable decarboxylase required for expression
FT                   of enzymes involved in thiamine biosynthesis may have a
FT                   role in catabolism of amino acids to long-chain and complex
FT                   alcohols"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25801"
FT                   /db_xref="GOA:C5DQ40"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ40"
FT                   /protein_id="CAR25801.1"
FT                   /translation="MYVDTTSMGPTITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKL
FT                   YGIEGLRWAGNTNELNAAYAADGYARLKGLGCIISTFGVGELSAINGIAGSYAEHVGLL
FT                   HVVGMPPTSAQTRQLLLHHTLGNGDYTVFHRMATEVSCHSAVIIDTELCAQEVDECIRN
FT                   AYIFQRPVYMGIPVNLVSMPVDSDRLNEPIDLSVPPNDTSKENEVIDQILTHFYKATNP
FT                   VIVADACVTRHRIEAETEELCRRTKFPLFVTPMGKGSVDEGLPQFGGVYTGSISSPSVR
FT                   EVVDFADCLIVIGCMLADFETTTFHFNYRANELVLLYPTSVKFKHATYPDLSIKPLLHS
FT                   LLANLQERQLSYQWQPRPRMVIPKLELPTTHPLRQEWVWNQISQWFMEGDVIITETGTS
FT                   AFGINQTNFPPHTLGISQALWGSVGYSLGACLGAAMAVDEKPRTHRVVLFVGDGAFQLT
FT                   AQELSTVIRWGLTPYIFIMNNQGYSVDRFLHSNASYYDIQQWNYSTLPSVFGAKDYESR
FT                   KIITVGDFQSMVNDPAFSVGDRIRILEIMLPPMDVPQALREKWIREEKRDQERRASVES
FT                   VKRLKLGP"
FT   gene            complement(<677122..>678225)
FT                   /locus_tag="ZYRO0A08448g"
FT                   /old_locus_tag="ZYRO-ORF8977"
FT   CDS_pept        complement(677122..678225)
FT                   /locus_tag="ZYRO0A08448g"
FT                   /old_locus_tag="ZYRO-ORF8977"
FT                   /product="ZYRO0A08448p"
FT                   /note="highly similar to uniprot|P38615 Saccharomyces
FT                   cerevisiae YMR139W RIM11 Protein kinase required for signal
FT                   transduction during entry into meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25802"
FT                   /db_xref="GOA:C5DQ41"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR039192"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ41"
FT                   /protein_id="CAR25802.1"
FT                   /translation="MNLELVTNTEVVHKQVYCGHPSGNNGENEPAEITYPTTEVVGHGS
FT                   FGVVFTTTIKETDEDVAIKKVLQDRRFKNRELEIMKLLKHPNIIDLKYYFYEKDSHGEV
FT                   YLNLILDYMPQSLYQRLRHFVHIPSAMPRLEIKCYMYQLFKSLNYLHNFALVCHRDIKP
FT                   QNLLVDPNTCALKICDFGSAKQLKPTEPNVSYICSRYYRAPELIFGATHYSNQIDVWSS
FT                   GCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSRQEICAMNPNYMEHKFPQIKPIPLS
FT                   RVFKKEDEQTVQFLADTLKYDPMERFNALQCLCSSYFDELRHAQGQLKQIVDSLQLLQF
FT                   EYDTELAHLTQDQLEAVRLKLQPTQIR"
FT   gene            complement(<678838..>679824)
FT                   /locus_tag="ZYRO0A08470g"
FT                   /old_locus_tag="ZYRO-ORF8975"
FT   CDS_pept        complement(678838..679824)
FT                   /locus_tag="ZYRO0A08470g"
FT                   /old_locus_tag="ZYRO-ORF8975"
FT                   /product="ZYRO0A08470p"
FT                   /note="similar to uniprot|P32419 Saccharomyces cerevisiae
FT                   YDL078C MDH3 Cytoplasmic malate dehydrogenase catalyzes
FT                   interconversion of malate and oxaloacetate involved in the
FT                   glyoxylate cycle"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25803"
FT                   /db_xref="GOA:C5DQ42"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ42"
FT                   /protein_id="CAR25803.1"
FT                   /translation="MKVAIVGASGGIGQPLSLLMKLNPLVTELSLYDIRLAPGVAQDLS
FT                   HISTNSVCQGFEKDDIARALQGAHVVIVPAGVPRKPGMTRDDLFKINASIVKGIVTSVA
FT                   QYAPEARLLIVSNPVNSTVPIAVETLKSMGKLQPGNVMGVTTLDCVRAETFLGEYLGRD
FT                   KTQVNQDVSVIGGHSGNTIVPVILNPKLRDGLKPHYQEFVHRVQFGGDEVVKAKAGAGS
FT                   ATLSMAFAGYRFADSILKSLAGEQVSGVPTFVYLPGINGGSEVQSKLGGVDYFALPVVF
FT                   SNGSVSKVDSSILSSLSSQEKKLVSESVRQLVGNIDKGKKFALGAKL"
FT   gene            complement(<679908..>680420)
FT                   /locus_tag="ZYRO0A08492g"
FT                   /old_locus_tag="ZYRO-ORF8974"
FT   CDS_pept        complement(679908..680420)
FT                   /locus_tag="ZYRO0A08492g"
FT                   /old_locus_tag="ZYRO-ORF8974"
FT                   /product="ZYRO0A08492p"
FT                   /note="similar to uniprot|P39110 Saccharomyces cerevisiae
FT                   YMR138W CIN4 GTP-binding protein involved in beta-tubulin
FT                   (Tub2p) folding isolated as mutant with increased
FT                   chromosome loss and sensitivity to benomyl"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25804"
FT                   /db_xref="GOA:C5DQ43"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ43"
FT                   /protein_id="CAR25804.1"
FT                   /translation="MGLLTIVKKQKLRDKEIRCLILGLDNAGKSTIVNQLLPQERRQHH
FT                   VSPTVGFAIHNVEMGPYNVSMWDVGGQTTLRPFWDNYYDTTDVLVWCIDVSSSHRLPES
FT                   LQELQPFLMGDSRVIIAFNKCDLLEDYQSELLQLQNQLPKVQFVPCSGRTGMGMRELCS
FT                   AIASCSI"
FT   gene            <680521..>681993
FT                   /locus_tag="ZYRO0A08514g"
FT                   /old_locus_tag="ZYRO-ORF8973"
FT   CDS_pept        680521..681993
FT                   /locus_tag="ZYRO0A08514g"
FT                   /old_locus_tag="ZYRO-ORF8973"
FT                   /product="ZYRO0A08514p"
FT                   /note="similar to uniprot|Q759M6 Ashbya gossypii ADR250C
FT                   ADR250Cp and weakly similar to YMR137C uniprot|P30620
FT                   Saccharomyces cerevisiae YMR137C PSO2 Required for a post-
FT                   incision step in the repair of DNA single and double-
FT                   strand breaks that result from interstrand crosslinks
FT                   produced by a variety of mono- and bi-functional psoralen
FT                   derivatives induced by UV-irradiation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25805"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011084"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ44"
FT                   /protein_id="CAR25805.1"
FT                   /translation="MGIKRQRTLAEFGISETRSLQIRNQQSSFGSSQDPIVVEEDEERV
FT                   QEVRCPLCNADITHLEIYMKEAHAQKCLDKAPEPKKPKTRPPLPGTKIVKLFSLQIVVD
FT                   GFAYDRHGDIEHYFLSHFHSDHYGGLKKSWTNGIIYASSITINLVRDKFKIDGSRLRPL
FT                   PMNEKIWITDKVSVVLLDANHCPGAVVFLFEEYDNDAVVKTVLHTGDFRANNKLIEEVK
FT                   RWTTRLDEVYLDTTYLIPGFHFPSQESVLEVTSNFAKDLVNRGFQSIFQNDQKSIVNYT
FT                   HQSPKLYKLLFLVGTYTIGKEKLAISLAQVLGTKIFIPAGTPRHRMISQYMEYFPSGLI
FT                   THDVKESCVHLVPLRILNSKDSIQSYFQNYSSIYEDVVGFIPTGWTFTSKWAKKPEFST
FT                   ILSRMDYCKEVLHNTQDALDINFVLKQFKKYQRFQVFKVPYSEHSSFKDLVNFGCSMDY
FT                   KTILATVNLHNIKEMNEWFATWQNMRNDSTFC"
FT   gene            complement(<682125..>683711)
FT                   /locus_tag="ZYRO0A08536g"
FT                   /old_locus_tag="ZYRO-ORF8972"
FT   CDS_pept        complement(682125..683711)
FT                   /locus_tag="ZYRO0A08536g"
FT                   /old_locus_tag="ZYRO-ORF8972"
FT                   /product="ZYRO0A08536p"
FT                   /note="weakly similar to uniprot|P40209 Saccharomyces
FT                   cerevisiae YMR136W GAT2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25806"
FT                   /db_xref="GOA:C5DQ45"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ45"
FT                   /protein_id="CAR25806.1"
FT                   /translation="MSAAKTTTMRALPTAEEAGSGSTEGGNVFGRTRHPVLSRSISTSA
FT                   KVPSVPYLLNISGETTTSATDEDPRSTLTPPASSTKMQFLSSQGYPGSGSSLEGSPLES
FT                   RTTGITTTGSALSSGRRRQSSMDSLMRAAATVENDNELNQLYQDKLSFIIELKNCISDE
FT                   IRNWPVVQDPEELSSTPTSSNSRILLDRVSNEQLSSLGNVVCRLKETVEELVELKSQTP
FT                   HIKENMASKLQRDLRVSTPQQQPRKVVLPPMESLTMNLPHQERTAFHGYRFPSGPTSPA
FT                   TAIPPQEQQRRQSQQQQQQQRQPQDPEQRHHQPPPPRPPPTQHQVISSWPSATQPSPTE
FT                   PSHRFTLSDPSAYVGRTTMPMIFKSSQPQQSQAQPQSIIPGKKNPKNLKFQKKRKKSLT
FT                   EVSLAAPQNYRRSLTQGLLIAENVRQTEQATTSCVHCKEGITPEWRRGPYGNRTLCNAC
FT                   GLFYRKLIKKFSTRDANILMRYKRQVNPEDRRVPSALDVPELFISQLENDPNLDSEFNT
FT                   IGGLVSNYKLG"
FT   gene            <684534..>685511
FT                   /locus_tag="ZYRO0A08558g"
FT                   /old_locus_tag="ZYRO-ORF8971"
FT   CDS_pept        684534..685511
FT                   /locus_tag="ZYRO0A08558g"
FT                   /old_locus_tag="ZYRO-ORF8971"
FT                   /product="ZYRO0A08558p"
FT                   /note="similar to uniprot|P40208 Saccharomyces cerevisiae
FT                   YMR135C GID8 Protein of unknown function involved in
FT                   proteasome-dependent catabolite inactivation of fructose-1
FT                   6-bisphosphatase contains LisH and CTLH domains like
FT                   Vid30p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08558g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25807"
FT                   /db_xref="GOA:C5DQ46"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ46"
FT                   /protein_id="CAR25807.1"
FT                   /translation="MTSSYERKSFSRDEWKENVGKNQLPASGEPSVPHLLLNYFVSMAF
FT                   EESSVRMARELGYISNNREAEEFNELYRVRERAHIISLIKSGRVAEAMERISEVFGTEV
FT                   LEDESGEEDLHFKLLLLNLTEMIREHRQAPPNGGEDSHEFILKLVEYSQQKLAMKAASS
FT                   KTHMQELELVMTLLLVPHDGEVNKLPRSLKGLYSLPLRAQVAEMVNRRLLKSMHSHVAE
FT                   GKYPDLVGGTGINSGSRYTGVLRVRPREDIAKELTTHRLGEIRDESNNPHNDGGDWAST
FT                   AKLLGGEDEGEQRFEARLIQVMKLWAWCENQLHGGDIGVPRVES"
FT   gene            complement(<685544..>686257)
FT                   /locus_tag="ZYRO0A08580g"
FT                   /old_locus_tag="ZYRO-ORF8970"
FT   CDS_pept        complement(685544..686257)
FT                   /locus_tag="ZYRO0A08580g"
FT                   /old_locus_tag="ZYRO-ORF8970"
FT                   /product="ZYRO0A08580p"
FT                   /note="similar to uniprot|P40207 Saccharomyces cerevisiae
FT                   YMR134W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25808"
FT                   /db_xref="GOA:C5DQ47"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ47"
FT                   /protein_id="CAR25808.1"
FT                   /translation="MVWIIDRYLELEAPLLHALARMPYVQNFIHDPISARITLFLMIMG
FT                   SIAIINELNMTRKMAQVTHETSEELNKGYIDESLKLHRLIVSDEYHSKEYLDEKSGIVI
FT                   EEFEDKEKFFAKPVHVAHLYVECQCIRTIESQPLLEKPLLFHLEFSPEEYENEKRPEFG
FT                   TRLRVLRKRLYHLFKDSHLFEELVTDRQKFAIGNNVRIFNSQNELLPVSTDDVQLCFLK
FT                   IETGDKIKCEFVLGE"
FT   gene            <687322..>687801
FT                   /locus_tag="ZYRO0A08602g"
FT   CDS_pept        687322..687801
FT                   /locus_tag="ZYRO0A08602g"
FT                   /product="ZYRO0A08602p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25809"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ48"
FT                   /protein_id="CAR25809.1"
FT                   /translation="MKFILPLAVVAPIAEAHLIQRDNIDPSSRSSVNTVYTFIGSGSSS
FT                   NVLQMQSSSSSPSETSDSARESSALSQLLHASTVSAPQSTEFSSASVTSSPSNMSASGS
FT                   SDASSKKHTGTNTGDKPSSSPSSSSTKSAASSGAANHLDVPIMAGGIAVAAIAML"
FT   gene            <688292..>688894
FT                   /locus_tag="ZYRO0A08624g"
FT                   /old_locus_tag="ZYRO-ORF8966"
FT   CDS_pept        688292..688894
FT                   /locus_tag="ZYRO0A08624g"
FT                   /old_locus_tag="ZYRO-ORF8966"
FT                   /product="ZYRO0A08624p"
FT                   /note="some similarities with uniprot|Q07988 Saccharomyces
FT                   cerevisiae YLR040C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25810"
FT                   /db_xref="GOA:C5DQ49"
FT                   /db_xref="InterPro:IPR000992"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ49"
FT                   /protein_id="CAR25810.1"
FT                   /translation="MVSCIHIAVNFFLFVGASAASSTITKGPDRVEVSKATDSASLRLD
FT                   AAEADMRFFSVFLSDFRVNMDSYTSYLGAHHKTMPQKVADYYHHVAELPQSADLEKDIA
FT                   ASFPFSQFRTFIADFPWYSTLLSSANESTMFLPEDFATEGASHGTKTTNVQPYSSSRST
FT                   SSLSSTKSHSHNGAMRGSDSSFPLQFFSIPLLVGMLL"
FT   gene            complement(<688899..>690134)
FT                   /locus_tag="ZYRO0A08646g"
FT                   /old_locus_tag="ZYRO-ORF8965"
FT   CDS_pept        complement(688899..690134)
FT                   /locus_tag="ZYRO0A08646g"
FT                   /old_locus_tag="ZYRO-ORF8965"
FT                   /product="ZYRO0A08646p"
FT                   /note="some similarities with uniprot|P32841 Saccharomyces
FT                   cerevisiae YMR133W REC114 Protein involved in early stages
FT                   of meiotic recombination"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25811"
FT                   /db_xref="GOA:C5DQ50"
FT                   /db_xref="InterPro:IPR004354"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ50"
FT                   /protein_id="CAR25811.1"
FT                   /translation="MDVEFSFPLKFYHAYLENIYAPQGLNASSRHLEKIKWRRFGPEAQ
FT                   MQFTVRREGNYTIVKVTRNGQALDYALVNSNEGRKLIQFCAKKPSISCKYMISSTHMRR
FT                   FQVAFDNDSDFSDATNKIIGLGLIVVRAHMPPVISQSAAPPQCSSQTPLQSMLSLLNQR
FT                   ATNDNAFPQSQLVPDMSMNVWEELGPLTRTDAIFTSTREPDSNLVQLQESSSLEKMVSE
FT                   EGVSGFPRFNDPIAAPSITTGNCLAVNPAIEILASQPYVKSTIENKGPKDPPSPPLEDR
FT                   ITLPKGLIKLAPAPLPILPTAPAPLVQFQVPQSPESAPHASATHSQIPIPASEPHSVHP
FT                   LASAAISPPNQEQNNETNGKLKKTEDNNTNATLPELKISKKLIKRKLKDKKFLKWVSKV
FT                   ESVLSEMVEKTS"
FT   gene            <690427..>691041
FT                   /locus_tag="ZYRO0A08668g"
FT                   /old_locus_tag="ZYRO-ORF8963"
FT   CDS_pept        690427..691041
FT                   /locus_tag="ZYRO0A08668g"
FT                   /old_locus_tag="ZYRO-ORF8963"
FT                   /product="ZYRO0A08668p"
FT                   /note="similar to uniprot|P40206 Saccharomyces cerevisiae
FT                   YMR132C JLP2 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08668g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25812"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="InterPro:IPR039730"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ51"
FT                   /protein_id="CAR25812.1"
FT                   /translation="MVYVYESKPIDTFDSHFIISGRDQFENDLLIKYGFREWGLIWFHT
FT                   DKYSSGHIYLKLLPHEKSLDDVPDEVLQDCLQLCKSNSIQGNKLGQCKIITTPWHNLRK
FT                   SGFMKPGEVSYKSTKNCKKFQCYERNQKLLNRLCKTRVELYDAEPLLHQAKKEKDACAL
FT                   LEYVEANHDKLIEEEKLRKREKKLKKRNPDKEDELVNDQSV"
FT   gene            <691253..>692803
FT                   /locus_tag="ZYRO0A08690g"
FT                   /old_locus_tag="ZYRO-ORF8962"
FT   CDS_pept        691253..692803
FT                   /locus_tag="ZYRO0A08690g"
FT                   /old_locus_tag="ZYRO-ORF8962"
FT                   /product="ZYRO0A08690p"
FT                   /note="highly similar to uniprot|Q04225 Saccharomyces
FT                   cerevisiae YMR131C RRB1 RiboSome Assembly 2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25813"
FT                   /db_xref="GOA:C5DQ52"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ52"
FT                   /protein_id="CAR25813.1"
FT                   /translation="MPKRSLEKDEEQRIVSARTEAQDAPKTVVDQEPDVQMDEYGDQYS
FT                   DDFESEDDIVELDGNDDVEEVEEGDDKDYIERKQKEAQEAIQRDQEESAEGKEIYLPHM
FT                   SRPLGPDEVLEADPSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQAT
FT                   RKKDNELMVLKLSQLSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTNRLKV
FT                   SPFATHGQEVLTATMCENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEG
FT                   YGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTEST
FT                   VFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVW
FT                   DLRQFSPANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEADD
FT                   DEIQQQTKEYKELQKIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGLNVWKTISV"
FT   gene            <693061..>696000
FT                   /locus_tag="ZYRO0A08712g"
FT                   /old_locus_tag="ZYRO-ORF8959"
FT   CDS_pept        693061..696000
FT                   /locus_tag="ZYRO0A08712g"
FT                   /old_locus_tag="ZYRO-ORF8959"
FT                   /product="ZYRO0A08712p"
FT                   /note="similar to uniprot|P40395 Saccharomyces cerevisiae
FT                   YLR039C RIC1 Subunit of a Golgi membrane exchange factor
FT                   (Ric1p-Rgp1p) that catalyzes nucleotide exchange on Ypt6p
FT                   involved in transcription of ribosomal protein genes and
FT                   ribosomal RNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25814"
FT                   /db_xref="GOA:C5DQ53"
FT                   /db_xref="InterPro:IPR009771"
FT                   /db_xref="InterPro:IPR040096"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ53"
FT                   /protein_id="CAR25814.1"
FT                   /translation="MSKHIWPLQPPQRLRISNSVVDLPEFNNNDILQVESLAQVNVLIM
FT                   LTPARVLVYNLRPMALVASHERTAESIAEFGPNKFLTRSDALEEAVEGLISEKEVENLI
FT                   GHQGKIIFHVATEKNALLTYQILKNCTNMTTFKNYGIPVVDLANLQDEDHQEYDENLDD
FT                   DTLTVFEKDKSSKIIQNGYCVTKETGFLQFLTSSQDSTDELPLKKLELRLKVVLKFDYP
FT                   VLDMIGFKRLSDTGDGKAEESLLLLFPHGLQQLTMIDFKLKDTYLVELIDGKKICIVRG
FT                   QVMVVSQNEDLSILVHRLGISSQIHKDTELRIGEKLLNCFEMNGIMVLAFTQTILYYDP
FT                   VSDKIGGKWNIGSQIKTCGKLNNSTLLIITQAGSIRFYSQYGNLLSCTASDDDDDQDND
FT                   ERQSYDHSSFTCVDKILVIVTHSGEYEMWDLWEELPQTFSDNRFQRGYALQNSNNDIAI
FT                   YSPPIDNSTNQQFLNTIKLPTSTINNCISLFRVNPTFKMSAVYVANKSVLLLQNMETNS
FT                   WYCFRDITIIDMHWLGSTYLVCHIKQEDCSHVVRCFRFPLQDLDTSEIEKYRLWEYELP
FT                   SHEQLQSFHVNTAVRYRLLRVKARDGEEVDKYGEKFFRTADIVLVTSHQIMVFAVISTM
FT                   HWSGLNVIKKFYEQMKVEIPLTDKINWITNHKEGLVYLSRNKLIKMDKEHGGWRSQVVL
FT                   RDVERIIDLVGEDIFLVKNQSVLIYKMDDLYESLPALLSSPIEDFYPVSLTPESATIHG
FT                   LHCIFQPNYVKLVIKHKIYLDQMIKAKIALGVSAQDIMMEYGSLRHYNFALEKILSTNI
FT                   LTNESLDGILPLVKLCDNEGTAISGHSNMLEIVSNSLRKIETKHWNILFSKLQMTPKDL
FT                   LAKCLEGKDAKILGVLLLVFLNYDKTDFMEDLRSGDDTVADVIEDQDMMLSVLRLLVTS
FT                   AANATDSTLAADSWDMCFQLMRLLKALDKGNNTNLVQEALQMINPSSSE"
FT   gene            <696226..>696477
FT                   /locus_tag="ZYRO0A08734g"
FT                   /old_locus_tag="ZYRO-ORF8957"
FT   CDS_pept        696226..696477
FT                   /locus_tag="ZYRO0A08734g"
FT                   /old_locus_tag="ZYRO-ORF8957"
FT                   /product="ZYRO0A08734p"
FT                   /note="highly similar to uniprot|Q01519 Saccharomyces
FT                   cerevisiae YLR038C COX12 Subunit VIb of cytochrome c
FT                   oxidase which is the terminal member of the mitochondrial
FT                   inner membrane electron transport chain required for
FT                   assembly of fully active cytochrome c oxidase but not
FT                   required for activity after assembly"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25815"
FT                   /db_xref="GOA:C5DQ54"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="InterPro:IPR036549"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ54"
FT                   /protein_id="CAR25815.1"
FT                   /translation="MSDEKGGSPLHTVGFDPRFPNQNQTRHCWQSYVDYHKCINMKGEE
FT                   FAPCKVFWRTYSSLCPVDWVDKWDEQREKGIFAGDIQP"
FT   gene            <696692..>696764
FT                   /locus_tag="ZYRO0A08756r"
FT                   /old_locus_tag="Zyro0A.tAla.TGC.15"
FT   tRNA            696692..696764
FT                   /locus_tag="ZYRO0A08756r"
FT                   /old_locus_tag="Zyro0A.tAla.TGC.15"
FT                   /note="tRNA-Ala (TGC) cove score=80.16"
FT   gene            complement(<696844..>697794)
FT                   /locus_tag="ZYRO0A08778g"
FT                   /old_locus_tag="ZYRO-ORF8956"
FT   CDS_pept        complement(696844..697794)
FT                   /locus_tag="ZYRO0A08778g"
FT                   /old_locus_tag="ZYRO-ORF8956"
FT                   /product="ZYRO0A08778p"
FT                   /note="similar to uniprot|Q04223 Saccharomyces cerevisiae
FT                   YMR130W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25816"
FT                   /db_xref="GOA:C5DQ55"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011949"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ55"
FT                   /protein_id="CAR25816.1"
FT                   /translation="MMMINRIYSCQRNTQRSMTWPKRIPIISWTSKLKPPVPKVITFDA
FT                   YNTLYSTTLPVMEQYGLVGKKYGIEADPQQLTQNFVTVFKELKSQHPNYGKTTRISAND
FT                   WWCLLIQGVFQPLSPPREMVDEILTRFEGSGAYEVLPDVKSFLQKVKSQYPDVIMGIVS
FT                   NTDPVMYTLLKNIGLYEYFQGHIYLSYDLEVKKPGKEIFERALEDIVSKNPELKRISNL
FT                   ASRCWHIGDEEVNDMLAASNVGWNGILLDRVNKYGYLSESFDKVQRTEHHLSIDKIDGN
FT                   SEEVYRQSISQTDIVQASERTFIASNFESLKRMLL"
FT   gene            <697861..>699711
FT                   /locus_tag="ZYRO0A08800g"
FT                   /old_locus_tag="ZYRO-ORF8954"
FT   CDS_pept        697861..699711
FT                   /locus_tag="ZYRO0A08800g"
FT                   /old_locus_tag="ZYRO-ORF8954"
FT                   /product="ZYRO0A08800p"
FT                   /note="some similarities with uniprot|Q07980 Saccharomyces
FT                   cerevisiae YLR035C MLH2 Protein required for DNA mismatch
FT                   repair in mitosis and meiosis involved in the repair of
FT                   mutational intermediates forms a complex with Pms1p and
FT                   Msh1p to repair mismatched DNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25817"
FT                   /db_xref="GOA:C5DQ56"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ56"
FT                   /protein_id="CAR25817.1"
FT                   /translation="MAIKPINFDASGKIGSSPLILSPISAVKELIDNAIDSGAKNIYID
FT                   IDEQTSGSEYIRVRDDGSGIDGAGRQLMCLNHTTSKISNPQEIAQVSTLGFRGQALFSL
FT                   ASLCKAEGSMEVITKCRKDAVGEKWFVNGDGSIKNSKITRIPYLQGTTLVLRRLFRGLR
FT                   ARHLKTSAKPFKQIGNCKTLIDHYSLDYRSIRFHFYLISLDKNGLVVKRELQQSHDTKF
FT                   TKIKILSSIARLRNTHGHTFFEELGILIDRSTKIDVILPRMLPHGGEEDLDNIKKPKKF
FT                   LSFNGRPLSLELSFGKSINELIDSLYHQLQLFDPMVWYLNLRSVMNIGDVNVEPEKNDV
FT                   LIKDVDRLLNNMRRALLGHIMQELKLNVHKESVLTAEEQTKANSHSQIRRPLTAGSMVS
FT                   NEGEWTHTLLDDDDINDPNSQDIQSSMDDLPSSLTYNYKETSFENEDLEISKELSISNP
FT                   FMTAKLRRAFKYGSHNRHTNQTHSLPTKRWTSSPTKSKENFMDGHRPMNKVRKLDKTEK
FT                   EQCEEFDLGHSLEDTTLVSAEEDQKDEEAILKRSIYNFSELTNNETTTEIFEIPHYSSC
FT                   TYDQEMNWLSRRGNPSEWLTTYIRSRSHGGVYTTEARANH"
FT   gene            complement(<699898..>703824)
FT                   /locus_tag="ZYRO0A08822g"
FT                   /old_locus_tag="ZYRO-ORF8953"
FT   CDS_pept        complement(699898..703824)
FT                   /locus_tag="ZYRO0A08822g"
FT                   /old_locus_tag="ZYRO-ORF8953"
FT                   /product="ZYRO0A08822p"
FT                   /note="similar to uniprot|P39685 Saccharomyces cerevisiae
FT                   YMR129W POM152 Nuclear pore membrane glycoprotein may be
FT                   involved in duplication of nuclear pores and nuclear pore
FT                   complexes during S-phase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25818"
FT                   /db_xref="GOA:C5DQ57"
FT                   /db_xref="InterPro:IPR037701"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ57"
FT                   /protein_id="CAR25818.1"
FT                   /translation="MDRDFFLNTTTPRGNHWIGATSSYRTQHNGTTSQRRFQPTTNSSK
FT                   EFKFGSLPEVKAKKPKQASDVDYSSLPLISPEVLDVSRQRFLALLVFIIIQSYKAYDLF
FT                   LLKTGLPVIGLLSTSSWFNFVSKYVVVDAMFLYFLPSFKIPKLTFQPWMVLLQILCMWV
FT                   ITFFISTEHDFSIFTGAITLLWRFNNKEVSLSGSSVSHRKLMDSSAHFKGAMTIKILPE
FT                   NTAMLNPSHESYCLPQDTDLLPEGHLKVPIRINSTSDIQLIQLEYRDLYTNGVELRNLT
FT                   AKDFKVVNDPSALLSKDHLSMKGIVDTNSIKYVELPLNEIGFYQIKRIIDSKNFSLKVY
FT                   HSHLIVSHCPVATIAGAGSFDRCIGDSDKLTIELQGVPPMRLGYSKAVGGQQHTYLDSN
FT                   LQPEYFESPLQSTPRHMFSSGDLEDLRWARTHPVTISLDLPVTQEGLYNYRIDRLVDGL
FT                   GNVMDFTKIPESVQKENGVSYNFKVHGIPRASLEEKFDPNSSTKKSISVNFEQIQDWGA
FT                   ATPYWAKISHVAADGGAQTFNVSTNSLSHGFQADLPGTYKLDSVGSTFCPGVVIGKSSV
FT                   LVTKPIPPELEVNSTPILDQCVGQVGLNFDLTFTGVPPFYYRAFIYRIENGKRKLYDTK
FT                   KYTSQGTRNQFSYSPTSEGNYEIVFDELSNQLFSEPISLIPREKYTFKTSMRVKPSAVF
FT                   KNINEKKLCLGDQTKAPVKLNGEPPFYVKYDIFETSSNKRKTYEVKDIQSNDYDINLPK
FT                   FDLGGDYIMSLVSVKDSSGCLVGLSEPDVMIKVRRDVPSASFNLLENANSIKIKQGSLA
FT                   EIPIKLAGEAPFTVKFQHLNHEGEVLGVYESRFNSNYKPSLKVSKEGSYKLLEMHDSYC
FT                   SGKIDNENFQFKVSFLDKPNFSVIENAKTNKLSAITFSKEQVCQGRESTIDLSLSGSPP
FT                   FILRYDIIAPNGYTSSDSIQVATKYAAIKLPNQEPGEYTAVINALFDANYGEDDFARAG
FT                   SPYEEVFVKQTVNPTPYVTFADMGKTYRTCSINVQEDTLSLEPIKLKFVQGVAPFSVTF
FT                   SIYHESKGRSDQFTLEDVDPANFPYHKLYENLKLGNHVVTIEKVVDANGCTNDLIATQN
FT                   NHVLISITDVPKIHLLDPTAEYCVGDYVAYQLNGVAPFSIRYEFNQKQLKLKEYTSQFV
FT                   RIASEPGIISIASIEDSISQCVVNFTTPSMKKEFEKLSLLVHPLPSVTVSRGKNIIEDI
FT                   HEGDQAEIIFTFEGNPPFSLTYVRTEEAEGSKGRGIPQVVETHKVTDIYAYEYRVVTSL
FT                   QGTYQAIEVSDAFCFAKNDAYFSS"
FT   gene            <704383..>705783
FT                   /locus_tag="ZYRO0A08844g"
FT                   /old_locus_tag="ZYRO-ORF8951"
FT   CDS_pept        704383..705783
FT                   /locus_tag="ZYRO0A08844g"
FT                   /old_locus_tag="ZYRO-ORF8951"
FT                   /product="ZYRO0A08844p"
FT                   /note="highly similar to uniprot|Q12078 Saccharomyces
FT                   cerevisiae YLR034C SMF3 Putative metal transporter Nramp
FT                   homolog homolog of SMF1 and SMF2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25819"
FT                   /db_xref="GOA:C5DQ58"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ58"
FT                   /protein_id="CAR25819.1"
FT                   /translation="MSGTLQAISKFVKFIGPGILVSVAYMDPGNYSTSVSGGAQFKYVL
FT                   LSSVFISNLFAVVLQCLCVKLGTVTGHDLAENCRRHLPRRLNLTLYFFAELAIIATDLA
FT                   EVVGTAIALEILFGIPLTWGVVLTVLDVLAILMFYSPDVGSMKKTRIFEIFVSLLVVGT
FT                   VTCFILELFKISVPNKVELFRGFMPSTIIFKDQQALYISLGILGATVMPHSLYLGSSLV
FT                   KPRLQDYDIKHYGKVQDRPSLRAINYSLNYSYAELIISLFLIATFVNSAILIVAGATLY
FT                   GQPEAADADLLSIYRLLVQYISPAAGLIFAWAMIFSGQSAGIICTLAGQVVSEGFLQWS
FT                   LPPWAIRICTRMMAVVPCLIVTLTMGQHGISDILNFSQVVLSLILPIVSAPLIYFTANR
FT                   KLMTVPKSVDERQEPGENTALISNKEEYVDFTNSTWLTATSVIIWALIGSLNCYLVISF
FT                   LLGADVHF"
FT   gene            complement(<705859..>707478)
FT                   /locus_tag="ZYRO0A08866g"
FT                   /old_locus_tag="Zyro0A.mRNA.4606.m"
FT   CDS_pept        complement(join(705859..707266,707339..707478))
FT                   /locus_tag="ZYRO0A08866g"
FT                   /old_locus_tag="Zyro0A.mRNA.4606.m"
FT                   /product="ZYRO0A08866p"
FT                   /note="similar to uniprot|Q07979 Saccharomyces cerevisiae
FT                   YLR033W RSC58"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25820"
FT                   /db_xref="GOA:C5DQ59"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ59"
FT                   /protein_id="CAR25820.1"
FT                   /translation="MAFRHELKKQSSSTISKNDNKELIVHTPPKMTEFSEVLSSIHAIL
FT                   KVASSKCKVLDESFPAKFFDPNPDKIFDSYYKFIKNRSNNEGIIKNEDKLAMTTISQQF
FT                   ETGEYSAERGGFYRLYHDINLVCMMLIHYYPQGTRNYQMVDKFSKFATELLLRECYRVG
FT                   VSLMQIDPEEYASKPEEKTELDRIVARDFIKISTNYKVPIAKTYHIKTKESELFSSIIG
FT                   KSSLDRRPQELPNSNFEINKIILQSNMCEDAPRLGFVAANTSNVPDPTLPPTEMMTRFL
FT                   HPNWYALPTTMWLEYGDYKSWVPSFNENGTVIDSTTKGIIWLERVGYMEAFSNGNEEKE
FT                   NEKEEEQNDKTEKKEESEADDSESKEPETTKPAEEDDASKDVPSENGKPQEVSDSEPPV
FT                   IKLQNLLQWSPANSLDEESISSFKEGSQSQLISNTLLQIQKMRKTRIKNKITKPSVEET
FT                   RLYNKTRRLMKEVILAKQTSGLPMNHCRSFPVLQANYNGSVPVVRTQPTRKRKHKRV"
FT   gene            complement(<707590..>711390)
FT                   /locus_tag="ZYRO0A08888g"
FT                   /old_locus_tag="ZYRO-ORF8948"
FT   CDS_pept        complement(707590..711390)
FT                   /locus_tag="ZYRO0A08888g"
FT                   /old_locus_tag="ZYRO-ORF8948"
FT                   /product="ZYRO0A08888p"
FT                   /note="similar to uniprot|Q04217 Saccharomyces cerevisiae
FT                   YMR128W ECM16 Essential DEAH-box ATP-dependent RNA helicase
FT                   specific to the U3 snoRNP predominantly nucleolar in
FT                   distribution required for 18S rRNA synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25821"
FT                   /db_xref="GOA:C5DQ60"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ60"
FT                   /protein_id="CAR25821.1"
FT                   /translation="MGTYRKRFNEKARAGQIAKQDELKKIRNKQFLRAAEDAEDAEDAE
FT                   EVPEASKESQGPDTNAEILPPMSQEEKALKKRKLQELFTPKETKVSRLKRKRLDKFIEH
FT                   QLRKEEKKDIMNKLQDYKIDTSLLTSSKKLGHGKQTKKEEFEEALSLERQGRGDEDTKE
FT                   ILYEEHDQKDWFQDHPEDAQQDESEKSGDEDEGEGEGEERKSAFVDFRPAQGTGMGFGF
FT                   ANAKVVHKHKAPKKKYHWRTLVEMEEKRKHGIEDEMDFASSGSDSEDKSSEEDSGDEDS
FT                   GADDEEEVQEHAEVDKEENAEVSDSSEEHQEESSDGESESSEPVNPEELAAERQTTADT
FT                   FKEWANEQIREMDGGNVDVEMPSLDFKYEPIVREEDLDDGLGSEDVPIDESSKRKAFYV
FT                   PVTRPEEIQAVRMQLPVFGEEHKIMEAIHHNDVVIVCGETGSGKTTQVPQFMYESGFGS
FT                   PESPDHPGMIGVTQPRRVATVAMANRISNELGDHSDKVAYQIRFDSSVKDDTRLKFMTD
FT                   GVLLREMMHDFKLSNYSSIIIDEAHERNINTDILIGMLSRCVKLRAREHAKNPEQNKKL
FT                   KLVIMSATLRVADFSENLSLFSTPPPVLNVEARQFPVSVHFNRRTPYNYVDEAFKKTCK
FT                   IHQRLPPGAILVFLTGQQEINHMVKKLRKEFPFPKDTNNIGRKDMQSSSSNVKVSSKNV
FT                   DLEAEDIDLSVKVVDEDNMGYIEGDRGEDEEEEEEEEGFEETLEENQTPNDPLYVLPLY
FT                   SLLSTKEQMKIFKEPPAGSRLCVVATNVAETSLTIPGVRYVVDCGRSKERTYNESNGVQ
FT                   SFEINWISKASADQRSGRAGRTGPGHCYRIYSSAVFEEDFEQFSRPEVLRMPVESVVLQ
FT                   MKSMAIQNVINFPFPTPPDPRTLSKAVKLLQYLGALDSREKITEDGKTMSLFPLSPRYS
FT                   KILLVSTEHNCLPYAISIVSALSVGDPFLKEHEIGLDFENSDSEEEDSDQKKLLRQRYY
FT                   KSKAKFSKLDKQSDVFRLLSVVSALDFIPEKEKASFMRQNFLRAKFLEEIAKLRKQLTY
FT                   IIKSNTTQENVAARVVDQDLKSDLPTELQLKMLKQMICAGFVDQVAIRADYLFPEDVKL
FT                   TNKMTIINIPYVNVLAPKSPEMEENFVYIHPTSVLSNSGESPPKFLVFHSLHQGNSSRT
FT                   RMNTLCDIKSTPLANIAGKGSLLTYSKPLTGKGLNTITVSHKERYCYVVPRFGSSVDSD
FT                   LSISWDLNPIAVHQVKENGQWIVKKFITNKNFEEERNKHNQ"
FT   gene            <711674..>712612
FT                   /locus_tag="ZYRO0A08910g"
FT                   /old_locus_tag="ZYRO-ORF8946"
FT   CDS_pept        711674..712612
FT                   /locus_tag="ZYRO0A08910g"
FT                   /old_locus_tag="ZYRO-ORF8946"
FT                   /product="ZYRO0A08910p"
FT                   /note="similar to uniprot|P40963 Saccharomyces cerevisiae
FT                   YMR127C SAS2 Histone acetyltransferase (HAT) catalytic
FT                   subunit of the SAS complex (Sas2p-Sas4p-Sas5p) which
FT                   acetylates free histones and nucleosomes and regulates
FT                   transcriptional silencing member of the
FT                   MYSTacetyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08910g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25822"
FT                   /db_xref="GOA:C5DQ61"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040706"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ61"
FT                   /protein_id="CAR25822.1"
FT                   /translation="MSHDGEGLYGILNERNIKEVQFGVDKRFPTWYGSNVYFDPESRAL
FT                   GYLEKNGSDGLSGSNGTNGHNKGDVQFWLDTLYVCEYCFKYTDNEEDLAGHAKHCRFQK
FT                   HSPGKIKYKSPNYTIKRVKGTKHRLFCQCLCLFTKLFLDNKSMYFKVDHYEFYIVYETS
FT                   STKPMGFFSKDTVSYYQNNLACVLVFPPYQRRQLGTFLLDFSYKISKSEGLISGPEFPL
FT                   SPFGLIGYVKYWSLKICWEFSEGELANMEKITLENISSVTGFRISDIITALKYLGCLGE
FT                   SDEIYLSILRKKLNRHSCEALVEDEYLLLDD"
FT   gene            complement(<712694..>716260)
FT                   /locus_tag="ZYRO0A08932g"
FT                   /old_locus_tag="ZYRO-ORF8945"
FT   CDS_pept        complement(712694..716260)
FT                   /locus_tag="ZYRO0A08932g"
FT                   /old_locus_tag="ZYRO-ORF8945"
FT                   /product="ZYRO0A08932p"
FT                   /note="similar to uniprot|P32849 Saccharomyces cerevisiae
FT                   YLR032W RAD5 Single-stranded DNA-dependent ATPase involved
FT                   in postreplication repair contains RING finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25823"
FT                   /db_xref="GOA:C5DQ62"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ62"
FT                   /protein_id="CAR25823.1"
FT                   /translation="MADERERYFKDEFDSSQEKERHEFKLNGGSFLFGSNGQEPVEPAA
FT                   PIVPSESGLHTSAGSDSQSQNDLQDETLQDESLQEEFEPASNELQSPDYISQIRQIIPG
FT                   MNLDVARGLVEKYRGEGDVVSKAISEYFEEGLIVEHEKPRNSSSPTAGGNEGAESNSNG
FT                   NSRNGSLVGQPLTREKRRKEVTPRPIKRLKSEIEWRKFIGSLQVNAMATRPTLRPLKYG
FT                   TELEILKSSGGLPTSKLYNTNGRKKVSMASFVKIFDTQQNREIGRLPEDVAQIVYPLIN
FT                   TDDVVFEATMVFCENKRLSIGDSFVLQLDCFLTSSIFDEDQNKELTPSRSARWGSNSSM
FT                   VETEEELQSRSKKVGLLSLFDRLRLRTVDDKADDASKSSANSEEDGVEVIDLDDDDNDG
FT                   DEKLEDIVAREEDDARRFSSQEEGVMNLNQLKVFYKATQSSDSLKTLPETEPPSTTINL
FT                   TLRKYQRQGLTWMLRREHEFEKAADSQGFQNVNGNMMNPLWKCFKWPKDMSWTAQRMED
FT                   HTEVDLGKFFYANLHTGEFCLEKPILKTMMKGGVLSDEMGLGKTISALSLIFTSPYDSS
FT                   LVDKHLFMDGNEDENLSPPSSQSSKKPYAMKTTLVIVPTSLLSQWHSEFTKFNNSPDLY
FT                   CEIYYGGNVSSLKTLLTKTKNPPTVVLTTYGIVQNEWTRILKMDRRDADMDSTTGLFSL
FT                   KFYRVILDEGHVIRNRTTSTSKAVMEISSMCRWVLTGTPIINRLDDLYSIVKFLKLEPW
FT                   AQISYWKMFVSDPFERKDYRQAFDVVNAILEPVFLRRTKQMQDADGRPLVELPPKEVVV
FT                   EKLTFNEAQNTIYKHYLEEAETSVKKGLARGDLLKKYSTILVHILRLRQICCDPKLLGA
FT                   QDENDEDLSKSNQLLKESVDVNKVYQKVGLNESSNRLDSGRLNTIKSRIQEKYPTADSL
FT                   KTLECSICTADPIELHKVLFTECCHSFCEECLKEYLEFQKQKELELKCPNCREPVNKNY
FT                   FFTLMLKDGESPQVVPLREVAKSAKIEALLKHCSILQETSPGEQIVVFSQFSSFLDILE
FT                   TELANTFLGNGVKVYKFDGRLNLKERAAVLENFSTKDFDNQKVLLMSLKTGGVGLNLTC
FT                   ASYAFMMDPWWSPSMEDQAIDRIHRIGQINQVKVTRFIVENSIEEKMLKIQERKRTIGE
FT                   AMDADEDERRKRRIDEIQMLFE"
FT   gene            <717007..>718056
FT                   /locus_tag="ZYRO0A08954g"
FT                   /old_locus_tag="ZYRO-ORF8943"
FT   CDS_pept        717007..718056
FT                   /locus_tag="ZYRO0A08954g"
FT                   /old_locus_tag="ZYRO-ORF8943"
FT                   /product="ZYRO0A08954p"
FT                   /note="similar to uniprot|Q04216 Saccharomyces cerevisiae
FT                   YMR126C DLT1 Protein of unknown function deletion causes
FT                   sensitivity to thermal stress"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25824"
FT                   /db_xref="GOA:C5DQ63"
FT                   /db_xref="InterPro:IPR038869"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DQ63"
FT                   /protein_id="CAR25824.1"
FT                   /translation="MPIIDFEIWKLWLFRSIKAIVIIFLVGFSIVLPVDSIVQAAESSN
FT                   TALNTFIVVGALVAFGLVSIIIIVGRIIFCRSCIQDIPRRYLPITPNDLPHRGSRKMIM
FT                   ENMEKSKELSILFKKPKEPVIHAGLEPPSRCDDPRYEKLFPDYLNYRSCIKSLSDRLKY
FT                   QGIFLNNMNIDMKLGETFADVVSNQFTRNTRNKTQIDNSKKFIDLYETIRYSGREVTRQ
FT                   QFIDFVSLAIYFVEVSLTRDDRSPALGELNTGSQLQFNFDNGTWENDVSNYSFPNDAYS
FT                   NGADYYYPESINYLKRTNSTSTVARKVPSFVPTNPEEEHKMALDPQDPVSHKPSMHTLA
FT                   DSFKYVTHR"
FT   gene            complement(<718141..>721059)
FT                   /locus_tag="ZYRO0A08976g"
FT                   /old_locus_tag="Zyro0A.mRNA.4587.m"
FT   CDS_pept        complement(join(718141..720719,721035..721059))
FT                   /locus_tag="ZYRO0A08976g"
FT                   /old_locus_tag="Zyro0A.mRNA.4587.m"
FT                   /product="ZYRO0A08976p"
FT                   /note="similar to uniprot|P34160 Saccharomyces cerevisiae
FT                   YMR125W STO1 Large subunit of the nuclear mRNA cap-binding
FT                   protein complex interacts with Npl3p to carry poly(A) mRNA
FT                   from the nucleus to the cytoplasm also involved in mRNA
FT                   degradation in the nucleus orthologous to mammalian CBP80"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25825"
FT                   /db_xref="GOA:C5DQ64"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR015172"
FT                   /db_xref="InterPro:IPR015174"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027159"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ64"
FT                   /protein_id="CAR25825.1"
FT                   /translation="MFSKKRRADFEEDDGYRDFRPRMPKRQRVPPVVQLCKEMMPDIRT
FT                   IGESVKAFEEDIKFLSDAIVNEYGHEDYFNDALLSTFRAVVLEQPQKQPAIALLTMVVN
FT                   ASNEVAAKSVINFFFEELQKLCDASTDENYEAVSNETGIWNKFKLVLRFLSLLSPIVST
FT                   DDLLAIYKSVFQLAVDLNRDAGPESRNALSEALYTNTLLDLPYLFFFNRSDDVLQSKVE
FT                   ELFNFVETEYQVKTSDVNLLKQFNKNAPYQTTELIHVVLPNVKKVLANNMEQLFQLFPD
FT                   WQYLLSEQPSERHGFNEPLKLPPLGQLKPFSSLDRGVGSVDSMWREPRYTFHVYLPNSV
FT                   GDFETVVPITSYAGQLFKDIIIDIVESLEFNRKEVAKQVITLDLFFKQGIFAEPGESIA
FT                   QLAATYEENPLASTFKIEDIAIETILELVFKLPDVSQPFAYFYTLLVEICQNSPKAIAP
FT                   VFGRAFRFFYNNLDNLDLELKLRYLDWFSIQMSNFNFSWKWNEWENDSIRFGSTFYNAK
FT                   MNFAKNLIRKELRLTSNTLDVEDSLPDEFKKYLDSSYVPREQLVEYYQSLFVGESFQVN
FT                   PNDIKKNDLYFRHESFPAHQQVRQLLDYVHKQNDSREVSELETIINSIRQEYGDIIANF
FT                   EKFIIVVLIQTVVHSGSRSLSHANKYIGDLKDDLTHILGQMEMDDSTKQFTIVEAVLRF
FT                   WNSNSQNGFLIADTFKFAGFLSPLSIFQFSFNEEKSGGSTKNYGLVDGTSIESTFRNLT
FT                   QHIGDQECLTFIFEKLINITNECITQLALQPEEAVNIPDVNDTNIEIDWQNDLPKLDLL
FT                   WKYETTMSFFKSILRKYVDEYRTSEERLRDFVETTISHTPTKRQLLLWIDETHKL"
FT   gene            complement(<721298..>724213)
FT                   /locus_tag="ZYRO0A08998g"
FT                   /old_locus_tag="ZYRO-ORF8940"
FT   CDS_pept        complement(721298..724213)
FT                   /locus_tag="ZYRO0A08998g"
FT                   /old_locus_tag="ZYRO-ORF8940"
FT                   /product="ZYRO0A08998p"
FT                   /note="weakly similar to uniprot|P39523 Saccharomyces
FT                   cerevisiae YMR124W Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery cytoplasm bud and bud neck"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25826"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ65"
FT                   /protein_id="CAR25826.1"
FT                   /translation="MVRSRGLLRSELLKTDGSIDVNNIDVNDDDDDGIDVNRARQQREP
FT                   IPMGFGYVPQMAQVGQGKIPGLPPGVPAGTPMGSPSPMPNPHPNPQQNMGFRQNGPMRM
FT                   QNGMPYRGGPPMGGMPPNGMPPNGMPPVGVPQQPQQPQRRAYSLNNVWRQRPRISHKNN
FT                   KKRNSGGNEDDEVIMQESEDDVTFNDIRTMGKSEKYGFGADTAPIIPTLITKSHNNMNN
FT                   TEYRKAMTAQRKNAMNAMAKQRQPGPVGAVPAAGADPRAMSLQGYGRGSPFNPMGPGGG
FT                   PGVYPGTSPGFGGNPRTPSGMPRSMSMMTTQSRPSVGYMRQHQQNMFAARDNEPPPGGR
FT                   ANSLINIPSSSSVGPSPNTAAPVSGVPGVAGPSSGSNPTPAPRRNLRLGINPPMPQSLD
FT                   PGPLTPDNDQSKNVTSPLKNQLVAPSPGSPPINGGQLNVLQLSQPQQNELKEREKQLAD
FT                   RERELKEKEEMVKKREAEVQEELKQKEQELERERLRKDQEELQKQEQRELMGPSEENQQ
FT                   QMKTEYSSNVPLQNQSLPPQDLSRCNTYDGLDLQPSSTLERGLDGLSLNDKLESESVAD
FT                   NKESENGRERKTEKKNNKNPSSYNNRESTISFGDLQNNRISTSTFMSALSDSPQKKNKP
FT                   ATGLYQLENTGNNEFFTAEEFFGHDANTNQGNSTLDISNMSPAASNTTATLNSNARMSG
FT                   QLHSDTPVDRSRNGPNRKPLSKIPSASSRENESGSGARTFSRNSVSNVSMGSFLGSNDD
FT                   TFDFKHANTDRNPSVKSVPSGKVTKGSSVKQVSEQNPESLKEEDGEMEHFSFDNTMGEP
FT                   YEPMFAHGSELIPPKIRFKTIIVSSDQLNILKENKSLMSEISIISAELADSIKRECILE
FT                   EKLQTISTNRDGNDKPLSGESLLDYEAQLRTKSEKIVDLLKQLNEQRLRRLIAEEQIFL
FT                   SENGAKPTSTDLVHKITDLESQLTAKDYEISRLREYQPQPF"
FT   gene            complement(<724485..>724880)
FT                   /locus_tag="ZYRO0A09020g"
FT                   /old_locus_tag="ZYRO-ORF8938"
FT   CDS_pept        complement(724485..724880)
FT                   /locus_tag="ZYRO0A09020g"
FT                   /old_locus_tag="ZYRO-ORF8938"
FT                   /product="ZYRO0A09020p"
FT                   /note="similar to uniprot|Q03880 Saccharomyces cerevisiae
FT                   YMR123W PKR1 Protein of unknown function overproduction
FT                   confers resistance to Pichia farinosa killer toxin"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25827"
FT                   /db_xref="GOA:C5DQ66"
FT                   /db_xref="InterPro:IPR013945"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ66"
FT                   /protein_id="CAR25827.1"
FT                   /translation="MSFFQNLWGSIFEPGTNPQLLIATHLSFTSLILVLVWLCYETRNV
FT                   HFFALLTIAAILWALVTWFINELKHQPLRDNDQLAKDNGARAEEEQEDKKEKNTNNNKK
FT                   ANQESRTTGTTAAASSANTRRTKSRKT"
FT   gene            complement(<725340..>725696)
FT                   /locus_tag="ZYRO0A09042g"
FT                   /old_locus_tag="ZYRO-ORF8936"
FT   CDS_pept        complement(725340..725696)
FT                   /locus_tag="ZYRO0A09042g"
FT                   /old_locus_tag="ZYRO-ORF8936"
FT                   /product="ZYRO0A09042p"
FT                   /note="some similarities with uniprot|Q3E842 Saccharomyces
FT                   cerevisiae YMR122W-A"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09042g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25828"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ67"
FT                   /protein_id="CAR25828.1"
FT                   /translation="MSLNSSLNNSNLSNSTSGIGSNLTSNLTSNLTSNSSSITTNSRLV
FT                   HSNVVAPSSVTAGGLSGFNTSSGSLSSATPTVSDGSKIKNGAGAGLVANPLSWKYGAAL
FT                   GAVIVGSFVLGSGL"
FT   gene            <727755..>727845
FT                   /locus_tag="ZYRO0A09064r"
FT                   /old_locus_tag="Zyro0A.tPhe.GAA.16"
FT   tRNA            join(727755..727791,727810..727845)
FT                   /locus_tag="ZYRO0A09064r"
FT                   /old_locus_tag="Zyro0A.tPhe.GAA.16"
FT                   /note="tRNA-Phe (GAA) cove"
FT   gene            complement(<728275..>729615)
FT                   /locus_tag="ZYRO0A09086g"
FT                   /old_locus_tag="ZYRO-ORF8934"
FT   CDS_pept        complement(728275..729615)
FT                   /locus_tag="ZYRO0A09086g"
FT                   /old_locus_tag="ZYRO-ORF8934"
FT                   /product="ZYRO0A09086p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25829"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ68"
FT                   /protein_id="CAR25829.1"
FT                   /translation="MYFKPQLVLALLALTQARETTILAPNAAPSASGASVAAPSFPGAA
FT                   NNSVPAAGGGANGTSLSPNGTSFSPNGTNASPGYANNTAPSSSVAAGPAGSNPLNAVGA
FT                   GGSGTGSQGSGSGGSPGGGSGGGSGGGSGAESSPAAQSGAGSGSQGSSGSGSSSHSSAE
FT                   GANSQSESSSSSGGGSSVAQAGSQGTDEDGNQSSSQSETNSGPGGSSSDSDSSSEPASS
FT                   ASPSSSSGGSTGSSAAPPSAASSAAPIGSAPASGSSAPNPSGAHPTIAVASPSASQGGF
FT                   SNNTAPSSPAAAVASPSLNGTNAAPAASVPAASAPAASAPAASAPANNATAPTDASPAP
FT                   ADDSSAPAASAPAASAPANNATVPTGVSSAPADASSAPADASAAPTDAASAPAASAPAA
FT                   SAAPSAVPSQAAPGNSTGSNSGLLRRSLLKRAETAIKADQFNLTGVN"
FT   gene            <731224..>731838
FT                   /locus_tag="ZYRO0A09108g"
FT                   /old_locus_tag="ZYRO-ORF8927"
FT   CDS_pept        731224..731838
FT                   /locus_tag="ZYRO0A09108g"
FT                   /old_locus_tag="ZYRO-ORF8927"
FT                   /product="ZYRO0A09108p"
FT                   /note="highly similar to uniprot|P54780 Saccharomyces
FT                   cerevisiae RPL15B and to uniprot|P05748 Saccharomyces
FT                   cerevisiae YLR029C RPL15A"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25830"
FT                   /db_xref="GOA:C5DQ69"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR020925"
FT                   /db_xref="InterPro:IPR024794"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ69"
FT                   /protein_id="CAR25830.1"
FT                   /translation="MGAYKYLEELQRKKQSDALRFLQRIRVWEYRQKNVVHRASRPSRP
FT                   DKARRLGYKAKQGFVIYRIRVRRGNRKRPVPKGATYGKPTNMGVNELKYQRAMRATAEE
FT                   RVARRASNLRVLNSYWVNQDSTYKYFEVILVDPFHKAIRRDAHYNWICNPVHKHREARG
FT                   LTATGKRSRGINKGHRYNNSQSGRRKIWKRHNTLSLWRYRK"
FT   gene            <732139..>733920
FT                   /locus_tag="ZYRO0A09130g"
FT                   /old_locus_tag="ZYRO-ORF8925"
FT   CDS_pept        732139..733920
FT                   /locus_tag="ZYRO0A09130g"
FT                   /old_locus_tag="ZYRO-ORF8925"
FT                   /product="ZYRO0A09130p"
FT                   /note="highly similar to uniprot|P38009 Saccharomyces
FT                   cerevisiae YMR120C ADE17 Enzyme of 'de novo' purine
FT                   biosynthesis containing both 5-aminoimidazole-4-
FT                   carboxamide ribonucleotide transformylase and inosine
FT                   monophosphate cyclohydrolase activities isozyme of Ade16p
FT                   ade16 ade17 mutants require adenine and histidine"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25831"
FT                   /db_xref="GOA:C5DQ70"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024050"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ70"
FT                   /protein_id="CAR25831.1"
FT                   /translation="MGDYESTAILSVYDKTGLLDLAKGLSEANVRILASGGTARMVREA
FT                   GFPVDDVSSITHAPEMLGGRVKTLHPAIHGGILARNLEQDEEDLQKQHIDKVDFVVCNL
FT                   YPFKETVAKVGVTVSEAVEEVDIGGVTLLRAAAKNHARVTILSDPHDYPAFLSELKKGN
FT                   GQVSQELRNHLALKAFEHTADYDNAISDFFRKQYSEGKSQLPLRYGANPHQKPAQAFVT
FT                   QQEELPFKVLCGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVGLPLS
FT                   DVEKQVYFVSDIENLSPLACAYARARGADRMSSFGDYIALSNIVDVPTAKIISREVSDG
FT                   IIAPGFEEEALAILKKKKGGKYCVLQIDPNFVPEPLETKQVYGVSLQQKRNDAIINKSS
FT                   FREIVSANKNLTEQAVIDLTVATIALKYTQSNSVCYARNGMVVGLGAGQQSRIHCTRLA
FT                   GDKVDNWWFRQHPRVLSIKWAKGVKRPEKSNAIDLFVTGQIPTEEPEKSDYESKFEQIP
FT                   TPFTEEERKDWSSKLTNVSLSSDAFFPFPDNVYRAVRSGVKFIAAPSGSVMDKAVFSAA
FT                   DSFQVVYVENPIRLFHH"
FT   gene            complement(<734930..>736831)
FT                   /locus_tag="ZYRO0A09152g"
FT                   /old_locus_tag="ZYRO-ORF8921"
FT   CDS_pept        complement(734930..736831)
FT                   /locus_tag="ZYRO0A09152g"
FT                   /old_locus_tag="ZYRO-ORF8921"
FT                   /product="ZYRO0A09152p"
FT                   /note="similar to uniprot|P54074 Saccharomyces cerevisiae
FT                   YMR119W ASI1 Putative integral membrane E3 ubiquitin ligase
FT                   genetic interactions suggest a role in negative regulation
FT                   of amino acid uptake"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25832"
FT                   /db_xref="GOA:C5DQ71"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ71"
FT                   /protein_id="CAR25832.1"
FT                   /translation="MNATSAIGSNVLESFSYLNQTAHSLIPDSVIFSPVVNYPYRLALS
FT                   FVNAAKLQYEQALDVDILWFGVRCLKELTYYLLSSYATASFVTALILNRIVIMASLRST
FT                   ANRVVLPLWSRVLLHLAAIIPLIYTLLQVLCQYGIVQKLEPLEFTTFLSSTFASYAWSN
FT                   CVETFVASTTNTLPLEESDYSIFELSILFYCLKKSKQLDLPLQDYLPDCMMATLGRLLV
FT                   HSVELFQCRKYRLFGSTILNFAGIGHFIYKVRWFGFNSLPVATRYINFPKMFSLFLIVM
FT                   SVSTYSLAYLVRLDPFGRGGLDPQELQFYSFMRNWWEHLNCTGEEEFSCVVVKLATMLC
FT                   MGRESMSKGVLREFSHINAPSSIHHSYVISGYLNNISTIPEDIEIRYRESIMTMHPGTS
FT                   NAPGLVKRFKICIMLVKHFFAFFRKSRAPEIRQEPLAKDPNRYVTERNYAKFLSKPQFS
FT                   QKETDLDNNQYLLPEDDLSGDYVPDQSEEVETDTEFGSDDEDLGTILAPESMDNLQEDL
FT                   SWYISMWSILKSAVHSGTRLTRKQYAAIEPQKILTEVVLERTASHRTDDDDDDDDDDMD
FT                   STFACVVCKTNSRNVVLWPCRCFALCESCRVSLGLRGFNSCVCCRRDVHGYSKLHAI"
FT   gene            complement(<737318..>737437)
FT                   /locus_tag="ZYRO0A09174r"
FT                   /old_locus_tag="Zyro0A.tLeu.CAA.29"
FT   tRNA            complement(join(737318..737361,737400..737437))
FT                   /locus_tag="ZYRO0A09174r"
FT                   /old_locus_tag="Zyro0A.tLeu.CAA.29"
FT                   /note="tRNA-Leu (CAA) cove"
FT   gene            <738006..>739091
FT                   /locus_tag="ZYRO0A09196g"
FT   CDS_pept        738006..739091
FT                   /locus_tag="ZYRO0A09196g"
FT                   /product="ZYRO0A09196p"
FT                   /note="highly similar to uniprot|P32473 Saccharomyces
FT                   cerevisiae YBR221C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25833"
FT                   /db_xref="GOA:C5DQ72"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ72"
FT                   /protein_id="CAR25833.1"
FT                   /translation="MLNVRIPSIAAKLAPLKSSSALLQSTRMASSQTMTVREALNAAMA
FT                   EEMDRDDDVFLIGEEVAQYNGAYKVSKGLLDRFGERRVVDTPITEYGFAGLSVGAALKG
FT                   LKPIVEFMSFNFSMQAIDHVINSAAKTHYMSGGTQKCQITFRGPNGAGVGLGAQHSQDY
FT                   AAWYGAIPGLKVLTPWSSEDAKGLMKAAIRDPNPVVVLEDEVLYGESFEVSDEVMSPDY
FT                   VTPFKAKVEREGTDVTLVAYTRNVGFAVQAAEILDKQHGVAAEVINLRSIRPLDMDTVI
FT                   KSVKKTNHLVTVESGFPHFGVGAEIAAQIMESEAFDYLDAPVQRVTAADVPTPYAKKLE
FT                   ELSFPDADTVVTATKEVLSIE"
FT   gene            <739559..>741226
FT                   /locus_tag="ZYRO0A09218g"
FT                   /old_locus_tag="ZYRO-ORF8917"
FT   CDS_pept        739559..741226
FT                   /locus_tag="ZYRO0A09218g"
FT                   /old_locus_tag="ZYRO-ORF8917"
FT                   /product="ZYRO0A09218p"
FT                   /note="similar to uniprot|P38318 Saccharomyces cerevisiae
FT                   YBR220C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09218g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25834"
FT                   /db_xref="GOA:C5DQ73"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ73"
FT                   /protein_id="CAR25834.1"
FT                   /translation="MAGKKNLAKHDLPQFYLLVALYFLQGIPVGLAFGTIPFLLKSMAK
FT                   DTSFTTLGIFSIATYPYSLKILWSPIVDSIYDSKVGRRRSWIIPIQLLSGSMLFILGWA
FT                   VSNNLVFKGVDDAFHGRHTNGLHDLNILTLAWYFGLLVFLCATQDIAVDGWALTILSAQ
FT                   SLSYASTAQTVGINLGFFLSFTIFISLNSSDFANKYFRSQPLEHGFVSLGGYMKFAGIL
FT                   YILVTIYVIMFTRERPLDDVLPRLGPSAAKKYDESKYAAEYPDGDAIGTSNKASIKYTY
FT                   KCFGRILKLKSVQTLVFIHLTSKLAFQCNEAATNLKLLERGFKKEDLAVTVLIDVPFEV
FT                   IFGYYVAKWSSESNHHHHSPRPIVSHRNSWVRFLVGDPGILTPWLWGFLGRLAAAALGS
FT                   YVLSVFPKDSQITKPFFLLVIIQHLLGSFMNTVQFVGISAFHTRVADPVVGGTYMTLLN
FT                   TLSNFGGTWPRLIIMSMINYFTVYECYVPATNHAITYQGGSMERCTEGLNGKLSILRDG
FT                   YYVTNGMCVLFGLILYFGFLKKKAQQLQTIPVDSWRCS"
FT   gene            complement(<741195..>742313)
FT                   /locus_tag="ZYRO0A09240g"
FT                   /old_locus_tag="ZYRO-ORF8916"
FT   CDS_pept        complement(741195..742313)
FT                   /locus_tag="ZYRO0A09240g"
FT                   /old_locus_tag="ZYRO-ORF8916"
FT                   /product="ZYRO0A09240p"
FT                   /note="weakly similar to uniprot|P53012 Saccharomyces
FT                   cerevisiae YGL126W SCS3 Protein required for inositol
FT                   prototrophy"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25835"
FT                   /db_xref="GOA:C5DQ74"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ74"
FT                   /protein_id="CAR25835.1"
FT                   /translation="MKRSVRTFGIITLFLCPLTLLLGHILGYLSSYPSSVDKDGWINTV
FT                   FVKKGWFWTSLVMWMCVYRYGKFNRQSFTRYLILTAWWYVFTQALWFHTAPIMDLIFLA
FT                   TGGLCRFDVLDADGNLNSSFQDSDSRKSRSLSKIYSFLVRFQLTTQDELKGNLASHTLA
FT                   TLRRLMGISNEKSDSTEPLVSPSEINIFIHDSIKSVREISTSAACRATGGHWKGGHDPS
FT                   GHIFLNTLMIMFLLGELDFFAPLAWSKLSSKGLGPLSYFTTLLDNSPLRNLMQRRPETV
FT                   GEKIWVVGFLPAWECIQGLIKFIIICVRYLVWENPVLLLIALVILWWYSLIVTTLVFHT
FT                   VSEQLSGLACAYLVAGGLYWYAIKNNARNQPV"
FT   gene            <742441..>742824
FT                   /locus_tag="ZYRO0A09262g"
FT                   /old_locus_tag="ZYRO-ORF8915"
FT   CDS_pept        742441..742824
FT                   /locus_tag="ZYRO0A09262g"
FT                   /old_locus_tag="ZYRO-ORF8915"
FT                   /product="ZYRO0A09262p"
FT                   /note="similar to uniprot|P38633 Saccharomyces cerevisiae
FT                   YGL127C SOH1 Protein with sequence similarity to RNA
FT                   polymerases; interacts with a DNA repair protein, Rad5p, in
FT                   the two-hybrid system; may provide a link between
FT                   recombination in direct repeats and transcription"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09262g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25836"
FT                   /db_xref="GOA:C5DQ75"
FT                   /db_xref="InterPro:IPR008831"
FT                   /db_xref="InterPro:IPR038089"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ75"
FT                   /protein_id="CAR25836.1"
FT                   /translation="MSVEADQEPPVAEEVPSLPTRFEVELEFVQSLANIPYVTYLLTQQ
FT                   QQLWKDPKFKNYLKYLEYWCEPPYALCIVYPNCLFVLKLINGFMENSTVNEDGLLDGLE
FT                   DLPKVLQMQGPQWMNEMVDRWVS"
FT   gene            <743360..>745516
FT                   /locus_tag="ZYRO0A09284g"
FT                   /old_locus_tag="ZYRO-ORF8914"
FT   CDS_pept        743360..745516
FT                   /locus_tag="ZYRO0A09284g"
FT                   /old_locus_tag="ZYRO-ORF8914"
FT                   /product="ZYRO0A09284p"
FT                   /note="similar to uniprot|P32501 Saccharomyces cerevisiae
FT                   YDR211W GCD6 Catalytic epsilon subunit of the translation
FT                   initiation factor eIF2B the guanine-nucleotide exchange
FT                   factor for eIF2 activity subsequently regulated by
FT                   phosphorylated eIF2 first identified as a negative
FT                   regulator of GCN4 expression"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25837"
FT                   /db_xref="GOA:C5DQ76"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035543"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ76"
FT                   /protein_id="CAR25837.1"
FT                   /translation="MAGKKIKAHPKEEMVQDDRLQAIVLTDSFETRFMPLSNDKPRCLL
FT                   PLANVPLLEYTLEFLAKAPVKEVYLVCSAHATLISDYIEASKWSFPWSPFKVFTIMSPE
FT                   ARSVGDAMRDLDNKGVIAGDFVLMSGDAVTNLDFDKFWDFHKRMHAKDKDHIVTTCLSK
FT                   ATQFHRTRAFEPASFILDKSDNRCLYYQEIPLPSSRVKTSVEIDPDLLEGVDEFVLRND
FT                   LIDCRIDICSPLVPAIFQENFDYQMLRSDFIKGVLSSDLLRKHVYAYITEEYAARVESW
FT                   QSYDSISQDFIGRWCYPLVLDSNLMPDQTYSYESNHIYKEQGVVLAQSCKIGKCTAIGS
FT                   RTKIGESALVENCVIGRNCYIGSGAVIRDSHIWDNTVIGNNSVINHSIVASGTKLGTNV
FT                   VLNDGCIIGFNVVIEDGKELPRGVRVNGTPVKDSEDNAFGLSDEEDEEETPEKDNPEIA
FT                   FELCGTKGRGYIYEDPLSEDEHDLPIGEEMVSGLSHRLDEVYLSDSSISSVTKSKKKRT
FT                   MSTNSAYTDREEDPTEFEDEEDFGVEGVATVKRAIENNHDLDTALLELNTLRMSLNVSY
FT                   HEVRTVTVVALLDRVYHFIATQTLGPKDAANKVFTRWGPMFRREAFDPDEYVDLMNIVM
FT                   EQVVEQELEKGDLILFSAFNALYDSDILEEEIIYDWWSHVSKDPKFDDIKKLVAKWIEW
FT                   LKEADEESSGEEEEEEESEEEEEN"
FT   gene            <745829..>746404
FT                   /locus_tag="ZYRO0A09306g"
FT                   /old_locus_tag="ZYRO-ORF8913"
FT   CDS_pept        745829..746404
FT                   /locus_tag="ZYRO0A09306g"
FT                   /old_locus_tag="ZYRO-ORF8913"
FT                   /product="ZYRO0A09306p"
FT                   /note="highly similar to uniprot|P19073 Saccharomyces
FT                   cerevisiae YLR229C CDC42 Small rho-like GTPase essential
FT                   for establishment and maintenance of cell polarity mutants
FT                   have defects in the organization of actin and septins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25838"
FT                   /db_xref="GOA:C5DQ77"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037874"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ77"
FT                   /protein_id="CAR25838.1"
FT                   /translation="MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVM
FT                   IGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHH
FT                   CPGVPCLIVGTQVDLRDDKVIIEKLQRQRLRPISQAEGERLSRELRAVKYVECSALTQR
FT                   GLKNVFDEAIVAALEPPVIKKSKKCTIL"
FT   gene            <747277..>748956
FT                   /locus_tag="ZYRO0A09328g"
FT                   /old_locus_tag="ZYRO-ORF8911"
FT   CDS_pept        747277..748956
FT                   /locus_tag="ZYRO0A09328g"
FT                   /old_locus_tag="ZYRO-ORF8911"
FT                   /product="ZYRO0A09328p"
FT                   /note="highly similar to uniprot|P12612 Saccharomyces
FT                   cerevisiae YDR212W TCP1 tailless complex polypeptide 1
FT                   chaperonin subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25839"
FT                   /db_xref="GOA:C5DQ78"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012715"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ78"
FT                   /protein_id="CAR25839.1"
FT                   /translation="MSQVYNNSHSDTLFLGGEKISGDDIRNQNVLAAAAVANVVKSSLG
FT                   PVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVIV
FT                   AAELLRRANELVKNKIHPTTIITGFRLALREAIRFINEVLSISVDTLGKSTLVNIAKTS
FT                   MSSKIIGSESEFFSNLVVDALLAVKTQNSKNEVKYPVKAVNILKAHGKSAKESVLVHGY
FT                   ALNCTVASQACPKRIGGGNVKIACLDINLQKARMAMGVQINIDDPEQLEQIRKREAGII
FT                   LERVKKIIDSGAQVVLTTKGIDDLCLKEFVEAKIMAVRRCKKEDLRRIARATGATLISS
FT                   MSNLEGDETFESSSLGTCQEVVQSKFSDDECILIKGTSKHSSSSIVLRGPNDYSLDEME
FT                   RSIHDSLSVVKRTLESGNVVPGGGCVETALNIYLDNFATTVGSREQLAIAEFAQALTVI
FT                   PKTLAVNAAKDSSELIAKLRAYHAASQMAKLDDHKRRNYKNYGLDLIKGKIVDEVSSGV
FT                   LEPTISKVKSLKSALEACVAILRIDTMIAVDPEPPKEDPHGH"
FT   gene            <749695..>752076
FT                   /locus_tag="ZYRO0A09350g"
FT                   /old_locus_tag="ZYRO-ORF8909"
FT   CDS_pept        749695..752076
FT                   /locus_tag="ZYRO0A09350g"
FT                   /old_locus_tag="ZYRO-ORF8909"
FT                   /product="ZYRO0A09350p"
FT                   /note="similar to gnl|GLV|KLLA0A04169g Kluyveromyces lactis
FT                   KLLA0A04169g and some similarites with YDR213W
FT                   uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
FT                   involved in sterol uptake zinc finger transcription factor
FT                   of the Zn(2)-Cys(6) binuclear cluster domain type"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25840"
FT                   /db_xref="GOA:C5DQ79"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ79"
FT                   /protein_id="CAR25840.1"
FT                   /translation="MIKDKMDRKSVLKKREKVVELIEIDGKKVSITSTGKRKFHNKSKN
FT                   GCDNCKRRRVKCDEGKPLCRKCVNMKLDCVYTPAQPKKRRESTVVKYVTRRAASGQEER
FT                   VPASELADHSSDDSSCDSSRSASRAPNPTPEEITQTDLQERRIFEGMPAKAPPTSTPQQ
FT                   LPQPQQLPQVPQQLLQRQQTHKNIGSPDKTFSTTNGSRGMLDGLLLPPLGSESSHLNQQ
FT                   QQQQQLQQQLLLLPQLMTLSNSEKYAAFEMPNSPPLQPAGMNITNSIGSIFSPNRFQQQ
FT                   QQQQQQQQQQQQQQQQQQQPPAQPPTLPSFQAESIAQLNKASINLKAMGMFPTAGIGGV
FT                   TYDFQELLGIKYPGNSQASKASNAEEALANMQEQQEQATKGDGDGNGNEETTANNDNEH
FT                   SAVHMLATPSLPNNPTISPAAPITPMTKTSINAAAATSSPSVTAVPGTTATLAGAGRTD
FT                   QHPAQEQVSSRNDSSDGYVANLLQLSREGNLNLIDLKLFHHYCTKVWPSITAAGISGRE
FT                   VWSTEIPELAFEHPFLMHSLLAFSATHLSRTESGLEPYVSCHRLDALRLLRQAVLQISE
FT                   DNTDALVASALILIMDSLANASNQGTTNPSSMSPSAWIFHVKGAATILTAVWPLTERSR
FT                   FYNLISVDLSDLGDVINQESATISELVCFDESIADLYPVEIDSPYLITLAYLDKLQREK
FT                   NQSDFILRVFAFPALLDKTFLALLMTGDAGAMRIMRSYYKLLRGFTTEMKDKIWFLEGV
FT                   SQVLPQDVDEYSGGGGMHMMLDFLGGGLPSMTTTNLSEFM"
FT   gene            <752252..>753262
FT                   /locus_tag="ZYRO0A09372g"
FT                   /old_locus_tag="ZYRO-ORF8905"
FT   CDS_pept        752252..753262
FT                   /locus_tag="ZYRO0A09372g"
FT                   /old_locus_tag="ZYRO-ORF8905"
FT                   /product="ZYRO0A09372p"
FT                   /note="similar to uniprot|Q7LIE3 Saccharomyces cerevisiae
FT                   YDR214W AHA1 Activator of Heat Shock Protein 90 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25841"
FT                   /db_xref="GOA:C5DQ80"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR015310"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036338"
FT                   /db_xref="InterPro:IPR039981"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ80"
FT                   /protein_id="CAR25841.1"
FT                   /translation="MVVHNPNNWHWVDKNCIGWAREYFGEKLTKLNTGDVNGKFAEIAS
FT                   VSSVEGDCEVNQRKGKAISLFDLKVVLLIKGHVEDLPFDGSINVPEVAFDSEESDYQFE
FT                   ISIYKETTKLNEVKPVIREKLLPQLRTVFQNFGKDLLAVHASDIQVPESQVKSKFTRAN
FT                   ASTTSSSSATPASTPKPAPTTATKSSAPTTSGANRSSLHLEPTFNVPAIELYRTFLYKP
FT                   LIMAWSRGSLQSATPGDQLKTGDQFDLFGGNVTSKLLECKEPTRLVFEWRLKEWSEKVV
FT                   SKLVMEFHESQEYHETKLQVSWSGIPVGEEDRVRGNFEEYYVRSIKLTFGFGAVL"
FT   gene            complement(<753381..>755078)
FT                   /locus_tag="ZYRO0A09394g"
FT                   /old_locus_tag="ZYRO-ORF8904"
FT   CDS_pept        complement(753381..755078)
FT                   /locus_tag="ZYRO0A09394g"
FT                   /old_locus_tag="ZYRO-ORF8904"
FT                   /product="ZYRO0A09394p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09394g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25842"
FT                   /db_xref="InterPro:IPR006353"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ81"
FT                   /protein_id="CAR25842.1"
FT                   /translation="MADKLSQKLNKMSQSSSKKAGVSAAKETGPSGMGSPVSFPVEDEE
FT                   PKSKVGEQQQPQPRRKSFLENNNPQEFQPMPRKKRVSSLSLSDQWSAVTPLHPEGSSSK
FT                   VSRHGSVTSGGHKGSRSRKSSIPVRHRKSVVNHERVASYAFAFDIDGVLVKGPETIPQG
FT                   PEALRMLNGHNKYNIKVPYIFITNGGGRSEKARCRDLSKRLGITVTEDQVIQGHTPMKD
FT                   LVDVYENVLVVGGVLDSCRKVAEGYGFKNVYIPLDVMKWKPSVTPYYVLNEEERNIAKD
FT                   VDFSKINIQAILVFADSRNWAADQQIILELLMSEKGVMGTISPTYDQGPGLYFAHSDFV
FT                   WATDYGLCRYGMGALQVSIAALYEEHTGKELQVTRFGKPQRGTFRFAEKVLSNWRRETL
FT                   SEHVENLKLEDPDEGENKETPFGDSDSEEDEADWGNDSGERPGDLVLELPPASTVYFVG
FT                   DTPESDIRFANSHDSTWYSILVKTGVYKDGVTPRYTPKKTCENVLEAVNFAIEREHAKE
FT                   LKEWNESCAEETVIHQEGNKKPVKEEDDEGEAPLTTNDLKSIRAETSS"
FT   gene            <756859..>760899
FT                   /locus_tag="ZYRO0A09416g"
FT                   /old_locus_tag="ZYRO-ORF8899"
FT   CDS_pept        756859..760899
FT                   /locus_tag="ZYRO0A09416g"
FT                   /old_locus_tag="ZYRO-ORF8899"
FT                   /product="ZYRO0A09416p"
FT                   /note="similar to uniprot|P07248 Saccharomyces cerevisiae
FT                   YDR216W ADR1 Positive transcriptional regulator controls
FT                   the expression of ADH2 peroxisomal protein genes and genes
FT                   required for ethanol glycerol and fatty acid utilization"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09416g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25843"
FT                   /db_xref="GOA:C5DQ82"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ82"
FT                   /protein_id="CAR25843.1"
FT                   /translation="MEMNELIDRSSDEKEITTTIASSATSVTGEDLTLSDQKPISNNNN
FT                   NNNNNNTENHSMNSRVNKQFNRLPENLRLNGRTPSGKPRLFVCQVCTRAFARQEHLTRH
FT                   ERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIHGGNYGDTIIKQNNVKENSNNRVSKGR
FT                   RSGSVTAANAANAVNTANVAATMTPNLSHPSSLPPIRGRRASYSAQSGNYVAPAQNEQW
FT                   HKADRVKFSTPELLPINMMDDDLSNNATKSNNFDGIGDDGNCNGNGFMESIAPLELNAP
FT                   WEFNMLDSNDWIYEYNNQNVTTSGSATAAGGPTPGDSPNSSSVDPSNSSIRLGNFPQSS
FT                   GELRRETIDNSYFENNKSRKLSWAINEEDGRLQVKSLFMNRNNSAPLPRPIRNVTKNIG
FT                   SPSRSSISGSGALGVRDSLTGSTASATTQTTTATTAATTTTTTTAETEDDWLPMANHTD
FT                   SVSSSVAPLHTIDGNSNTGALLEQFNRLEFNDNGMGDLSEFTKDVQTIFGHYIQDEQSD
FT                   VYNIPHQFPLSSSNDENLTDPTMGSTNQTSTSANDNYTFYGLDYLTLSNISRASPPNNL
FT                   NSEDLPSSKLFTHELRQICLHSLRYYSNHCNGVLGSDPVFISKDLILPSCSELNGYSSY
FT                   FQKYFNPHTAFIHPDFFQLDLPSLMNYINEGDTNDEEDSQYLQYSNIACLPLFVATVGS
FT                   IYKSGCNSRTMELYEISRRVLHVYLERRKQQQRQQSAGETPMEGVRYENRQRIWLIQSL
FT                   ILSITFALFADYLERMDSGMIKRQVSAICSIIKGNFLKIISIDCHEFFSSYKDLTFDNP
FT                   CDYVFFESKIRCTLMVYKICQFLKIFYRVGSKLFLNEKDLDPVCIPDDESTWLNSSLLV
FT                   PSKSTKKKYTVDFQKFYHSFTFNNTGMHSIPECLTTAMLYYEFNEINFSPFHVFLTRID
FT                   TKKLELNQTQLSQIDSDPNIVTAHDILNSDSITLRNCLMSMVFLTKIDVTFGSKIWNGK
FT                   LRELFTSFLDPSSINILTKGSYSLLTDFLVALNFSIKNVSHFLTLNENGTAIELDKTNM
FT                   SLFNCQGFYCNFLILIKFILDFECTPNFKLLCIFTELKKLANNLLIPKYSNLYPMEFAK
FT                   FQDVSLTNTYLQHHPKSDASAKFSTINAHKLEKLINNVLVHAFNDASFLNMSEQPTNEF
FT                   LFNNNHPTYYPYASPTTTAFNYEEIQFKSPSSPTSNDNDFLPSKSSVDLLRYQNNNSDN
FT                   NANDNVGGSVNSNNDEGNLSKQGFAERYQLSDKYIVIAKCFFTHIREIYAHCHIFKKMI
FT                   ADFQQLEDCIDEKRRKSNMFKMSREDGSNATMAKNASSNSTVTMTKNHSSGDLINKFLQ
FT                   TQV"
FT   gene            complement(<761287..>764670)
FT                   /locus_tag="ZYRO0A09438g"
FT                   /old_locus_tag="ZYRO-ORF8896"
FT   CDS_pept        complement(761287..764670)
FT                   /locus_tag="ZYRO0A09438g"
FT                   /old_locus_tag="ZYRO-ORF8896"
FT                   /product="ZYRO0A09438p"
FT                   /note="weakly similar to uniprot|P14737 Saccharomyces
FT                   cerevisiae YDR217C RAD9 DNA damage-dependent checkpoint
FT                   protein required for cell-cycle arrest in G1/S intra-S and
FT                   G2/M transmits checkpoint signal by activating Rad53p and
FT                   Chk1p hyperphosphorylated by Mec1p and Tel1p potential
FT                   Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09438g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25844"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR013914"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ83"
FT                   /protein_id="CAR25844.1"
FT                   /translation="MSNGIIQSNDSVENSMKDPAMQETPIADHLMISNDVPHATDGSRD
FT                   NTRSIGNGKVFSNDNVNENSGDYYSSPLVDKNRDMDVFSKESKGDEIEHLPQSPLRLNK
FT                   RTPDLDKIADFFRNNRTPKQKRLLAQFESSVTQDTPVSQRRDHSPLRLKSNKKSSSTEY
FT                   VRNLHSVDDEPSLEVTEADIQYNLNASREGKTLESQTDYEHTNRLKFFGQGTQSQEKLQ
FT                   TQGIQEVESFHHDNDTIQRPDNDYHEHTKISSNEKDPDVFMGNKTNDENMCHEETRVND
FT                   TTDGDISVQWVFRSNKNDQENSNKSTQIIPTGETQKDEMNSEFQNTQTSLSQANETQTQ
FT                   VVASFNAQETPVDHKKNEMESPTQIVRSPERNMDGNTQEIPSEPGRFSGVGAITEVLGT
FT                   SPASKSRDIIDVESRSSSPRYSVPSVSRNDSEQERDNQGKVLLQISGKPELFPNFDIEP
FT                   GAEENADKNTAIVISENDLTQDLPELEEQGSQEKRKEQESFRRIADGSFEESQEITKKT
FT                   WKRSGRTRPTIVQEEEEEEEEEEGEEGELDERCRNHPKKKLRRGDTDHGHQVQVQTPDT
FT                   SPQIDGEKSALTELRSGNEVPSESWLEKIRDFPQDVRKREEDFLSKKDIKFEDAVWCQY
FT                   NLNYCFYPGRLISYDEKADGCWVVFETGQSLTKNDDIYYLDIRVGDTVNWHGRVHKVIA
FT                   LERRTQDPIVIRCIRGYDTIHLKKRNVSGKLGKKTSVVPLSSISLDLNEWAKRPKVILE
FT                   EGSHTRAKAFKFLQHPIRGRKSITSLSPRKARLDSGATGRLTYKEDSDDESNDSVDSVG
FT                   KNGIIELSSKLESPGLKRKLFNSQDPGIFKDCLFILSGLNEEKYELSEVIGSLGGRIVD
FT                   AGFPDLFDFEFLEERDQHIEKYTLNLGWKSNIKSENLRFGCLLSTKHLRSLKYLETLAL
FT                   GWPTLHWKFVERCVSDGKLCTKNIHQYLLPSGESFRLNSRSEDQSGIIKSNDIFQFYLL
FT                   LLQNALLKDQIGHNYHVLSDYVVIIFGHSGLDQFIRFILACLGVKTTFQISSKIGNFAT
FT                   IQNLNVLTNFTNTILLGQDNSKIIIYINGDNGLPNEILEEIKGRIWGEFVNGGQTSPNF
FT                   HVESKEWLIQTLINGNSGFD"
FT   gene            <764869..>766360
FT                   /locus_tag="ZYRO0A09460g"
FT                   /old_locus_tag="Zyro0A.mRNA.2396.p"
FT   CDS_pept        join(764869..764881,764964..766360)
FT                   /locus_tag="ZYRO0A09460g"
FT                   /old_locus_tag="Zyro0A.mRNA.2396.p"
FT                   /product="ZYRO0A09460p"
FT                   /note="weakly similar to uniprot|Q05955 Saccharomyces
FT                   cerevisiae YLR227C ADY4 Component of the meiotic outer
FT                   plaque a membrane-organizing center that assembles on the
FT                   cytoplasmic face of the spindle pole body during meiosis II
FT                   and triggers the formation of the prospore membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09460g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25845"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ84"
FT                   /protein_id="CAR25845.1"
FT                   /translation="MNYNELCYAGGKFEYHSLLEYLDEEIELIAKEFQTSLKYSEPLYR
FT                   KVTKLILILCPEEKMRMIFDKSCYTRLQLEGLMNKEMLKYVELDFNVNPKVVAKALVKS
FT                   TADHPNVFCYKVFLLLANKGILAYLANFDGDYLKGFIDFRWCLQFIYYIKRLDPLEGEI
FT                   KNFLEDCERMFAILCAKCLMKEIEEKGDKQITSQLEILRLDEGSILQSLLFTVIDCTDP
FT                   SMMTTGNYLDRYILSMFFESLGEIERFIAIFKGSLAEYECMPNVNDLALRVQREHLNDT
FT                   IRRYILSMTTKLNGDPAIIRCIHKILECLVLYGGVHMGIIQFFYSLKKYYLGVLSAASE
FT                   LPFDSKLTKECVTLLDKICQEWDNVKTKSNSRLIQSPQILLKSMFGEFVIVDEVFDENR
FT                   PLEHHHDLSIMLSSMKLKVKHKWLGEAHTFKEYSNSMWKIGMEWVVFWKDCYIDNHEEL
FT                   PLEMIQIFNGI"
FT   gene            complement(<766396..>767586)
FT                   /locus_tag="ZYRO0A09482g"
FT                   /old_locus_tag="ZYRO-ORF8890"
FT   CDS_pept        complement(766396..767586)
FT                   /locus_tag="ZYRO0A09482g"
FT                   /old_locus_tag="ZYRO-ORF8890"
FT                   /product="ZYRO0A09482p"
FT                   /note="similar to uniprot|Q04921 Saccharomyces cerevisiae
FT                   YDR218C SPR28 Septin-related protein expressed during
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25846"
FT                   /db_xref="GOA:C5DQ85"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ85"
FT                   /protein_id="CAR25846.1"
FT                   /translation="MPSAADIRRRRNASKEYRLCMLVLGERGIGKKTFLNNLCGKTVFP
FT                   TEERIKEVPEPSQAHASPDIQLTTELVQLDDARSTPIDIVLFPGCGDCMDNTSTPGKIK
FT                   EYLDAQFDIVLNEELRIKRSRVDTDSRSHVCIYFIRATSRGLREFDVQLMKQLGDRVNI
FT                   IPVIGKADLLTSEELQHNKKLIMHDIAKHELNVFDFKNDKLQDSLVEADDFLCDGRNEK
FT                   IPDVNIRDMLPFALICGDKEITEPRGEIAHVRNYQWGQIVVEDGSNSDFIFLKHILLGS
FT                   HLQELKDVTNDVFYENYRTKMLLSKKVSVEYSREFMGPEPSQLPASATGSKRRNAFSVS
FT                   SSVPEQEKDEYMPFSKEMEEKNKIIKAYQQKIEALEKMLKNNPDDAAAKACLEAIM"
FT   gene            complement(<767874..>769064)
FT                   /locus_tag="ZYRO0A09504g"
FT                   /old_locus_tag="ZYRO-ORF8888"
FT   CDS_pept        complement(767874..769064)
FT                   /locus_tag="ZYRO0A09504g"
FT                   /old_locus_tag="ZYRO-ORF8888"
FT                   /product="ZYRO0A09504p"
FT                   /note="similar to uniprot|Q05949 Saccharomyces cerevisiae
FT                   YLR226W BUR2 Cyclin for the Sgv1p (Bur1p) protein kinase
FT                   Sgv1p and Bur2p comprise a CDK-cyclin complex involved in
FT                   transcriptional regulation through its phosphorylation of
FT                   the carboxy-terminal domain of the largest subunit of RNA
FT                   polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25847"
FT                   /db_xref="GOA:C5DQ86"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ86"
FT                   /protein_id="CAR25847.1"
FT                   /translation="MSSESDNHQAATPTAPAAPTAPAAPAAQPSRKEYNTRLLWPDMIK
FT                   TPNNTWTFSCKEIVEKLGTNPQATAELKRNMEKCLIYFYTVKKVLNLFDHTYTASCMLF
FT                   FRYWYVYGLPPYLPDCIHIAQAILVTACKTMENNRPIDAYIKATCDYFIKETTGLRVRQ
FT                   NLDKLKWDVRDRLVSNEKKILCCFGFDLNLENPKELIEDMFSGFYRFNRDYNLPDDFTQ
FT                   IFPKILQEARNFIVQAVTQPVSLLCDGYTFVALALIYCGLQYKKNVDESFQFPSNFFRD
FT                   KFPVLVTAQRFGQFFNDYRVLEENFFDLKSNKREKLQISVQEIDELINEDPLPDGEVSD
FT                   PYDYNLIKSGEVRQELKDHIHKRIRDIYERTVAETKKRMSPENVADLEQSKKKLKT"
FT   gene            complement(<769311..>770327)
FT                   /locus_tag="ZYRO0A09526g"
FT                   /old_locus_tag="ZYRO-ORF8887"
FT   CDS_pept        complement(769311..770327)
FT                   /locus_tag="ZYRO0A09526g"
FT                   /old_locus_tag="ZYRO-ORF8887"
FT                   /product="ZYRO0A09526p"
FT                   /note="weakly similar to uniprot|Q04922 Saccharomyces
FT                   cerevisiae YDR219C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09526g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25848"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ87"
FT                   /protein_id="CAR25848.1"
FT                   /translation="MLQGLPLDVVLRIFSLLNMNDLVQVGKCSHLLRQLANHALLTKNV
FT                   LISAHSNWIRDSLFFDMSRMDLEFIRHDEDEGHEEQEKEDNDEQLLMDMYAKPIMCNNE
FT                   ETLSYMRILQGVHEEDTKLVETDHVTSPDPNDWDAKLEKALKVLSPACSDYSKSSANST
FT                   FSELPPRLSNSEWSSPINELNTLSDVSVHGISDCESTSSANSLDKLRSSNKVRDKAALF
FT                   EKLMAEDVNHTTRSQGKSMKRKSYGLLSHFFPDRSFDTRDRNVSQGYIEELARCNGEPA
FT                   ATTAPGELQDTQANDNTLECTEEPLSKKNYRNNSKGIQRNRLKAFVTQGNRICYEKI"
FT   gene            <770850..>772805
FT                   /locus_tag="ZYRO0A09548g"
FT                   /old_locus_tag="ZYRO-ORF8885"
FT   CDS_pept        770850..772805
FT                   /locus_tag="ZYRO0A09548g"
FT                   /old_locus_tag="ZYRO-ORF8885"
FT                   /product="ZYRO0A09548p"
FT                   /note="weakly similar to uniprot|Q04924 Saccharomyces
FT                   cerevisiae YDR221W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25849"
FT                   /db_xref="GOA:C5DQ88"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR026874"
FT                   /db_xref="InterPro:IPR028146"
FT                   /db_xref="InterPro:IPR036607"
FT                   /db_xref="InterPro:IPR039794"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ88"
FT                   /protein_id="CAR25849.1"
FT                   /translation="MVNSQLKYGLLGLYSLFSLVKGSEGVVGVPESRQSIYEPRDDGKW
FT                   ACLGDANVIIEATQINDGICDCPDGSDEPGTGACGMKAPQFYCKNGEFLPRYISQSKVG
FT                   DGVCDCCDCSDEQLTKGEVFYRGTQCSDLRTSFDKFVQQELENHHHGMQTLLQLKAQSP
FT                   APVKTQEGLSEQIRSLSEQLSNNEKILASEKADYAEKLKAENPLLYEFEQLHVDALANA
FT                   VNDQLSEIIRVGRAYEDLVRILDALVENYSSHLMDLVVNENVKKYQFYKLKKLSKISCN
FT                   PGNDNEQREQLLVYFQTELPELFANGLSDKPAKYIQGKATFVDMLILSKAEYTEVIMEA
FT                   INKLRSILQDVAENYNRNYQDQGVRQAAEAFKHYTEKYATVDIVRLPQDLMDELDHLKS
FT                   FVIEKAPELVSSSPSLENQDEAGQTGVMQQVQNWVGGIPNFFKPDMRGQIEKHEQDVRS
FT                   LRAEMAARRKELTSLVEQESSGADERTKYIKALIDATNLSLEKNLDAYIYGIQYNGQIL
FT                   QKEKSGDQNSVLIGNFKSLRLNEELALLKYKEYVRINYSGDDELVQHLISETTDEEEDY
FT                   LFGNLYQLNNGLQLEFENGDQCWDGPRRSATVFVQCSDKQELKKITETSRCRYSVEIES
FT                   PFGCSEDFIYQPFRAE"
FT   gene            <773230..>774441
FT                   /locus_tag="ZYRO0A09570g"
FT                   /old_locus_tag="ZYRO-ORF8883"
FT   CDS_pept        773230..774441
FT                   /locus_tag="ZYRO0A09570g"
FT                   /old_locus_tag="ZYRO-ORF8883"
FT                   /product="ZYRO0A09570p"
FT                   /note="similar to uniprot|Q05948 Saccharomyces cerevisiae
FT                   YLR225C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25850"
FT                   /db_xref="GOA:C5DQ89"
FT                   /db_xref="InterPro:IPR013931"
FT                   /db_xref="InterPro:IPR033394"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ89"
FT                   /protein_id="CAR25850.1"
FT                   /translation="MHWGNKDGVRFVPVREVQSEDDYTIVDNLEQLEWYAKSLHKPSHK
FT                   SNRVLSAVKKSTETKIETQTVYFTDLKSGRCGFIQLLYSSVIGGIYKGFQLNFKSFRSE
FT                   ESEENEEKESRADVWESFKLEDIKEFSELTVNSSRATFAFKHSLDSSAISKLEIKVDIP
FT                   VGSNTNGLKIDLVVDLYRGILVNPDGCSYYLDKPLTKDEISKQRDAIFSKKMVRHLFVP
FT                   RAQCCGNISYLDSKGEKVDLQLDKVPGLYIDAVQGLVPYKAANRWNFLCFQSLTTSLLC
FT                   MEFTTTEEYNRTTVTIWCSTRNNQIETVGSSINGKNIQFEATTKDDKTGYEYPTQIAFP
FT                   MGFVEQHLRLVNRYDIMGELPSLVKSLAENIAHIKPYIYQYCQSSTHAGQKGISIIEST
FT                   FISS"
FT   gene            complement(<774455..>775522)
FT                   /locus_tag="ZYRO0A09592g"
FT                   /old_locus_tag="ZYRO-ORF8882"
FT   CDS_pept        complement(774455..775522)
FT                   /locus_tag="ZYRO0A09592g"
FT                   /old_locus_tag="ZYRO-ORF8882"
FT                   /product="ZYRO0A09592p"
FT                   /note="weakly similar to uniprot|Q05947 Saccharomyces
FT                   cerevisiae YLR224W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25851"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ90"
FT                   /protein_id="CAR25851.1"
FT                   /translation="MELDQFPLEILWKLLLACPLELRLVNRKFYHLHNELYREKTLQIV
FT                   DTVDEEERFWSELKNPIASYIKSLDFLRKDARMIYRTSKDTQEFIDDSWFIIYSALSCP
FT                   LKCWNSPALCERDSLDMQKPIYAGECVVPVDCHDGIISTKTGRSIPLNAWFFIDKPIAA
FT                   SKVPGFVTEIRQSQYGAYKKRSTQGNVADFIKERGVYCFNLGDLPDIFLNNQDHKINGH
FT                   YFCPFEIRLVEVGMAPPTYFENSEITFLGYDFNSYGFGKPWILFKCDRDFEASIFNPFE
FT                   SYLAESLAKFTGAFPFSHIDWPSQTADTGEESIEPYFDPNQRAMRHFVYRFPRAQQDWN
FT                   KERTVADWRAPHLIQ"
FT   gene            <775967..>779131
FT                   /locus_tag="ZYRO0A09614g"
FT                   /old_locus_tag="ZYRO-ORF8880"
FT   CDS_pept        775967..779131
FT                   /locus_tag="ZYRO0A09614g"
FT                   /old_locus_tag="ZYRO-ORF8880"
FT                   /product="ZYRO0A09614p"
FT                   /note="weakly similar to uniprot|P39520 Saccharomyces
FT                   cerevisiae YLR223C IFH1 Essential protein with a highly
FT                   acidic N-terminal domain IFH1 exhibits genetic interactions
FT                   with FHL1 overexpression interferes with silencing at
FT                   telomeres and HM loci potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25852"
FT                   /db_xref="GOA:C5DQ91"
FT                   /db_xref="InterPro:IPR018837"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ91"
FT                   /protein_id="CAR25852.1"
FT                   /translation="MTEGSSSRKSPLYSGQVGKKLPGPLAKKYPQNNHLGPVTRPRRFS
FT                   LLYSSDSSVSEGSDVDEKDADPKKQERRGSDRARSISSNAGGKRSKLIRHSSDIQEEEE
FT                   EEEDDDDDDDDANDDENDNENGNEISVPEQAVSSDDEEVGDDEESDEDDDDDDDDDDDD
FT                   NSDSESESNDTSSSEEDIDFVKLQAQRKKRSMKALSALKRDGSNLGEERDSKRLATESR
FT                   QPDRKTELEPISPILENEQAVSSTDGSDMDEENVNTEALSFKFRKDDDGIRFGKVDDED
FT                   SEEDIGEEVQDADDTSNNNSLEIQPDDNLNQLHVPHFSDSEDSEYNIDQDAYFNAIEDE
FT                   DDLVGIENGLDPNEDEDGDVLREEENMISALQNDDDISFDGSIRESGSDPETMSVSAAE
FT                   QNRSVDGDDESDDEDDEMMTVFDMPFFEDPKFASLYYCEDGSEPRLSLSTSLPLLTSDE
FT                   KMLRKNRREAKKLERKERIQRRKQLKEKRSRVKKSGVKKAKSDYNDEEFMFGVFFNNDQ
FT                   DDSESGFNGGSLELKKKLDFDSPLRRLGSAAASDISSDDEYDNILMDIANIPSSDDSDD
FT                   EKITKDKKGHENGEEKIDESVESTSDGLELELGETDDELQDDSSVSNVFIDIDDLDPDS
FT                   FYFHYSEDDASTSYSEMMTDDTDADKKEKEEDSKEDAVETVTYANDESTDEDDNLPPPS
FT                   SRSKNIGTKAKEVVSANVVGLKPPKLGTWETDSKPFTIIDGLSTKSLYPLIQEHQHLLE
FT                   QQQRAQSQSPEYHSPHEVTSANGDELTLNELLNMSELEDEEAPAPSYSQAASDWYQRPA
FT                   VPLSAFRNKGVNSHEDDEVMLPANSTRKVPIGYIGSERTRRKIDKVKELQRKKNEKKRK
FT                   LKKRKRLLKLKRDRQRAEKENGVQSHEAIGVDEGEASLQLPDSDFIMDRAIEDAQQETE
FT                   GQRSRKNSVKSVGLAEIHEILGNDNSDLLENNVEFFDAQAEEDAAAMEVTDADILASLT
FT                   APVDLNDVGRRPFWRRRQSMVEAAAENLRFTKNGLFSESALADIEGFFNNSGVTSNAFE
FT                   FNESLQ"
FT   gene            <779501..>781927
FT                   /locus_tag="ZYRO0A09636g"
FT                   /old_locus_tag="ZYRO-ORF8874"
FT   CDS_pept        779501..781927
FT                   /locus_tag="ZYRO0A09636g"
FT                   /old_locus_tag="ZYRO-ORF8874"
FT                   /product="ZYRO0A09636p"
FT                   /note="highly similar to uniprot|Q05946 Saccharomyces
FT                   cerevisiae YLR222C UTP13 Nucleolar protein component of the
FT                   small subunit (SSU) processome containing the U3 snoRNA
FT                   that is involved in processing of pre-18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09636g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25853"
FT                   /db_xref="GOA:C5DQ92"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013934"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ92"
FT                   /protein_id="CAR25853.1"
FT                   /translation="MDLKSSYSNTALNPIYAGSGAVATVSSDGSILATPVLDEINIIQL
FT                   VPERKTLFTIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISSPS
FT                   YVVDSDSTSTLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLA
FT                   SGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYW
FT                   QFNLKKKCTLLKTLPVSQQVESCGFANSELIYTAGSDAFLQLISLESGKAVKRTHKPVE
FT                   ELFTVGVLSILGGSKLYMVISDQTLALINLEEALESESALIEVESYIAGNHGTIADMNF
FT                   VGPELDKLALATNSPTLRIIPVSMEGGLPIDVELYEGHKDLLNAVDATEDGLWLATASK
FT                   DSTAILWWYQSNSNKFVPYAKFEGHSSAVTAVGLPNIMHKGWPEFILTASNDLTVKKWA
FT                   VPKPVASNESFELQVVKVSEYTRRAHEKDINALSVAPNDSTFATASYDKTCKVWDLESG
FT                   EVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCS
FT                   FINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWALCVAEDGDLIVSADADGVF
FT                   QFWKDSTEQERQQHNEQQHLKVEQEQSLQNYLSQGDWTNAFLLAITLDHPLRLFRVLKQ
FT                   SLGSMDDDERKDSKVIFNRELDQTISNLSNEKLLLLMKRCRDWNTNSRTHSIAQRTVRC
FT                   ILLQHNIAELSEIPGMVQIVDAILPYSKRHYARVESLVEQSYILDYALVEMDKFF"
FT   gene            <782112..>782699
FT                   /locus_tag="ZYRO0A09658g"
FT                   /old_locus_tag="ZYRO-ORF8872"
FT   CDS_pept        782112..782699
FT                   /locus_tag="ZYRO0A09658g"
FT                   /old_locus_tag="ZYRO-ORF8872"
FT                   /product="ZYRO0A09658p"
FT                   /note="some similarities with uniprot|Q05942 Saccharomyces
FT                   cerevisiae YLR221C RSA3 Protein with a likely role in
FT                   ribosomal maturation required for accumulation of wild-
FT                   type levels of large (60S) ribosomal subunits binds to the
FT                   helicase Dbp6p in pre-60S ribosomal particles in the
FT                   nucleolus"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25854"
FT                   /db_xref="GOA:C5DQ93"
FT                   /db_xref="InterPro:IPR028217"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ93"
FT                   /protein_id="CAR25854.1"
FT                   /translation="MVESDIRAADNVAKKSRRRKKRRTTEVSDSSDSSDSSSEEETKAS
FT                   DTGAGEALQAAYQLSEDEDEKMPDASAKPERETLSRNTKESLNNIPFTRTELNGKSTRN
FT                   NDDVSMDLQRVNEAINDAKQKIRESKEESQSTSQLKNSYLELLFENYGDDINSLRDAPD
FT                   FTSNSLIMIAQVLKDGSSMFDVETLKTMLETK"
FT   gene            complement(<783059..>784027)
FT                   /locus_tag="ZYRO0A09680g"
FT                   /old_locus_tag="ZYRO-ORF8871"
FT   CDS_pept        complement(783059..784027)
FT                   /locus_tag="ZYRO0A09680g"
FT                   /old_locus_tag="ZYRO-ORF8871"
FT                   /product="ZYRO0A09680p"
FT                   /note="highly similar to uniprot|Q74ZL6 Ashbya gossypii
FT                   AGR182C AGR182Cp and similar to YLR220W uniprot|P47818
FT                   Saccharomyces cerevisiae YLR220W CCC1 Functions in the
FT                   homeostasis of both calcium and manganese ions Possible
FT                   transmembrane Ca2 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25855"
FT                   /db_xref="GOA:C5DQ94"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ94"
FT                   /protein_id="CAR25855.1"
FT                   /translation="MSIVAIKNAVSDYVSSKKDSGKTAPLLTNDNGSHTSHNAYGSTNG
FT                   DLENGNGTSSQGNNNGKHNSSGSDRDADTLGGSSDNNNRNGNSNGGLFNNVDPRVISDL
FT                   VIGLSDGLTVPFALTAGLSSLGDSKLVITGGFAELISGAISMGLGGYLGAKSEGDYYHA
FT                   EVKQEKSAFYDNPTMINHEIEDILLDINPNFSDDTILSFIKDLQRTPELMVDFIIRYGR
FT                   GLEEPAENRQLISAVTIGGGYLMGGLVPLLPYFFVQQVGTGLIWSIIVMGITLFWFGYI
FT                   KTQVSMSDACTLGKKISEGLQMVVVGGVAAGAAFLLVKTLG"
FT   gene            complement(<784576..>784974)
FT                   /locus_tag="ZYRO0A09702g"
FT                   /old_locus_tag="ZYRO-ORF8870"
FT   CDS_pept        complement(784576..784974)
FT                   /locus_tag="ZYRO0A09702g"
FT                   /old_locus_tag="ZYRO-ORF8870"
FT                   /product="ZYRO0A09702p"
FT                   /note="similar to uniprot|P02293 Saccharomyces cerevisiae
FT                   YDR224C HTB1 One of two nearly identical (see HTB2) histone
FT                   H2B subtypes required for chromatin assembly and chromosome
FT                   function Rad6p-Bre1p-Lge1p mediated ubiquitination
FT                   regulates transcriptional activation meiotic DSB formation
FT                   and H3 methylation and similar to YBL002W uniprot|P02294
FT                   Saccharomyces cerevisiae YBL002W HTB2 One of two nearly
FT                   identical (see HTB2) histone H2B subtypes required for
FT                   chromatin assembly and chromosome function;
FT                   Rad6p-Bre1p-Lge1p mediated ubiquitination regulates
FT                   transcriptional activation, meiotic DSB formation and H3
FT                   methylation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09702g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25856"
FT                   /db_xref="GOA:C5DQ95"
FT                   /db_xref="InterPro:IPR000558"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ95"
FT                   /protein_id="CAR25856.1"
FT                   /translation="MSAKAEKKPASKAPAEKKPAAKKTASSVEGKGKKNKARKETYSSY
FT                   IYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNRKSTISAREIQTAVR
FT                   LILPGELAKHAVSEGTRAVTKYSSSTQA"
FT   gene            <785434..>785832
FT                   /locus_tag="ZYRO0A09724g"
FT                   /old_locus_tag="ZYRO-ORF8869"
FT   CDS_pept        785434..785832
FT                   /locus_tag="ZYRO0A09724g"
FT                   /old_locus_tag="ZYRO-ORF8869"
FT                   /product="ZYRO0A09724p"
FT                   /note="similar to uniprot|P04911 Saccharomyces cerevisiae
FT                   YDR225W HTA1 One of two nearly identical (see also HTA2)
FT                   histone H2A subtypes core histone required for chromatin
FT                   assembly and chromosome function DNA damage-dependent
FT                   phosphorylation by Mec1p facilitates DNA repair acetylated
FT                   by Nat4p and similar to YBL003C uniprot|P04912
FT                   Saccharomyces cerevisiae YBL003C HTA2 One of two nearly
FT                   identical (see also HTA1) histone H2A subtypes; core
FT                   histone required for chromatin assembly and chromosome
FT                   function; DNA damage- dependent phosphorylation by Mec1p
FT                   facilitates DNA repair; acetylated by Nat4p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25857"
FT                   /db_xref="GOA:C5DQ96"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ96"
FT                   /protein_id="CAR25857.1"
FT                   /translation="MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRKGNYAQRV
FT                   GSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTI
FT                   AQGGVLPNIHQNLLPKKSAKPGKASQEL"
FT   gene            <786274..>786346
FT                   /locus_tag="ZYRO0A09746r"
FT                   /old_locus_tag="Zyro0A.tThr.AGT.17"
FT   tRNA            786274..786346
FT                   /locus_tag="ZYRO0A09746r"
FT                   /old_locus_tag="Zyro0A.tThr.AGT.17"
FT                   /note="tRNA-Thr (AGT) cove score=74.49"
FT   gene            complement(<786558..>789785)
FT                   /locus_tag="ZYRO0A09768g"
FT                   /old_locus_tag="ZYRO-ORF8868"
FT   CDS_pept        complement(786558..789785)
FT                   /locus_tag="ZYRO0A09768g"
FT                   /old_locus_tag="ZYRO-ORF8868"
FT                   /product="ZYRO0A09768p"
FT                   /note="some similarities with uniprot|Q05812 Saccharomyces
FT                   cerevisiae YLR219W MSC3 Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery msc3 mutants are defective in directing
FT                   meiotic recombination events to homologous chromatids"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25858"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ97"
FT                   /protein_id="CAR25858.1"
FT                   /translation="MGLLTQRKEHKVPDLSRYDYYYQRKDDYNKSPRLSAAAAYAASRS
FT                   RGNPVLVQQRSQSLTQPRRVVRTRPRTKSRGAVEAREAREAPRADSIMRDANFQDTKGT
FT                   KSITRRTIRRINGVDYMETVTTTPLEDEDNARHFNEFSEPVDNYADEHPVRRVRRVKKT
FT                   APSSPKSVRSTRTQRGPISPPRSPVRYHRPEDYQYEEPAQAESEFAPPAAAPVRRTTST
FT                   TRPVRSRSTRSVRKAGSVPQSAVVANAAGERRLTEQEMYARALEIAQRNVYSGSDFSPD
FT                   VLDSASSQDGQAPSRMGQRSLRRDSGRGKKKFTLFNKDRDAGAAGALPAADAPRASGAS
FT                   SLDNRLGQNVEPTAVSASTASRRNLSDEEMYGQALAMSQNKSQRNVEEPESGTQPLNLG
FT                   GVEKDVRSPQSNAAASFVTPAQTIDENYEENFEDAKNYDGEWKDARPKGGAYGNYDYPV
FT                   ENGDRYDFEEPEPEAEPEYIEPELEREYVDPERLPKAAPEYEPEYQTEEVYEPVYEKRE
FT                   ERAPIKRNVSGYSRRSGVAQDEALQQPKRSGSGYSRRSGIAQDGALQQPRRSVSGYSGR
FT                   SGLASGLASPIDTTKSGFSNPIASPEEVRAGDLQAAGANNVGASARSPLRSQVGKQQTV
FT                   QSPIQSPLEDSAARGGFDSEAELGGLGGAAAAGGVEPASRRKSKGFSSGLSRFKTRKSL
FT                   FGGKPDEQPLPDLPKTDLTQAGAEDSEIGYSPAHKAQQYEGKTSESRPKNKLKSMLNKV
FT                   VEFGAENSGYQPPRGVKEQQKAEKTGAGFLREGEGSVPYTKHQRGASLGNGVGAGGVTT
FT                   DGGLATDGPAAVDSTTAKYGVVDDGTAAHAPAVGSGAATRGPSARVPSARGPATAGAAT
FT                   TGATTGPTIGTTAGPTTGATTGDVAAGTTAGAAAGGVGKRSGGGSHPWRRNAQPASATD
FT                   GGVASGKAPAASSAQQPNNHLGTAAPGLEETSESSNYDTEHVVDEGFADGYADGLRDSQ
FT                   YESGYDRAGRAEGTEKANGLGGSAAAADVAGEGGQEGMGYRQGVQDKLNQAKDSSWGQK
FT                   VIGKTKEEAQGQAKEQKGNLFKKLFKK"
FT   gene            <791893..>794520
FT                   /locus_tag="ZYRO0A09790g"
FT                   /old_locus_tag="ZYRO-ORF8861"
FT   CDS_pept        791893..794520
FT                   /locus_tag="ZYRO0A09790g"
FT                   /old_locus_tag="ZYRO-ORF8861"
FT                   /product="ZYRO0A09790p"
FT                   /note="some similarities with uniprot|P11978 Saccharomyces
FT                   cerevisiae YDR227W SIR4 Silent information regulator that
FT                   together with SIR2 and SIR3 is involved in assembly of
FT                   silent chromatin domains at telomeres and the silent
FT                   mating-type loci potentially phosphorylated by Cdc28p some
FT                   alleles of SIR4 prolong lifespan"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25859"
FT                   /db_xref="InterPro:IPR031556"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ98"
FT                   /protein_id="CAR25859.1"
FT                   /translation="MSKEDEAAARNIKLVRYTHPSPQNWKGKDGLEKSRSLPVQHKKKS
FT                   EGRLMDMLKSRSAKFHNLTVNRSLSAGPKDTRNGVKKNKETCFLPVRTPNTVSRPNPIS
FT                   PSAVQKLNLDTRLIPGNNSSNHGSFTSNVKKMLEEQRPQLNSIQKQQPVPHTSSRSANT
FT                   TPKKTDGTFQGERVKSPQLAKSPQQQHLKTNDKKSEHEDGRQVEKEADHKEEQREEKNK
FT                   EPLPQTHPSERGNSIRPERRLDENPHRDQFNKIPSQRQDRLEIEAEQAAEQSRPSSTES
FT                   RFNDETASSSTERTTPQAIEPENRHDSIRSGLLKLFKQVETENLASDSDSNFRIVQLLQ
FT                   GKRSEAGEQEEQEEEEFEVSDFDERDRSLQGSVVAFEGELGPPEDSGTSRLEVVYLSDE
FT                   EEEKRPRHKVLPPSSGLLRPASPRRSIPAMKDPMAEKRKNDREVAVDALAKLKDKKTFD
FT                   KDTFTQIIEKGVADHRALEGNPNVSVTNDVCSVNNYETSHAYYYQQFDRRSKLAWLSLH
FT                   EPTTSTGNEPLKEIWKSELLANFMSCTIFFHPITSSNLTADQQSSLDYQISQLKKLLQN
FT                   KFYIKLSGSLDKRVDIVILYGQNEKVLNELLEKKQNSSFRVWSLQRALNYLQDVGIDLQ
FT                   EWNIEKDAQDRESILDVPISEDSIQEDIEDSTEEVEREGNKETEREEENEETKEGEREE
FT                   HKETGKENAAEREENKETGKENAVEREEEKELEKEEDEELEEKVEEEPQSEKREPNPEK
FT                   NAPKLSKSPPKRVVKAKSSRKKDAYVQELLQQASGALDKRDAQLKAAHSIILALSRDVM
FT                   HQEVQITSLTGQLKYSKKELDRQTELAEQYRLCMAEQEVEMAQLRIQLAKKKSKKNRRA
FT                   SPNP"
FT   gene            <794785..>796419
FT                   /locus_tag="ZYRO0A09812g"
FT                   /old_locus_tag="ZYRO-ORF8857"
FT   CDS_pept        794785..796419
FT                   /locus_tag="ZYRO0A09812g"
FT                   /old_locus_tag="ZYRO-ORF8857"
FT                   /product="ZYRO0A09812p"
FT                   /note="some similarities with gnl|GLV|DEHA0A12507g
FT                   Debaryomyces hansenii DEHA0A12507g"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09812g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25860"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQ99"
FT                   /protein_id="CAR25860.1"
FT                   /translation="MDGNKRRGSQDFEDDIEPLNKLPKSNGNSNNIHEQNSGSMWIYSN
FT                   VSMKRNRIVESDNNPFLKSQKYLRRILSPNPQRDNGSSMNDADSGDARNSNKNLAQSPD
FT                   AAVKPIDESFRDIMNQLTGEIMNYEVKLASLYGKVEEMKTENVKIRNRYTLMCRGVVGS
FT                   LGGSNDFDQSVDTEEFSSDDETCASDGTEACDEPEMMNDGGKNEEFGVIVPSERFSKLK
FT                   DELDTLETRILNRFEELQENQKSTNNTSPNDLERLGVNLEDIPLVKNLRTDLRRSLEEL
FT                   KEVRKFTDIRVSNLKSTLTSERKISATARRDFESSKVYVKNAADFVNRANSHIEQYKLV
FT                   NQTQHNVIESLQRQLANVQEKIKNTQVQSASDQKNVSDEYRLVSEKYQRIFTAYTVLNS
FT                   ISQKQKSDVALLHHLYEEEKRKSVSLIAVVEQQRKLMNPTRYMGPITASEALTRLSALY
FT                   DNRCDESAREERTNLARMATIHVMYKNLLDQKDREHQGAIENLVRELNELKGINTAPQK
FT                   SDPSGQSRDIFDGDVDRAMANPEQHGV"
FT   gene            complement(<796638..>798506)
FT                   /locus_tag="ZYRO0A09834g"
FT                   /old_locus_tag="ZYRO-ORF8856"
FT   CDS_pept        complement(796638..798506)
FT                   /locus_tag="ZYRO0A09834g"
FT                   /old_locus_tag="ZYRO-ORF8856"
FT                   /product="ZYRO0A09834p"
FT                   /note="similar to uniprot|P39081 Saccharomyces cerevisiae
FT                   YDR228C PCF11 mRNA 3' end processing factor essential
FT                   component of cleavage and polyadenylation factor IA (CF IA)
FT                   involved in pre-mRNA 3' end processing and in transcription
FT                   termination binds C-terminal domain of largest subunit of
FT                   RNA pol II (Rpo21p)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25861"
FT                   /db_xref="GOA:C5DQA0"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR021605"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQA0"
FT                   /protein_id="CAR25861.1"
FT                   /translation="MDKEAEIVVKDFTSILEELTFNSRPIITTLTKIAEENIPCAQYFV
FT                   DALEAKLERCPPKQKLCAFYALDSICKNAGSPYTIYFSRNLFSLYRRTYLLVDNTTRTK
FT                   LINMFKTWMVPNESTGGYSPLFEKTALEKIEQFLIKASALHQKNFQSMLPTPTVPLLMR
FT                   EIDKLTALSTERLRAQPQDEKLNMKLVVLSQLKQELQREKLTAGALKQLQMQLRQIFAQ
FT                   DQQTLQDRQRHQQQEQFVQQQQQQLQQQQHQQQQQQHQNQNQNQQQNPLYGQSVIPLFG
FT                   DSSNIGRGVSSLFGGPQSILSPLNFSEFDRQSKKTKLQELYQSLDEEGLVYKPPKESIV
FT                   TLCSRLGADQNGLGTHQQQTHKPLPPMDFLHGILADCKASFATVHVDILNTPNLQLSQQ
FT                   VISNENPIVNNCLVHLLYRAKPNKCNVCGKRFGNDVEEKRLQAEHLDWHFRIHKRMKGS
FT                   EGTVISGTGLGGTAAQKNIQSRNWYLHDSQWVNFKDEEIVSTNRTTDESLTLANLDAQS
FT                   TNAQSSVPVEEIKSPETVAVDESILRKKYVVVPELAEDMSFQCPICKDAVTGLYDEDLG
FT                   EWVWKNSMEANGKYFHATCYYEAVKNNSGSNVVQLDLEKLKHLVSG"
FT   gene            <798939..>799844
FT                   /locus_tag="ZYRO0A09856g"
FT                   /old_locus_tag="ZYRO-ORF8854"
FT   CDS_pept        798939..799844
FT                   /locus_tag="ZYRO0A09856g"
FT                   /old_locus_tag="ZYRO-ORF8854"
FT                   /product="ZYRO0A09856p"
FT                   /note="highly similar to uniprot|P38988 Saccharomyces
FT                   cerevisiae YDL198C GGC1 Mitochondrial GTP/GDP transporter
FT                   essential for mitochondrial genome maintenance has a role
FT                   in mitochondrial iron transport member of the mitochondrial
FT                   carrier family (putative) mitochondrial carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25862"
FT                   /db_xref="GOA:C5DQA1"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQA1"
FT                   /protein_id="CAR25862.1"
FT                   /translation="MSTNDKKQTGLARLLGSASAGMLEIGVFHPVDTISKRLMTNHTKI
FT                   LNTTELNRVIFREHYQVPLSKRVFTLFPGLGYAACYKVLQRVYKYGGQPFVNEFLNKNY
FT                   KADFDNAFGSKTGKALRSATAGSLIGIGEVFLLPLDVLKIKRQTNPEAFRGRGFLGILK
FT                   DEGLFNLYRGWGWTMARNAPGSFALFGGNAFAKEYVLGIKDYSQATFAQNFVSSICGAC
FT                   ASLVVSAPLDVIKTRIQNRSFDNPETGITILKNTLKNEGITAFFKGLTPKLLTTGPKLV
FT                   FSFALAQSFIPMFDRLLQKN"
FT   gene            <800187..>802235
FT                   /locus_tag="ZYRO0A09878g"
FT                   /old_locus_tag="ZYRO-ORF8852"
FT   CDS_pept        800187..802235
FT                   /locus_tag="ZYRO0A09878g"
FT                   /old_locus_tag="ZYRO-ORF8852"
FT                   /product="ZYRO0A09878p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09878g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25863"
FT                   /db_xref="GOA:C5DQA2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQA2"
FT                   /protein_id="CAR25863.1"
FT                   /translation="MVQANYNLDEDGGENPFADPNLREDNHQEEEIDDILTPSPTTSHG
FT                   FGLHTSIPTDEDLTDVMVGDRRSSGSPKAVEYDGETLQQQIIPPGYNEHMMVKDSFLTG
FT                   RALLYFTSVFVSIGVFLFGYDQGVMSGCLTGKYFKRHFHDPSRAAIGIMVSILEIGALV
FT                   SSLVTSRLGEKLGRRRTIKYGSLVFIIGGLFQAFAGGIGYLIAGRLISGVGVGLLSTIV
FT                   PIYQSEISPPHNRGKLACIEFTGNIVGYATSVWIDYACSYFENNAAWRLPLFIQSVIGF
FT                   MLFSGSFVIVETPRWLLNHDRDVEGFIVIANLYSDGDLHHAKAKEEFQSIKETVLISRM
FT                   QGEGKSYVKVFKRYRRRMLIAMSSQMFAQLNGINVISYYAPLVFEKAGWVGRKALLMTG
FT                   FNGIMYIVSTLPPWILVDKWGRKPMLLTGSILMGFALACISLSMLANIKATPKLVVVFV
FT                   VIFNSSFGFSWGPIPWLYPVEIAPLSARSAMASASTATNWLCNWLVGIMTPILEEKISW
FT                   GLYWIHATSCFASFLAVYKIYPETAGVRLEDMDTIFNDRLPSFGVTKNNRSNSDPNNLE
FT                   MDMDSLTVNENNADADPFKSPEDEVNFKSNQSMLSRTNATDSLPIETPSMDEVLQFKEQ
FT                   QKSKGLGMVIRSGSRNMWYMINKFIPSKSSDSGTYNTIWNNDLENGS"
FT   gene            <802417..>802941
FT                   /locus_tag="ZYRO0A09900g"
FT                   /old_locus_tag="ZYRO-ORF8848"
FT   CDS_pept        802417..802941
FT                   /locus_tag="ZYRO0A09900g"
FT                   /old_locus_tag="ZYRO-ORF8848"
FT                   /product="ZYRO0A09900p"
FT                   /note="similar to uniprot|P26188 Saccharomyces cerevisiae
FT                   YDL200c, DNA repair methyltransferase (6-O-methylguanine-
FT                   DNA methylase) involved in protection against DNA
FT                   alkylation damage"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25864"
FT                   /db_xref="GOA:C5DQA3"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQA3"
FT                   /protein_id="CAR25864.1"
FT                   /translation="MEEKLYYRYLDHPITTVLLVSRGKTGCLVYASLGSNRKELLKISQ
FT                   SDFRKLSRSTKVSYGLYYDANDSMVNLERSFASYLDGSFTETIPYEYLFGTKFQHKVWD
FT                   ELLKIKTGETTTYRQIAEAIGSPKAYRAVGTAVGANKIAVIVPCHRCKPCDGSLGNFRW
FT                   GTQLKNRLLQQ"
FT   gene            complement(<802951..>803796)
FT                   /locus_tag="ZYRO0A09922g"
FT                   /old_locus_tag="ZYRO-ORF8847"
FT   CDS_pept        complement(802951..803796)
FT                   /locus_tag="ZYRO0A09922g"
FT                   /old_locus_tag="ZYRO-ORF8847"
FT                   /product="ZYRO0A09922p"
FT                   /note="highly similar to uniprot|Q12009 Saccharomyces
FT                   cerevisiae YDL201W TRM8 Subunit of a tRNA methyltransferase
FT                   complex composed of Trm8p and Trm82p that catalyzes
FT                   7-methylguanosine modification of tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09922g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25865"
FT                   /db_xref="GOA:C5DQA4"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR025763"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQA4"
FT                   /protein_id="CAR25865.1"
FT                   /translation="MKAKPLSQDPGSKRYAYRVNKEENRKELKHVRIDESEQKIDLPRK
FT                   RFYRQRAHSNPFSDHQLEYPVSPDEMDWSRLYPEFHDPTTGKMKSQVTIADIGCGFGGL
FT                   MVDLSPEFPDQLILGMEIRVQVTNYVEDKIIALRNNHAQQKGYQNINVLRGNAMKFLPN
FT                   FFYKGQLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLREGGVVYTITDVKDLHDW
FT                   MVKHLEEHPLFQRLSSEWESKDKCVKIMTHATEEGKKVERKKGDKYVACFERLPNPVIE
FT                   "
FT   gene            complement(<803998..>804750)
FT                   /locus_tag="ZYRO0A09944g"
FT                   /old_locus_tag="ZYRO-ORF8846"
FT   CDS_pept        complement(803998..804750)
FT                   /locus_tag="ZYRO0A09944g"
FT                   /old_locus_tag="ZYRO-ORF8846"
FT                   /product="ZYRO0A09944p"
FT                   /note="similar to uniprot|P36521 Saccharomyces cerevisiae
FT                   YDL202W MRPL11 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25866"
FT                   /db_xref="GOA:C5DQA5"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQA5"
FT                   /protein_id="CAR25866.1"
FT                   /translation="MNFVSRQLWGSSGLGFCSLRICSQTIVSRSFASYASRAAPAAFKT
FT                   SKSPQDGRDIVKPVTSRKTFLIDSYKQLMGSNPVILFVHYNNLMKNEDHHYRSQIKKAG
FT                   GSLTVLRNNLFSVYLRNSAFPDPCAPIKRRDQNLSHPLLPLFKGPTAAICFPETDPQSV
FT                   AKVLKLLEKSQDRLFVVGAKVETAVYDINQLSHFKNLPDKQGLQSQLLGLLHILSGAGL
FT                   VKTLEAGSQTLYLTLQSHHDNNEKDGQE"
FT   gene            <804999..>806114
FT                   /locus_tag="ZYRO0A09966g"
FT                   /old_locus_tag="ZYRO-ORF8845"
FT   CDS_pept        804999..806114
FT                   /locus_tag="ZYRO0A09966g"
FT                   /old_locus_tag="ZYRO-ORF8845"
FT                   /product="ZYRO0A09966p"
FT                   /note="similar to uniprot|Q04934 Saccharomyces cerevisiae
FT                   YDR229W IVY1 Phospholipid-binding protein that interacts
FT                   with both Ypt7p and Vps33p may partially counteract the
FT                   action of Vps33p and vice versa localizes to the rim of the
FT                   vacuole as cells approach stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25867"
FT                   /db_xref="GOA:C5DQA6"
FT                   /db_xref="InterPro:IPR037470"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQA6"
FT                   /protein_id="CAR25867.1"
FT                   /translation="MDRPDSGSVSPGRYAPHLSEFYSIVNNTSPSSSDGMVDGERRGSH
FT                   SMAAPSMTSNFSSISDLRTLVTKRDIKNTVDALQGLLDSSRAYNSSLQEVSRNASLMGH
FT                   SLENLARLKGCSDDSAEKLLSASGLFYLLANHENIMSQCLKGVLGESLLDKIDQFKVES
FT                   KKMENEFKSHAREESLKLKIQERHNLKLAQRRTRNLVSYKESLVNLQSQLDQLESLRHD
FT                   YYQDSYNLVESTCAKVLDAVATVSRARVEISENVARKGWSGGGLDDLLMDAEDPFNKED
FT                   STINEGQSEGEETIEDDNLKKGVASPQFSTAQPHNEMESEAEHDHSHENEDRDDDEDDG
FT                   NVDPDADNSFSLPLAGSSRSREPPIENDDES"
FT   gene            complement(<806161..>806757)
FT                   /locus_tag="ZYRO0A09988g"
FT                   /old_locus_tag="ZYRO-ORF8843"
FT   CDS_pept        complement(806161..806757)
FT                   /locus_tag="ZYRO0A09988g"
FT                   /old_locus_tag="ZYRO-ORF8843"
FT                   /product="ZYRO0A09988p"
FT                   /note="similar to uniprot|Q04935 Saccharomyces cerevisiae
FT                   YDR231C COX20 Mitochondrial inner membrane protein required
FT                   for proteolytic processing of Cox2p and its assembly into
FT                   cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A09988g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25868"
FT                   /db_xref="GOA:C5DQA7"
FT                   /db_xref="InterPro:IPR022533"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQA7"
FT                   /protein_id="CAR25868.1"
FT                   /translation="MGWWPWKSKKDESASEPVTDLPSASPSEPAPSSYSRGQKILLEDT
FT                   SPKFNNEMSQSQLANSKEQINFKQAWGTVSWRDFSVAKLTSIPCFRDSGLIGFTSMFVM
FT                   GGVTFLYHKNPSRAFNWSIGGLLLGSVVGWEQCRMRRKRSFQIAQMAKQTMANKERPMR
FT                   RNVDHDERIKGQWDNRHETASEQHDERKKPWYKFW"
FT   gene            <807115..>808851
FT                   /locus_tag="ZYRO0A10010g"
FT                   /old_locus_tag="ZYRO-ORF8842"
FT   CDS_pept        807115..808851
FT                   /locus_tag="ZYRO0A10010g"
FT                   /old_locus_tag="ZYRO-ORF8842"
FT                   /product="ZYRO0A10010p"
FT                   /note="similar to uniprot|Q07622 Saccharomyces cerevisiae
FT                   YDL203C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10010g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25869"
FT                   /db_xref="GOA:C5DQA8"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQA8"
FT                   /protein_id="CAR25869.1"
FT                   /translation="MYRDKYRQNPSYDEPFNLFPPHSVNSSREAVAPYPIEDANEVINP
FT                   IPVFTSSTTNSHSTTPTRRNHDRYEMPFQYAEPGLDPLMTSSHVRVPPSLSTPTDSSFP
FT                   REVHVGTPLNEAMVPPPPYEESEARILQEKAYRVESPPQEIQEPLPAAPQAQAQRQAQR
FT                   QAQPQAQPQPRSKDRHKGVERERDLSEYSPKAIEFYKVYKATVEDSTNFTHSIQMKWCE
FT                   TLLEYAFDDEFLSHYNINAEKLKRTLRPEESLKNQKVILGHSFRVLTKLVSHKCGSAMY
FT                   LMGTLYSHQPYLQIKNKNIVDRNDKKALEYYCRAAKTNHSDACYRAGVCFEYQRGTPAE
FT                   EFTKERALQKAFQYYERGAVHCANSSCMYKLGMFYLYGLSGQQDPLEALQWFKRASEGG
FT                   KSTQALYELGKIYEFTSLPPQVQSILTRYNINRDPATALKYFHKCAMEYDYPLAQWKLG
FT                   YCYEFGELQLPVIAKKSIAWYAKAALAQPKGNPMAMLALSGWYLTGAPDVLKPNDKEAF
FT                   KWASRACEASDGKLSRAEYALACYHENGIGCHRNLTEARIHFETATRLGHIKARDRLEK
FT                   GF"
FT   gene            <809241..>810914
FT                   /locus_tag="ZYRO0A10032g"
FT                   /old_locus_tag="ZYRO-ORF8840"
FT   CDS_pept        809241..810914
FT                   /locus_tag="ZYRO0A10032g"
FT                   /old_locus_tag="ZYRO-ORF8840"
FT                   /product="ZYRO0A10032p"
FT                   /note="highly similar to gnl|GLV|KLLA0C15059g Kluyveromyces
FT                   lactis KLLA0C15059g and similar to YDR232W uniprot|P09950
FT                   Saccharomyces cerevisiae YDR232W HEM1 5- aminolevulinate
FT                   synthase catalyzes the first step in the heme biosynthetic
FT                   pathway an N-terminal signal sequence is required for
FT                   localization to the mitochondrial matrix expression is
FT                   regulated by Hap2p-Hap3p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10032g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25870"
FT                   /db_xref="GOA:C5DQA9"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQA9"
FT                   /protein_id="CAR25870.1"
FT                   /translation="MESIARQSVKMCPFMQRAGSAKGLKALHNSNLPAAARQCPIVGHA
FT                   MKRTYATATGAPREASASNAKAARNANEVVANHATQESTFDYNGLFESEIDKKRVDKSY
FT                   RFFNNINRLAKEFPKAHRDVEEDKVTVWCSNDYLALSKNQQVVDAMKKTLDRYGAGAGG
FT                   TRNIAGHNRHALRLEAEIAALHKKEGALVFSSCYVANDAVLSLLGQKVKDLVIFSDELN
FT                   HASMIMGMKHAQTTKHIFRHNNYAHLEELLQMYPKSTPKLIAFESVYSMAGSVADIDKI
FT                   CSLAEKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEPHRVTGVESVPGNSTVMDRVDMI
FT                   TGTLGKSFGTVGGYVAASQRLVDWLRSYAPGFIFTTSLPPSVMAGATEAIRYQRSHLEL
FT                   RQLQQLHTGYVKQGMKELGIPVIPNPSHIVPVLVGNPDLAKQASDMLMDKHKIYVQAIN
FT                   FPTVSRGTERLRITPTPGHTDDLSEILLNAVDDVFKELQLPRVRDWESQGGILGVGEPG
FT                   FVEQSNLWTEEQLSLTNDHLNPNVLDPILDHLEVSSGIKV"
FT   gene            complement(<811216..>812541)
FT                   /locus_tag="ZYRO0A10054g"
FT                   /old_locus_tag="ZYRO-ORF8839"
FT   CDS_pept        complement(811216..812541)
FT                   /locus_tag="ZYRO0A10054g"
FT                   /old_locus_tag="ZYRO-ORF8839"
FT                   /product="ZYRO0A10054p"
FT                   /note="some similarities with uniprot|Q04947 Saccharomyces
FT                   cerevisiae YDR233C RTN1 reticulon gene member of the RTNLA
FT                   (reticulon-like A) subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10054g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25871"
FT                   /db_xref="GOA:C5DQB0"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQB0"
FT                   /protein_id="CAR25871.1"
FT                   /translation="MSSYPKGVRAQPPQAPSDYASTGATTGGAAPSVPVKDPTTDLLLW
FT                   KNPIETGKYFGLSLLTLLILKKVNLITFFLRVLYTVIFTTGGIEFVSKVVLGQGLVSKY
FT                   SLKECPNVVGCLRPRIEELLRHLPTYQAKLRTLVFADEPKQNMKAGLVLYFLHKFFSWF
FT                   SVWTIVFLGVISAFTLPLVYHTHQEEIDAAVNHALKIARAKSAEFSKIASEKSRPYLEK
FT                   LDCKLGPVSKFVKTQYANYNRASAAPKTTSSAAPQATTAGLAAKVPFEHSAAPTGSEEQ
FT                   GAYVSGHAPSATTAASRGVPSSRSAAAGAAGTAGAATHEAHPSEAFSQKQTSSPLQATA
FT                   QTFSSHIPTETPTAGSTGISHHHLSDLNDEYNSHFGHDFSVHDVEDAANKASDKTGHKF
FT                   PQVPSSNPLSSEANHDFSVDQLQNELRQNKDSLTQELNFNKH"
FT   gene            complement(<813860..>813956)
FT                   /pseudo
FT                   /locus_tag="ZYRO0A10065r"
FT                   /note="RDN58-1 58S rRNA"
FT   gene            <814329..>816422
FT                   /locus_tag="ZYRO0A10076g"
FT                   /old_locus_tag="ZYRO-ORF8835"
FT   CDS_pept        814329..816422
FT                   /locus_tag="ZYRO0A10076g"
FT                   /old_locus_tag="ZYRO-ORF8835"
FT                   /product="ZYRO0A10076p"
FT                   /note="similar to uniprot|P49367 Saccharomyces cerevisiae
FT                   YDR234W LYS4 Homoaconitase catalyzes the conversion of
FT                   homocitrate to homoisocitrate which is a step in the lysine
FT                   biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10076g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25872"
FT                   /db_xref="GOA:C5DQB1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004418"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR039386"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQB1"
FT                   /protein_id="CAR25872.1"
FT                   /translation="MLRFSRLFHTTPRRNAQNLTEKIVQKYAVGIPSGKEVRMGDYVSI
FT                   QPEHCMSHDNSWPVALKFMGLGAKKIHNPRQIVNTLDHDIQNQDAKNLTKYKNIENFAK
FT                   SQGVDFYPAGRGIGHQIMVEEGYAFPLTLAVASDSHSNTYGGVGALGTPLVRTDAAAVW
FT                   ATGQTWWQIPPVARVELRGSLPHGISGKDVIVALCGVFNNDEVLNHAIEFAGDISALSV
FT                   EHRLTIANMTTEWGALSGLFPVDKTLLQWYKEKRLPKMPNDHPRINSTRLGLLERQLAQ
FT                   NDAALRPDNDAQYAKKLVLDLNSLTHYVSGPNSVKVSAPVQDLADVKVNKAYLVSCTNS
FT                   RLADLEDAAAVVCPTGDLNDIRKVAPGVSFYVAAASSEVEADAKATGAWDKLLRAGCTV
FT                   LPPGCGPCIGLGTGLLEPGEVGISATNRNFKGRMGSREALAYLASPAVVAASAVTGHIA
FT                   SPAEVIGQPDAKFSGIKASTDTQSEEAPAAEAADSNASAATESGTEILEGFPSKISGEL
FT                   VFCDADNVNTDGIYPGKYTYQDDVPRETMAKVCMENYDSAFGDIAKPGDILVSGYNFGT
FT                   GSSREQAATALLAKGIPLVVSGSFGNIFFRNSINNALLTLEIPELISLLREKYSSEAAK
FT                   PTRRTNIFLTWDVAHKKVVVTEGSPEGPVILEQQVGELGKNLQEIIVSGGLEGWVMRKL
FT                   GTQ"
FT   gene            <816642..>817625
FT                   /locus_tag="ZYRO0A10098g"
FT                   /old_locus_tag="ZYRO-ORF8834"
FT   CDS_pept        816642..817625
FT                   /locus_tag="ZYRO0A10098g"
FT                   /old_locus_tag="ZYRO-ORF8834"
FT                   /product="ZYRO0A10098p"
FT                   /note="similar to uniprot|P28789 Saccharomyces cerevisiae
FT                   YDL205C HEM3 Phorphobilinogen deaminase catalyzes the
FT                   conversion of 4-porphobilinogen to hydroxymethylbilane the
FT                   third step in the heme biosynthetic pathway localizes to
FT                   both the cytoplasm and nucleus expression is regulated by
FT                   Hap2p-Hap3p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10098g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25873"
FT                   /db_xref="GOA:C5DQB2"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQB2"
FT                   /protein_id="CAR25873.1"
FT                   /translation="MSRRIRIGGRQSQLAIVQSELVKHLIEQKFPDITCSVFALQTLGD
FT                   QQQSKPLYSFGGKALWTKELEDLLYDEDDNRKLDIIVHSLKDMPTTLPDGFELGGITER
FT                   VDPSDCLVMPQGSPHKNLDTLPAGSVVGTSSVRRSAQLKRKYPHLRFESIRGNLHTRIR
FT                   KLDDPQNDYQCIILASAGMKRLGLGYRITNTFDSSVMYHAVGQGALGIEIRAQDKEMKK
FT                   ILDAVCHKNTTVCCLAERQLMRSLEGGCSVPIGVGSRYDETTGYLHLRGIVVSVDGKQA
FT                   VELNQELAINDVIRDSIECGKLLAEKMISNGARKILEEINLDKIDQ"
FT   gene            <817803..>819386
FT                   /locus_tag="ZYRO0A10120g"
FT                   /old_locus_tag="ZYRO-ORF8833"
FT   CDS_pept        817803..819386
FT                   /locus_tag="ZYRO0A10120g"
FT                   /old_locus_tag="ZYRO-ORF8833"
FT                   /product="ZYRO0A10120p"
FT                   /note="similar to uniprot|Q03776 Saccharomyces cerevisiae
FT                   YDR235W PRP42 U1 snRNP protein involved in splicing
FT                   required for U1 snRNP biogenesis contains multiple
FT                   tetriatricopeptide repeats"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10120g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25874"
FT                   /db_xref="GOA:C5DQB3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQB3"
FT                   /protein_id="CAR25874.1"
FT                   /translation="MDRFSRVVSDPAFSELTLEVARFPKSLEGWERLLNHLTTVASPLN
FT                   KNIDTRLYQLLISTYQSFLCQFPYLENYYVDYALLEYRLGHLNKMHRIFQHGLAVFNNK
FT                   SLLLWTSYLKICNEVVPKSKQLLEKYELAEDHIGMHFFAGEFWQMYLEQVKLRSNQQQR
FT                   FFSILRKTLEIPLYSFSHFYAVWLRCVDDIQDLSQLKKLAPKEDLIKKLKIDIDTGGRK
FT                   GPRLQEAKKLLRKFTRELYLVIQYQVLEIYSLYESKIQTRYYVSPETLIPTHELELWQK
FT                   YLEYTVNLKIDDLTHLNFQRALLPLAHYDIVWIQYARWLVDWKEDLLTAKQVLTKGISL
FT                   SLKKSKLLKFLYTILCSLNEFDQLQWIIDHVETAYSNHIEETDDFELFWDYVHFQLFIK
FT                   PQSGDVLDIISRRLDHCQAREGQFLLLSALLQLQKMDNTSSIEDRIFQHLIKNNWDYYL
FT                   KDGRFWSLYSRLIYLDPNRSYLERRRCISNQVWTKARERPTKSEILPHLQQFCQSYLPE
FT                   DIDHLEDLFQ"
FT   gene            complement(<819449..>821542)
FT                   /locus_tag="ZYRO0A10142g"
FT                   /old_locus_tag="ZYRO-ORF8832"
FT   CDS_pept        complement(819449..821542)
FT                   /locus_tag="ZYRO0A10142g"
FT                   /old_locus_tag="ZYRO-ORF8832"
FT                   /product="ZYRO0A10142p"
FT                   /note="similar to gnl|GLV|KLLA0C15191g Kluyveromyces lactis
FT                   KLLA0C15191g and weakly similar to uniprot|Q12424
FT                   Saccharomyces cerevisiae YDL206W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10142g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25875"
FT                   /db_xref="GOA:C5DQB4"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQB4"
FT                   /protein_id="CAR25875.1"
FT                   /translation="MRLYQRCIVAAFFYSINAILIILSLKSERLWQFYVEPIGLFGCFV
FT                   MLGSIASDFLTPSLSQISRDILHVSDRVSGFTLLAMGNAIPDITGTYQAMNAGAITLAI
FT                   GELLGGIFFLLTVVLGSMALIKTIELKPMDRLSCNLESLAEPLSVDESGSVAYNRQLFV
FT                   QDMSIFAGLILLSIYFLCDGTLMLWECAVMVLAYCAYATFLVFDHKRDNLLPSSPVVSA
FT                   QRENSDAMADITTIVSNVEVPEISRRGNIHMFNEGIRERRANIRRRIRQYLRVNYNRWI
FT                   RIRLRDFLDIWENETLLKNQQVAAADICSDIESEFDQDTIPPLVARRRASSWQEGDISA
FT                   DLPVISHPPPETQSSEGSVHYSGPQENDQLLSVPQKRPVCSKSLSCDHLPDLRPLYYTL
FT                   TPVGQSDEQHVVVMESQAVEGSPKTFKSWLQRFKLYGYLTDANAFVPTSEFILLLFTTP
FT                   LTIWLTILVPVMPQDKQDKPHHILDVIRFSLVPAISSLLLAEECPLSVLLLCSILFIIL
FT                   SFRWYKGIINWNINLRAIAGFVLSLSATSFNVHLVVNILMKWGEKFNISNTILGLTVFA
FT                   WGNSFGDLVSNIVFMEIGVLDIALGACFGSPLLYFLLGIGVDGIILMLGSHKGCEKSLI
FT                   KCGIDFQVDSHLSLSAIGVLVSFIILGIVVPINGWRIDKKISITLLVLYIFITGLNIYI
FT                   EVI"
FT   gene            complement(<821877..>822446)
FT                   /locus_tag="ZYRO0A10164g"
FT                   /old_locus_tag="ZYRO-ORF8830"
FT   CDS_pept        complement(821877..822446)
FT                   /locus_tag="ZYRO0A10164g"
FT                   /old_locus_tag="ZYRO-ORF8830"
FT                   /product="ZYRO0A10164p"
FT                   /note="similar to uniprot|Q03778 Saccharomyces cerevisiae
FT                   YDR236C FMN1 Riboflavin kinase phosphorylates riboflavin to
FT                   form riboflavin monophosphate (FMN) which is a necessary
FT                   cofactor for many enzymes localizes to microsomes and to
FT                   the mitochondrial inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25876"
FT                   /db_xref="GOA:C5DQB5"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQB5"
FT                   /protein_id="CAR25876.1"
FT                   /translation="MELRPNDWLIPEEPESPFPIVTNFCDIEFGFGRGSAELGIPTANV
FT                   PLEQLPPETQDLELGVYFGYALLKRVNREDTTALRNDGRTVTYNYGKLLKETNDDLKIH
FT                   PVVLSVGKNPFYHNKLKTVELHILHHFQADFYGAQVKFNLLGRIRPELNYNSKEALIDD
FT                   INKDKLIASEILSRPNYLKYQKQVDH"
FT   gene            complement(<822619..>824211)
FT                   /locus_tag="ZYRO0A10186g"
FT                   /old_locus_tag="ZYRO-ORF8829"
FT   CDS_pept        complement(822619..824211)
FT                   /locus_tag="ZYRO0A10186g"
FT                   /old_locus_tag="ZYRO-ORF8829"
FT                   /product="ZYRO0A10186p"
FT                   /note="some similarities with uniprot|Q12315 Saccharomyces
FT                   cerevisiae YDL207W GLE1 Cytoplasmic nucleoporin required
FT                   for polyadenylated RNA export but not for protein import
FT                   component of Nup82p nuclear pore subcomplex contains a
FT                   nuclear export signal"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10186g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25877"
FT                   /db_xref="GOA:C5DQB6"
FT                   /db_xref="InterPro:IPR012476"
FT                   /db_xref="InterPro:IPR038506"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQB6"
FT                   /protein_id="CAR25877.1"
FT                   /translation="MRFVLDELYDISDDEDVSPFSTDEPSPDEYTFVNEKEVDIPRLKL
FT                   PRQHSRQSSEVSEKLDAEYEQLLSQLNLRAKLPTVESIPTVVPGSSGQASERSLENSAS
FT                   PSASASKFASSGSVVAHDTRDILSALANSLVSKMNQLDIDNSAQVQSVRNAKRKAEEDR
FT                   RRKEEEARKHQEELAKRRREEEDAKKRQLEEERKRQEAERKLKEEKEQQEQRTRDEQEK
FT                   ALIAEQARRGKTVTDFKGIEKTFWHYKDKILQIKKEIVEPVKQMDVDTRNLISRHKRKI
FT                   NPKFGQLTNSNQQLQSIQMELFGLIDQTKANQLAYLWVLNFIAKALVHQSETEVRVKPE
FT                   SALPLAKLTLALMTRYPDLKELLMARLVKKCPFVIGYTCKIDTEKGRSNMGWKRNSDDK
FT                   WEEDTSYDERMGGMVTLFAVITRLPLSVEVINQQQHPLPISYSWRLLARIANTSQDLLT
FT                   NSHFVVLGSWWDAAALQFYQAYGKQAQKLLQLVGDNLTSAVAQQKYVGAARLRILMEEW
FT                   QTSGIKSFPEMID"
FT   gene            <824470..>825357
FT                   /locus_tag="ZYRO0A10208g"
FT                   /old_locus_tag="ZYRO-ORF8827"
FT   CDS_pept        824470..825357
FT                   /locus_tag="ZYRO0A10208g"
FT                   /old_locus_tag="ZYRO-ORF8827"
FT                   /product="ZYRO0A10208p"
FT                   /note="similar to uniprot|P36519 Saccharomyces cerevisiae
FT                   YDR237W MRPL7 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10208g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25878"
FT                   /db_xref="GOA:C5DQB7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQB7"
FT                   /protein_id="CAR25878.1"
FT                   /translation="MQKFSCSKRCFSSSSVAYKSHCSLVNPVHHRVRIDKSRLSPRFPE
FT                   LNLDKNDIRNPGFNPVTTHQDRVHEHYLNTLKSDMLLINYAHNAQTKAGLKKRSWDGSS
FT                   PYHINRPLRKPQGSTSQLPDLHPVKWHNIPEVTSVVLNCYVREAKENKLLAISAALQLQ
FT                   QITGCKPHPIFSKSDVPSWKLRRGNQMGAKIELKGRPMSQFLSTLTEIVMPRIREYKGI
FT                   SNKSGNGLGSLSFGLTSEDVKFFPEIDSNQDLWPKTFGMHININTSAQTDVQARTLVSG
FT                   FQIPFHGVEKKRIA"
FT   gene            <825679..>826005
FT                   /locus_tag="ZYRO0A10230g"
FT                   /old_locus_tag="ZYRO-ORF8825"
FT   CDS_pept        825679..826005
FT                   /locus_tag="ZYRO0A10230g"
FT                   /old_locus_tag="ZYRO-ORF8825"
FT                   /product="ZYRO0A10230p"
FT                   /note="similar to uniprot|P53305 Saccharomyces cerevisiae
FT                   YGR215W RSM27 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25879"
FT                   /db_xref="GOA:C5DQB8"
FT                   /db_xref="InterPro:IPR013219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQB8"
FT                   /protein_id="CAR25879.1"
FT                   /translation="MTVSKDRLLKVAELSAKIFDQNFNPSGVRTGSQILAKRLKGPAVA
FT                   SYYGDPDLLRFRHLRTLYPGFKFADLDEEYRLTMLEARKRRGKGAPKKKKEATSGGGKA
FT                   KKRK"
FT   gene            complement(<826106..>827953)
FT                   /locus_tag="ZYRO0A10252g"
FT                   /old_locus_tag="ZYRO-ORF8824"
FT   CDS_pept        complement(826106..827953)
FT                   /locus_tag="ZYRO0A10252g"
FT                   /old_locus_tag="ZYRO-ORF8824"
FT                   /product="ZYRO0A10252p"
FT                   /note="similar to uniprot|P53306 Saccharomyces cerevisiae
FT                   YGR216C GPI1 Membrane protein involved in the synthesis of
FT                   N-acetylglucosaminyl phosphatidylinositol"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25880"
FT                   /db_xref="GOA:C5DQB9"
FT                   /db_xref="InterPro:IPR007720"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQB9"
FT                   /protein_id="CAR25880.1"
FT                   /translation="MNLNRYIFWPQELNSRSLRLPSEELAAIAIALRGTDYVVLDAVPN
FT                   QLIDDKELESPYAIVGKRKAYSNQWEFSIKQTCIIEFRAPRIELLQFFSLEPISLSLPE
FT                   KEYDANDSCKEARSLCQIWDHPRYQAHDRRLRQSLKLLNLFSTHLAALYHRYPHYSRKS
FT                   VKTYNRRIALWNRLKPVRNFLASICFYVTIFACHLATCIYLILNNGLLPLVNLSVTARQ
FT                   IDLRCQQICYFPVQYLRINVNVSIRKALPRFRTYSEASANLRKDLPSKYYPDYIRFYNT
FT                   LWLMLNDVSFGLIFGSILLEKCDEIAPVLHRVITYCLYHCINTVTLVLAQNPVGIKLNE
FT                   ELALFLSDMFLWTIDFSNLMFIKPLADVGTLKFFINGLAKMSCVFGGTFALSMILDYFS
FT                   ILSIHIYLFYRISSKIYHWQLNIMISLFYLFCGKKKNILRNRVDNNFFQLDELLLGTLF
FT                   FIILVFLTPTVLAFYFSYTVLRMAAITIEIILESIIALLNHFPLFALLLRIKDPRRIPG
FT                   GISLKLKKNEDVPHFELKNKPLSIYFMFKPFVVLMDHIRDNFYSIKTLKQITLGLPVTI
FT                   KRNRLYQILYSSLPKRPIDIHTLYDKWEQFTNTKDRKLD"
FT   gene            <828154..>834159
FT                   /locus_tag="ZYRO0A10274g"
FT                   /old_locus_tag="ZYRO-ORF8823"
FT   CDS_pept        828154..834159
FT                   /locus_tag="ZYRO0A10274g"
FT                   /old_locus_tag="ZYRO-ORF8823"
FT                   /product="ZYRO0A10274p"
FT                   /note="similar to uniprot|P50077 Saccharomyces cerevisiae
FT                   YGR217W CCH1 Voltage-gated calcium channel involved in
FT                   calcium influx in response to mating pheromones"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25881"
FT                   /db_xref="GOA:C5DQC0"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQC0"
FT                   /protein_id="CAR25881.1"
FT                   /translation="MVNTKRRLTQLFEPGNNDEDDQGDTSGGHDTNIPLVKPSVNVVPP
FT                   QTDDEDNYEADNDENEIGLSDKEDNETPKKESTLGNMFKNQSTSKLGKARPKLTLRTGS
FT                   FNNDSNKNVGHSKSFSSLSGDLFKGKGRRRSNSSNPQDQGTSPDSNTYSDRPPKSARIL
FT                   SYIAAEDMDEFHDIEKDFQSAMDTDGLSWLPQLGQMRSKSSANLLVDNGPDSGKSQGYI
FT                   EDADHLGDKFGESESLQPDVGHSNAPEHGKSSILGLALHSPSRKDDAGSFFDKSSHVEV
FT                   SSFEVEVANFDEEQEEGSWQLYGNSLGLISPTNPVRLKLAALQMSEKYRFFMVVMLSLF
FT                   TCLMAYRTYEPHSNILFSFSNWADVINFLLCVLFTLSDVSKIIAFGFWDDSEMFAAYGK
FT                   KYVSLLEKFGVIKLYLYLRNKYGPQIINTIIPFRIATDEEEGKFQRKSLGDSWSEEEIK
FT                   RRSKRKNFEVPRAFARSSWNRIDLTSTICFWIALFLTINDYDRKNGIRIFKTLAILRIL
FT                   RLVNTDTGLSSILRGIKQAVPQLINVGTMLVYFWVLFGVLGVQSFRGSFRRQCVWTNPN
FT                   DPTDTYTYDNQFCGGYLDPKTGAPKNYVFADGSEGPISKGFLCPRNSKCVSDTNPYNGR
FT                   VSFDNIVNAMELVFVIMSANTFTDLMYYTMDSDEMAASLFFIIAIFVLTIWMMNLLIAV
FT                   LVSSFQLANERFKKKKLDLNTVESWPLRITKGYWRYFQVKARNKKFPAWARKGLFFFNK
FT                   INPIFVALIVVDAILRCLLDAKVSESFTQTFFKIDVSICSVLFVESIFRLIFHLPNIWK
FT                   FLTEFSYVYDLVISLLTLIISSLKVQGYLGHSYYWLSILHISRLYRVIFFFGFTSNLWR
FT                   RVLGNGIMIWNLSAFYFFFTFLVSIIMSVFFEGVLPDSEEDNQSFGMYSLPNSFLSLFI
FT                   IGSTENWTDILYELQSHAFNMSSSFLSSVLLIVWFILSNSVILNIFIALISETMEVKEE
FT                   EKRPLQIKHYLKYVYPQKIKDYTHATLLRRVRKKFFGNRTNEDSKDFKQFLIRGTAIMN
FT                   IAQNMGDLANEFRKDQNPGGLPNWLAAGLGKVTEGFSFMQKLKMYTDNPFYKNPKVIFN
FT                   EGDDRTRKTFSLELDEYEDEKLEYLKMHPSFNYSYFILPPRHKFRRFCQRLVPPSVGRR
FT                   TDGVQFYDDGTDEYGQKFYFRHIERDIFVLFLSIITLLLIVFSCYVTPLRRMQENMGVW
FT                   GWSTYIDVGFVCILSLEFLVKTVADGVLYTPNAYLRNPWNIIDFIVLVSMWINFIAFVK
FT                   NNGDLSRIFRGLTALRALRCLTISNMARQTFNMVVFDGIRKIFEATFVSLTLLFPFAIW
FT                   GMNIFRGRLGTCTDNNMGRDDCYNEFTNSVFQWDVMMPRVYQQPYLYLDSFGSALRSMY
FT                   EIVSLEGWVDLLENLMNSTGVGTVTSTFASPGNAVFLVLFNFLSMVFILNLFVSFIINN
FT                   HAKTTGSAYYTLEEKSWLESQKLLSQAKPKVTPSLIELPRSRQFFYMLAIEKGNFYYAS
FT                   FLQLTLYLHIIVLLCRSYKEPHATTTFEDTYFMVSATIFFMQEIFHLYGEGFRLYIRSK
FT                   WNVLRFGIVVTSFVLTAIGLKLSSDQIWFSNIKELFHLVMFLLIIPQNDTLSELAETAV
FT                   ASWPPILSLTYTWAILFLVYAIALNQIFGTTRLGANTTDNINFRTVIKSLIVLFRCSFG
FT                   EGWNYIMDDLTVSEPYCSSTKEGSFASDCGSRTYAYILLMSWNIVSMYIFLNMFISLII
FT                   GNFSYVYRRGGSNSAIDRREVLKYSDAWAKYDSDGTGYLEFSHLPRLMHSFNGPLSFKI
FT                   WEGRHTVPNLVKNYMTVNPEDPYDVKIDFPGLNKELNSIDWTEVAHRRLQYRRFVHEVL
FT                   YTNSYWGAIRFSSLLQLIPLYTTYNPRECLGIDEYVRYLYNMGKVDKILDTERNLDILN
FT                   MVVTSWKYCVKSKKRLPKVEDDISRQTIEVPTNPFTDEFESDSGDVNFANTPSMDFGVD
FT                   NFMWSPRKR"
FT   gene            complement(<834376..>838395)
FT                   /locus_tag="ZYRO0A10296g"
FT                   /old_locus_tag="ZYRO-ORF8819"
FT   CDS_pept        complement(834376..838395)
FT                   /locus_tag="ZYRO0A10296g"
FT                   /old_locus_tag="ZYRO-ORF8819"
FT                   /product="ZYRO0A10296p"
FT                   /note="similar to uniprot|Q02979 Saccharomyces cerevisiae
FT                   YPL110C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25882"
FT                   /db_xref="GOA:C5DQC1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="InterPro:IPR033506"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQC1"
FT                   /protein_id="CAR25882.1"
FT                   /translation="MKFGKTFPNHQVPSWSHQYVNYKGLKKLIKEITEQQEKLYREEHA
FT                   NLKDNNQPPTKVRDSSKVEQNYMDNEEVKKLLAFFFFALDRDIEKVDNFYNMQFSEYER
FT                   RLRKLTSSAQFADINNSLMIQSGISLVPRDLQHPQPKINGLNPNYSNTSQPMMPSVSHT
FT                   PEDISEDLVEVLGILVELRSHFRNLKWYGELNKRAFTKILKKLDKKVGTHQQHAYLQAR
FT                   ILPLDFSNDSGISKSLNAINDFLDKVSYKVQDKVSNGTKLSEEEISGVESKNGGLPNDV
FT                   ISLLIEKNDGIGLINELTAIYRSLVLIPTRILVNLLNKSALSQSFQCMDELLKIIPTLR
FT                   DPTDMNARNFFHHHVIALGKNHKKLSESTAKGAGSPTFATVNTHLNRSHDSSVENEENL
FT                   DEINNLNSLLKETLDLEAAELPDHNSKLIGAFGPDGINSNDSPASLIHILEKLPAHLRP
FT                   CLLQKDNYKRTPLHYSAQYGLVEITRIIIENLANWGAWNPDVSIDDTSYWGDSESLTPL
FT                   HLAVIGSHPQTVRTLLSYVNSNQVVTCPHLLHLATRLNSGSLVESLLSAEGFDLNFCDE
FT                   ESHETPLYLASKLNLYDAAACLLKHGANTELREKLFGWTPIFVAATEGYERIVQLLRDH
FT                   GAEYVVFDDSGWTPMEHAALRGHLNITKMLKITDHPEICHPKMPSDDMESATNGNNGNL
FT                   QSPSPDSTTSLATQSDTSTIHSNSNGIVNGSNGSVYGKSDNQSSIEHKPKSSNTKINHR
FT                   ALLKSSTPGGHHKSHSNNGVLQPVKSFGHRYLNSDESLLMITLGGNDSRNTKPAISLNK
FT                   VPVSKVSSTQLDTALSLVISCADDLSKTPHVLDLPLDDNLDAITFKVPSKSDHSHVVFF
FT                   DIVPTYGSLPPRSSESPFSYHGDFNTHSYYRNPGMLGSEASLSSSNNTFRNNGSPRVLG
FT                   RAVALLSKTGAFVGINRRSLNDLITVPIVANETMDVLGTVSFEHFMVTAFNHPKMSLGR
FT                   TETYWKSLVSTRVIGHRGLGKNFNSKKSLQLGENTVESFIAAASLGASYVEFDVQLTKD
FT                   NIPVVYHDFLVAETGVDVPMHELTLEQFLDLNNVDGHMDVVNRKDRRRSVDDLESGVHK
FT                   TRFDDTNAKGGAHEDVSKLLENRMRLTRTYKKDNFKGNFRGHSIASSFVTLKELFKKIP
FT                   QNVGFNIECKYPMADEAEQEDIGQIAVEMNHWVDTVLQVVYDNANGRDIMFSSFHPDVC
FT                   VLLSLKQPSIPILFLTEAGTAQMADVRASSLQNAVRFARSWNLLGIVAAAAPIIQAPRL
FT                   AQVVKSSGLVCVTYGVENNDPENANIEMDAGVDAVIVDSVLAIRKELTKANANAR"
FT   gene            complement(<839096..>840907)
FT                   /locus_tag="ZYRO0A10318g"
FT                   /old_locus_tag="ZYRO-ORF8817"
FT   CDS_pept        complement(839096..840907)
FT                   /locus_tag="ZYRO0A10318g"
FT                   /old_locus_tag="ZYRO-ORF8817"
FT                   /product="ZYRO0A10318p"
FT                   /note="similar to uniprot|Q02981 Saccharomyces cerevisiae
FT                   YPL109C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10318g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25883"
FT                   /db_xref="GOA:C5DQC2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQC2"
FT                   /protein_id="CAR25883.1"
FT                   /translation="MFRILNRSWTFLRTPAIRNLVIPTSIALFYSQKQTCYYKLWNESL
FT                   KPLPGGDTFEMGLYLASQHELRQEVIQKRSNRLRTSSNSIIRQLKRLWFEVKDHLVEPI
FT                   YTMLRFIEIFAIFAPVLICYPITFFGRRHKLDRDEVHILETSGSLIWYRLLRKALELAG
FT                   PSFIKLGQWAGSRTDMFSPGLCHELSNLHSNSKPHSLKYSKQRICQSLDNQFEFDEIFD
FT                   EFREKPLGVGAIAQVYMGKLSDKFIRSMQNQNTDFDGNDSDGWVAVKVIHPNCGKKINR
FT                   DLKIMQFIANVIDELPTMVWLSLPAEVEQFSILMRLQLDLRIESLNLTRFNKNFENSLQ
FT                   TKFPRGFPQFSSREVLFEEYIHGFPMETFLQVKDKLRSTELCKKVSDLFIDAFLQMLIL
FT                   DDFIHADLHPGNVMIRFLKTDKYGTHVTSTEREHFSIVHKLRQLAHENNSDELVKELKY
FT                   ALQEYTPQICFIDAGLITELNKQNRINFIALFNALARFDGYQAGELMIERSRTPETAVD
FT                   KELFAFKVEKLVTKVKKRTFTLGTVSIGDLLDQMLTMVRSHHVRMEGDFVSVVVAILLL
FT                   EGIGRQLDPELDLFARFVSFFFIYGFH"
FT   gene            complement(<841263..>841814)
FT                   /locus_tag="ZYRO0A10340g"
FT                   /old_locus_tag="ZYRO-ORF8814"
FT   CDS_pept        complement(841263..841814)
FT                   /locus_tag="ZYRO0A10340g"
FT                   /old_locus_tag="ZYRO-ORF8814"
FT                   /product="ZYRO0A10340p"
FT                   /note="highly similar to uniprot|P38116 Saccharomyces
FT                   cerevisiae YBR164C ARL1 Soluble GTPase with a role in
FT                   regulation of membrane traffic; regulates potassium influx;
FT                   G protein of the Ras superfamily, similar to ADP-
FT                   ribosylation factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25884"
FT                   /db_xref="GOA:C5DQC3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQC3"
FT                   /protein_id="CAR25884.1"
FT                   /translation="MGNFFSSMFDRLWGVNKELRILILGLDGAGKTTILYRLQIGEVVT
FT                   TKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMATA
FT                   AKELHLMLQEEELQDSALLVFANKQDQPGALTASEVSKELNLVELKDRSWSIVASSAVK
FT                   GEGITEGLDWLIDVVKEEQL"
FT   gene            <842988..>843692
FT                   /locus_tag="ZYRO0A10362g"
FT                   /old_locus_tag="ZYRO-ORF8813"
FT   CDS_pept        842988..843692
FT                   /locus_tag="ZYRO0A10362g"
FT                   /old_locus_tag="ZYRO-ORF8813"
FT                   /product="ZYRO0A10362p"
FT                   /note="similar to gnl|GLV|CAGL0I10813g Candida glabrata
FT                   CAGL0I10813g and some similarities with uniprot|P38290
FT                   Saccharomyces cerevisiae YBR165W UBS1 Ubiquitin-
FT                   conjugating enzyme suppressor that functions as a general
FT                   positive regulator of Cdc34p activity nuclear protein that
FT                   may represent a link between nucleocytoplasmic transport
FT                   and ubiquitin ligase activity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10362g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25885"
FT                   /db_xref="GOA:C5DQC4"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQC4"
FT                   /protein_id="CAR25885.1"
FT                   /translation="MVVLTRKLLRDWKSLNRHYSHFSARENALFCIRPQDSNLHIWHLV
FT                   IFNPVTKVEVYLKLYIGDEDEPSIILKCLTPNTLFPIGRSVSLTHLNYFLVEDGFLPLL
FT                   QQIWRLFFDNCEQMGNSRLTFAWNRIMCKEFKIHFPELLGNLVSGDYSMVKNYYNASGV
FT                   ANPNDVMDDTQPVLTTPIQCHSSNGDTTNTIACDDFPRSQKRQRSTGESVDFITPGSDD
FT                   DDGTPLRKRLRR"
FT   gene            complement(<843877..>845199)
FT                   /locus_tag="ZYRO0A10384g"
FT                   /old_locus_tag="ZYRO-ORF8812"
FT   CDS_pept        complement(843877..845199)
FT                   /locus_tag="ZYRO0A10384g"
FT                   /old_locus_tag="ZYRO-ORF8812"
FT                   /product="ZYRO0A10384p"
FT                   /note="similar to uniprot|P20049 Saccharomyces cerevisiae
FT                   YBR166C TYR1 Step of tyrosine biosynthesis pathway
FT                   Prephenate dehydrogenase (NADP )"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10384g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25886"
FT                   /db_xref="GOA:C5DQC5"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012385"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQC5"
FT                   /protein_id="CAR25886.1"
FT                   /translation="MVSEDQIKQWKSSKTIGIIGLGDMGLLYAKEFSKAGWKVVACDKE
FT                   EHYQALKTLHADLPFEIVANGHLVSRVSDFIIYSVEAESIEKIVSLYGPSSKVGAIVGG
FT                   QTSCKNPEIAAFERHLPLDTEIITVHSLHGPKVSTEGQPLVLIKHRCQHEESFQFVQTV
FT                   MSCLKSKFVYLDYEEHDKITADTQAVTHAAFLSMGAAWAKLKVYPWNMGLEKWYGGLEN
FT                   VKVNISLRIYSNKWHVYAGLAITNPAAHQQILQYATSATELFTIMLAHDKAKLVERLQK
FT                   AKEFVFGSHKGLLLLDDKLLDKFSFSGSLDNAQGEPIPNSHLSLLAIVDSWYQLGINPY
FT                   DHMICSTPLFRVFLGVSEYLFLTPELFEKTIDAAINCESFRRDDLEFVVSAREWSSIVG
FT                   FANFELYRKQFEQVQKFFEPMFPKANKVGNEMLKTIASHSQ"
FT   gene            <845321..>845932
FT                   /locus_tag="ZYRO0A10406g"
FT                   /old_locus_tag="ZYRO-ORF8811"
FT   CDS_pept        845321..845932
FT                   /locus_tag="ZYRO0A10406g"
FT                   /old_locus_tag="ZYRO-ORF8811"
FT                   /product="ZYRO0A10406p"
FT                   /note="similar to uniprot|P32459 Saccharomyces cerevisiae
FT                   YIR032C DAL3 Ureidoglycolate hydrolase converts
FT                   ureidoglycolate to glyoxylate and urea in the third step of
FT                   allantoin degradation expression sensitive to nitrogen
FT                   catabolite repression"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10406g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25887"
FT                   /db_xref="GOA:C5DQC6"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQC6"
FT                   /protein_id="CAR25887.1"
FT                   /translation="MTSMIAEALTIESFAPYGSIISPDEEISKLDESAKNANQGTAIKL
FT                   LKRSKVENPLTQQVPNWNLFRCFSQPHLKISLHAKDSTKAATINHSIRVLEKHPYSSQT
FT                   FLPMGCSSQEFGYLVVVALENPETKKPDISTARAFLCKGNQAVTYGAGVWHAPMIVVGA
FT                   REYIDFGVLIYELLDPNAPEKDCMECFYGASDLLVTMYTS"
FT   gene            <846010..>846507
FT                   /locus_tag="ZYRO0A10428g"
FT                   /old_locus_tag="ZYRO-ORF8810"
FT   CDS_pept        846010..846507
FT                   /locus_tag="ZYRO0A10428g"
FT                   /old_locus_tag="ZYRO-ORF8810"
FT                   /product="ZYRO0A10428p"
FT                   /note="similar to uniprot|Q02872 Saccharomyces cerevisiae
FT                   YPL108W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25888"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQC7"
FT                   /protein_id="CAR25888.1"
FT                   /translation="MLWGRLIRMAMSDSEVVGSMEAVPVPAPVTTGPATSTISVDGITG
FT                   EVTVRKASGKVKVRKGQSKEEYENQLHDYFQLNGGPRKTEEKWMDEVDPLRLLQEKDLT
FT                   IKLNRQSLSNFCERLYYQRRYDECLTLGEELLRRYQEVNKKNKMQREIEELEYMVKRSK
FT                   GK"
FT   gene            complement(<846539..>846907)
FT                   /locus_tag="ZYRO0A10450g"
FT                   /old_locus_tag="ZYRO-ORF8809"
FT   CDS_pept        complement(846539..846907)
FT                   /locus_tag="ZYRO0A10450g"
FT                   /old_locus_tag="ZYRO-ORF8809"
FT                   /product="ZYRO0A10450p"
FT                   /note="similar to uniprot|P38291 Saccharomyces cerevisiae
FT                   YBR167C POP7 Subunit of both RNase MRP which cleaves pre-
FT                   rRNA and nuclear RNase P which cleaves tRNA precursors to
FT                   generate mature 5' ends"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10450g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25889"
FT                   /db_xref="GOA:C5DQC8"
FT                   /db_xref="InterPro:IPR014612"
FT                   /db_xref="InterPro:IPR020241"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQC8"
FT                   /protein_id="CAR25889.1"
FT                   /translation="MAKLIKKHPTVKSISHKQVHSTLYLKSKTPYVSALKRINKFLANV
FT                   NRTGSTYVIVLGMGKAVEKALSLACHFQDQLQKRVEILTKSVDVMDELSNDDDDDPPDV
FT                   DTELRKRTISGVEIRIYP"
FT   gene            <846938..>848161
FT                   /locus_tag="ZYRO0A10472g"
FT                   /old_locus_tag="ZYRO-ORF8808"
FT   CDS_pept        846938..848161
FT                   /locus_tag="ZYRO0A10472g"
FT                   /old_locus_tag="ZYRO-ORF8808"
FT                   /product="ZYRO0A10472p"
FT                   /note="similar to uniprot|P38292 Saccharomyces cerevisiae
FT                   YBR168W PEX32 Peroxisomal integral membrane protein
FT                   involved in negative regulation of peroxisome size
FT                   partially functionally redundant with Pex31p genetic
FT                   interactions suggest action at a step downstream of steps
FT                   mediated by Pex28p and Pex29p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25890"
FT                   /db_xref="GOA:C5DQC9"
FT                   /db_xref="InterPro:IPR006614"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="InterPro:IPR029953"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQC9"
FT                   /protein_id="CAR25890.1"
FT                   /translation="MSTCVSLKVRKVNLHYKTVHQPKSDMAKEASDYYCRAHFIYHHGQ
FT                   KPSLTLVTPATMSSVLHRIYPLLLIADATLSNLMWICEDLCLPFIHLVMVLMVVNFLCE
FT                   DLQVDISHIAQLWLGLMSLFFLAFSVAYYILTLYQDLLYESEPPTVDDIVIVLESVVDK
FT                   LETIQHEGLSVNKRRALQLAVLLTPLHWGLIKLVSMKNYCMGFTLMCILYHSNWFQCTL
FT                   KLFWRILLTRKVYYGLERLFNGHGPFPKKPVDFFRAISSSEYIYRMALPHDVKALHSHK
FT                   LQLRLQQLFPWDKPLHNDENGSDLMVIEFKINENQRKWQADGWTARMLPYERTKYSIEL
FT                   GGKINTCHSPWQFQESDLKNWSWLDDCWRPTDWIYSDTNWDFKGVHDSLDCCTRTRAWK
FT                   RRVYRLME"
FT   gene            <848539..>849303
FT                   /locus_tag="ZYRO0A10494g"
FT                   /old_locus_tag="ZYRO-ORF8807"
FT   CDS_pept        848539..849303
FT                   /locus_tag="ZYRO0A10494g"
FT                   /old_locus_tag="ZYRO-ORF8807"
FT                   /product="ZYRO0A10494p"
FT                   /note="similar to uniprot|Q02873 Saccharomyces cerevisiae
FT                   YPL107W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25891"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="InterPro:IPR039251"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQD0"
FT                   /protein_id="CAR25891.1"
FT                   /translation="MRCVESIAMQGIMFSQVSRRFLSVSPRLNMTFEGNKEGLAGTAEE
FT                   RMSHIFGAGRLRGEPPKSSSRRIRGESRLIAGVQVPSRPVEPDNCCMSGCINCVWELFN
FT                   DDIREWRRRRKEAAQRIKDTEDIWPRDWSPPLPYLSLKNVPESLKTEKIHMDRQRKNQK
FT                   QKNISTASLFPQREGPLPKTVQEAKRRNLQEREKEPEKQEATDTSKGSSSEEPIYDDDD
FT                   GWQNVPVYIRAFAEFERTKKLQRLQAQEQNQT"
FT   gene            complement(<849541..>851625)
FT                   /locus_tag="ZYRO0A10516g"
FT                   /old_locus_tag="ZYRO-ORF8805"
FT   CDS_pept        complement(849541..851625)
FT                   /locus_tag="ZYRO0A10516g"
FT                   /old_locus_tag="ZYRO-ORF8805"
FT                   /product="ZYRO0A10516p"
FT                   /note="highly similar to uniprot|P32589 Saccharomyces
FT                   cerevisiae YPL106C SSE1 HSP70 family member highly
FT                   homologous to Ssa1p and Sse2p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10516g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25892"
FT                   /db_xref="GOA:C5DQD1"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQD1"
FT                   /protein_id="CAR25892.1"
FT                   /translation="MSTPFGLDLGNHNSVLAVARNRGIDIVVNEVSNRSTPSIVGFGQR
FT                   NRFLGEAGKNKQTSNVKNTVENLKRIIGLGYDDKEFPEEAKYFSNKLVKLEDGKVGAQV
FT                   KFVNKDHVFSAPQLAGMFFDRVKDTVQTETKANISDVCLAVPSWYTEEQRYVVADAARI
FT                   AGLNPVRVVNDVTAAAVSYGVFKPDLPDVDQKPRVVALVDIGHSSYTCSVIGFKKGEFK
FT                   VLGTAWDKHFGGRNFDRAITEHFAQEFKTKYKIDINENPKAYSRVVAAAEKLKKVLSAN
FT                   SSAPFNIESVMNDIDVSSQFSRVELEELMKPLLERVHEPIYKALAQAKLSVEDVDFVEL
FT                   IGGTSRIPVLKETISKAFNKQLSTTLNQDEAIAKGAAFICAIHSPTLRVKPFKFEDMHA
FT                   YSVSYSWDKQVEDEDHLEVFPAGSTFPSTKMITLHRTGDFVMEAYYTHKEELPEDVPTH
FT                   IAKWEITGVQLPEGATSVPVKLKLRCDPSGLHIIEEAYTLEDITVKEEIPLPEDAPEGA
FT                   EPEYKEVTKTVKKDTLNIVEHTFGLKPEELNLLVEKENEMTSQDKLVAETEDRKNALEE
FT                   YIYTLRGKLDEEYAPFASDQEKTKLRDQLAKAEDWLYEDGYDSTKAKYVAKYEELASTG
FT                   NIIRGRYLSKQEEQKQALRQKDEAKKMAELSEKLSAQRKSEAENKESSKKDAEGDVNLD
FT                   "
FT   gene            <852296..>854122
FT                   /locus_tag="ZYRO0A10538g"
FT                   /old_locus_tag="ZYRO-ORF8803"
FT   CDS_pept        852296..854122
FT                   /locus_tag="ZYRO0A10538g"
FT                   /old_locus_tag="ZYRO-ORF8803"
FT                   /product="ZYRO0A10538p"
FT                   /note="similar to uniprot|P36062 Saccharomyces cerevisiae
FT                   YKL146W AVT3 Vacuolar transporter exports large neutral
FT                   amino acids from the vacuole member of a family of seven S.
FT                   cerevisiae genes (AVT1-7) related to vesicular GABA-
FT                   glycine transporters"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10538g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25893"
FT                   /db_xref="GOA:C5DQD2"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQD2"
FT                   /protein_id="CAR25893.1"
FT                   /translation="MDTSSTSPSVSKGKPNDKDHSLVDIHNPDPQVVDIVNRHLVHSPN
FT                   NLQLQGADVTRDLYKWSTDQQQLPLETATGTVPTSPRDDIHSPIPLSQRRRSISFSGMS
FT                   IQSSSPNNYLSADVPGTTMTHEEIRAPGGFRRSFILRQHERKYGATAPPPNFFTRNFIE
FT                   FLTLYGHFAGQDLGEDEDEDEYEDGRGHEDEESVLLERVPTRDSKKQQRKATTFKAILL
FT                   LLKSFVGTGVLFLPRAFHNGGWAFSTGCLLFCAIASSLAFVLLIKTKDKVGVSGYGDLG
FT                   KALYGPKVEFSILFSIALSQLGFSAAYTVFTATNLKVFFENAFNFPADSVPLSAYIILQ
FT                   ALIFIPLSLTRNITKLSGTALIADLFILLGLLYVYYYPALYIAKHGIATDSVLFFNRSD
FT                   WSLFIGTAIFTFEGIGLLIPIQESMKKPEHFYPSLGFVMSIVTFIFVSSGLLCYLAFGA
FT                   KVETVVLLNFPQDSIATISVQLIYSLAILLSTPLQLFPAIRIFETWTFPSNASGKHNHR
FT                   VKWLKNYFRTGVVIFTALLAWVGANDLDKFVSLVGSFACIPLIYIYPPLLHLKSSDTQT
FT                   SKFIILGDLLIFFFGVGVMAYTSYQNIVLWGN"
FT   gene            <854410..>855816
FT                   /locus_tag="ZYRO0A10560g"
FT                   /old_locus_tag="ZYRO-ORF8802"
FT   CDS_pept        854410..855816
FT                   /locus_tag="ZYRO0A10560g"
FT                   /old_locus_tag="ZYRO-ORF8802"
FT                   /product="ZYRO0A10560p"
FT                   /note="highly similar to uniprot|P33299 Saccharomyces
FT                   cerevisiae YKL145W RPT1 One of six ATPases of the 19S
FT                   regulatory particle of the 26S proteasome involved in the
FT                   degradation of ubiquitinated substrates required for
FT                   optimal CDC20 transcription interacts with Rpn12p and the
FT                   E3 ubiquitin-protein ligase Ubr1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10560g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25894"
FT                   /db_xref="GOA:C5DQD3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035245"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQD3"
FT                   /protein_id="CAR25894.1"
FT                   /translation="MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAP
FT                   YATKLKETEKDLKDIEQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCT
FT                   KIIKSTSDSNENGEGLDGAAGPGATSENRDADDAEEDEDAKYVINLKQIAKFVVGLGER
FT                   VSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKL
FT                   REVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELV
FT                   QKYVGEGARMVRELFEMARSKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQ
FT                   LDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSV
FT                   ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKF
FT                   SSTSRYMQYN"
FT   gene            complement(<855900..>856529)
FT                   /locus_tag="ZYRO0A10582g"
FT                   /old_locus_tag="ZYRO-ORF8799"
FT   CDS_pept        complement(855900..856529)
FT                   /locus_tag="ZYRO0A10582g"
FT                   /old_locus_tag="ZYRO-ORF8799"
FT                   /product="ZYRO0A10582p"
FT                   /note="highly similar to uniprot|P35718 Saccharomyces
FT                   cerevisiae YKL144C RPC25 RNA polymerase III subunit C25"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10582g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25895"
FT                   /db_xref="GOA:C5DQD4"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQD4"
FT                   /protein_id="CAR25895.1"
FT                   /translation="MFTLSKISELVRIPPDQFHRDTISSITHELNNAYANKVIPHIGLC
FT                   ITVYDILEVDEGQLRPGDGASYINVTFRALVFKPFVGEVITGWISKCTAEGIKVSLLGL
FT                   FNDIFIPQNMLFEGCSYSPDENAWIWPMDESNQLYFDVNEKIRFRVEQEVFVDVKPKSP
FT                   KEREHEEQERQQAEEAGVAYNETKSPAYALLGSCQTDGMGVVSWWE"
FT   gene            <856725..>858101
FT                   /locus_tag="ZYRO0A10604g"
FT                   /old_locus_tag="ZYRO-ORF8798"
FT   CDS_pept        856725..858101
FT                   /locus_tag="ZYRO0A10604g"
FT                   /old_locus_tag="ZYRO-ORF8798"
FT                   /product="ZYRO0A10604p"
FT                   /note="similar to uniprot|P34078 Saccharomyces cerevisiae
FT                   YKL143W LTV1 Protein required for growth at low
FT                   temperature"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10604g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25896"
FT                   /db_xref="GOA:C5DQD5"
FT                   /db_xref="InterPro:IPR007307"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQD5"
FT                   /protein_id="CAR25896.1"
FT                   /translation="MSKRFNKKNSQKYVVVHRPHDDPEYYDNDASEHVLVPASNPNTAK
FT                   TAERPPPLVEDPVQTAGKKENEHVGEAMLYGINFDDSKYDYTQHLKPIGTDPENSLYIP
FT                   AKKPVDKTKSKKSIDDLFVEPKYQNADPSKNEPLFARGVAKPEYLERQQNVADELTGFR
FT                   PDMNPALREALEALEDEAYVVNKDRELRKAQENTDENDEDDIFQQLLEGGQAADDEEFE
FT                   DNLDEWDIDNLDEYEDEHYQKEMEELDNVENLEDLKNIDYQADVQRFKKEKKRDIFEDE
FT                   VSSTGPQSVEPEDEVEEEEEEEEIDGLGELPSIKQTKGKKRKDRQKMGTKSDLTGFSMT
FT                   SSAIARTETMTILDDKYDNVISGYENYQDEQEDLEEKQSKPFDMSQERSDFESMLDDFL
FT                   DNYELGKGGREFHKKDEEEQNMKNAADEVSKGKLSQRRNKERKAKSTKGITNSLSSLHI
FT                   "
FT   gene            <858296..>858946
FT                   /locus_tag="ZYRO0A10626g"
FT                   /old_locus_tag="ZYRO-ORF8797"
FT   CDS_pept        858296..858946
FT                   /locus_tag="ZYRO0A10626g"
FT                   /old_locus_tag="ZYRO-ORF8797"
FT                   /product="ZYRO0A10626p"
FT                   /note="similar to uniprot|P35719 Saccharomyces cerevisiae
FT                   YKL142W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10626g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25897"
FT                   /db_xref="InterPro:IPR012917"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQD6"
FT                   /protein_id="CAR25897.1"
FT                   /translation="MSSELNQIKQQVADLQRLVKKQSLIISKTGQNVLEMQVSKQRSDV
FT                   NAIGSKSSESKHGIPQLEANDVVTNEDLVQLVGELQGQLDTIEERNVRRLVNCVKSQPD
FT                   DILAPLPNADGEIPKGGSEGVFPTTLNDFEKIDDVALFKLAKFYELLPPSLKEQEKFED
FT                   FMEGKVEEFHISEMPDEEVQKELKNYSSGQLEDTFNELARYLGLRARRGTATW"
FT   gene            complement(<859035..>861005)
FT                   /locus_tag="ZYRO0A10648g"
FT                   /old_locus_tag="ZYRO-ORF8796"
FT   CDS_pept        complement(859035..861005)
FT                   /locus_tag="ZYRO0A10648g"
FT                   /old_locus_tag="ZYRO-ORF8796"
FT                   /product="ZYRO0A10648p"
FT                   /note="highly similar to uniprot|P47077 Saccharomyces
FT                   cerevisiae YJL010C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10648g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25898"
FT                   /db_xref="GOA:C5DQD7"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040000"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DQD7"
FT                   /protein_id="CAR25898.1"
FT                   /translation="MGKPRGRKLLKQQEKDQFKPAKEFDVPDEQDNFDGSNGTDSDPQM
FT                   FFGVLDREELEYFKHAEATLSMDAFDNAEEKKQFVTNVIEETRGKELKLVISQICSKLM
FT                   ERLILDCDDQQLKSIFKAFNGVFYNLSCHKYASHVLETLLVRGAALVEKELLTPSFDGE
FT                   TDEESFITMENVYLYMLNEVKPHLKAMINHRYASHVLRLLILILASKNLPKTTQNNSTL
FT                   RSKKSKIARKMIDIKDNDDFDRVHQTPESFKLELKDFLKNLYAGFTNGAASRSDISPTY
FT                   VTKFRELCVDPVASPVIQLIIQVEGIFDRERSFWRLVFNTTDETDAKEEAFLEYLLSDP
FT                   VGSHFLENVISFARTKFVERLYNLYMKPKITKLAQRDTTGAFVVQALLRHLKDKEVKEI
FT                   LEELVPQLSMLLNSNIDFGTSIIEASIKEDNYLRDEVINQLLVKYYPEQNENRNILESC
FT                   LLLSSSTLGNTRDDWPTAEERRRSLFLEQLIGYDSKFVDVTIESMLKLPEERFLQMAYH
FT                   GVFSHVVEHVLKPTIVDAIKRKLLLNVLCKDVVNMSCNAYGSHIVDKLWEFTAKLTLYK
FT                   ERIANSLLKESDKVKNSSYGKRVWRNWHLDQYVRKPMDWRRIVKEQDVAIFPNAQPLQP
FT                   KNPLKRPKHTDLPPSKRKGVK"
FT   gene            complement(<861234..>862949)
FT                   /locus_tag="ZYRO0A10670g"
FT                   /old_locus_tag="ZYRO-ORF8795"
FT   CDS_pept        complement(861234..862949)
FT                   /locus_tag="ZYRO0A10670g"
FT                   /old_locus_tag="ZYRO-ORF8795"
FT                   /product="ZYRO0A10670p"
FT                   /note="highly similar to uniprot|P47079 Saccharomyces
FT                   cerevisiae YJL008C CCT8 Subunit of the cytosolic chaperonin
FT                   Cct ring complex related to Tcp1p required for the assembly
FT                   of actin and tubulins in vivo"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10670g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25899"
FT                   /db_xref="GOA:C5DQD8"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012721"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQD8"
FT                   /protein_id="CAR25899.1"
FT                   /translation="MSLKLPQNLNSGLFKQGYNSYSNSDGQINKSIAAIREIHQMCLTS
FT                   MGPCGRNKIIVNHLGKIIVTNDAATMLRELDIIHPAVKVLVMATEQQKMDMGDNTNLVM
FT                   VLAGELLIVSEKLIALGLSAVEIIQGFNMAKNFTLEELDKLVVGDVIDKSNPQELIKVI
FT                   KPVIASKKYGSEDLLSQLVAEAVSHVLPQSSQGTIPYFNVDSIRVVKIMGGSLVNSTVI
FT                   KGMVFNREPEGHIKSLPEGGKHKVAVFTCPIDIANTETKGTVLLHNAQEMLDFSKGEEK
FT                   QIDAMMKEIADMGVTCVVAGAGVGELALHYLNRYNILVLKVPSKFELRRICRVCGATPL
FT                   PRLGAPTPEEIGVVETVKTMEIGGDRVTVFKQESEEATRTSTIILRGATQNNLDDIERA
FT                   INDGVAAIKGLMTPNGGKLLPGAGATEIELVSRITKYGERTPGLLQLAIKQFALAFEVV
FT                   PRTLADTAGLEVNEVLPNLYAAHTVVSGEKDEEAARKECLFKGVDILKDTSDGLTDIRE
FT                   DSVYDLLAPKKFAINVATEAATTVLSVDQIIMAKRAGGPAPPQAKRPGNWDQDD"
FT   gene            <863275..>863347
FT                   /locus_tag="ZYRO0A10692r"
FT                   /old_locus_tag="Zyro0A.tMet.CAT.18"
FT   tRNA            863275..863347
FT                   /locus_tag="ZYRO0A10692r"
FT                   /old_locus_tag="Zyro0A.tMet.CAT.18"
FT                   /note="tRNA-Met (CAT) cove score=71.12"
FT   gene            <863919..>866423
FT                   /locus_tag="ZYRO0A10714g"
FT                   /old_locus_tag="ZYRO-ORF8793"
FT   CDS_pept        863919..866423
FT                   /locus_tag="ZYRO0A10714g"
FT                   /old_locus_tag="ZYRO-ORF8793"
FT                   /product="ZYRO0A10714p"
FT                   /note="similar to uniprot|P47061 Saccharomyces cerevisiae
FT                   YJL029C VPS53 Required for Vacuolar Protein Sorting Vps53p
FT                   is a hydrophilic protein that is peripherally associated
FT                   with the late Golgi and forms a stable complex with Vps52p
FT                   and Vps54p."
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10714g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25900"
FT                   /db_xref="GOA:C5DQD9"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="InterPro:IPR031745"
FT                   /db_xref="InterPro:IPR038260"
FT                   /db_xref="InterPro:IPR039766"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQD9"
FT                   /protein_id="CAR25900.1"
FT                   /translation="MISNSVDYNPFEDITTILSAKESLNDIDRLICATRRYKLQLADEI
FT                   KESEGQEESDKVGRSSDERRFDFGKVFREIEETKNFASGTQSTISQLTEGISHLDNAKR
FT                   NLTQCMTLFQNLQILTDSYFHCKELIGRSAYKEMASSYKMMCSLAENTFKPYKSVDEIN
FT                   KLLASISRLRADTFEKIKHSYSRVLSGKVAESEAIEAELREGACDILDSDSSGKAQIID
FT                   TCLKKLLNEIGEIFRVDDEAGSLENLSRRYIFFKKVLNNFNSKFARYFLAEWEMPLRLT
FT                   STFFKMTAKDLEILLKKEFQGKDASIDLFMGALQETLDFEKYIDVRFSNKLRETKLSQH
FT                   FESYLSLWVSHQDKMMNEKFLSYMSGGDLGSNLGDSLIIPSSADLFRTYRSVLTQTFEL
FT                   IENNSNNGILVSLANFFTKWLIAYSNKILQPLILPDSEEMQNKEETIKYTVTMINTADY
FT                   CSVTIGQLEEKLAELSPDPVKIEQSFAMVRDTYDGLSAKGNSILLNRVLSVDLAFVARE
FT                   FNNLDWARVVVENYSRYMTTLKEILCFDPSPGRKSTLQLILSQFNRDVYSWNFLDKVID
FT                   QVTQEFSGYIIRLLQPMPPFATSTSTRKFDPIKVVSIGEQLLLDTELLKEILYSLPGSV
FT                   SDEANSAQTTAFKRVKKHIDTNLSQLLQFIKILVAPLSSVDDYHEAYQKLTDYNTSSVV
FT                   WAYLLSLKGIPWDFNLWKQHWSAFDMDRDSHGSNDGNKDLFIFKWNTKLLTQFEYNLLR
FT                   IQDPTWSKFVKEELEVKPTPRNPSKIRVHTNPRAYQYQTPPSDGPESHQQQQQQSPQGT
FT                   PTSPLANVKNLMTSNRFFDIGG"
FT   gene            complement(<866467..>867066)
FT                   /locus_tag="ZYRO0A10736g"
FT                   /old_locus_tag="ZYRO-ORF8792"
FT   CDS_pept        complement(866467..867066)
FT                   /locus_tag="ZYRO0A10736g"
FT                   /old_locus_tag="ZYRO-ORF8792"
FT                   /product="ZYRO0A10736p"
FT                   /note="highly similar to uniprot|P40958 Saccharomyces
FT                   cerevisiae YJL030W MAD2 Component of the spindle-assembly
FT                   checkpoint complex which delays the onset of anaphase in
FT                   cells with defects in mitotic spindle assembly forms a
FT                   complex with Mad1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10736g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25901"
FT                   /db_xref="GOA:C5DQE0"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="InterPro:IPR027097"
FT                   /db_xref="InterPro:IPR036570"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQE0"
FT                   /protein_id="CAR25901.1"
FT                   /translation="MSNSISLRGSTRTITEFFEYSINSILYQRGVYPQEDFTTIRKYGL
FT                   TLLKTHDEELKAYIRRILAQVHKWLVGGKCNKLVLCIVDKDEGDKVEEWSFDVVQFSKL
FT                   DQNQVELPQEVDDNETQNQIRSLIRQITASVTFLPELNNEGNYTFNVLAYTDANAKVPL
FT                   EWSDSDNKPINNGETVQFKSFRTNDHQVGAQVSYRY"
FT   gene            <867206..>868257
FT                   /locus_tag="ZYRO0A10758g"
FT                   /old_locus_tag="Zyro0A.mRNA.2674.p"
FT   CDS_pept        join(867206..867208,867280..868257)
FT                   /locus_tag="ZYRO0A10758g"
FT                   /old_locus_tag="Zyro0A.mRNA.2674.p"
FT                   /product="ZYRO0A10758p"
FT                   /note="highly similar to uniprot|Q00618 Saccharomyces
FT                   cerevisiae YJL031C BET4 Alpha subunit of Type II
FT                   geranylgeranyltransferase required for vesicular transport
FT                   between the endoplasmic reticulum and the Golgi provides a
FT                   membrane attachment moiety to Rab-like proteins Ypt1p and
FT                   Sec4p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10758g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25902"
FT                   /db_xref="GOA:C5DQE1"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR032955"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQE1"
FT                   /protein_id="CAR25902.1"
FT                   /translation="MHGVKRKQWTQELLKQKKEQDRKRITQYRGLVDKLLDSRDSKTYN
FT                   MEVFKETTQLLRINPEYNAGWNYRRDIIEHLSPELKHEFWEDELAFSMALLKDYPKVYW
FT                   IWNHRKWTLENHIDKSVKIWLRELAIVSKLLQMDPRNFHGWHYRRILVAEIEGRTGQSR
FT                   DGEELQYAIDNTNKNISNYSAWHQKATLIPKMFEKDEIKDKKKFIQDEFTYITNAIYTD
FT                   AEDQSVWFYIEWFVKNHIVIDALGRDELIQKLQELQENILAINEDDLQFSGKQNNWCLK
FT                   VLIVLEDVQRNLKVQFTPHSHEYLAQLIEADPMRKNRYLHLLHRK"
FT   gene            complement(<868275..>869261)
FT                   /locus_tag="ZYRO0A10780g"
FT                   /old_locus_tag="ZYRO-ORF8790"
FT   CDS_pept        complement(868275..869261)
FT                   /locus_tag="ZYRO0A10780g"
FT                   /old_locus_tag="ZYRO-ORF8790"
FT                   /product="ZYRO0A10780p"
FT                   /note="similar to uniprot|P46962 Saccharomyces cerevisiae
FT                   YJL006C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10780g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25903"
FT                   /db_xref="GOA:C5DQE2"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQE2"
FT                   /protein_id="CAR25903.1"
FT                   /translation="MSTKFDTQLLLSRPYLTKRELTRLQRDSITDRRTYNQKKLAVIKF
FT                   MSEICLQLNFPRRTLETAIYFYQRYHVFNRFETELCYTVATSSLLLSCKQVETIKKVNE
FT                   LCSVSLRLRNVPKPSSEMLDNFKKGVFQIELRILESCSFDYRTNNFLHIDECVVKFGKT
FT                   FNLDYQVCLLAWVIGYDVLKLDTLLTIPQHTIALAVLKIAYQILTPGSDWFQLVARRNL
FT                   ETDKYSLNEAYFDILNFYINSFDICDLKNNIPPGISYFGLEKFIELKKNAGPEFGLHDF
FT                   NEKDIEMDPYFTSHRDYSVRERRYVLSPKLVQDEIKTNSSNTVGGRV"
FT   gene            complement(<869465..>871780)
FT                   /locus_tag="ZYRO0A10802g"
FT                   /old_locus_tag="ZYRO-ORF8789"
FT   CDS_pept        complement(869465..871780)
FT                   /locus_tag="ZYRO0A10802g"
FT                   /old_locus_tag="ZYRO-ORF8789"
FT                   /product="ZYRO0A10802p"
FT                   /note="similar to uniprot|P20448 Saccharomyces cerevisiae
FT                   YJL033W HCA4 Putative nucleolar DEAD box RNA helicase high-
FT                   copy number suppression of a U14 snoRNA processing mutant
FT                   suggests an involvement in 18S rRNA synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10802g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25904"
FT                   /db_xref="GOA:C5DQE3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQE3"
FT                   /protein_id="CAR25904.1"
FT                   /translation="MPRKQHLTTSQRKQIRKREDQYIEELHTKTQEFNNPKATYFQDLP
FT                   LSNAVLRGLKDASYVKLTDIQRDSIPVSLKGNDVLGAAKTGSGKTLAFLIPVLEKLYRE
FT                   RWTEYDGVGALIISPTRELAMQIYEVLIKIGTHCSFSAGLVIGGKDVKFEAERISKINI
FT                   LIGTPGRLLQHLDQSVGLNIDNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPIRQTLLF
FT                   SATQSQSLNDLARLSLTDYKTVGTPANVSGSQPETPETLQQHYIVVELADKLDTLFSFI
FT                   KTHLKCKMIVFFSSSKQVHFVYETFRKLQPGISLMHLHGRQKQRARTETLDKFSRAQQV
FT                   CLIATDVVSRGIDFPAVDWVVQVDCPENVDTYIHRVGRSARYGKQGKSLIMLTPQENEP
FT                   FLQRLKGRRIEPNMLNIKQSKKKSIKPQLQSLLFKDPELKYLGQKAFISYVRSIYIQKD
FT                   HEVFKFDQLPTEEFAQSLGLPGAPKIKLRGMGAIERSKDLKNAPRQLLKLNKADENGEF
FT                   EDKPKEARTKFDKMFERKNQTVLSEHYLNITKSQAQADEDDGDFISLKRGDHQLKEEDL
FT                   PPLIAPQSKRAVRKALSKKASLASKGNASKMVFDEDGQAHPVYELEDEEQFHEKGDAMS
FT                   QKQEFLTKEAEIMAQKDVEDKQLAKEKRQEKKRKQLEALRREMEENESYYSEDEEPTVL
FT                   LGTGNLSDDMDEHSEGEDKEEENESQEQDEQESDFEEPPRKKHAAHREQKQDDGLLEVE
FT                   EPETLEDLESLTSRLINQ"
FT   gene            <871927..>872439
FT                   /locus_tag="ZYRO0A10824g"
FT                   /old_locus_tag="ZYRO-ORF8788"
FT   CDS_pept        871927..872439
FT                   /locus_tag="ZYRO0A10824g"
FT                   /old_locus_tag="ZYRO-ORF8788"
FT                   /product="ZYRO0A10824p"
FT                   /note="similar to uniprot|Q07930 Saccharomyces cerevisiae
FT                   YLR016C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10824g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25905"
FT                   /db_xref="GOA:C5DQE4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQE4"
FT                   /protein_id="CAR25905.1"
FT                   /translation="MKNTAIPQKRFRPTVLPDFRPSGLLELESNNKEGVLLKHVEPADA
FT                   CEPNTFYAKTSIGQRPLYKLMVYRDDSLVQEFELMEKSSYIVGRASGETVVADIPIEED
FT                   TCSKQHCVIQFRQQNGQLKAYLMDLESSNSTTLNGDEIPSSHYVQLRPGDIISSLDSQY
FT                   DLVFMNS"
FT   gene            complement(<872490..>874511)
FT                   /locus_tag="ZYRO0A10846g"
FT                   /old_locus_tag="ZYRO-ORF8787"
FT   CDS_pept        complement(872490..874511)
FT                   /locus_tag="ZYRO0A10846g"
FT                   /old_locus_tag="ZYRO-ORF8787"
FT                   /product="ZYRO0A10846p"
FT                   /note="highly similar to uniprot|P16474 Saccharomyces
FT                   cerevisiae YJL034W KAR2 ATPase involved in protein import
FT                   into the ER also acts as a chaperone to mediate protein
FT                   folding in the ER and may play a role in ER export of
FT                   soluble proteins regulates the unfolded protein response
FT                   via interaction with Ire1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10846g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25906"
FT                   /db_xref="GOA:C5DQE5"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042050"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQE5"
FT                   /protein_id="CAR25906.1"
FT                   /translation="MLSNRWLAPLAVILYTLFLVVLPLGPRTNSVLVRGEEESYGTVIG
FT                   IDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDEERLIGDAAKNQVAANPKNTV
FT                   FDIKRLIGLRYSDKSVQRDVKHLPYDIVDNKGKPGVRVTVKGEERVFTPEEISGMVLSK
FT                   MKQIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGL
FT                   DKSSDEHQIIVYDLGGGTFDVSLLSIENGVFEVQATAGDTHLGGEDFDYKIVRQLIKQF
FT                   KKKHGIDVSDNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFEE
FT                   LNLDLFKKTLKPVEKVLEDAGLGKKDIDDIVLVGGSTRIPKVQQLLESFFDGKKTSKGI
FT                   NPDEAVAFGAAVQAGVLSGEEGVEDIVLLDVNALTLGIETSGGVMTPLIKRNTAIPTKK
FT                   SQIFSTAVDNQPTVMIQVYEGERAMAKDNNLLGKFELTGIPPAPRGIPQIEVTFALDAN
FT                   GILKVSATDKGTGKMETITITNDKGRLTPDEIEKMVEDAEKFASEDAAVKKKIEARNKV
FT                   ENYAHSLKNQVNGDLGEKLEEKDRETLLDAASDVLEWLEDNFDSAMAEDFEEKFNSLSK
FT                   AAYPITSKLYGGAGEGASPDDEEDEEDDDGDYFEHDEL"
FT   gene            <875479..>877044
FT                   /locus_tag="ZYRO0A10868g"
FT                   /old_locus_tag="ZYRO-ORF8782"
FT   CDS_pept        875479..877044
FT                   /locus_tag="ZYRO0A10868g"
FT                   /old_locus_tag="ZYRO-ORF8782"
FT                   /product="ZYRO0A10868p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10868g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25907"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQE6"
FT                   /protein_id="CAR25907.1"
FT                   /translation="MTSKGTVLIYYGFRSGKSVAGDTGISSEAWTSYYYHDIGKSFRVA
FT                   AKSKRLNSKGFDRLQSSDGAGLIIDLSPSLQNDNDSATCQEDCLESTLEQNEFIAYSAE
FT                   AAAFAQFASIDAIILASNELANANCPKVSQVEHHKVRFWRNKRSRNDEMTNSSKDLTER
FT                   PAKRHHFRKWLNEVRDEVDLGYIYENRNRACAVAAEAARMATIRNNARAAAKVGATATA
FT                   QMGTVRSRSRKSIQAGALATVKAVHLGTVSSHAREWMGICALEAASSAQTRLFEQHATS
FT                   VMHSRISTSDQEPFSNKNVEGEIHHGAQDTEEYVQNISQSTVVDPEDRNIHNHNSQPLQ
FT                   DSSSGEDIKKETTSKIAGVYEQFEAASPAFPKLESGPLIEACGTYSPIESQSEAKSEEE
FT                   FWDCISPKESTSTESFFIESFDKQPSKLGSGELAQVIEGGDFENKLSSKSNVLGWFSKT
FT                   ANDDTTIAAKTLEENTQECTTAAETNVWKSLGRQLGLFKKEEALNSDMEVVSPFGDNQI
FT                   GYAF"
FT   gene            <877423..>878169
FT                   /locus_tag="ZYRO0A10890g"
FT                   /old_locus_tag="ZYRO-ORF8779"
FT   CDS_pept        877423..878169
FT                   /locus_tag="ZYRO0A10890g"
FT                   /old_locus_tag="ZYRO-ORF8779"
FT                   /product="ZYRO0A10890p"
FT                   /note="similar to uniprot|P47058 Saccharomyces cerevisiae
FT                   YJL035C TAD2 tRNA-specific adenosine-34 deaminase subunit
FT                   Tad2p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25908"
FT                   /db_xref="GOA:C5DQE7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQE7"
FT                   /protein_id="CAR25908.1"
FT                   /translation="MALANVHLRHMETALRLGRYALDHGETPVACIFVHIPTDQIVAFG
FT                   MNDTNRSLTGVAHAEFMGIEQIREFVSPDELVPFFGDIALYVTVEPCIMCASALKQLGI
FT                   GKVIFGAGNDRFGGNGTVLSINQDSCTLGGKHESIPGVLRREAIMLLRYFYVRSNEKAP
FT                   KPRTKGERLLDKENFPPMQWQDYIDRDSFAQEFGDDKIACYDEKTDWTKDVKWALIEQR
FT                   QDGILEELKQHHYQFGLWLKHKKVRR"
FT   gene            complement(<878270..>879523)
FT                   /locus_tag="ZYRO0A10912g"
FT                   /old_locus_tag="ZYRO-ORF8778"
FT   CDS_pept        complement(878270..879523)
FT                   /locus_tag="ZYRO0A10912g"
FT                   /old_locus_tag="ZYRO-ORF8778"
FT                   /product="ZYRO0A10912p"
FT                   /note="highly similar to uniprot|P47057 Saccharomyces
FT                   cerevisiae YJL036W SNX4 Sorting NeXin"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25909"
FT                   /db_xref="GOA:C5DQE8"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQE8"
FT                   /protein_id="CAR25909.1"
FT                   /translation="MTSHNVGELPGGEASRKPQYRLEILVSDPQKRYGDQTSTSSYVSY
FT                   QISTKTDNPAYLKNHKSDDEIIVVHRRYSDLLLLYNILLNDHPTCIIPPLPDKKVFQYI
FT                   AGDRFSQSFTQKRCHSLQNFLRRVANHPVLSNSSVLMVFLVSNDWDAYRKSLSGHLQTN
FT                   KEEVTDAFMNAFKTVHKQSDEFVEIKEKSDKLDHNVAKIDKIFHRVVKKNDSISEDYAT
FT                   LGANLQDLQELCSGENEDLAKKAKVFNEGITQLSYGFRDLSKYLAYEYIVDLKDLEHYI
FT                   DSMGQLIKLKDQKQIDYEELSEYLTKSVNEKNNLISGYGGSNFFTNKLEELAGINQEAA
FT                   RREKIDKLEGKINSLSGELESAKKIADAFEQETLREVALFEELKTKELKDSLGSLADHH
FT                   IEFYQKMLDAWVKVDESL"
FT   gene            complement(<879804..>881165)
FT                   /locus_tag="ZYRO0A10934g"
FT                   /old_locus_tag="ZYRO-ORF8776"
FT   CDS_pept        complement(879804..881165)
FT                   /locus_tag="ZYRO0A10934g"
FT                   /old_locus_tag="ZYRO-ORF8776"
FT                   /product="ZYRO0A10934p"
FT                   /note="similar to YLR015W, uniprot|P43132 Saccharomyces
FT                   cerevisiae YLR015W (BRE2)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10934g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25910"
FT                   /db_xref="GOA:C5DQE9"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR037353"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQE9"
FT                   /protein_id="CAR25910.1"
FT                   /translation="MKIGILPYQSQDIAYGPSDNQLRPPWPIFQETHEISDGQEKFEKP
FT                   EDMPLNRRNFVYRPCGANPFFKELGYCCSEYPFAKPGMNLMDRSDGVSLNRGNNECVSV
FT                   SNSMGWRTARCDVCIKEGLTYWEVEVVQGGTPSGFDTGHSFQKRKDIINETPHVRLGIS
FT                   KREASLESPVGFDSYGYAIRDTSLESIHEGKVAQSLGTHSLKPGDRLGFLLQLPSCQTQ
FT                   VDQAKEYTQRRLDALVQSTKNTYQDHEQPKKRSKTTNKNFQIALLADIDHSNVVRDHIA
FT                   IRYKNQLFFEATDYVKTTKPEYYSSDKRERQDYYQLEDSFLAVYLNGEPLGEAFRDLKP
FT                   FLPPFSELQYNEKFYFGYWKNGVDDPGHNAKRTGILLRNKYVNNNKLGYYPTISCFNGG
FT                   TARIITTKQDCKYYDQLNKPAKLLEELFDEQIAEDVVWDIIDEIEEEFSDKGSG"
FT   gene            <881429..>883996
FT                   /locus_tag="ZYRO0A10956g"
FT                   /old_locus_tag="ZYRO-ORF8774"
FT   CDS_pept        881429..883996
FT                   /locus_tag="ZYRO0A10956g"
FT                   /old_locus_tag="ZYRO-ORF8774"
FT                   /product="ZYRO0A10956p"
FT                   /note="similar to uniprot|P07272 Saccharomyces cerevisiae
FT                   YLR014C PPR1 Zinc finger transcription factor containing a
FT                   Zn(2)-Cys(6) binuclear cluster domain positively regulates
FT                   transcription of genes involved in uracil biosynthesis
FT                   activity may be modulated by interaction with Tup1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A10956g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25911"
FT                   /db_xref="GOA:C5DQF0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQF0"
FT                   /protein_id="CAR25911.1"
FT                   /translation="MKRTIKQVEGEEEVSRKRPSSVVVGITKSISACKRCRTKKIKCDH
FT                   EFPSCKKCARANKPCVSLDPATGRDVPRSYVIFLEDRLTAMMNKLRECGVDPERVQGNI
FT                   PMTSEDNPCDIELYEERLRNEHQVPHDNLLAAYLINKGTSMQQGVGIADDEETASNGGG
FT                   SHISPQSGLTRSAELDESHKSITAIGSIKNNASNSYLGDSSGIPFAKLVFTAVNFRPDS
FT                   VEDESDEEIKQRESQYVDYSNAETTSAFEPLWLPPREIAESFVSQYFTDSNSQLPVLHR
FT                   EYFLKKYFEPIYGSWNPSVSLASDHTKINTSFKLPRDCEDVQDEEPWYDSWKRRYDREE
FT                   NITLPDKYEIPYFFLNMVFAIGESTQVLRSDTVRVVSFKRRALQFSKALNFSPNRLESL
FT                   AGTVLVAVYSLMRPNVPGVWYTMGSALRLAVDLGLHAEKLNRNYDPFTRELRRRLFWCV
FT                   YSLDRQICSYFGRPFGIPEENITARYPSMLDDALITTTNDDIVDYSKMKSSMASPKVVA
FT                   LAMFKVRRLQANIVQVLYAPNGEVPRSFSNLESWKFEMHRSLDNWFRKEVPKTYKKMNS
FT                   KFNTEFFNLNYWFTKSMLYGLSPKILTLDDYAFDVVYDSTRGSIDVFYKLCHNSKINYT
FT                   WVTVHMLFMTSMTYLYSIYYSDRGIRDGRKMAENYVSKLLYVLRKLIGTCEAAKNCYNI
FT                   CKVLSAAMIKLRFDGNKTEENSTPRYPQVMSSNSSPVDILEGTLDMPKIKPDSFDVPLD
FT                   QFFDELERVTLQSDPESTRSKFSSHDSPQLPNVNYPSLEAEDGADVERDRSANGKDGQR
FT                   IIDMVTQVTTDSIWSEFFNKARSSNGFTINEDELNKGASNFPL"
FT   gene            <884115..>884196
FT                   /locus_tag="ZYRO0A10978r"
FT                   /old_locus_tag="Zyro0A.tSer.AGA.19"
FT   tRNA            884115..884196
FT                   /locus_tag="ZYRO0A10978r"
FT                   /old_locus_tag="Zyro0A.tSer.AGA.19"
FT                   /note="tRNA-Ser (AGA) cove score=83.48"
FT   gene            complement(<884402..>885424)
FT                   /locus_tag="ZYRO0A11000g"
FT                   /old_locus_tag="ZYRO-ORF8772"
FT   CDS_pept        complement(884402..885424)
FT                   /locus_tag="ZYRO0A11000g"
FT                   /old_locus_tag="ZYRO-ORF8772"
FT                   /product="ZYRO0A11000p"
FT                   /note="highly similar to uniprot|Q07748 Saccharomyces
FT                   cerevisiae YDL244W THI13 Protein involved in synthesis of
FT                   the thiamine precursor hydroxymethylpyrimidine (HMP) member
FT                   of a subtelomeric gene family including THI5 THI11 THI12
FT                   and THI13"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11000g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25912"
FT                   /db_xref="GOA:C5DQF1"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQF1"
FT                   /protein_id="CAR25912.1"
FT                   /translation="MATEKITFCLNWQAAPYHIPIYLALTKGYFKEQGLDIAVLEPSNP
FT                   SDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGLLYLPDSGITEDFQ
FT                   SLRGKKIGYVGEFGKIQLDELTKHYGMTPNDYTAVRCGMNVAKYIIEGKIHAGIGIECM
FT                   QQVQLEEFLKEQGRSASEAKMLRIDKLACLGCCCFCTVLYICNDEFLKKNPEKVKKFLK
FT                   AIKKSTDYVLQNPEAAWNEYIDFKPALNNSLNFKQFQRCYAYFSESLYNVHRDWRKVTG
FT                   YGKRLEILPPDYVSNYSNEYLTWPEPEEVSDPLEAQRLMGIHQTACREEPSFKRLALPA
FT                   "
FT   gene            <885779..>886216
FT                   /locus_tag="ZYRO0A11022g"
FT                   /old_locus_tag="ZYRO-ORF8770"
FT   CDS_pept        885779..886216
FT                   /locus_tag="ZYRO0A11022g"
FT                   /old_locus_tag="ZYRO-ORF8770"
FT                   /product="ZYRO0A11022p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11022g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25913"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQF2"
FT                   /protein_id="CAR25913.1"
FT                   /translation="MSQLVVDLNELEGLLPSNGSRFRVVAQLIELEYLEGTSKVILGNL
FT                   PEFRYSDEGKTLKATIGTSVYESTFLQGNRVPQRGDAVSVWLVVYALGEERCWEVLELK
FT                   TITTKELNRLRIFWESSWGHEFRALSSSSRRDDVADHNEKL"
FT   gene            <886222..>887424
FT                   /locus_tag="ZYRO0A11044g"
FT                   /old_locus_tag="ZYRO-ORF8769"
FT   CDS_pept        886222..887424
FT                   /locus_tag="ZYRO0A11044g"
FT                   /old_locus_tag="ZYRO-ORF8769"
FT                   /product="ZYRO0A11044p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11044g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25914"
FT                   /db_xref="GOA:C5DQF3"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQF3"
FT                   /protein_id="CAR25914.1"
FT                   /translation="MLRLIMDKQRIMIKHVVKRFQHTFQPYETVLARLLSKPNEKFHLS
FT                   KPLQAGEVINTGNGPIRHEDVIGKPYRSLVTSSTSTSHQYMLCRPSLEEYVVNKRREAQ
FT                   PIYPLDAGLIVQLSDVHADFPDMELGPSIDVEKPASFQRLNLSERYDRFLHDRWENRKS
FT                   QLPQGLRTCAPPKQYLECGTGHGSLTLQICKEIHSGNAYYDGNDSTRGSILHSLDRNDK
FT                   HLATGVRNLKHYDRGIYWTDVEFHLLTESEQGPSQWLQGPAASYYRDVVGRLAGRPGGF
FT                   LNGAFLDLPSPQDHLETIAQNLVAESPLIVFVPSITQLWDCLCQIKTVGIPLSMTRVLE
FT                   LMPGSGGGGMREWDLRRTVIRETGKESMVVRPKVGARVVGGGFVGIFKKLPADSVVRTW
FT                   R"
FT   gene            complement(<887519..>888118)
FT                   /locus_tag="ZYRO0A11066g"
FT                   /old_locus_tag="ZYRO-ORF8768"
FT   CDS_pept        complement(887519..888118)
FT                   /locus_tag="ZYRO0A11066g"
FT                   /old_locus_tag="ZYRO-ORF8768"
FT                   /product="ZYRO0A11066p"
FT                   /note="similar to uniprot|Q07915 Saccharomyces cerevisiae
FT                   YLR009W RLP24 Ribosomal Like Protein 24"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11066g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25915"
FT                   /db_xref="GOA:C5DQF4"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQF4"
FT                   /protein_id="CAR25915.1"
FT                   /translation="MRIHQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRN
FT                   PRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVDTTLKAMEKIEDIRKKRE
FT                   RAFYKNRMKGNEEQDFLRDKQLVENNPELLRIREVEMAQILAKEQEKAEAAEEEDEEEE
FT                   EEEDMEVDEDEEEEEEKEKQKIVLKNKKRNQKKLAF"
FT   gene            <888349..>888855
FT                   /locus_tag="ZYRO0A11088g"
FT                   /old_locus_tag="ZYRO-ORF8767"
FT   CDS_pept        888349..888855
FT                   /locus_tag="ZYRO0A11088g"
FT                   /old_locus_tag="ZYRO-ORF8767"
FT                   /product="ZYRO0A11088p"
FT                   /note="similar to uniprot|Q07914 Saccharomyces cerevisiae
FT                   YLR008C PAM18 Constituent of the mitochondrial import motor
FT                   associated with the presequence translocase along with
FT                   Ssc1p Tim44p Mge1p and Pam16p stimulates the ATPase
FT                   activity of Ssc1p to drive mitochondrial import contains a
FT                   J domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11088g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25916"
FT                   /db_xref="GOA:C5DQF5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQF5"
FT                   /protein_id="CAR25916.1"
FT                   /translation="MASDPSRNDNLAGLSAPQLPIPGQDNSRIHEDQNVALEAPKPMAP
FT                   SQKQGMDLYFDQALEKMGQHPVLTGVGTFFALYVAAGAYKSITSKVRGEKGAAAFLKGG
FT                   FDAKMNQNEALQILNLNESQLNKRKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLE
FT                   KKVLK"
FT   gene            complement(<888913..>889821)
FT                   /locus_tag="ZYRO0A11110g"
FT                   /old_locus_tag="ZYRO-ORF8766"
FT   CDS_pept        complement(888913..889821)
FT                   /locus_tag="ZYRO0A11110g"
FT                   /old_locus_tag="ZYRO-ORF8766"
FT                   /product="ZYRO0A11110p"
FT                   /note="similar to uniprot|Q07913 Saccharomyces cerevisiae
FT                   YLR007W NSE1 Essential nuclear protein required for DNA
FT                   repair forms a complex with Smc5p and Rhc18p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25917"
FT                   /db_xref="GOA:C5DQF6"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQF6"
FT                   /protein_id="CAR25917.1"
FT                   /translation="MTEDIEFTDPNGNTAQPSESGTVIPETDKSITDHDIARYLLQYLL
FT                   DCRGICHENMLLVVLDKLQKYTQDPTSQVCSTDKLVEIIKGINVKLNPLGYKISRVGHG
FT                   MGKNNVSSMLKDTGLPSNNRFYVYVNTVTSEESKLATRFSTREIEFIKWCVEKMCVSRD
FT                   CEVIIDCPIITEVDRIRNDVSWNKCITYSVESSEFFQYKDWSPIEIESLLFKLCGLKWF
FT                   AKDENGRISMDLRCSVELEEYLIANGISTCENCHRLALQGTRCTSCSRSWHVDCYQHRI
FT                   THIGKYCPCGESILQNGMYIV"
FT   gene            complement(<890189..>892285)
FT                   /locus_tag="ZYRO0A11132g"
FT                   /old_locus_tag="ZYRO-ORF8765"
FT   CDS_pept        complement(890189..892285)
FT                   /locus_tag="ZYRO0A11132g"
FT                   /old_locus_tag="ZYRO-ORF8765"
FT                   /product="ZYRO0A11132p"
FT                   /note="some similarities with uniprot|Q22X91 Tetrahymena
FT                   thermophila SB210 TTHERM_00561660 Viral A-type inclusion
FT                   protein repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25918"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQF7"
FT                   /protein_id="CAR25918.1"
FT                   /translation="MRTPDHFKIPKERRADYWDYKPSRDELIKEPLITPIHEIKNQNKL
FT                   INSAMLYFSKPSHRDHGFYPDPKIPYEAYFANETEEREKLRFGENETITFDINEEVGKL
FT                   VMKEAEYKPASQHGALDQKNTKNKSILKTNPRTVIPYRPHANPYIDACQEVMIKCYNMC
FT                   GISVDYLDIDKMFDSLGKLMFGISNEFKMKELCFNYVLAAEKRKWFEEKEDLKASVEQF
FT                   KTERLGLCELNVELGIKLQQESKRVENLQKLLVKLEQFDKVQQENTGLALVNTDLTSKN
FT                   DQLTSKLLNLEAKVLQLSDVDRTNVELNDKISALTSKNESLSDDYDKLFKEKQELESKN
FT                   SELLQNNNELRSERERWLERNENLIINSTDFNVKMEERNAKIKFLEAQIENIKAKYDRD
FT                   TKSDMKYFKNKINDMLRENVNQTSQMEKVIVNLNQANYKVDELLKDNESLRVDNNNMRA
FT                   DLQQKLKDIKDLQLQLKQDKVTFTKYEKLENEKTACDKALVHLRQEYRTLQESFQNLKE
FT                   VHSNLDDQNKELSQYRKAAHDALCELNEEVGKLEDMNAVLQDGKRIDQIQINDLNCQVK
FT                   KHIETIELLERSNSKFRKKPQELENKIQTLQCEYERLDKQYKDRETEIQQAKLNMRKMT
FT                   TSLYNARMNASDHENRCTAADYNGLTSNSAKAPLRKRDMLRSLANRRTVLVTEPSQSLN
FT                   KNIY"
FT   gene            <893793..>896123
FT                   /locus_tag="ZYRO0A11154g"
FT                   /old_locus_tag="ZYRO-ORF8762"
FT   CDS_pept        893793..896123
FT                   /locus_tag="ZYRO0A11154g"
FT                   /old_locus_tag="ZYRO-ORF8762"
FT                   /product="ZYRO0A11154p"
FT                   /note="similar to uniprot|Q07084 Saccharomyces cerevisiae
FT                   YLR006C SSK1 Cytoplasmic response regulator part of a two-
FT                   component signal transducer that mediates osmosensing via a
FT                   phosphorelay mechanism dephosphorylated form is degraded by
FT                   the ubiquitin-proteasome system potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25919"
FT                   /db_xref="GOA:C5DQF8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQF8"
FT                   /protein_id="CAR25919.1"
FT                   /translation="MSESSTLKLRPTSPLSVNRNVALNSALSWKIWLRLEDYEESINQA
FT                   FSLQFGELDTIDDLKTKIFENLNTIRWSRVNDNASIALGFYCNRTDWEPDRFSPIQRLP
FT                   TSPVNTLFGKSKPLQQPSAASTKRSFADNDSKSGSLNTSPRISASGSPKLSAVPRLPTA
FT                   RYGPNIGSPFLSVQNGGVNNNGGSNGVGSTGLARLPGGVAPTLSPLPFSGGRLALTSWS
FT                   KKDLKHSVEPVGDSLYRILFEPDELVLTIYNELFGHLGSQAASDALLVFCNDIIPKHEM
FT                   LPASAMDGPNFASNQLTQELLNSQNRKREQEGLRLDTRDPHDLLQPGLETPPTIGALNP
FT                   GDAPPELVLDDTAAQLAREESEREFQLITNEEQLRKVSQSMLDEDNPDSPKQAILLLPK
FT                   NFDGDVNFNESPSKMSSRPSSPLTTVGDTSNENTDSNINIGGFNGDNNNINANINTNTH
FT                   NYKNNDNNNNSQESQLSMPLVDRPRTDDSLMQSHAPLIEKEVGMVHPLLENDRKKGLSS
FT                   PTSPLLPRNPPPNFNRLSRSFAPKNGSSREKPFPGEWSATSDKVFPKINVLIVEDNVIN
FT                   QTILSSFLRKHKIFYKVAKNGQEAIDVWREGGIHLIFMDLQLPVLSGIDAAKKIRELER
FT                   EHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKKEALISGCNDYLTKPV
FT                   NLHWLSNKINEWGCMQALINFDSWKEGQSRMTDNVLVKAPSQRSVKAVSGNPDIKYRMN
FT                   RRRSRSSSTSSQSKISEALRLAP"
FT   gene            complement(<896333..>897766)
FT                   /locus_tag="ZYRO0A11176g"
FT                   /old_locus_tag="ZYRO-ORF8761"
FT   CDS_pept        complement(896333..897766)
FT                   /locus_tag="ZYRO0A11176g"
FT                   /old_locus_tag="ZYRO-ORF8761"
FT                   /product="ZYRO0A11176p"
FT                   /note="highly similar to uniprot|Q04673 YLR005W
FT                   Saccharomyces cerevisiae SSL1 Component of RNA polymerase
FT                   transcription factor TFIIH"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25920"
FT                   /db_xref="GOA:C5DQF9"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004595"
FT                   /db_xref="InterPro:IPR007198"
FT                   /db_xref="InterPro:IPR012170"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQF9"
FT                   /protein_id="CAR25920.1"
FT                   /translation="MPPVIDPESDEDEEQVQVSSKETRRHKRELDQDEENDNDDDEGDV
FT                   KSGSKSSSNPKDRNGKASKDPKRNGRSARRNKTSNKALQGASGGYAWEDEIKRSWDLVP
FT                   ADDEGDMAALAASIVESRKKRTAQKNISPYQRGIIRTLILVLDCSEAMLEKDMRPNRHA
FT                   MLVQYSIDFVHEFFDQNPISQIGIVSMRNGLAHMISQVSGNPQDHVDALKSIRKQEPKG
FT                   NPSLQNALEMTRGLLLPVPPHCTKEVLIVFGSLSSTDPGDIHLTIGSLVQEGIRVKIIG
FT                   LSAQVAICRELCKATNYGDESFYKVPLDEIHCKELFAEAVTPLPVNKINKGFTLVKMGF
FT                   PTRIFEEAPTFCACHSKLLYGGYFCPNCQSKVCSLPMVCPCCDLMLILSTHLARSYHHL
FT                   MPLKTFSEVPTGQVFPTENCFSCQVRFPTVKNHKTGELLTSSRYRCEDCLKDFCIDCDV
FT                   FIHEILHNCPGCESKPTIT"
FT   gene            complement(<899061..>899918)
FT                   /locus_tag="ZYRO0A11198g"
FT                   /old_locus_tag="ZYRO-ORF8758"
FT   CDS_pept        complement(899061..899918)
FT                   /locus_tag="ZYRO0A11198g"
FT                   /old_locus_tag="ZYRO-ORF8758"
FT                   /product="ZYRO0A11198p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25921"
FT                   /db_xref="GOA:C5DQG0"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQG0"
FT                   /protein_id="CAR25921.1"
FT                   /translation="MSMISYEGEMDLEKCVQMYEEEEIELPEDSTSGKLVYFLAPYFFE
FT                   KTWIYDIIVSLSGAFISSAVLLVYISLRDFYHNPLESELSVEFSPLWTISHYFLCFTFS
FT                   FLNFIHHRKKVNIETKALQKLLKEVAGVDLTGDPVAWRRIASRVNHFSEETGYRYSLFY
FT                   SGEHCMRFFVREIVKPIECQTYDIRCYCEGEMYSNFWKNPSNKALTERALAKYNKSVEN
FT                   FGELSHTAERDEFRDGTFERFRNIFNTSILYFWVIELGSFLILLLTFIISMIVWGIFHS
FT                   FATA"
FT   gene            <900615..>900926
FT                   /pseudo
FT                   /locus_tag="ZYRO0A11220g"
FT                   /old_locus_tag="pseudo-Zyro0A-900615-900926"
FT   gene            complement(<901859..>902716)
FT                   /locus_tag="ZYRO0A11242g"
FT                   /old_locus_tag="ZYRO-ORF8754"
FT   CDS_pept        complement(901859..902716)
FT                   /locus_tag="ZYRO0A11242g"
FT                   /old_locus_tag="ZYRO-ORF8754"
FT                   /product="ZYRO0A11242p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25922"
FT                   /db_xref="GOA:C5DQG1"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQG1"
FT                   /protein_id="CAR25922.1"
FT                   /translation="MSVISYESEMDLEKCVQTFEEEEIQLPEDSSGGKLTYFLAPYFFE
FT                   KTWISNILASLSAAFMSSAAPLVYFSLRDFYHDPLESELSDFLSPLWMIIHYLLCFTFS
FT                   IFSFIDDRKKVKIETKVLQKLLKEVAEVDLTGDPVAWQRIASRVNHFSEGTEYRYSLFY
FT                   SGEHCMRFFVREIVKPIERQTYDIRYYCEGKMYRNFWKNPSNKALVERAVANYNKNVKN
FT                   FGELSHIAEKDECRDDIFEKFRNIFNISMLYLGVIEFASFMIMILTFIISMIVWGIFHS
FT                   FATA"
FT   gene            <903365..>904333
FT                   /pseudo
FT                   /locus_tag="ZYRO0A11264g"
FT                   /old_locus_tag="pseudo-Zyro0A-903365-904333"
FT   gene            complement(<905159..>906016)
FT                   /locus_tag="ZYRO0A11286g"
FT                   /old_locus_tag="ZYRO-ORF8749"
FT   CDS_pept        complement(905159..906016)
FT                   /locus_tag="ZYRO0A11286g"
FT                   /old_locus_tag="ZYRO-ORF8749"
FT                   /product="ZYRO0A11286p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25923"
FT                   /db_xref="GOA:C5DQG2"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQG2"
FT                   /protein_id="CAR25923.1"
FT                   /translation="MSMISYEGEMDLEKCVQMYEEEEIELPEDSTSGKLVYFLAPYFFE
FT                   KTWIYDIIVSLSGAFFSSVAVFVYFSLRDFYHDPLESELSVEFCPLWTISHYFLCFTFS
FT                   IFGFINDRKKVKIETKVLQKLLKEVAEVDLTGDPVAWQRIASRVNHFSEGTGYRYSLFY
FT                   SGEHCMRFFVREIVKPIECQTYDIRCYCEGEMYSNFWKNPSNKALTERALAKYNKSVEN
FT                   FGELSHTAERDEFREGIFERFCNIFNTSMLYLGVIEFASFFILLLTFIISMIVWGIFHS
FT                   FATA"
FT   gene            complement(<907471..>908328)
FT                   /locus_tag="ZYRO0A11308g"
FT                   /old_locus_tag="ZYRO-ORF8746"
FT   CDS_pept        complement(907471..908328)
FT                   /locus_tag="ZYRO0A11308g"
FT                   /old_locus_tag="ZYRO-ORF8746"
FT                   /product="ZYRO0A11308p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25924"
FT                   /db_xref="GOA:C5DQG3"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQG3"
FT                   /protein_id="CAR25924.1"
FT                   /translation="MSMISDESEMDLEKCEQTCEEEEIELPEDSSGGKLTYFLAPYFFE
FT                   KTWIEDIIFSLSGAFISSAAVLVYFSLRDFYHNPLESELSDEFCPLWTISHYLLCFTFS
FT                   IFSFIDGREKVNIETKVLQKLLKEVAEVDLTEDPVAWRRIASRVNHFSEETGYRYSLFY
FT                   SGEHCMRFFVRQIVKPIECQTYDIRSYYEGEICSNFWKNPPNKALTERALAKYNKSVEN
FT                   FGELSHTAERDEFRDGIFERFRNIFNTSILYFWVIELGSFLILLLTFIISMIVWAIFHS
FT                   FATA"
FT   gene            <909014..>909464
FT                   /pseudo
FT                   /locus_tag="ZYRO0A11330g"
FT                   /old_locus_tag="pseudo-Zyro0A-909014-909464"
FT   gene            complement(<910040..>910897)
FT                   /locus_tag="ZYRO0A11352g"
FT                   /old_locus_tag="ZYRO-ORF8742"
FT   CDS_pept        complement(910040..910897)
FT                   /locus_tag="ZYRO0A11352g"
FT                   /old_locus_tag="ZYRO-ORF8742"
FT                   /product="ZYRO0A11352p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25925"
FT                   /db_xref="GOA:C5DQG4"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQG4"
FT                   /protein_id="CAR25925.1"
FT                   /translation="MSMISDESEMDLEKCVQMYEEEEIELPEDSTSGKLVYFLAPYFFE
FT                   KTWIEDILFSLSGAFFSSVAVFVYFSLRDFYHNPLESELSVDFCPLWTISHYFLCFTFS
FT                   IFSFINDRKTVNIETKVLQKLLREVAGVDLTEDPVAWQRIASRVNHFSEETGYRYSLFY
FT                   SGEHCMHFFVREIVKPIECQTYDIRCYCEGEMYSNFWKNPSNKALTERALAKYNKSVEN
FT                   FGELSHTAERDEFRDGTFERFCNIFNTSMLYLGVIEFASIFILLLTFIISTIVWAIFHS
FT                   FATA"
FT   gene            <911217..>911912
FT                   /locus_tag="ZYRO0A11374g"
FT                   /old_locus_tag="ZYRO-ORF8741"
FT   CDS_pept        911217..911912
FT                   /locus_tag="ZYRO0A11374g"
FT                   /old_locus_tag="ZYRO-ORF8741"
FT                   /product="ZYRO0A11374p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25926"
FT                   /db_xref="GOA:C5DQG5"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQG5"
FT                   /protein_id="CAR25926.1"
FT                   /translation="MSNKKKSKSKASESHKRGGRENSPRGQHNSLSPQRDNSISDQQGS
FT                   ENSGTGSGTNGIKLAARLFRNPLFSKRGLKHAKEGLRIKSSDKSISKLRCIGSGFLFLY
FT                   PFLLIGYCIAGFLAGDINSKHAFLYGIPLCIAVPYFIRCLDDVDTLLSSIFEIGEKSLL
FT                   GYFADPVIREFLLTVFEIVGHIYKCIEGTQKSRIYIWRILSFICYLLGNICLIMKRREK
FT                   PESIVGNST"
FT   gene            <913083..>914654
FT                   /locus_tag="ZYRO0A11396g"
FT                   /old_locus_tag="ZYRO-ORF8738"
FT   CDS_pept        913083..914654
FT                   /locus_tag="ZYRO0A11396g"
FT                   /old_locus_tag="ZYRO-ORF8738"
FT                   /product="ZYRO0A11396p"
FT                   /note="similar to uniprot|Q07904 Saccharomyces cerevisiae
FT                   YLR004C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25927"
FT                   /db_xref="GOA:C5DQG6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQG6"
FT                   /protein_id="CAR25927.1"
FT                   /translation="MNKTSPPEAEKIDEQVDISSTKDDSTFTSGDDDADIALKFLTHKN
FT                   AKSYVSEEDEELNTTEKNFYGSSALPPKLLRKIDACVLTFLCFAYLLMFLDKTLLNYAA
FT                   SMGIKEHLKGNEFSNLGTIFYASYIFMEPIVSFLIQRYPLSKVMGTFITCWGIVLACHC
FT                   ACKSYTSLMIVRTLLGVFESSSAVGCITISGMYYTKSEQCARIGYWTSQAGTGYIVGGL
FT                   ISFGFLHYHGKDFTSWQIMFLVVGLFTVLFGLLTLVILPDNVTNAWFLSEEEKILVVKH
FT                   IKDNQTGLENKKFKWSHIKELFLHDKLTWPMLVITACSQMTTGAIGTFSVTITQTFGFD
FT                   KYVTALLQLPIGAITIIIMIITTQMMSRWGQITLVTTSMYIPTIIGCIVMLSLPLSHKI
FT                   GNLFSLYLLYSGSSVITNIYVWNSLNTSGYSKRIFRNAATLMVYSLAYILAPQTFREAN
FT                   YPGYVPAKITLLVTQCICVPLQLYVGYVCLTENKKRDKEQEGKDVGKYDFRDLTDIQNR
FT                   NFRYMY"
FT   gene            <914813..>915673
FT                   /locus_tag="ZYRO0A11418g"
FT                   /old_locus_tag="ZYRO-ORF8736"
FT   CDS_pept        914813..915673
FT                   /locus_tag="ZYRO0A11418g"
FT                   /old_locus_tag="ZYRO-ORF8736"
FT                   /product="ZYRO0A11418p"
FT                   /note="similar to Q07897 YLR003C uniprot|Q07897
FT                   Saccharomyces cerevisiaeCMS1 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25928"
FT                   /db_xref="InterPro:IPR032704"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQG7"
FT                   /protein_id="CAR25928.1"
FT                   /translation="MPNADDLDDGLDYNYESDPEAEEVAVEDTGAEESKDSQEDEPEEK
FT                   PHDDDKKRKAGESSEREGRPLSKRQKKLQNSKLKDKKEEQVKYQLDKKKTIPKSSPEEI
FT                   VEYLATLIREKNPDLSGLELDEMYLKKSDFLSTEKFQEDRNLTNLPNFMSQFSKSPRTI
FT                   VLSLTNLRIADIYRSLGGNKACVKLFAKNKLKDDLATVEEILSAKSKKNEHIRYFIATP
FT                   TRLEKLIESTDLFFQGKEKLDILLDASYMDPKANTLLNCENTTVLCKLLKTFLNKKSSV
FT                   KVLLY"
FT   gene            complement(<915716..>917839)
FT                   /locus_tag="ZYRO0A11440g"
FT                   /old_locus_tag="ZYRO-ORF8734"
FT   CDS_pept        complement(915716..917839)
FT                   /locus_tag="ZYRO0A11440g"
FT                   /old_locus_tag="ZYRO-ORF8734"
FT                   /product="ZYRO0A11440p"
FT                   /note="similar to uniprot|P27351 Saccharomyces cerevisiae
FT                   YJR005W APL1 beta-adaptin large subunit of the clathrin-
FT                   associated protein complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25929"
FT                   /db_xref="GOA:C5DQG8"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:C5DQG8"
FT                   /protein_id="CAR25929.1"
FT                   /translation="MSDQRIFARYKATEIRAELQNFDAKRSKVSATKRKVALRKIIANL
FT                   KMGNYNEMVLLYPEMLKFWQVEDDLEVKRICHEYVRTLGAAKPQSAKEALGAVLGDLEN
FT                   KNEEVQIMSLRTLSAVTSLEYINEAFKAVGYVLARRGVPQNLLKTAILLLKYMDDLDHD
FT                   RVSSTLDSLYDIFERQLASPTVQVAALHTIYAIHEKNTDLKPLRLELDVAMGLLDLLPQ
FT                   LNEWDKAMVLESLTTSAVPQTHSDVCAMIELVLPQLQHANTYVALNAFKFIAYLLNYAE
FT                   HVNEGLIKRFSNSIVSLLNKPPELEFLVLRNIILLLLSRGASLLKLDVSFFFIEYNDPI
FT                   YIKDTKLECLYLSADHETLPRILEELVQYATDIDIQMSRKAIRAIGNLAVKLNEEAAHD
FT                   CVDALLDLLEFGVDYVVQEIISVFRNILRKHPKRFESIIGELVKHTESVQEPEAKNAMI
FT                   WIITNYSYALPNYLEFFQVFSSNLLEETSDVQFSILTSSVKFFIRNPNYQTEKICIKAL
FT                   KQCTEEINNPDLRDRAFMYWRLLSLAQSPKSHLLSNDSMTKLIDGELPAIQLSTKLDPV
FT                   ILEELELNIGTIASIYLKPVSQVFRNTRTKRLLPSPILNPNKENLKVINDGSTNLNSGA
FT                   FERVPEWETIGQSDDVSVASPRRTKTMMNDYDKPAEKVNQLKGKRKSSSAGPSTLSRKP
FT                   SMLVRKLSMKKPF"
FT   gene            <919106..>922453
FT                   /locus_tag="ZYRO0A11462g"
FT                   /old_locus_tag="ZYRO-ORF8733"
FT   CDS_pept        919106..922453
FT                   /locus_tag="ZYRO0A11462g"
FT                   /old_locus_tag="ZYRO-ORF8733"
FT                   /product="ZYRO0A11462p"
FT                   /note="some similarities with uniprot|P20840 Saccharomyces
FT                   cerevisiae YJR004C SAG1 Alpha-agglutinin of alpha-cells
FT                   binds to Aga1p during agglutination N-terminal half is
FT                   homologous to the immunoglobulin superfamily and contains
FT                   binding site for a-agglutinin C-terminal half is highly
FT                   glycosylated and contains GPI anchor"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25930"
FT                   /db_xref="GOA:C5DNT9"
FT                   /db_xref="InterPro:IPR001389"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR024672"
FT                   /db_xref="InterPro:IPR033504"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNT9"
FT                   /protein_id="CAR25930.1"
FT                   /translation="MYKTFNSIRSILFLLCLAWHTFAKEINGVSFSGLKFTPLSSLHYP
FT                   HQGWSASFDFEIENGSSVSKGDYFTLNFPTVYRIKFDDNKLTTNATLQDGSEAFECFAA
FT                   QQAAYKNEDTVFKCVAIQGLSSYSSLSGSLSFGLSFSSGGSSYEYEMQNADKFHSGTMQ
FT                   VSLADQLSASVEFDSANFTKDIYTIGRSTTFNSLESYYLGMSCPNGYLLGGTQTINYDR
FT                   ENKGYDLDCSSVQVYLSDQFNDWSLPLKGDNANAKVDCSDDTLKVNMNEAKPNQKLWIN
FT                   ALQDVSAGVNTIQHEVHLQYSCSDTEQKTTYSTQFSTVVEYTIYQASDSGTLSGLTATS
FT                   ASSSSPVVTTPTITSTITTGWTGTYNTTYSTGSTELSGSGDVPTEEIIYYVETPSESSV
FT                   PQTTTTTTTTGWTGTYTTTYSTGSTELSGSTGAPTEEIIYYVETPSESSVPQTTTTTTT
FT                   TGWTGTYTTTYSTGSTELSGSTGAPTEEIIYYVETPSETVTPQTTTTTTTNIWSGSYTT
FT                   TYSTESTSLYFSTGVPMEEVIIYVETPESKVAPSSSTPQSKTTVTSTTTTGWTGKYNST
FT                   YSTASTILVGSTGIPTEEIIYYFETPETQLFNTSSTPAPSSSTTIGIVTTTTTTTTGWT
FT                   GTYTTTYLTASTSLGGNTGTLTEEIIYYVETPNTTVFPPPSTSVTSKANITSSTSQISS
FT                   TSWSSKVNLTSSTPHLVTLSTTDLNSTYLTTCDCSESVPTINWSSSSTSNTITSVPPSE
FT                   TSYVPQSSSASVSKSSLNITSTSSPSASIQSISTLPSPTSSDVFNSTISPSLPVSSFST
FT                   LSTSSAQNSINSTHVTTTTPTAETFFSTTANSTGSNYLTSSRPISTSSVETTSVTNSTS
FT                   VPPAITSNPIITSPWVTATATTLQSRTEASSTSVGNFSSTTSAATLTPTTEASSTIIAD
FT                   SSTTPVTSVAIPSSTSATLSTDSATTSTSPIIPIAASSSSSSSSSSAPSSGFSSAAAVS
FT                   TTPSPSSSGGRFSLGLSLDQGSIAQIPIAQSSTPCSTSTKISTATVTVTKNSTTTKHVT
FT                   APVTHTVTQKVSDCHCPVESHQSSLEPYFNNNSSDTGPSIAPYSGQGLVLKRGNSITAL
FT                   IGVLLFIL"
FT   gene            <923141..>925120
FT                   /locus_tag="ZYRO0A11484g"
FT                   /old_locus_tag="ZYRO-ORF8731"
FT   CDS_pept        923141..925120
FT                   /locus_tag="ZYRO0A11484g"
FT                   /old_locus_tag="ZYRO-ORF8731"
FT                   /product="ZYRO0A11484p"
FT                   /note="weakly similar to uniprot|O00026 Saccharomyces
FT                   cerevisiae YOR066W Protein of unknown function potential
FT                   Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25931"
FT                   /db_xref="GOA:C5DNU0"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNU0"
FT                   /protein_id="CAR25931.1"
FT                   /translation="MEKPVRKRGRPPITKDYANPLESPMAHSSLRMQRQGAQVFQRPTM
FT                   KVGSVTPSPKNRSFSNSGIGNGANNNTMGNNSGSTLVESGSQPGSSTKKARYRGVILST
FT                   PTKWPAGGKNDNGTGSTGTPTPSSSDSVFCSASKLALKSSPPLSTSPLKDENDENSSNN
FT                   IKNNFSTAKRAGPNFTNSSSSQQFKFSLTIGENGRASIAGSSSQDSTPCKSNDPQQLNS
FT                   DGQDNREDLGLQTFEKRKVLTLLKQMRNDAAPPSPSNTVSRVKKPKHNHKKQNSYGETE
FT                   LPPILESCAGVNSGTNVGGKSPKAPPVWTQSPQPPSTPKTSFSIRTGFTPNIGIDQVLL
FT                   DVVASPKSAGPTENPLNYGYLSNMISLSPRTKSPEFPQQEQSQRQSQQDHQESQQQQQQ
FT                   QQQQQQQQQQQQQKDEEQQKQKQQTQQQFVFKFSGADPLLLTDDADGNWSEIIYNHLQN
FT                   SPRPQICFNTPPSWVNFGSPRAAGFTPQARRDSTSQSALENDPSKSIKGLSQVNRRDSI
FT                   INLSSSPPRRELFPASPLRRPSLPYSTTLTPRITTNTTTVAGNHNDKLVPEPSTPRGQE
FT                   VQLPAMIECTPLIQQTMNGSLTTKYLSNVLSNTANGTNANGINDCGAFAEAALPVKDPI
FT                   RHLSSPGGEQEDARAALKKLIAER"
FT   gene            complement(<925282..>926952)
FT                   /locus_tag="ZYRO0A11506g"
FT                   /old_locus_tag="ZYRO-ORF8728"
FT   CDS_pept        complement(925282..926952)
FT                   /locus_tag="ZYRO0A11506g"
FT                   /old_locus_tag="ZYRO-ORF8728"
FT                   /product="ZYRO0A11506p"
FT                   /note="highly similar to uniprot|P40351 Saccharomyces
FT                   cerevisiae YOR067C ALG8 adds glucose to the dolichol-
FT                   linked oligosaccharide precursor prior to transfer to
FT                   protein glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25932"
FT                   /db_xref="GOA:C5DNU1"
FT                   /db_xref="InterPro:IPR004856"
FT                   /db_xref="InterPro:IPR039487"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNU1"
FT                   /protein_id="CAR25932.1"
FT                   /translation="MKSGRQLNKQEQLAAMGTRRFSLWNFWIASLVLKILLIPDYFSTD
FT                   FDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEIV
FT                   DKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQSFVIASSIVLSPAFLIV
FT                   DHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLLRAY
FT                   CLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPFVKDLPQVLTRLFPFSRG
FT                   LTHAYWAPNFWALYSFLDKILTVVMLKLPYVHQFTSKFIQPPLIPSTIDEIKQRIAQNN
FT                   NGTKGLVQDVFFVILPQITPKLTFALTAFYQVLAVIPVLFDPSYKRFIGSLTLCGLASY
FT                   LFGWHVHEKAIMLAIVPFSFLVACDRRLLTSYMLLAASGYVSLFPLLYENQDFLLKCLY
FT                   TLVWCMIYFYALRKTTFLSSSVERRVFFLDRLSMIYIYLLLPLVLGVQFLDMMKWRYPL
FT                   FQKFEFVSLMSYSVYCSLGIIGSWAGLSWLYNFDEPLWE"
FT   gene            <927139..>929091
FT                   /locus_tag="ZYRO0A11528g"
FT                   /old_locus_tag="ZYRO-ORF8727"
FT   CDS_pept        927139..929091
FT                   /locus_tag="ZYRO0A11528g"
FT                   /old_locus_tag="ZYRO-ORF8727"
FT                   /product="ZYRO0A11528p"
FT                   /note="similar to uniprot|Q92331 Saccharomyces cerevisiae
FT                   YOR069W VPS5 Component of the retromer coat that retrieves
FT                   proteins from late endosomes sorting nexin I homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25933"
FT                   /db_xref="GOA:C5DNU2"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR035803"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR037868"
FT                   /db_xref="InterPro:IPR039358"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNU2"
FT                   /protein_id="CAR25933.1"
FT                   /translation="MDYDDDLNAPVWDDLNPPKQASVPELSDTFADLNTDEANQGEEEE
FT                   EDEGVNSGEETHTAEHENSDNLLNTLAPQEDPLVDLQTANEASILSSPTKGADDPLFSA
FT                   STYQPLVFGDTNDQDLSQSTPVLSSAARKSGKPRMLFNSARMRRRPLDKKASNTTTTTT
FT                   VTNNNANSEVADPLGKIKKETEKKVDEGPISVTSNNTTKSKSIIDQVEEPLFKVPARRN
FT                   ISENQLESNETQVQKQQEQNQDEEREPVNFYIEVKDPVKVGELTSMHVEYTVVVESELL
FT                   ETRYAQVNRRYRDFRWLYRQLQSNHWGRIIPPPPEKQSVGRFKQDFIENRRFQMEKMLQ
FT                   KIASSPVLQSDLDFILFLTSNNFNFESKHREHTTGSNASRDSNDLSEIHISEIELLGAE
FT                   DAAVVLKNGGLDGESQKRFLSLSFSSLPKYNETDEYFIDQYKLTESLEERLKQLNKSLD
FT                   LVDSERNELASVTEEFSKTIDSLAELEVTRQNVEILTNFADTHRRIRESLERSSLQESL
FT                   TLGVTLDEYIRSLASVKAIFNQRARLGHYLVIVETDFAKKQSLLEKLPQNSTSQSNIDK
FT                   INSAKREYQTLQRRCKSVKKRWQEVGDCIKKELANFEIEKVKDFRNSLEIFLESAIESQ
FT                   KECIELWETFYQNNL"
FT   gene            complement(<929179..>931617)
FT                   /locus_tag="ZYRO0A11550g"
FT                   /old_locus_tag="ZYRO-ORF8724"
FT   CDS_pept        complement(929179..931617)
FT                   /locus_tag="ZYRO0A11550g"
FT                   /old_locus_tag="ZYRO-ORF8724"
FT                   /product="ZYRO0A11550p"
FT                   /note="similar to uniprot|P36159 Saccharomyces cerevisiae
FT                   YKR079C TRZ1 Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25934"
FT                   /db_xref="GOA:C5DNU3"
FT                   /db_xref="InterPro:IPR027794"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNU3"
FT                   /protein_id="CAR25934.1"
FT                   /translation="MFYLTTVAHPTSDTSHPLLLLQSHHGDRYFFGKMAEGSQRCLTES
FT                   RTRIGKLQDIFLTGELNWNSLGGLPGMILTVADQGKANLKLHHGGDLINYVVSTWRYFV
FT                   FRFGISLQTDAMKDQEIYSDGLLRVKSIIVPQSGGNDNLVFNERQNMALKSIVANMFPK
FT                   NGPTSRYDPSSDPFLNVELPTQFSVPRTSTCYEIVFEPVRGKFRPDIAAKLGVPKGPSF
FT                   GKLASGQSITLDDGSQITPEQVLEKQRQFPRVLILDIPDDSYIEGFREKFKEYDCEDLG
FT                   IVYFFLGGDVTINDNLIKSMELFGNDVQMFVSHPKVCPNTIVFKGAALTVLKLKALMVQ
FT                   NFNLPQSNSILSKEFYECFSKPTDRGTTLSQSQEEPLRSTIPSENVHPFTQGSVTQIES
FT                   FTKGEESMRIKIENNCPDWSWDFAYRRHVKPLNLPSTSFEKIVTEQQGVDNFDTPEKKS
FT                   NVEAITLGTGSALPSKYRNVLSTLLKIPYKTETGNIDSRIILLDAGENTLGTIRRHFPS
FT                   TTVCKIFKNMKMMYLSHLHADHHLGIISILKEWFKYHQDDDEVIYVITPWQYNRFINEW
FT                   LLLEDANLLNRIRYISCEHFVNGSYVRRETKPIPLEEYADGLESADKKRRKLEIDSNSS
FT                   LRDLDTIKKMYKDLRIFNMQTCRAKHCDWAYSNTISFFMSSSSKKLFKMSYSGDTRPNI
FT                   EHFSKDIGKNSDLLIHEATLDNELIEDAIKKKHCTINEAIEVSNEMNAQKLILTHFSQR
FT                   YPKAPQVNDNIKILAKEYCYAFDGMIVDYETLGEQESVFDQLNQVFMEEKQEEEDESQS
FT                   "
FT   gene            complement(<932133..>933977)
FT                   /locus_tag="ZYRO0A11572g"
FT                   /old_locus_tag="ZYRO-ORF8723"
FT   CDS_pept        complement(932133..933977)
FT                   /locus_tag="ZYRO0A11572g"
FT                   /old_locus_tag="ZYRO-ORF8723"
FT                   /product="ZYRO0A11572p"
FT                   /note="similar to uniprot|Q08484 Saccharomyces cerevisiae
FT                   YOR070C GYP1 Cis-golgi GTPase-activating protein (GAP) for
FT                   the Rab family members Ypt1p (in vivo) and for Ypt1p Sec4p
FT                   Ypt7p and Ypt51p (in vitro) involved in vesicle docking and
FT                   fusion"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25935"
FT                   /db_xref="GOA:C5DNU4"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNU4"
FT                   /protein_id="CAR25935.1"
FT                   /translation="MGVRSSSKEMHQKDHGSSPYGYGYSLASSGTNLVSSLMKSWRISS
FT                   ASSPKSNSSYTGDGNFDAMAKQQTTAIKNSSSSSSYSPLKYSTPISSSGGGSASSRRTS
FT                   TDSSKPYTSANKYNPSYYRDSGGGSGSGSGSSRKSDKYFKDLDEDWSAVIDDYNMPIPI
FT                   ITNGGVASPATPKVTRSSSVKTTPTSSTTAMANQNASSTFSYPQLPQLQKTLTTDLRSQ
FT                   LEVENEREAQELTSMLQRMAKFDCILKNKHIINQQELRQISWNGIPKPQRPVVWKLLIG
FT                   YLPANTKRQESLLKRKRQEYHDGLDHVFSEQHSRDVPTWHQIEIDVPRTNPHIPLYQFK
FT                   SVQRSLQRILYLWAIRHPASGYVQGINDLLTPFFQTFLTEYLPQSQIDDVEKLDPESYL
FT                   TESQLNDVEADTFWCLTKLLEQITDNYIHGQPGILKQVKNLSQLVKRIDRDLFNHFQSE
FT                   QVEFIQFAFRWMNCLLMREFQMSTVIRMWDTYLSETSLETSSSAAAMMSDTGPPRTPTE
FT                   PASMTFQSFTSPSTTSKGSSEDLPRLRRSSLNEFHVFVCAAFLIRWSDQLIDMDFQNII
FT                   TFLQNPPTRNWKETDIEMLLSEAYIWQSLYKDATSHWQ"
FT   gene            <935022..>935996
FT                   /locus_tag="ZYRO0A11594g"
FT                   /old_locus_tag="ZYRO-ORF8721"
FT   CDS_pept        935022..935996
FT                   /locus_tag="ZYRO0A11594g"
FT                   /old_locus_tag="ZYRO-ORF8721"
FT                   /product="ZYRO0A11594p"
FT                   /note="highly similar to uniprot|Q02046 Saccharomyces
FT                   cerevisiae YKR080W MTD1 NAD-dependent 5 10-
FT                   methylenetetrahydrafolate dehydrogenase plays a catalytic
FT                   role in oxidation of cytoplasmic one-carbon units
FT                   expression is regulated by Bas1p and Bas2p repressed by
FT                   adenine and may be induced by inositol and choline"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25936"
FT                   /db_xref="GOA:C5DNU5"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR035812"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNU5"
FT                   /protein_id="CAR25936.1"
FT                   /translation="MSDATVSKPGVTVLASKISKIYVEEITSKVKAIQNIRPHGPLLVG
FT                   FLANDDPAAEMYASWTKKTSEDMGFRYELRRIDEKDFLEEAIIEANRDPQVDGIMVYYP
FT                   VFGNAQDQYLQQVVAKEKDVEGMNHVYYQNMYHNIRYLDSENTLKSILPCTPLAVVKIL
FT                   EYLKVYNNLLPQGNRLYGKKCVVVNRSEIVGRPLAALLANDGAVVYSVDIDNIQKFTRG
FT                   EGLKFKKHHVEDLGAFSKDLLKQCCSEADVIITGVPSESYKFPTECIKEGAVCINFSSN
FT                   KNFDETVKSKASLYVPMTGKVTISMLLRNMLRLIENSEKFKNP"
FT   gene            complement(<936104..>937241)
FT                   /locus_tag="ZYRO0A11616g"
FT                   /old_locus_tag="Zyro0A.mRNA.4220.m"
FT   CDS_pept        complement(join(936104..937160,937228..937241))
FT                   /locus_tag="ZYRO0A11616g"
FT                   /old_locus_tag="Zyro0A.mRNA.4220.m"
FT                   /product="ZYRO0A11616p"
FT                   /note="highly similar to uniprot|P36160 Saccharomyces
FT                   cerevisiae YKR081C RPF2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25937"
FT                   /db_xref="GOA:C5DNU6"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="InterPro:IPR039770"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNU6"
FT                   /protein_id="CAR25937.1"
FT                   /translation="MIRTVKPKTAKAKRALKEKEPKLVENVKQALFVPGQTSNKLLHDA
FT                   MVDLSSLKKPDMKRFDRKNEIRPFEDPAPLEFFSEKNDCSLLVLSTTSKKRRNNLTFVR
FT                   TFGYKIYDMVELMIVNNYKLLEDFKAKTFAVGLKPMFSFQGSAFDTHPVYKHLKSLFLD
FT                   FFRGTVTDLYDVAGLQHVISVTLQGDFQDGEPLPNVLFRVYRLRTYRSEQGGRKLPRVE
FT                   LQETGPRFDFKIGRIQSPSPEMEKEARRKPKQLNTKTVKNVDMDPMGDKLGRIHMGKQD
FT                   LNKLQTRKMKGLKSRFDQDQEDDDVEEYINDEEEELNDGEELNDEAENSEEDTYGEEFV
FT                   TAEDIDEPSTKRQKKK"
FT   gene            <937496..>940924
FT                   /locus_tag="ZYRO0A11638g"
FT                   /old_locus_tag="ZYRO-ORF8718"
FT   CDS_pept        937496..940924
FT                   /locus_tag="ZYRO0A11638g"
FT                   /old_locus_tag="ZYRO-ORF8718"
FT                   /product="ZYRO0A11638p"
FT                   /note="similar to uniprot|P36161 Saccharomyces cerevisiae
FT                   YKR082W NUP133 Subunit of the Nup84p subcomplex of the
FT                   nuclear pore complex (NPC) localizes to both sides of the
FT                   NPC required to establish a normal nucleocytoplasmic
FT                   concentration gradient of the GTPase Gsp1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25938"
FT                   /db_xref="GOA:C5DNU7"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR037624"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNU7"
FT                   /protein_id="CAR25938.1"
FT                   /translation="MSSGQPLFQLRKELSVPLSAGEDDTTNQTTDTNTSYERFQSVDVS
FT                   LDTHHHEDKQTFNNIKILTENERYVVKRLAPDLSTLPIDSSSSEGLVDTHSGKALVNDN
FT                   DFLYIWDYYSSQRNTNFCRIPLHEEHVVLKHEPKCLITWPAAMDDTTQMFAENSGGAFG
FT                   GVCIIHRKNGQLIYYEDIDSINNLHLQLSHSKAHTVNLKLKDNESVTEAINCEPAGIVI
FT                   ATSLGRVLFVTIRDSSGKPSVRVKQQLVKPQQGFFFSTFNPSNEVVSLKMGPIVGRGER
FT                   LLYIVTRGGNFQMWHLSVSISSYKRLDVQLFEQILDSLQDLYPFAHGSLQVLDSHPLFP
FT                   DSSSVHLVLSSITNGDEMYYILSTIVLDEKTKSFTIFSTYRLNTYVTSFVDKKPELFIP
FT                   AALGEQLTDTTTVFVLFNDAVVLTQVSSKLDSSYPLRRKWEDIISFRDDVNLIGSGYDS
FT                   ESIYVMSKEIGVLEISVTGEVNESEKSMEEVRFVKSHVDQAVYFSGISSNPIEFNLPKG
FT                   ISLEVDEIEADLRSCSDEIFHSKGKYIPPMMNTLTQHLSLRVDLFRNLLNFVEQNFNFK
FT                   VSPNEKLKLLQNFEILNCCLKLCILLKNLPELNEIWKKTLKLRNSNLTTETLFVGQLHE
FT                   FPKVFSQFLAQLNSKSMPASIPLKTSVVDLLIECVYKGILEEGEKQLRYDLFKLDPLEL
FT                   GIELPWFINYENLESINSSFLDFKFSTQITSDEDKNRLLTLTKTLYYLFNQANLWFKEY
FT                   SQRQETELFGKFQLLFLNNHLSWNQALLDSNLKQEALQIAEFYQDLEALVETLESLDKS
FT                   ISQEAYFYYFDKFGYQFGSTVFQYYISQNKLDDLFYRFPEQHDMLVEFLGSSDKYGEVA
FT                   WIQEILDKRYDAATTTLCDISLGETKKDQPLEQRQVYLNIAKLTGLMNQPIPLDQLKLI
FT                   QGDLDTLDGQKNLLFKLQDPRIKLASGFAGTPFEELFQSLTSKIEQHQSLSLRLLIEIY
FT                   SMLEDTDSFYCALKLIAFNGDSLGYEHKKFLVAMVWRRCILIEDWDSIKDNTKSSLYQV
FT                   LCKYFSEEFFQSGLALPSFALITDSSLLTMEYLQNVYQEREDVIKDSFRKEFESVRSLE
FT                   PQFDKRIQSIIATANEAAGKKCIVNYETNTVEYYS"
FT   gene            complement(<940979..>941347)
FT                   /locus_tag="ZYRO0A11660g"
FT                   /old_locus_tag="ZYRO-ORF8716"
FT   CDS_pept        complement(940979..941347)
FT                   /locus_tag="ZYRO0A11660g"
FT                   /old_locus_tag="ZYRO-ORF8716"
FT                   /product="ZYRO0A11660p"
FT                   /note="similar to uniprot|P36162 Saccharomyces cerevisiae
FT                   YKR083C DAD2 Essential protein component of the DASH
FT                   complex involved in spindle integrity and kinetochore
FT                   function interacts with Duo1p and Dam1p localizes to
FT                   intranuclear spindles and kinetochore"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25939"
FT                   /db_xref="GOA:C5DNU8"
FT                   /db_xref="InterPro:IPR013963"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNU8"
FT                   /protein_id="CAR25939.1"
FT                   /translation="MLPLEEQIEAKKRELEALKKITALTDDMKLQLDELAGQVRQMNSN
FT                   ATSVSRVMENWNSISRSISLAGLSLLQYAEGDYEVGAWKKDKNNNNSNNNKQDEEEPED
FT                   GHGPLPETLVRIRMDDEN"
FT   gene            <941646..>943463
FT                   /locus_tag="ZYRO0A11682g"
FT                   /old_locus_tag="ZYRO-ORF8715"
FT   CDS_pept        941646..943463
FT                   /locus_tag="ZYRO0A11682g"
FT                   /old_locus_tag="ZYRO-ORF8715"
FT                   /product="ZYRO0A11682p"
FT                   /note="similar to uniprot|Q08490 Saccharomyces cerevisiae
FT                   YOR073W SGO1 Component of the spindle checkpoint involved
FT                   in sensing lack of tension on mitotic chromosomes protects
FT                   centromeric Rec8p at meiosis I required for accurate
FT                   chromosomal segregation at meiosis II and for mitotic
FT                   chromosome stability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25940"
FT                   /db_xref="GOA:C5DNU9"
FT                   /db_xref="InterPro:IPR011515"
FT                   /db_xref="InterPro:IPR011516"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNU9"
FT                   /protein_id="CAR25940.1"
FT                   /translation="MARTIKKRSRSGSSGTAAASKVAANASSSFATPGIQELQDLMDAQ
FT                   EGKIAAVKSAYSQQNTQFAKSNSALLMKLTDFEKKISELVQENVILRSRISMNEYTYKE
FT                   RLNEQISILEEGISRRFEEIFHMFDSIRRKENLPSASTTSGSPMESRSILKSKRSRPSS
FT                   GRTSSIHFQDIDTNENKISEEIQTRKKHKSSRRESIFMPGDFDFAYEDQDQPQIEQEQE
FT                   QEQEQEQEQEPPAAPEPEPEPEPPLTETTVAATSPLPLPTQQPLDAETNEIQLGINEEQ
FT                   PQDAHDESLNFTNSIIDYSIPEEAATVGPNSSTEAEPPASSKLEIFRDEPEQETHQKHS
FT                   IPPKQEGKNQSMTFMPLEASQSKIKHSMRPLSTKTKKKMVDEVMPSTNVACDLDFPRTR
FT                   RTRGKAIDYTLPSLRAKMRRPSEKLVDATTFTNIQDLQVTHLDRRSSKGSSRKTTISPE
FT                   PLPDLRAKSEELQAQEPPKESIPIEQPKAVTENTSEGRPKSGDENKSQDHFSFSSTTST
FT                   SSGSSGKALKDITNTPKVKQPPKTKKLFKNAIINDLCDQIPNKSQNSSNDRNVSFRLQE
FT                   EDLSVFDLIGADKVKYPQKTYRAKSRRKA"
FT   gene            complement(<943625..>944557)
FT                   /locus_tag="ZYRO0A11704g"
FT                   /old_locus_tag="ZYRO-ORF8714"
FT   CDS_pept        complement(943625..944557)
FT                   /locus_tag="ZYRO0A11704g"
FT                   /old_locus_tag="ZYRO-ORF8714"
FT                   /product="ZYRO0A11704p"
FT                   /note="highly similar to uniprot|P06785 Saccharomyces
FT                   cerevisiae YOR074C CDC21 Thymidylate synthase required for
FT                   de novo biosynthesis of pyrimidine deoxyribonucleotides
FT                   expression is induced at G1/S"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25941"
FT                   /db_xref="GOA:C5DNV0"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNV0"
FT                   /protein_id="CAR25941.1"
FT                   /translation="MTGQEHKRQRTESSSANAEEQQYLDLIQRILDEGEFRPDRTGTGT
FT                   YSIFAPPQLRFDLSNDRFPLLTTKKVFTKGIILELLWFISGCTDGKKLSEQGVKIWEGN
FT                   GSREYLDKIGLHDRREGDLGPVYGFQWRHFGAKYRTCDDDYTGQGFDQLHEVIHKLKNN
FT                   PYDRRIIMSAWNPPDFPLMALPPCHVFSQFYVSFPKEGKPKLSCLLYQRSCDMGLGVPF
FT                   NIASYSLLTKMIAHVCDMEPGEFIHTMGDAHIYKDHIDALKEQLSRTPKDFPQLKIARK
FT                   MDNIDNFKYEDFKIENYHPHGRIQMNMSV"
FT   gene            <944766..>945767
FT                   /locus_tag="ZYRO0A11726g"
FT                   /old_locus_tag="ZYRO-ORF8712"
FT   CDS_pept        944766..945767
FT                   /locus_tag="ZYRO0A11726g"
FT                   /old_locus_tag="ZYRO-ORF8712"
FT                   /product="ZYRO0A11726p"
FT                   /note="similar to uniprot|P41834 Saccharomyces cerevisiae
FT                   YOR075W UFE1 t-SNARE that resides on the endoplasmic
FT                   reticulum and mediates retrograde traffic from the Golgi
FT                   complex potential Cdc28p substrate endoplasmic reticulum t-
FT                   SNARE coprecipitates with Sec20p Tip1p. and Sec22p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25942"
FT                   /db_xref="GOA:C5DNV1"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR019529"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNV1"
FT                   /protein_id="CAR25942.1"
FT                   /translation="MTDLTNKFKSYLHIIQDSGFTAEDGSDGFKGNESSTNKSKETERL
FT                   RLQDSFIKECYDLLKSLTQLRKILKSVRPSYMNEDEMSEEEKDDVDTELRLQFQQYIQK
FT                   FRLMERYENERQRLISEEFLSSKAYLKSFFQGISSEKLTLFHKANNEFRLGVLKSLSMW
FT                   LNIFSSEFSSMQQERLDAQRKFEALDFNSGLQNVVSVSSVSQTPVVESTQEEVRHYEET
FT                   VSKLTQEQLQLLETEHEEMLNKKNEQLKKAEQLNKTIIDIVGIQHEISAHLQEQSQNIN
FT                   SVLDNQEDVEINIREGNKQLTKAKKSAGKAAKMMTYMAIIMGFMILFLDYIS"
FT   gene            complement(<945790..>948329)
FT                   /locus_tag="ZYRO0A11748g"
FT                   /old_locus_tag="Zyro0A.mRNA.4127.m"
FT   CDS_pept        complement(join(945790..947318,948068..948329))
FT                   /locus_tag="ZYRO0A11748g"
FT                   /old_locus_tag="Zyro0A.mRNA.4127.m"
FT                   /product="ZYRO0A11748p"
FT                   /note="similar to uniprot|P32769 Saccharomyces cerevisiae
FT                   YKR084C HBS1 GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25943"
FT                   /db_xref="GOA:C5DNV2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015033"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNV2"
FT                   /protein_id="CAR25943.1"
FT                   /translation="MVAYEDDDLMDYEEELPEFENEADLDEYLNDDEYELMNQLFPHVK
FT                   KEMVDYQGWDNFALKKTIFETNFDPDESLKILKRSFKKKKSEAAKTKAVENFKKPSPDD
FT                   VVLEAQSRALDNVTENVSKLKVQEEKQAKQQSQPKLATKPTKPTDPIDIQNYLSKGKPH
FT                   CSFVVIGHVDSGKSTLMGRVLYDLGVVDISHLRKLKRESEIVGKSSFHLAWVMDQTPEE
FT                   RERGVTVSVCTNDFETPSTRFTIVDAPGHRDFVPNAIAGISEADAAVLSIDCGTDAFES
FT                   GFNLDGQTKEHTLLARSLGVGHIIVAMNKMDTVDWYQERFEQIRRELSSFFETIGYRPE
FT                   QISWIPCSGLTGANVVKRTTHEMQNWYQGRSLVEELEYKAEQIEKSYQEDIINAPFLFS
FT                   ITEVISVNKNEEVVVSGKVESGSIQPGETLNIFPSEQSVVVNRITIDNNERKVPVATKG
FT                   DFAVLRLRNAFAEIIEAGDLAASVGVEIPVRNTLKVQALTFQMSRPLLPGTPFMFFKGV
FT                   NEQPARVSKLNSIIDKQDPSKIIKKKVKHLGSNQAAIFEIELVEKERWIPFLTSTQNRR
FT                   MSRIVMRKEGRTIAAGTIIE"
FT   gene            <948612..>949118
FT                   /locus_tag="ZYRO0A11770g"
FT                   /old_locus_tag="ZYRO-ORF8708"
FT   CDS_pept        948612..949118
FT                   /locus_tag="ZYRO0A11770g"
FT                   /old_locus_tag="ZYRO-ORF8708"
FT                   /product="ZYRO0A11770p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25944"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNV3"
FT                   /protein_id="CAR25944.1"
FT                   /translation="MLAVSSMSSSRETATTKSSSLIPSTFILARSSRYHKCALFNVLPS
FT                   DLTNESAFAGEKCRLFYGDVVLDEYIENGSSISRYILKFEWNRGGSRRRNVFCHTEVMD
FT                   NVHKWNETITEWSSERFRIMMQCSDDRYILLELQICETSEDRKFRDVLCRISEEFEIWA
FT                   ELMDD"
FT   gene            complement(<949187..>949801)
FT                   /locus_tag="ZYRO0A11792g"
FT                   /old_locus_tag="ZYRO-ORF8707"
FT   CDS_pept        complement(949187..949801)
FT                   /locus_tag="ZYRO0A11792g"
FT                   /old_locus_tag="ZYRO-ORF8707"
FT                   /product="ZYRO0A11792p"
FT                   /note="similar to uniprot|P22354 Saccharomyces cerevisiae
FT                   YKR085C MRPL20 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25945"
FT                   /db_xref="GOA:C5DNV4"
FT                   /db_xref="InterPro:IPR024388"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNV4"
FT                   /protein_id="CAR25945.1"
FT                   /translation="MQCFVRRIHNSSFQLKNLSKIINNSKKTPELKGASTIYNAKSSAS
FT                   NYKGYMRAKVPAGLYFNRAPSSPTGSINSETIPSSFLPSNDPRKQLVQEIASKDVLSKP
FT                   DAPPVLPSRSSLQGKSYHLNPEQIEQIRRLRLEDPAKNTRKSLASQYNVSPLFISMVSE
FT                   PPKEWKQEMDSRLTTIKSKWHVKRVTAREDRKRRKELWYRS"
FT   gene            <950029..>953286
FT                   /locus_tag="ZYRO0A11814g"
FT                   /old_locus_tag="ZYRO-ORF8706"
FT   CDS_pept        950029..953286
FT                   /locus_tag="ZYRO0A11814g"
FT                   /old_locus_tag="ZYRO-ORF8706"
FT                   /product="ZYRO0A11814p"
FT                   /note="similar to uniprot|P15938 Saccharomyces cerevisiae
FT                   YKR086W PRP16 RNA helicase in the DEAH-box family involved
FT                   in the second catalytic step of splicing exhibits ATP-
FT                   dependent RNA unwinding activity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25946"
FT                   /db_xref="GOA:C5DNV5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNV5"
FT                   /protein_id="CAR25946.1"
FT                   /translation="MSDDEELIRFVQEHRSSTVTSNFIKTLRKLVENCRGDSNKFVAGC
FT                   KALGGFQGQDEFLGTLFVRLNGRKAIPLPPVKRKIRLQLDLDEDEDENEDGEEQDIPLF
FT                   KPKRNPSQFKRIDKNTAQKLKEFNKDAAVLKDKDKQQISTTTEEDKSGTSIGMPKLQAV
FT                   SDNEEEDQEESGNDTDGSVVSEDSVAEDREWYNYDDDYGNPVTEEPAKDMDFKNPVQSY
FT                   KNFKMPTTSVQLYTMPVSQRKQFLPPFLKKNYQLQGVTDATIVGSFLDSPLSGLVNPFK
FT                   NPDGELSVSAKKGSHLVALRRLQKDKTQRSREAADVVGTALGDVLGLKEKDQNQTAVDV
FT                   SNDATDQEVSSREDILQARKSLPAYAMRSQIIQTIRDNQVTIIIGETGSGKTTQLAQYL
FT                   DEAGICQSGKSIGCTQPRRVAAMSVAKRVALEMGVELGQEVGYSIRFEDCTSNKTKIKF
FT                   MTDGILLREALMDHTLEKYDCIIIDEAHERSLNTDVILGLFKRLLARRRDIKLIITSAT
FT                   INATKFADFFGGAPLCTIPGRTFPIQIIYSKHPVSDYVEASVMQAIRIHLSADVDAGDI
FT                   LIFMTGQEDIEATNDALREKLTEVYSKSMGITRYDEINNVEIFPIYSALPADVQSRIFK
FT                   KLESGKRKIVISTNIAETSLTIDGIRYVVDCGFSKLKVYNPKIGLDSLTITPISRANAD
FT                   QRSGRAGRTGPGTAYRMYTEDAAYDDMYSQAIPEIQRTNLSNTVLLLKSLHVDDILKFP
FT                   FIDPPPLQTLLASLYELHFLGALDNFGNLTSLGTEMSKLPLRPSLSKALLISARNGCSE
FT                   EMVTIVSMLSVPIVFYRPTERQKESDQARSRFFVPESDHLTFLNVYSQWKSNRYSHRWC
FT                   GRHFLQYRSLQRARDIRVQLVKIMQSQGIPLVSSGTEWDIVRRCICSGFAHQAAKISGL
FT                   GKYVHLKTGMEVQLHPTSALYGMGDLPPFVVYNELLMTTKEYISCVTSVDPFWLMDYGG
FT                   LLYDIKRIKEIDNNDVKGFFQLVDEPQEREDEPDELDLRMKDCLAARDRVIRRLEESDK
FT                   KFAQQNSDSLRSSSSSSSNKRDTDKSVQIGFKRRRPF"
FT   gene            complement(<953325..>954359)
FT                   /locus_tag="ZYRO0A11836g"
FT                   /old_locus_tag="ZYRO-ORF8703"
FT   CDS_pept        complement(953325..954359)
FT                   /locus_tag="ZYRO0A11836g"
FT                   /old_locus_tag="ZYRO-ORF8703"
FT                   /product="ZYRO0A11836p"
FT                   /note="similar to uniprot|P36163 Saccharomyces cerevisiae
FT                   YKR087C OMA1 Metalloendopeptidase of the mitochondrial
FT                   inner membrane involved in turnover of membrane-embedded
FT                   proteins member of a family of predicted membrane-bound
FT                   metallopeptidases in prokaryotes and higher eukaryotes"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25947"
FT                   /db_xref="GOA:C5DNV6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNV6"
FT                   /protein_id="CAR25947.1"
FT                   /translation="MFKRFSSKIFPSAKNASARLTAFRTYQQATYRRFNNARPGFQLNI
FT                   YDPTTRKILGFVAGGGGLFYLANLKEAPVSGRRRFLWIPPSLELMIGKSSYKSILRETG
FT                   PFLLPDTHPTTQRVSKIFSRIVDAALKDPSVDKSSLQGIEWKVHVVNNPRAPPNAFVLP
FT                   GGKVFVFSSILGICQNDDGLATVLSHEFSHQLARHTAENLSKTPIYLILSTLLYTVTGA
FT                   ESINRLLLDSILRMPASRQMETEADYIGLMIMSRACFDPQESIKLWGRMSDFEKKNIGA
FT                   GARFEFLSTHPASERRIDNMREWISQASQLYDQSDCGQFGGFYRGFQNSIFGPPEPPTI
FT                   LRGF"
FT   gene            <954506..>955237
FT                   /locus_tag="ZYRO0A11858g"
FT                   /old_locus_tag="ZYRO-ORF8701"
FT   CDS_pept        954506..955237
FT                   /locus_tag="ZYRO0A11858g"
FT                   /old_locus_tag="ZYRO-ORF8701"
FT                   /product="ZYRO0A11858p"
FT                   /note="similar to uniprot|Q759P8 Ashbya gossypii ADR225W
FT                   ADR225Wp and weakly similar to YOR077W uniprot|P40962
FT                   Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25948"
FT                   /db_xref="GOA:C5DNV7"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR019447"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR037321"
FT                   /db_xref="InterPro:IPR038254"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNV7"
FT                   /protein_id="CAR25948.1"
FT                   /translation="MGRAEYGTAKYASKQMKARGLQKLKFYCQVCQKQCRDDNGFKSHI
FT                   KSPSHVRKISQVSQTDIDEYTREFENDFLRLLKLAHGEKKIEANKFYNEYIQDKDHVHM
FT                   NATRFTSLTKFIKYLGQTGKIRVHGVDVSKGNNDKSDEDADDDIDMGQLMISYIDNSQG
FT                   NLLRREKLQELAKDEKSDQEIKMMLLQRQMQSAAENVEEDKEEEIAAPVVREPVGKVSL
FT                   QLGKSSSRSKKRPNIRKNVFQ"
FT   gene            complement(<955259..>956263)
FT                   /locus_tag="ZYRO0A11880g"
FT                   /old_locus_tag="ZYRO-ORF8700"
FT   CDS_pept        complement(955259..956263)
FT                   /locus_tag="ZYRO0A11880g"
FT                   /old_locus_tag="ZYRO-ORF8700"
FT                   /product="ZYRO0A11880p"
FT                   /note="similar to uniprot|P36164 Saccharomyces cerevisiae
FT                   YKR088C TVP38 Integral membrane protein localized to
FT                   vesicles along with the v-SNARE Tlg2p green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm in
FT                   a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25949"
FT                   /db_xref="GOA:C5DNV8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNV8"
FT                   /protein_id="CAR25949.1"
FT                   /translation="MSQHVRASSQDARIHLSEMRGSSTSPRPAMVSRPNYDDDYDIGGD
FT                   GVGEEDDFLDVYDLTPRQRLVRHFKKTLFKLMNHYAFLPVWQKVAVIIGGLCALVLGIL
FT                   LLVFHTPMLHWLVHTSNELKSQKKTAFILILLIFCVSFPPLIGFSFLSTSTGLIYGVSF
FT                   EGWMILVAGSVFGSIASFAVFQTLLRSRAEQLVHASPRFEAFAAILQENHSYWILALLR
FT                   LCPFPYSLTNGAVAAVHGLSLRNFAIAQVIASPKLFAYLFVGSRIKNIGESNSTGSKLF
FT                   DLISILVTGVVLTITAWILYFKTRNKYMEIQRLQQHQDHQSHRSVSPDVEFDI"
FT   gene            <957251..>958099
FT                   /locus_tag="ZYRO0A11902g"
FT                   /old_locus_tag="ZYRO-ORF8697"
FT   CDS_pept        957251..958099
FT                   /locus_tag="ZYRO0A11902g"
FT                   /old_locus_tag="ZYRO-ORF8697"
FT                   /product="ZYRO0A11902p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25950"
FT                   /db_xref="GOA:C5DNV9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNV9"
FT                   /protein_id="CAR25950.1"
FT                   /translation="MAQNIRDLKVPTPAAELPGHVLDFFKLKGRVASVTGASGGIGYEV
FT                   ALGFAQAGADVAMWYNSNPKIEEEVGELSKKYGVKIKAYKCSVTDSADVERTVDQIVKD
FT                   FGRIDIQVANAGVGWNRGPILDYLEEAGREALDKEWNKVIDVDFNSVYYVARATGKHFK
FT                   KQGNGSLILTASISGQIVNIPQMQAAYNSAKAGVIHLGRSLSMEWAGFARVNTVSPGYI
FT                   ETPLTDRLSQELRDRWIEYVPLGRLANPRELVGAYLYLASDASTYVTGTDIRVDGGYCA
FT                   F"
FT   gene            <958538..>959245
FT                   /locus_tag="ZYRO0A11924g"
FT                   /old_locus_tag="ZYRO-ORF8693"
FT   CDS_pept        958538..959245
FT                   /locus_tag="ZYRO0A11924g"
FT                   /old_locus_tag="ZYRO-ORF8693"
FT                   /product="ZYRO0A11924p"
FT                   /note="some similarities with uniprot|P38276 Saccharomyces
FT                   cerevisiae YBR137W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25951"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR010371"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNW0"
FT                   /protein_id="CAR25951.1"
FT                   /translation="MRTNFIKCSNLFQSKSRRTCILTKMSRKEGSKILEYSETCNLTLG
FT                   PDPLVKFDVDDAFNLGIMARSLILEKIREDGYVIEICSADDHCLFRCCTSSDTTVGNDW
FT                   RLELKRQAALKHRNSSFELQKRIGSYMNSKLIKSTRAYLLENKHTVITEGAVLIFVKGV
FT                   SFPVGCFAIDKRDPCFRIEHIAKYCLYRYSQEQLQKQEQKLELEISKRVEEKLKLDNPI
FT                   QKIDGEAWKLFKE"
FT   gene            complement(<959285..>959404)
FT                   /locus_tag="ZYRO0A11946r"
FT                   /old_locus_tag="Zyro0A.tLeu.CAA.28"
FT   tRNA            complement(join(959285..959328,959367..959404))
FT                   /locus_tag="ZYRO0A11946r"
FT                   /old_locus_tag="Zyro0A.tLeu.CAA.28"
FT                   /note="tRNA-Leu (CAA) cove"
FT   gene            <959715..>960575
FT                   /locus_tag="ZYRO0A11968g"
FT                   /old_locus_tag="ZYRO-ORF8692"
FT   CDS_pept        959715..960575
FT                   /locus_tag="ZYRO0A11968g"
FT                   /old_locus_tag="ZYRO-ORF8692"
FT                   /product="ZYRO0A11968p"
FT                   /note="similar to uniprot|P53210 Saccharomyces cerevisiae
FT                   YGR017W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25952"
FT                   /db_xref="GOA:C5DNW1"
FT                   /db_xref="InterPro:IPR024624"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNW1"
FT                   /protein_id="CAR25952.1"
FT                   /translation="MRNCNQLLPTRSFNPTRMIHQMAPWVPTFIQSTKNNPKPFLPFQL
FT                   ATVDVHTNKPRCRTLVFRDFLFMDKRSNVLTFHIDLRSNKVAESFSLDSPTPVEACFYF
FT                   AETREQYRFSGHCFLITKRNHSEIPQDVTHRYGIISPSVCGHHKDELYKFATEDERQHS
FT                   TDNSNRQERVLSQGDFKPPLEQEWGMELKRQWSRLSRSSKSQYRKPNPGTELTTQSSNL
FT                   LDKINRGVDGSKEETGLENFAIACICVDEVDYLNLTSGSGDERVIFSRSVEGGTENWDE
FT                   KHVCP"
FT   gene            <961203..>962747
FT                   /locus_tag="ZYRO0A11990g"
FT                   /old_locus_tag="ZYRO-ORF8691"
FT   CDS_pept        961203..962747
FT                   /locus_tag="ZYRO0A11990g"
FT                   /old_locus_tag="ZYRO-ORF8691"
FT                   /product="ZYRO0A11990p"
FT                   /note="highly similar to uniprot|P17649 Saccharomyces
FT                   cerevisiae YGR019W UGA1 Gamma-aminobutyrate (GABA)
FT                   transaminase (4-aminobutyrate aminotransferase) involved in
FT                   the 4-aminobutyrate and glutamate degradation pathways
FT                   required for normal oxidative stress tolerance and nitrogen
FT                   utilization"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A11990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25953"
FT                   /db_xref="GOA:C5DNW2"
FT                   /db_xref="InterPro:IPR004631"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNW2"
FT                   /protein_id="CAR25953.1"
FT                   /translation="MLRVRQAATKTKGMAPRYLNGADSTARRTLLVPTRNFQTSTIRMS
FT                   VTSKYYPNEPTKPLVKTESIPGPISKKEIAELDKVFDARPAYFVADYEKSLGNYIADVD
FT                   GNLYLDLYAQIASIALGYNNPALIKAAQSQEMIRALVDRPALANFPSKDLTNSLSKLLK
FT                   FAPKGQDHVWPALSGADANELAFKAAFMFRQSHERGYDTEFSKEENDSVMDNQAPGSPQ
FT                   LSVLSFRRAFHGRLFASGSSTNSKPLHKLDFPAFDWPHAEYPTYKFPLEENEAANRAED
FT                   DRCLKQVEDLIVTWKNPVAALIVEPIQSEGGDNHASKYFLQSLRDITLKHNVVYIIDEV
FT                   QTGVGATGKFWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFNTWCGEP
FT                   ARLLIAGAIGDEIVNKGLLEQVQRVGKYLFGKLEQLQKQYPDKLQNLRGKDRGTFIAWD
FT                   LPTGEQRDLLLKKLKLNGCNVGGCSTSSVRLRPSLTFEEKHADIFVDALTKSIKEL"
FT   gene            <963062..>964999
FT                   /locus_tag="ZYRO0A12012g"
FT                   /old_locus_tag="ZYRO-ORF8689"
FT   CDS_pept        963062..964999
FT                   /locus_tag="ZYRO0A12012g"
FT                   /old_locus_tag="ZYRO-ORF8689"
FT                   /product="ZYRO0A12012p"
FT                   /note="some similarities with uniprot|Q12114 Saccharomyces
FT                   cerevisiae YLR330W CHS5 Protein of unknown function
FT                   involved in chitin biosynthesis by regulating Chs3p
FT                   localization also involved in cell fusion during mating"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A12012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25954"
FT                   /db_xref="GOA:C5DNW3"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR031669"
FT                   /db_xref="InterPro:IPR031673"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNW3"
FT                   /protein_id="CAR25954.1"
FT                   /translation="MSDVEVLLTVGKLDASLALLTTQDHHVIEFPTMLLPDNVKAGSIV
FT                   KLSVSQNLEEEKRQRRLFKDIQMKILEKYGTEKPEAPVLKIVNVTQTSCVLAWDPLSLG
FT                   SARLKSLILYRQGVRSMVIPSPLKTTTTKISGLSVDTDYEFQLKLSTTSGQYWSEKVKM
FT                   HTHKMTDMSGITVCLGALDPLQNVSDEQIAQSLQKIGARPMQKHAAIDTTHFVTNEVDN
FT                   EDDPELVRAKSSNIPIVRPEWVRACEIERRIVGVRGFYLDADPGILKSYQFPKVNGSKV
FT                   KFADKAETMGEKKEEEPKKEAEEPKIEAEEPKKEVEEPKKETEEPKTEGYTKQEEEIKE
FT                   QQTEKEVSEAKEDVNTDKLNEAGEAATETTTEVKEDAPQGDQNVSEAKKEEEPAQVPET
FT                   NEKVVEEAKPEVDATIQANKEPEASQAGAQAEAVSSEAAEPKEASTEEKLDVTEAKEAT
FT                   KPEETKEETIEAKSGTQEEAPEAVEEKPDASDAKPEEAKNETADEKTGANEAAELKPDE
FT                   AKKDTSEVKPDEVEEKTTEAKPEEVKAETAAVQPEESNQEESKAEVTPESNADESKESP
FT                   KESQPETAETKPSETQDNLETSQPKTESQEATPEPSSQENTQTPTPKPTPSAGSGNSKK
FT                   NKKKNKNKKK"
FT   gene            complement(<965078..>965434)
FT                   /locus_tag="ZYRO0A12034g"
FT                   /old_locus_tag="ZYRO-ORF8686"
FT   CDS_pept        complement(965078..965434)
FT                   /locus_tag="ZYRO0A12034g"
FT                   /old_locus_tag="ZYRO-ORF8686"
FT                   /product="ZYRO0A12034p"
FT                   /note="highly similar to uniprot|P39111 Saccharomyces
FT                   cerevisiae YGR020C VMA7 Vacuolar H ATPase subunit F of the
FT                   catalytic (V1) sector"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A12034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25955"
FT                   /db_xref="GOA:C5DNW4"
FT                   /db_xref="InterPro:IPR005772"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNW4"
FT                   /protein_id="CAR25955.1"
FT                   /translation="MTDKRTLIATIADEDTNTGLLLAGVGQITPETQDKNFFVYQEGKT
FT                   TREDVRQAFDKFTKDRDDVAILLINQHIAELIRSDLDGFTSAFPAVLEIPSKDHPYDPE
FT                   KDSVLKRVRRLYGE"
FT   gene            <966074..>966916
FT                   /locus_tag="ZYRO0A12056g"
FT                   /old_locus_tag="ZYRO-ORF8683"
FT   CDS_pept        966074..966916
FT                   /locus_tag="ZYRO0A12056g"
FT                   /old_locus_tag="ZYRO-ORF8683"
FT                   /product="ZYRO0A12056p"
FT                   /note="similar to uniprot|P53212 Saccharomyces cerevisiae
FT                   YGR021W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0A12056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR25956"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DNW5"
FT                   /protein_id="CAR25956.1"
FT                   /translation="MIGSTLRNLPAISPKRCSPRFLHTTAIQLSGHNKWSTIKHDKAKN
FT                   DSQKNKLFSQFAQRISIAVKQGGSTDPNINMRLATALEQAQKNNVTKKVIENAIRKGSG
FT                   VPAPGEKPTESCIYEGIGPGGISYVVEALTDNKNRTISLVRSAFNKAGGSMTPTLYCFQ
FT                   RRGFVNILSPKGMDEEQVIMTILDVEGVEDYSEMDDVELGEGEYGGSFVVFTKPSDANK
FT                   VAQRLKESKFYVDDVGVEFNAQDPIGSTLKEEELRANDSLENALDDIEEVTDVYTNRG"
FT   gene            complement(<966974..>967045)
FT                   /locus_tag="ZYRO0A12078r"
FT                   /old_locus_tag="Zyro0A.tGlu.CTC.27"
FT   tRNA            complement(966974..967045)
FT                   /locus_tag="ZYRO0A12078r"
FT                   /old_locus_tag="Zyro0A.tGlu.CTC.27"
FT                   /note="tRNA-Glu (CTC) cove score=60.59"
FT   gene            <967785..>969401
FT                   /locus_tag="ZYRO0A12100g"
FT                   /old_locus_tag="ZYRO-ORF8680"
FT   CDS_pept        967785..969401
FT                   /locus_tag="ZYRO0A12100g"
FT                   /old_locus_tag="ZYRO-ORF8680"
FT                   /product="ZYRO0A12100p"
FT                   /note="some similarities with uniprot|P36027 Saccharomyces
FT                   cerevisiae YLR332W MID2 Protein required for mating and to
FT                   YGR023W uniprot|P53214 Saccharomyces cerevisiae YGR023W
FT                   MTL1 Protein with both structural and