(data stored in ACNUC22857 zone)

EMBL: CU928179

ID   CU928179; SV 1; linear; genomic DNA; STD; FUN; 1865392 BP.
XX
AC   CU928179;
XX
PR   Project:PRJNA12502;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Zygosaccharomyces rouxii strain CBS732 chromosome G complete sequence.
XX
KW   genomic DNA.
XX
OS   Zygosaccharomyces rouxii
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Zygosaccharomyces.
XX
RN   [1]
RP   1-1865392
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1865392
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   MD5; 6c7a4fdb6e8582afb0d99b82e4cff451.
DR   BioSample; SAMEA3138235.
DR   CABRI; CBS 732.
DR   EnsemblGenomes-Gn; ENSRNA049644807.
DR   EnsemblGenomes-Gn; ENSRNA049644827.
DR   EnsemblGenomes-Gn; ENSRNA049644840.
DR   EnsemblGenomes-Gn; ENSRNA049644855.
DR   EnsemblGenomes-Gn; ENSRNA049644876.
DR   EnsemblGenomes-Gn; ENSRNA049644890.
DR   EnsemblGenomes-Gn; ENSRNA049644912.
DR   EnsemblGenomes-Gn; ENSRNA049644927.
DR   EnsemblGenomes-Gn; ENSRNA049644943.
DR   EnsemblGenomes-Gn; ENSRNA049644956.
DR   EnsemblGenomes-Gn; ENSRNA049644974.
DR   EnsemblGenomes-Gn; ENSRNA049644992.
DR   EnsemblGenomes-Gn; ENSRNA049645016.
DR   EnsemblGenomes-Gn; ENSRNA049645031.
DR   EnsemblGenomes-Gn; ENSRNA049645044.
DR   EnsemblGenomes-Gn; ENSRNA049645060.
DR   EnsemblGenomes-Gn; ENSRNA049645077.
DR   EnsemblGenomes-Gn; ENSRNA049645096.
DR   EnsemblGenomes-Gn; ENSRNA049645117.
DR   EnsemblGenomes-Gn; ENSRNA049645139.
DR   EnsemblGenomes-Gn; ENSRNA049645171.
DR   EnsemblGenomes-Gn; ENSRNA049645183.
DR   EnsemblGenomes-Gn; ENSRNA049645197.
DR   EnsemblGenomes-Gn; ENSRNA049645219.
DR   EnsemblGenomes-Gn; ENSRNA049645242.
DR   EnsemblGenomes-Gn; ENSRNA049645258.
DR   EnsemblGenomes-Gn; ENSRNA049645269.
DR   EnsemblGenomes-Gn; ENSRNA049645298.
DR   EnsemblGenomes-Gn; ENSRNA049645333.
DR   EnsemblGenomes-Gn; ENSRNA049645361.
DR   EnsemblGenomes-Gn; ENSRNA049645383.
DR   EnsemblGenomes-Gn; ENSRNA049645411.
DR   EnsemblGenomes-Gn; ENSRNA049645426.
DR   EnsemblGenomes-Gn; ENSRNA049645446.
DR   EnsemblGenomes-Gn; ENSRNA049645479.
DR   EnsemblGenomes-Gn; ENSRNA049645509.
DR   EnsemblGenomes-Gn; ENSRNA049645542.
DR   EnsemblGenomes-Gn; ENSRNA049645574.
DR   EnsemblGenomes-Gn; ENSRNA049645603.
DR   EnsemblGenomes-Gn; ENSRNA049645629.
DR   EnsemblGenomes-Gn; ENSRNA049645657.
DR   EnsemblGenomes-Gn; ENSRNA049645670.
DR   EnsemblGenomes-Gn; ENSRNA049645689.
DR   EnsemblGenomes-Gn; ENSRNA049645712.
DR   EnsemblGenomes-Gn; ENSRNA049645747.
DR   EnsemblGenomes-Gn; ENSRNA049645766.
DR   EnsemblGenomes-Gn; ENSRNA049645785.
DR   EnsemblGenomes-Gn; ENSRNA049645819.
DR   EnsemblGenomes-Gn; ENSRNA049645842.
DR   EnsemblGenomes-Gn; ENSRNA049645872.
DR   EnsemblGenomes-Gn; ENSRNA049645891.
DR   EnsemblGenomes-Gn; ENSRNA049645916.
DR   EnsemblGenomes-Gn; ENSRNA049645931.
DR   EnsemblGenomes-Gn; ENSRNA049645965.
DR   EnsemblGenomes-Gn; ENSRNA049645983.
DR   EnsemblGenomes-Gn; ENSRNA049646019.
DR   EnsemblGenomes-Gn; ENSRNA049646053.
DR   EnsemblGenomes-Gn; ENSRNA049646086.
DR   EnsemblGenomes-Gn; ENSRNA049646132.
DR   EnsemblGenomes-Gn; ENSRNA049646169.
DR   EnsemblGenomes-Gn; ENSRNA049646184.
DR   EnsemblGenomes-Gn; ENSRNA049646213.
DR   EnsemblGenomes-Gn; ENSRNA049646253.
DR   EnsemblGenomes-Gn; ENSRNA049674183.
DR   EnsemblGenomes-Gn; ENSRNA049674242.
DR   EnsemblGenomes-Gn; ENSRNA049674333.
DR   EnsemblGenomes-Gn; ENSRNA049674389.
DR   EnsemblGenomes-Gn; ENSRNA049674443.
DR   EnsemblGenomes-Gn; ENSRNA049674505.
DR   EnsemblGenomes-Gn; ENSRNA049674580.
DR   EnsemblGenomes-Gn; ENSRNA049674637.
DR   EnsemblGenomes-Gn; ENSRNA049674710.
DR   EnsemblGenomes-Gn; ENSRNA049674790.
DR   EnsemblGenomes-Gn; ENSRNA049674866.
DR   EnsemblGenomes-Gn; ZYRO0G00220r.
DR   EnsemblGenomes-Gn; ZYRO0G00594r.
DR   EnsemblGenomes-Gn; ZYRO0G00660r.
DR   EnsemblGenomes-Gn; ZYRO0G00858r.
DR   EnsemblGenomes-Gn; ZYRO0G00880r.
DR   EnsemblGenomes-Gn; ZYRO0G00968r.
DR   EnsemblGenomes-Gn; ZYRO0G01122r.
DR   EnsemblGenomes-Gn; ZYRO0G01232r.
DR   EnsemblGenomes-Gn; ZYRO0G01254r.
DR   EnsemblGenomes-Gn; ZYRO0G01496r.
DR   EnsemblGenomes-Gn; ZYRO0G02200r.
DR   EnsemblGenomes-Gn; ZYRO0G02332r.
DR   EnsemblGenomes-Gn; ZYRO0G02728r.
DR   EnsemblGenomes-Gn; ZYRO0G02882r.
DR   EnsemblGenomes-Gn; ZYRO0G03432r.
DR   EnsemblGenomes-Gn; ZYRO0G03652r.
DR   EnsemblGenomes-Gn; ZYRO0G03674r.
DR   EnsemblGenomes-Gn; ZYRO0G03960r.
DR   EnsemblGenomes-Gn; ZYRO0G04070r.
DR   EnsemblGenomes-Gn; ZYRO0G04290r.
DR   EnsemblGenomes-Gn; ZYRO0G04576r.
DR   EnsemblGenomes-Gn; ZYRO0G04774r.
DR   EnsemblGenomes-Gn; ZYRO0G04906r.
DR   EnsemblGenomes-Gn; ZYRO0G05588r.
DR   EnsemblGenomes-Gn; ZYRO0G06094r.
DR   EnsemblGenomes-Gn; ZYRO0G06138r.
DR   EnsemblGenomes-Gn; ZYRO0G06996r.
DR   EnsemblGenomes-Gn; ZYRO0G07062r.
DR   EnsemblGenomes-Gn; ZYRO0G07678r.
DR   EnsemblGenomes-Gn; ZYRO0G08646r.
DR   EnsemblGenomes-Gn; ZYRO0G08668r.
DR   EnsemblGenomes-Gn; ZYRO0G09042r.
DR   EnsemblGenomes-Gn; ZYRO0G09218r.
DR   EnsemblGenomes-Gn; ZYRO0G09240r.
DR   EnsemblGenomes-Gn; ZYRO0G09262r.
DR   EnsemblGenomes-Gn; ZYRO0G09636r.
DR   EnsemblGenomes-Gn; ZYRO0G10142r.
DR   EnsemblGenomes-Gn; ZYRO0G10560r.
DR   EnsemblGenomes-Gn; ZYRO0G10736r.
DR   EnsemblGenomes-Gn; ZYRO0G11132r.
DR   EnsemblGenomes-Gn; ZYRO0G11352r.
DR   EnsemblGenomes-Gn; ZYRO0G12122r.
DR   EnsemblGenomes-Gn; ZYRO0G12166r.
DR   EnsemblGenomes-Gn; ZYRO0G12826r.
DR   EnsemblGenomes-Gn; ZYRO0G12848r.
DR   EnsemblGenomes-Gn; ZYRO0G13024r.
DR   EnsemblGenomes-Gn; ZYRO0G13266r.
DR   EnsemblGenomes-Gn; ZYRO0G13442r.
DR   EnsemblGenomes-Gn; ZYRO0G13860r.
DR   EnsemblGenomes-Gn; ZYRO0G13882r.
DR   EnsemblGenomes-Gn; ZYRO0G13904r.
DR   EnsemblGenomes-Gn; ZYRO0G13926r.
DR   EnsemblGenomes-Gn; ZYRO0G14366r.
DR   EnsemblGenomes-Gn; ZYRO0G14410r.
DR   EnsemblGenomes-Gn; ZYRO0G15158r.
DR   EnsemblGenomes-Gn; ZYRO0G15532r.
DR   EnsemblGenomes-Gn; ZYRO0G15928r.
DR   EnsemblGenomes-Gn; ZYRO0G17688r.
DR   EnsemblGenomes-Gn; ZYRO0G17908r.
DR   EnsemblGenomes-Gn; ZYRO0G18392r.
DR   EnsemblGenomes-Gn; ZYRO0G18414r.
DR   EnsemblGenomes-Gn; ZYRO0G19382r.
DR   EnsemblGenomes-Gn; ZYRO0G19470r.
DR   EnsemblGenomes-Gn; ZYRO0G19536r.
DR   EnsemblGenomes-Gn; ZYRO0G19558r.
DR   EnsemblGenomes-Gn; ZYRO0G19668r.
DR   EnsemblGenomes-Gn; ZYRO0G20174r.
DR   EnsemblGenomes-Gn; ZYRO0G21098r.
DR   EnsemblGenomes-Gn; ZYRO0G21274r.
DR   EnsemblGenomes-Gn; ZYRO0G22066r.
DR   EnsemblGenomes-Gn; ZYRO0G22088r.
DR   EnsemblGenomes-Gn; ZYRO0G22220r.
DR   EnsemblGenomes-Gn; ZYRO0G22242r.
DR   EnsemblGenomes-Tr; EFT00001983252.
DR   EnsemblGenomes-Tr; EFT00001983253.
DR   EnsemblGenomes-Tr; EFT00001983254.
DR   EnsemblGenomes-Tr; EFT00001983255.
DR   EnsemblGenomes-Tr; EFT00001983256.
DR   EnsemblGenomes-Tr; EFT00001983257.
DR   EnsemblGenomes-Tr; EFT00001983258.
DR   EnsemblGenomes-Tr; EFT00001983259.
DR   EnsemblGenomes-Tr; EFT00001983260.
DR   EnsemblGenomes-Tr; EFT00001983261.
DR   EnsemblGenomes-Tr; EFT00001983262.
DR   EnsemblGenomes-Tr; EFT00001983263.
DR   EnsemblGenomes-Tr; EFT00001983264.
DR   EnsemblGenomes-Tr; EFT00001983265.
DR   EnsemblGenomes-Tr; EFT00001983266.
DR   EnsemblGenomes-Tr; EFT00001983267.
DR   EnsemblGenomes-Tr; EFT00001983268.
DR   EnsemblGenomes-Tr; EFT00001983269.
DR   EnsemblGenomes-Tr; EFT00001983270.
DR   EnsemblGenomes-Tr; EFT00001983271.
DR   EnsemblGenomes-Tr; EFT00001983272.
DR   EnsemblGenomes-Tr; EFT00001983273.
DR   EnsemblGenomes-Tr; EFT00001983274.
DR   EnsemblGenomes-Tr; EFT00001983275.
DR   EnsemblGenomes-Tr; EFT00001983276.
DR   EnsemblGenomes-Tr; EFT00001983277.
DR   EnsemblGenomes-Tr; EFT00001983278.
DR   EnsemblGenomes-Tr; EFT00001983279.
DR   EnsemblGenomes-Tr; EFT00001983280.
DR   EnsemblGenomes-Tr; EFT00001983281.
DR   EnsemblGenomes-Tr; EFT00001983282.
DR   EnsemblGenomes-Tr; EFT00001983283.
DR   EnsemblGenomes-Tr; EFT00001983284.
DR   EnsemblGenomes-Tr; EFT00001983285.
DR   EnsemblGenomes-Tr; EFT00001983286.
DR   EnsemblGenomes-Tr; EFT00001983287.
DR   EnsemblGenomes-Tr; EFT00001983288.
DR   EnsemblGenomes-Tr; EFT00001983289.
DR   EnsemblGenomes-Tr; EFT00001983290.
DR   EnsemblGenomes-Tr; EFT00001983291.
DR   EnsemblGenomes-Tr; EFT00001983292.
DR   EnsemblGenomes-Tr; EFT00001983293.
DR   EnsemblGenomes-Tr; EFT00001983294.
DR   EnsemblGenomes-Tr; EFT00001983295.
DR   EnsemblGenomes-Tr; EFT00001983296.
DR   EnsemblGenomes-Tr; EFT00001983297.
DR   EnsemblGenomes-Tr; EFT00001983298.
DR   EnsemblGenomes-Tr; EFT00001983299.
DR   EnsemblGenomes-Tr; EFT00001983300.
DR   EnsemblGenomes-Tr; EFT00001983301.
DR   EnsemblGenomes-Tr; EFT00001983302.
DR   EnsemblGenomes-Tr; EFT00001983303.
DR   EnsemblGenomes-Tr; EFT00001983304.
DR   EnsemblGenomes-Tr; EFT00001983305.
DR   EnsemblGenomes-Tr; EFT00001983306.
DR   EnsemblGenomes-Tr; EFT00001983307.
DR   EnsemblGenomes-Tr; EFT00001983308.
DR   EnsemblGenomes-Tr; EFT00001983309.
DR   EnsemblGenomes-Tr; EFT00001983310.
DR   EnsemblGenomes-Tr; EFT00001983311.
DR   EnsemblGenomes-Tr; EFT00001983312.
DR   EnsemblGenomes-Tr; EFT00001983313.
DR   EnsemblGenomes-Tr; EFT00001983314.
DR   EnsemblGenomes-Tr; EFT00001983315.
DR   EnsemblGenomes-Tr; EFT00001983316.
DR   EnsemblGenomes-Tr; EFT00001983317.
DR   EnsemblGenomes-Tr; EFT00001983318.
DR   EnsemblGenomes-Tr; EFT00001983319.
DR   EnsemblGenomes-Tr; EFT00001983320.
DR   EnsemblGenomes-Tr; EFT00001983321.
DR   EnsemblGenomes-Tr; EFT00001983322.
DR   EnsemblGenomes-Tr; ZYRO0G00220r-1.
DR   EnsemblGenomes-Tr; ZYRO0G00594r-1.
DR   EnsemblGenomes-Tr; ZYRO0G00660r-1.
DR   EnsemblGenomes-Tr; ZYRO0G00858r-1.
DR   EnsemblGenomes-Tr; ZYRO0G00880r-1.
DR   EnsemblGenomes-Tr; ZYRO0G00968r-1.
DR   EnsemblGenomes-Tr; ZYRO0G01122r-1.
DR   EnsemblGenomes-Tr; ZYRO0G01232r-1.
DR   EnsemblGenomes-Tr; ZYRO0G01254r-1.
DR   EnsemblGenomes-Tr; ZYRO0G01496r-1.
DR   EnsemblGenomes-Tr; ZYRO0G02200r-1.
DR   EnsemblGenomes-Tr; ZYRO0G02332r-1.
DR   EnsemblGenomes-Tr; ZYRO0G02728r-1.
DR   EnsemblGenomes-Tr; ZYRO0G02882r-1.
DR   EnsemblGenomes-Tr; ZYRO0G03432r-1.
DR   EnsemblGenomes-Tr; ZYRO0G03652r-1.
DR   EnsemblGenomes-Tr; ZYRO0G03674r-1.
DR   EnsemblGenomes-Tr; ZYRO0G03960r-1.
DR   EnsemblGenomes-Tr; ZYRO0G04070r-1.
DR   EnsemblGenomes-Tr; ZYRO0G04290r-1.
DR   EnsemblGenomes-Tr; ZYRO0G04576r-1.
DR   EnsemblGenomes-Tr; ZYRO0G04774r-1.
DR   EnsemblGenomes-Tr; ZYRO0G04906r-1.
DR   EnsemblGenomes-Tr; ZYRO0G05588r-1.
DR   EnsemblGenomes-Tr; ZYRO0G06094r-1.
DR   EnsemblGenomes-Tr; ZYRO0G06138r-1.
DR   EnsemblGenomes-Tr; ZYRO0G06996r-1.
DR   EnsemblGenomes-Tr; ZYRO0G07062r-1.
DR   EnsemblGenomes-Tr; ZYRO0G07678r-1.
DR   EnsemblGenomes-Tr; ZYRO0G08646r-1.
DR   EnsemblGenomes-Tr; ZYRO0G08668r-1.
DR   EnsemblGenomes-Tr; ZYRO0G09042r-1.
DR   EnsemblGenomes-Tr; ZYRO0G09218r-1.
DR   EnsemblGenomes-Tr; ZYRO0G09240r-1.
DR   EnsemblGenomes-Tr; ZYRO0G09262r-1.
DR   EnsemblGenomes-Tr; ZYRO0G09636r-1.
DR   EnsemblGenomes-Tr; ZYRO0G10142r-1.
DR   EnsemblGenomes-Tr; ZYRO0G10560r-1.
DR   EnsemblGenomes-Tr; ZYRO0G10736r-1.
DR   EnsemblGenomes-Tr; ZYRO0G11132r-1.
DR   EnsemblGenomes-Tr; ZYRO0G11352r-1.
DR   EnsemblGenomes-Tr; ZYRO0G12122r-1.
DR   EnsemblGenomes-Tr; ZYRO0G12166r-1.
DR   EnsemblGenomes-Tr; ZYRO0G12826r-1.
DR   EnsemblGenomes-Tr; ZYRO0G12848r-1.
DR   EnsemblGenomes-Tr; ZYRO0G13024r-1.
DR   EnsemblGenomes-Tr; ZYRO0G13266r-1.
DR   EnsemblGenomes-Tr; ZYRO0G13442r-1.
DR   EnsemblGenomes-Tr; ZYRO0G13860r-1.
DR   EnsemblGenomes-Tr; ZYRO0G13882r-1.
DR   EnsemblGenomes-Tr; ZYRO0G13904r-1.
DR   EnsemblGenomes-Tr; ZYRO0G13926r-1.
DR   EnsemblGenomes-Tr; ZYRO0G14366r-1.
DR   EnsemblGenomes-Tr; ZYRO0G14410r-1.
DR   EnsemblGenomes-Tr; ZYRO0G15158r-1.
DR   EnsemblGenomes-Tr; ZYRO0G15532r-1.
DR   EnsemblGenomes-Tr; ZYRO0G15928r-1.
DR   EnsemblGenomes-Tr; ZYRO0G17688r-1.
DR   EnsemblGenomes-Tr; ZYRO0G17908r-1.
DR   EnsemblGenomes-Tr; ZYRO0G18392r-1.
DR   EnsemblGenomes-Tr; ZYRO0G18414r-1.
DR   EnsemblGenomes-Tr; ZYRO0G19382r-1.
DR   EnsemblGenomes-Tr; ZYRO0G19470r-1.
DR   EnsemblGenomes-Tr; ZYRO0G19536r-1.
DR   EnsemblGenomes-Tr; ZYRO0G19558r-1.
DR   EnsemblGenomes-Tr; ZYRO0G19668r-1.
DR   EnsemblGenomes-Tr; ZYRO0G20174r-1.
DR   EnsemblGenomes-Tr; ZYRO0G21098r-1.
DR   EnsemblGenomes-Tr; ZYRO0G21274r-1.
DR   EnsemblGenomes-Tr; ZYRO0G22066r-1.
DR   EnsemblGenomes-Tr; ZYRO0G22088r-1.
DR   EnsemblGenomes-Tr; ZYRO0G22220r-1.
DR   EnsemblGenomes-Tr; ZYRO0G22242r-1.
DR   EuropePMC; PMC2765284; 19525356.
DR   EuropePMC; PMC5734014; 29079616.
DR   EuropePMC; PMC6250768; 30505317.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00015; U4.
DR   RFAM; RF00069; SNORD24.
DR   RFAM; RF00093; SNORD18.
DR   RFAM; RF00134; snoZ196.
DR   RFAM; RF00509; snosnR64.
DR   RFAM; RF01195; snR52.
DR   RFAM; RF01244; snR4.
DR   RFAM; RF01247; snR32.
DR   RFAM; RF01258; snR10.
DR   RFAM; RF01261; snR82.
DR   RFAM; RF01267; snR37.
DR   RFAM; RF01502; Fungi_SRP.
DR   StrainInfo; 105346; 0.
XX
CC   The Zygosaccharomyces rouxii sequence is made of 7 chromosomes (A to G).
CC   The sequence was annotated by the Genolevures Consortium. For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1865392
FT                   /organism="Zygosaccharomyces rouxii"
FT                   /chromosome="G"
FT                   /strain="CBS 732"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Zyro0G"
FT                   /db_xref="taxon:4956"
FT   gene            <2663..>3700
FT                   /pseudo
FT                   /locus_tag="ZYRO0G00110g"
FT                   /old_locus_tag="pseudo-Zyro0G-2663-3700"
FT   gene            complement(<4148..>5011)
FT                   /locus_tag="ZYRO0G00132g"
FT                   /old_locus_tag="ZYRO-ORF1896"
FT   CDS_pept        complement(4148..5011)
FT                   /locus_tag="ZYRO0G00132g"
FT                   /old_locus_tag="ZYRO-ORF1896"
FT                   /product="ZYRO0G00132p"
FT                   /note="some similarities with uniprot|P36034 Saccharomyces
FT                   cerevisiae YKL219W COS9"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29084"
FT                   /db_xref="GOA:C5E1P1"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1P1"
FT                   /protein_id="CAR29084.1"
FT                   /translation="MSMISDESEIDLEKCVQMYEEEEIELPADSTSGKLVYFLAPYFFE
FT                   KTWTSDIVASLSAAFLSPSLVRLPYFIMRDLYDDPFETKLSDIFSPVWMIIHYFLCFTF
FT                   SFWNFIDNRKKVNIEKKVLQQLLKEVAEMDLPGDPVAWQRIASRVNHFSEETGYRYSLF
FT                   YSGEHCMRFFVREIVKPIECQTYDIRCYQEGSTVVNFWKNPPNKALTERALANYNKCVE
FT                   SFGKLSHTAEKDEFRDGIFEKFHSIFNTSLFYLVIIELGSFIIMMLTFIISMISCAIFN
FT                   SFATPH"
FT   gene            <5335..>6033
FT                   /locus_tag="ZYRO0G00154g"
FT                   /old_locus_tag="ZYRO-ORF1895"
FT   CDS_pept        5335..6033
FT                   /locus_tag="ZYRO0G00154g"
FT                   /old_locus_tag="ZYRO-ORF1895"
FT                   /product="ZYRO0G00154p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29085"
FT                   /db_xref="GOA:C5E1P2"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1P2"
FT                   /protein_id="CAR29085.1"
FT                   /translation="MSNKKKSKSKASESHNRGGRENSPRGQHNSLSPQRDSSISDQQGS
FT                   ENGGTGSRTNGIKLAARLFRNPLFSKRGFQHAKEGLKSESSGDSMSNVRFLGSFFLLTY
FT                   PIFLIGYSIFGFLYGDKNNGIHVFLYGSPLFTAVPYIIQYLNDVDTLLLSIFEIGEKNL
FT                   LEYFADPGIRELLLTVFEIVGFIYQLVKGRQNFEIFICGIVGFNLYLVGNTLLIWERKK
FT                   RPKPVMADSA"
FT   gene            complement(<7333..>8019)
FT                   /locus_tag="ZYRO0G00176g"
FT                   /old_locus_tag="ZYRO-ORF1892"
FT   CDS_pept        complement(7333..8019)
FT                   /locus_tag="ZYRO0G00176g"
FT                   /old_locus_tag="ZYRO-ORF1892"
FT                   /product="ZYRO0G00176p"
FT                   /note="similar to uniprot|P43543 Saccharomyces cerevisiae
FT                   YNL335W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29086"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR017771"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1P3"
FT                   /protein_id="CAR29086.1"
FT                   /translation="MSKYGFIKVNKEFEKAIKDPKDPLPRTTVPIPSGKVANFFYNYAA
FT                   KELPLATLNHSLRVFQYSVAIMKDQFPEWDLDEEVIYVTALMHDIATTDKNLNETKLSF
FT                   EFYGGYISRELILRETGGNTDYADAVAEAIIRHQELTTTGFITSLGLILQIATTLDNAG
FT                   ANTNLIHQETIYSINEKYPRVNWSTCFANVLSKEDTQKPWSHSTTFGIEDFKEKVLNNP
FT                   VKYERQ"
FT   gene            complement(<8925..>9170)
FT                   /locus_tag="ZYRO0G00198g"
FT                   /old_locus_tag="ZYRO-ORF1890"
FT   CDS_pept        complement(8925..9170)
FT                   /locus_tag="ZYRO0G00198g"
FT                   /old_locus_tag="ZYRO-ORF1890"
FT                   /product="ZYRO0G00198p"
FT                   /note="some similarities with uniprot|Q03034 Saccharomyces
FT                   cerevisiae YDR539W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29087"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1P4"
FT                   /protein_id="CAR29087.1"
FT                   /translation="MRKVYEDKLPISFFKNLKQQKGNVDPDNLFDIVGCVDSLRGFGND
FT                   HARIAHHLRSSSHISMKEIISCLLEDRKKKQPYPIS"
FT   gene            complement(<10051..>10122)
FT                   /locus_tag="ZYRO0G00220r"
FT                   /old_locus_tag="Zyro0G.tGly.TCC.63"
FT   tRNA            complement(10051..10122)
FT                   /locus_tag="ZYRO0G00220r"
FT                   /old_locus_tag="Zyro0G.tGly.TCC.63"
FT                   /note="tRNA-Gly (TCC) cove score=71.59"
FT   gene            complement(<12031..>13032)
FT                   /locus_tag="ZYRO0G00242g"
FT                   /old_locus_tag="ZYRO-ORF1884"
FT   CDS_pept        complement(12031..13032)
FT                   /locus_tag="ZYRO0G00242g"
FT                   /old_locus_tag="ZYRO-ORF1884"
FT                   /product="ZYRO0G00242p"
FT                   /note="similar to uniprot|P53183 Saccharomyces cerevisiae
FT                   YGL039W and similar to uniprot|P53111 Saccharomyces
FT                   cerevisiae YGL157W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29088"
FT                   /db_xref="GOA:C5E1P5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1P5"
FT                   /protein_id="CAR29088.1"
FT                   /translation="MAVLVTGATGFIAQWVLDCLLKENYQVIGTVRSQEKGDKLHKQFG
FT                   SPSKLSFEIVKDISDTEAFEPLFKKRGKEIDIVLHMASPCHFNTSDYEKDLLIPALNGT
FT                   KGVLNAIKKYGDVKKVVVTSSYAAITDMVNSADGSLVFTEKDWNPATWERCQTDAVNAY
FT                   CASKKFAEQAAWEFSKETGVSLTTINPVFVFGPQKFDEDVTSQLNTSNEIINGLIHSKP
FT                   GDKLEPDYHSAYVDVRDVARAHLVAFQKDTTGERLGLSNGAFNCQSILDILNEKFPQLD
FT                   ITKGPEPGMGDTKPGAVFDNRHSKEVLAFPFISLEQCVYDTVAQVLKKEGRL"
FT   gene            <15320..>15787
FT                   /pseudo
FT                   /locus_tag="ZYRO0G00264g"
FT                   /old_locus_tag="pseudo-Zyro0G-15320-15787"
FT   gene            <18542..>20311
FT                   /locus_tag="ZYRO0G00286g"
FT                   /old_locus_tag="ZYRO-ORF1880"
FT   CDS_pept        18542..20311
FT                   /locus_tag="ZYRO0G00286g"
FT                   /old_locus_tag="ZYRO-ORF1880"
FT                   /product="ZYRO0G00286p"
FT                   /note="highly similar to uniprot|P39003 Saccharomyces
FT                   cerevisiae YDR343C HXT6 High-affinity glucose transporter
FT                   of the major facilitator superfamily nearly identical to
FT                   Hxt7p expressed at high basal levels relative to other HXTs
FT                   repression of expression by high glucose requires SNF3"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29089"
FT                   /db_xref="GOA:C5E1P6"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1P6"
FT                   /protein_id="CAR29089.1"
FT                   /translation="MSTENYKSALADNGNVKNMIDDIPVEHARESTASDSLENRSLSKN
FT                   EKDDLQPVEGMNYDGHNGIQEEENDVALPKKPLSDYLSVFIFCVLIAFGGFVFGWDTGT
FT                   ISGFVNQTDFIERFGQLNHRTGEHYLSKVRTGLIVSLFNIGCAFGGLILTKPADVYGRK
FT                   LAVTIAAVFYVVGTVISIASIDKWYQYMIGRIISGLGVGSLAVLSPMLISEVAPKQLRG
FT                   TLVSIYQLMVTAGIFLGYCANYGTKTYDNSVQWRVPLGLNFAWAILMVAGMTFVPESPR
FT                   YLVQIGKVQEAKRSLSRSNKVSPEDPGLLAELEQIETGIEAERAAGKASLQELFSTRGK
FT                   VLQRVIMAAVIQSLQQLTGDNYFFYYGTTVFKSVGLNDSFETSIVLGVVNFFSTFFGIY
FT                   YVERFGRRTCLLWGAATMVCCFVVFASVGVTRLWPNGQGNGSSKGAGNCMIVFTCFYIY
FT                   CFASSWAPICFVVVSETFPLRVKSKGMAIAMVANWVWGFLIGFFTPFITGAINFYYGYV
FT                   FMGCLVFAFFYVFFFVPETKGLTLEEVSTMWEENVLPWKSTSWVPPDRRGRGYDSEALA
FT                   HDDKPWYKAMFTK"
FT   gene            <20674..>22623
FT                   /locus_tag="ZYRO0G00308g"
FT                   /old_locus_tag="ZYRO-ORF1879"
FT   CDS_pept        20674..22623
FT                   /locus_tag="ZYRO0G00308g"
FT                   /old_locus_tag="ZYRO-ORF1879"
FT                   /product="ZYRO0G00308p"
FT                   /note="similar to gnl|GLV|KLLA0C18953g Kluyveromyces lactis
FT                   KLLA0C18953g and some similarites with YKL015W
FT                   uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
FT                   Positive regulator of PUT (proline utilization) genes zinc-
FT                   finger transcription factor of the Zn(2)-Cys(6) binuclear
FT                   cluster domain type"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29090"
FT                   /db_xref="GOA:C5E1P7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1P7"
FT                   /protein_id="CAR29090.1"
FT                   /translation="MSGKKSKKACEICKRRKKRCSGGLPCEYCVKIDKPRECVYHTRTS
FT                   SKTVKVTERYVLNLKAKIKNLESRLATVSDDSSNANPSISSEEEDNGQTMGGNIDSSGN
FT                   YRLGNSACNKFLFQLKDSLVNSCQLPDDIYEPDIETISLESSPNVALIQLIFQENCPSR
FT                   SEAKRWISAAYNVIGADYMYIEPDYETKILDSLIWDENSRNANFVRYATEITRFFTYLA
FT                   LGCLFNEERSPENTRSKFPGLQYFETALKLQSELLKVYDMVANTSLVQSFLYAAYYALS
FT                   LDKSDFAYLTIGSAIRMTFTLGLHKKTLTFTENRVFWLCFVYDRLVSVRFGLPLMINEM
FT                   DIDVPLLTESERPNQQGLFEAHHFNSQVRLAKITTQIVRKIYTRNSFSFVQNCYMVLKE
FT                   LKHWLDTLPNSLKVDYGNFSAKQSRSTINLHINYNYTIIITTRPIFLYVFNKLIESGRK
FT                   AEEIFPEKLLNTITILLESSVQAAQIQSLILTRLYYDGRMVSASFLDCHYIFNATIILI
FT                   FAAFCRSMPNHTISFGCDINTLFERVQINLTVLQQISQFNIAACNFNKQLTEIIELISS
FT                   PDLQVTLKGSFAKQSGYTESEQQSLEMPATSNFDMDVIRNLDLSRILDDIGDTGKTDQV
FT                   LPFDNEDFMKYGFF"
FT   gene            complement(<22695..>26561)
FT                   /locus_tag="ZYRO0G00330g"
FT                   /old_locus_tag="ZYRO-ORF1878"
FT   CDS_pept        complement(22695..26561)
FT                   /locus_tag="ZYRO0G00330g"
FT                   /old_locus_tag="ZYRO-ORF1878"
FT                   /product="ZYRO0G00330p"
FT                   /note="highly similar to uniprot|P28273 YKL215C
FT                   Saccharomyces cerevisiae Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29091"
FT                   /db_xref="GOA:C5E1P8"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1P8"
FT                   /protein_id="CAR29091.1"
FT                   /translation="MTGEPINQRIRIAIDRGGTFTDCIGNPGTGKVEDDVCIKLLSVDP
FT                   KNYKDAPLEGMRRLLETLEKKTIPRGMPLDVSNVSSIRMGTTLATNCALERNGEPCAFV
FT                   TTKGFKDVMAIGDQTRPDIFNLKIQKPQPLYEMVVEINERITLEDFSEDPLHNISKPDN
FT                   NAGTVYGTSGEVVRILKIPDPQEITLALKNIKQRGIESIAVSFLHSYTYPQHEQLVGRI
FT                   AKQLGFKHVSLSSEVSPMIKHLPRAHSSVADAYLTPVIRRYLESIQSGLINTENTSIQF
FT                   MQSDGGLVEGQRFSGLKSILSGPAGGVVGYSRTCYDEANEIPLIGFDMGGTSTDVSRFG
FT                   DSKLEHVLETTTAGIVIQTPQLNVNTIAAGGSSRLFWENGLFRVGPESATANPGPVAYR
FT                   KGGPLTITDANLLLGRLVPEFFPKIFGPNEDESLDIDATRKQFEALTKIINADLNTNMT
FT                   PNEVAFGFLKVANESMARPIRAITEAKGHVLSKHRLVTFGGAGGQHAVAVAESLGIKEV
FT                   LAHRYSSLLSAYGIFLADVVEENQEPCFLLLNLPENSTKIKSKLESLVVKCNDQLVSQG
FT                   FPEHLIDHEKYLNLRYEGTETSLMVLEQDEDWDFENWFAEAHMREFGFAFNDKNIIVDD
FT                   IRVRAVAKSFVREEESVDAQLNKYERREVVTSKEASFFKKVYFDGKLYETPIFRIDNMV
FT                   YGSVVHGPAILADGTQTNIIPRNAKATVLKSHIFIEILHKSTDISSLEEPESHVDPVML
FT                   SIFSHKFMDIAEQMGLQLKKTSVSTNVKERLDFSCALFDPDGNLVANAPHVPVHLGSMS
FT                   TCIAAQAKLWKGKLKPGDVLVTNHPDIGGTHLPDITVISPAFSEETGEVIFYVASRAHH
FT                   ADIGGILPGSVPPNSKELYEEGAAIYSEFIVRGGEFQEQLIRKLLLEEPAKYPECSGSR
FT                   RLSDNISDLKAQIAANNKGIQLIAKLMREHGLGAIVKYMKAIQNNASDTIKKMLKQLAQ
FT                   HFGQTEFSGEDLMDDGTLIKLKVKLDIEKEEYVFDFDGTSPQVYGNINAPEAITNSAIL
FT                   YCLRCLVGEDIPLNQGCLKPITVKIPKGSVLSPINGIAVVGGNVLTSQRVTDVVLKTFH
FT                   VMADSQGDCNNFTFGTGGRDPKTGEVTNGFGYYETICGGHGAGADSFRGPGWDGADAVH
FT                   TNMTNTRMTDSEIFERRYPVILREFSIRSCSGGDGQYMGGDGVIRDIEFSQPVQASILS
FT                   ERRVVAPHGIHGGQDGQKGINLWIRNNGKNTINIGSKNSVRVNPGDRIIIKTPGGGGCG
FT                   IKEN"
FT   gene            <27042..>28526
FT                   /locus_tag="ZYRO0G00352g"
FT                   /old_locus_tag="ZYRO-ORF1875"
FT   CDS_pept        27042..28526
FT                   /locus_tag="ZYRO0G00352g"
FT                   /old_locus_tag="ZYRO-ORF1875"
FT                   /product="ZYRO0G00352p"
FT                   /note="weakly similar to uniprot|P53322 Saccharomyces
FT                   cerevisiae YGR260W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29092"
FT                   /db_xref="GOA:C5E1P9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1P9"
FT                   /protein_id="CAR29092.1"
FT                   /translation="MTEVDLTLRKNNESQKANGEESIVSLTENSEFIEEDLYIDKYEER
FT                   KLLKKLDIRLLPMLAFMYFLSSLDRSNIANAYTSGMKEDLGLTSKQYSNCVSVFYSTYL
FT                   AAELPAVLVLKRTNVKYYMSFLVFSWSIITLCSGFVKSHKSLLALRVLLGTFEGGFFPA
FT                   MTLIISIVYKPQEQAKRIAFFFGSSALSGAFGGLIATGLASVKDAGGLEGWRWLYIIEG
FT                   LISIGASIWLFLGLPAKFEYLPFLNERESKLMEIRSKQREQYMGTQEKFDWSFVKDALM
FT                   DFKTYFSFIIQFCQDTVMYGFSTFLTSILKMGLGYSSRKSQYMSAPVYILAGIVFLISA
FT                   FLSDRFKLRGPIFFGYNIMGIVGYILLLSVHNDAVKYFACYLITFSLYTGTGLNISWLT
FT                   NNMAPHYKRATALGLNQTLGNLSGAIAGQIYTKPPYTFGNSFSLGCIVLSNILTFSQVI
FT                   ILKRINIKKKKILAGESPDTAKSRRGDWALDYEYCL"
FT   gene            complement(<28649..>30553)
FT                   /locus_tag="ZYRO0G00374g"
FT                   /old_locus_tag="ZYRO-ORF1874"
FT   CDS_pept        complement(28649..30553)
FT                   /locus_tag="ZYRO0G00374g"
FT                   /old_locus_tag="ZYRO-ORF1874"
FT                   /product="ZYRO0G00374p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29093"
FT                   /db_xref="GOA:C5E1Q0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Q0"
FT                   /protein_id="CAR29093.1"
FT                   /translation="MLMIRRMIKVPKSLTTLAYLSKLDDNYGGERREMTKYTRSRNGCR
FT                   KCKELKIKCDEQRPRCQNCIRRNFQPCDYSKVLQWGGRPGKKNNQQQLQGLVCKPTPKP
FT                   SPLPTFQPDTLLQDLFVQNHQSIPSNCFDIENNNNENSDEYNDRLPLISTGDTSLHSLR
FT                   TPWSASVAFSKIPLSSLQLPSPLPDVLLNTPHYLNLFEFYMRETAYLLVPLPRELYSDN
FT                   PFCWRFGQMALACPTLLYLLLAFSANHRTMIATQKRKLELPSLEEPWNLESSSESSLAP
FT                   FGDVETGNTLTNELLTITFNNLLVDLTNEQRRKSDCTLATIMMLAAFDIFFSDRRRKWR
FT                   AHVNGAGRLIMERLCGSDCNMLTLQDSEEQTDLFFLTRWFSYLDIIGSLSSTSRVITTE
FT                   KLQAIKYKSMLTDPSVLKSRRINLSDLEAGTGFEYTILSYLAEVSSLIKEKESEQDETG
FT                   MERMSQEMLAKVLELDYEINTYLENSERERSQIYEKYYSKKPWENYRGYYNLRITNLIF
FT                   GLTGSYQLKRRVLNLPLDSKIVQDLLVRITKLVDENVPLAASSTSCLSFCLFSCGCELL
FT                   NDSMAQYRPIYMERIDALNKEGVNCAAMAKSIMEKCWKFKKNWWDILREENLDITFAI"
FT   gene            complement(<30608..>31807)
FT                   /locus_tag="ZYRO0G00396g"
FT                   /old_locus_tag="ZYRO-ORF1871"
FT   CDS_pept        complement(30608..31807)
FT                   /locus_tag="ZYRO0G00396g"
FT                   /old_locus_tag="ZYRO-ORF1871"
FT                   /product="ZYRO0G00396p"
FT                   /note="highly similar to uniprot|P38891 Saccharomyces
FT                   cerevisiae YHR208W BAT1 Mitochondrial branched-chain amino
FT                   acid aminotransferase homolog of murine ECA39 highly
FT                   expressed during logarithmic phase and repressed during
FT                   stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29094"
FT                   /db_xref="GOA:C5E1Q1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Q1"
FT                   /protein_id="CAR29094.1"
FT                   /translation="MLKRLSSNSNFSKGLWKILNQRNMSTSKLDASKLQVTRVSQKSQP
FT                   KPNDQLVFGKTFTDHMLSIEWTMEKGWDAPVIKPYGPITLDPASCVFHYAFELFEGLKA
FT                   YRTKDGKITMFRPDKNMERMNKSAARICLPTFDSDELIKLIGKLIEEDKHLVPEGQGYS
FT                   LYIRPTMIGTTDGLGVGYPDRALLYVITSPVGPYYKTGFKAVKLLATDFATRAWPGGVG
FT                   DKKLGANYAPCILPQLQAADKGYQQNLWLFGPEKNITEVGTMNVFFVFKDSKTGKKELV
FT                   TAPLDGTILEGVTRDSVLSLARERLDPKEWEVNERYYTIYEVSERSKKGELVEAFGSGT
FT                   AAVVSPIKEIGWQDEDIQVPLLPGEQSGELTKDVANWIAAIQYGKEVHGNWSRVVADVN
FT                   "
FT   gene            <32322..>32969
FT                   /locus_tag="ZYRO0G00418g"
FT                   /old_locus_tag="ZYRO-ORF1870"
FT   CDS_pept        32322..32969
FT                   /locus_tag="ZYRO0G00418g"
FT                   /old_locus_tag="ZYRO-ORF1870"
FT                   /product="ZYRO0G00418p"
FT                   /note="similar to uniprot|P40099 Saccharomyces cerevisiae
FT                   YER183C FAU1 5 10-methenyltetrahydrofolate synthetase
FT                   involved in folic acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29095"
FT                   /db_xref="GOA:C5E1Q2"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Q2"
FT                   /protein_id="CAR29095.1"
FT                   /translation="MSKKAVRLAVKEALHKVTSKEVEIQSRCIASALRPLLESHHDVAC
FT                   YMSMDQGEIDTSYLMEWLFEQGKKVYLPRCTSTTKTGQVPLRAVGASGGHPHLTFHSMD
FT                   SWEKVKLLEPRGKYNLREPEAESPAPLPPRLDVMLVPGLAFDPSRGTRLGHGAGYYDDF
FT                   FQRYQLQHKGEKPLLVGLALIEQLRGSIPTDSHDWTMDCIVSGDGKVQWITN"
FT   gene            complement(<32982..>33701)
FT                   /locus_tag="ZYRO0G00440g"
FT                   /old_locus_tag="ZYRO-ORF1869"
FT   CDS_pept        complement(32982..33701)
FT                   /locus_tag="ZYRO0G00440g"
FT                   /old_locus_tag="ZYRO-ORF1869"
FT                   /product="ZYRO0G00440p"
FT                   /note="similar to uniprot|P40098 Saccharomyces cerevisiae
FT                   YER182W FMP10 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29096"
FT                   /db_xref="GOA:C5E1Q3"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Q3"
FT                   /protein_id="CAR29096.1"
FT                   /translation="MFRRLATNTFKRCYTYSKGPASFTVRPKPKQRKWVPWTIFGTSFI
FT                   TGLLITQHMTLTDFLAFWKYDKLPQGSPEVDNYKLELTQRCENLSVVKQLKQTGFTEVF
FT                   PNRREEDLLVAHTLDTPGGIAISPRFYYNPLTKETVGIYHLGMKLTGYPFIVHGGILAT
FT                   VLEDLMREAVKIIRAKPGEKTKELALSYKMPTFANQFVIVRTTKVEEFGKNTKLHAQIM
FT                   DQTGNTTLISGKGTFST"
FT   gene            <33882..>35339
FT                   /locus_tag="ZYRO0G00462g"
FT                   /old_locus_tag="ZYRO-ORF1868"
FT   CDS_pept        33882..35339
FT                   /locus_tag="ZYRO0G00462g"
FT                   /old_locus_tag="ZYRO-ORF1868"
FT                   /product="ZYRO0G00462p"
FT                   /note="similar to uniprot|P38890 Saccharomyces cerevisiae
FT                   YHR207C SET5"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29097"
FT                   /db_xref="GOA:C5E1Q4"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Q4"
FT                   /protein_id="CAR29097.1"
FT                   /translation="MHLQIQTLSLNDDSGSLPAASIVPSNQQVCDSILLLWREEPASED
FT                   YNLEELLKVVKERHSEWKLSVESLRKLLQSHSLYATDEKSLQIYSDKVRMPEMAEGEVK
FT                   LPRSVRIGACSGDKQRGLFATNALKAGDMIFEDLPLVVVPPMDKLVLMQSGKACPLCGS
FT                   SVSHSQHTIIMNGLDCGECGAVWCSKNCKKNDLTHTSLRHTRSRCRQINLNGWKKYESF
FT                   CKQYVFVAAYSIGIIYASMILDKNGKNGVHPKFQLLADVSQRIRKDSSDSTNLGGTLDA
FT                   SSGAFTSDDPEPMWTQALDLFKEAFPELDDMDMEAYLNCIGKFNINQVSGQIFPVYSFI
FT                   NHDCEPNVRYEIDDKLRLKLYARKHIKKGEELLTTYVNPLHGVKLRRRELRVNWGFLCH
FT                   CDRCNRELTKRKEKLTSPTPSAHHSPANSFSDKNRRKSSMRNARPDLHELLKNGQEFDL
FT                   EIPDNLETHHRKTSVRFDNNVSVAVDE"
FT   gene            complement(<35793..>37736)
FT                   /locus_tag="ZYRO0G00484g"
FT                   /old_locus_tag="ZYRO-ORF1867"
FT   CDS_pept        complement(35793..37736)
FT                   /locus_tag="ZYRO0G00484g"
FT                   /old_locus_tag="ZYRO-ORF1867"
FT                   /product="ZYRO0G00484p"
FT                   /note="similar to uniprot|P38889 Saccharomyces cerevisiae
FT                   YHR206W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29098"
FT                   /db_xref="GOA:C5E1Q5"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014402"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Q5"
FT                   /protein_id="CAR29098.1"
FT                   /translation="MNLSNDTDISRPSTSASTNLGIVNSASQNNGNNNNTIKAPSNDFV
FT                   RKLFGILERCEYPDIVRWTEKGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYDF
FT                   HKVKKSPEERQNSQYGELSWEFRHPYFTIHNEEALDNIKRKTTVQKKIMLDDSTVLLKP
FT                   NSGTQTGTEERAGANLILGNAVTKDKFNLLKRRVDRLQKDLDSAKEESYNAKLEFQKLN
FT                   SKYNTVVESLFTFKTVNDNLMNNFNILCSVLNNRGIELPPHIYQDPRLKQNSGTQQQAQ
FT                   AATSAATQATTSASNSTAGMSPMQNKPFDPLNSAVNAMVPGPVPLSASLSNHNAVNAAA
FT                   ELQLPLPNMNHGPTITTDKGDKLPETYDSFVLREGFHVLLVEDDAVCIQLCSKFLRKYG
FT                   CTVEVVTDGLAAISTLEKFRYDLVLMDIVMPNLDGATATSIVRSFDIHTPIIAMTGNIE
FT                   DQDLITYLQHGMNDILAKPFTKDDLHSMLIRYLRDRVPLIKQQEQRAHATNEHHHHHGS
FT                   TADNGTGTGTANGNSGGGVNHGSNSGDNSNGNGPHSVDRNGYASSEADSQPELLTRSQS
FT                   HSQMQGSLDDTTTNPPGVPPQSLPPTSGQAHGPGRGVPLSTTASGHSSSAVSDHDVKGL
FT                   VDDEPLLKKQRV"
FT   gene            complement(<38488..>40854)
FT                   /locus_tag="ZYRO0G00506g"
FT                   /old_locus_tag="ZYRO-ORF1864"
FT   CDS_pept        complement(38488..40854)
FT                   /locus_tag="ZYRO0G00506g"
FT                   /old_locus_tag="ZYRO-ORF1864"
FT                   /product="ZYRO0G00506p"
FT                   /note="similar to uniprot|P11792 Saccharomyces cerevisiae
FT                   YHR205W SCH9 protein kinase involved in growth control may
FT                   be redundant with cAMP pathway cAMP-dependent protein
FT                   kinase homolog suppressor of cdc25ts"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29099"
FT                   /db_xref="GOA:C5E1Q6"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Q6"
FT                   /protein_id="CAR29099.1"
FT                   /translation="MMNFFGSNKVASTGDSDSRNGDSINGSDSNNNGNNNNNNGSANHI
FT                   GTTLSSNLGTGFFPSFTSQTATPTTAVSQNSYAMGTTGVTSENVLSHMKAMNEGGDAPG
FT                   ATFQSTTSSSQLSSQFPQNDSGMQETRLAKGQQQQQQPPLPQQQQQQRQHLNQAQVHHL
FT                   TLPTGGDSTRLGGASSTGLETEVPLGSLTVTIVEARNLLTRSATAQPYVVCTFESSEFI
FT                   SDGPESVDNKPFHGSGWQQPGLPAIPENAAKHRPLYTHRSSSNLNKMREDADTQLEQHS
FT                   STNSSNPMWHHKTTFDVLGACSELEISVYDAAHDDMFLGQVRLRPRIQNTRKASQSQWH
FT                   ALQKRVLDEHVSGDILISWQYTSTKKRQYGPSDFEVLRLLGKGTFGQVYQVKKKDSQRI
FT                   YAMKVLSKKVIIKKNEIAHTIGERNILVRTASQLCPFIVGLKFSFQTPADLYLVTDYMS
FT                   GGELFWHLQKEGRFSEDRAKFYIAELVMALEYLHDNDIVYRDLKPENILLDANGNIALC
FT                   DFGLSKAELKDRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFA
FT                   EDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAVDDGRELRAHPFFAD
FT                   IDWEALRQRKIPPPFKPHLNSDVDTSNFDPEFTQTSTSYLNKNAPIAATPLSPAMQAKF
FT                   AGFTFVDESAMDEHYNTTYNNRKFLQNSYFMEPGSFIPGNPDLPPDEDVIDDQIDDDDP
FT                   NDDFNQSKHLHGVGQVDYEGDQHMDDEFVSGRFEI"
FT   gene            complement(<41393..>43831)
FT                   /locus_tag="ZYRO0G00528g"
FT                   /old_locus_tag="ZYRO-ORF1861"
FT   CDS_pept        complement(41393..43831)
FT                   /locus_tag="ZYRO0G00528g"
FT                   /old_locus_tag="ZYRO-ORF1861"
FT                   /product="ZYRO0G00528p"
FT                   /note="similar to uniprot|P38888 Saccharomyces cerevisiae
FT                   YHR204W MNL1 Alpha mannosidase-like protein of the
FT                   endoplasmic reticulum required for degradation of
FT                   glycoproteins but not for processing of N-linked
FT                   oligosaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29100"
FT                   /db_xref="GOA:C5E1Q7"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR036026"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Q7"
FT                   /protein_id="CAR29100.1"
FT                   /translation="MLYTLIWVWVLLPIWAQASQEHFNRNDNSKQLQFEKYSFNRFELK
FT                   HYRETVKDLFHFAHENYLQKGYPYDELRPIACIPKTRNFEDPDDEITNDVLGNFSVTLV
FT                   DSLTTLAVMNDRPKFAEMVKLIEDTFPNKFNIDSTVQVFETTIRIVGGLISAHLYATDP
FT                   SKKVYLGEEYKGSLLQLAKDMADRLLPSYLTLTGLPVPRINLRSKFDPISVESVSENNV
FT                   AAMVSPIFEFTMLSYLTLDSKYADVTRYAMNKTWALRTELQLLPMSFNPQSGQCYTPIS
FT                   GVGASIDSFYEYALKGAILFDDDGLLKIWQDAYNSLNTNSRADWFYTNVQSTTGQLQTL
FT                   WIDSLSAFFPGLQVLAGDVEDAILKHMLTLKLWNTFGGVPERWDFQTLAAFEKKKEFTP
FT                   EDIKSFVPLEWYPLRPEFVESTYFLYRATRDPFYLNVGVAILESLQTRFKHECGFGGFQ
FT                   DVTTGEPQDRMETFILSETLKYLYLLFDVDNELHSTRDNVVFSTEAHPMWLTPKMINNY
FT                   EQNKYFNDTVYREHLRACRKRDRKSALHENERTFMGGKLLRFAKSLFTADQEPTKDIST
FT                   HAQPEPEEQPDASKPSVYEQMCFPVDFAAPHTDKPQWLHSHLLSHFDRLFEIDRRYNST
FT                   LIRPKHMQNVVPMELQRGFYEKWAHDKFAHSRPMPSTEALEIVLDLPGECQLIRLPDGS
FT                   IHRETLGGRNKIRLEKIEPGKIDVYGRILDPQLFVSARCKDVFKSTCDKIDRLYTPSLL
FT                   YRATVLNGINLPADANLTINRKTVFKTQREENTFRDLFGQNSYNQLMLECTPIINMLMQ
FT                   "
FT   gene            <44824..>45609
FT                   /locus_tag="ZYRO0G00550g"
FT                   /old_locus_tag="ZYRO-ORF1859"
FT   CDS_pept        44824..45609
FT                   /locus_tag="ZYRO0G00550g"
FT                   /old_locus_tag="ZYRO-ORF1859"
FT                   /product="ZYRO0G00550p"
FT                   /note="highly similar to uniprot|P05753 Saccharomyces
FT                   cerevisiae YJR145C RPS4A or to YHR203C uniprot|P05753
FT                   Saccharomyces cerevisiae YHR203C RPS4B"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29101"
FT                   /db_xref="GOA:C5E1Q8"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="InterPro:IPR032277"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Q8"
FT                   /protein_id="CAR29101.1"
FT                   /translation="MARGPKKHLKRLAAPHHWLLDKLSGTYAPRPSQGPHKLRESLPLV
FT                   VFLRNRLKYALNTREVKAIMMQRHVKVDGKVRTDSTFPAGFMDVISLDATNENFRLVYD
FT                   VKGRFAVHRITDEEASYKLGKVKKVQLGKKGIPYVVTHDGRTIRFPDPNVKVNDTVKID
FT                   LASGKIQDYIKFDTGKLVYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTFVTRL
FT                   NNVFVIGEPGKPYISLPKGKGIKLSITEERDRRRAQNGL"
FT   gene            complement(<45758..>47560)
FT                   /locus_tag="ZYRO0G00572g"
FT                   /old_locus_tag="ZYRO-ORF1858"
FT   CDS_pept        complement(45758..47560)
FT                   /locus_tag="ZYRO0G00572g"
FT                   /old_locus_tag="ZYRO-ORF1858"
FT                   /product="ZYRO0G00572p"
FT                   /note="similar to uniprot|P38887 Saccharomyces cerevisiae
FT                   YHR202W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29102"
FT                   /db_xref="GOA:C5E1Q9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041823"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Q9"
FT                   /protein_id="CAR29102.1"
FT                   /translation="MLVKTVCTVLAASHLVASWSVQHLFEQELPLHEKPSPQIRDLETG
FT                   QLNFLHTTDTHGWLGSHLLQSVYDADWGDFISFASYFRHRRLQKDQDLIIVDTGDKHDG
FT                   NGLSDATSPNGIETTKIFNEQDYDLLTLGNHELYTPDNTLLEYYATVLSPKFRDNYVSS
FT                   NVEFVKKDGTRVPFGNKYRAFRTEKNGLRILALSFLFDFKRFNERAVVTPALEEIKQPW
FT                   FHELTKEKYPEGSVDLVLVFGHMPVTDIANREINKLHEQLRQLYPNTIIQYFGGHSHIR
FT                   DFVELDSKSTGIQSGRFAETLGFLSIDYVNSDSPHFFRSYLDFSKKSFAHHLKLDQSPT
FT                   TDKGIRVSNLTKALRQKLNLDAQLGYVPHTYYMSSKPMDSDENLYHLLTTEVLPRLHSK
FT                   ATNDSVSRFILMNTGAVRYDLHEGPFTLDTEFIVLPFSNDWLYLELPLRVASHIAEYLN
FT                   KGPVIASLNPPHIAAAAAMAAAEMDTSAVRRTLKRKRCPRTDQPFLTPGLTTSDDYGCD
FT                   GDDTPHNTLDEFPIPNVVQSEELVSEDPDSLVHFVFYSFLKPYVLEAVSALTEEGLYQD
FT                   LHCKHYGGESTKKLLEEFIKDTSR"
FT   gene            <47870..>47955
FT                   /locus_tag="ZYRO0G00594r"
FT                   /old_locus_tag="Zyro0G.tTyr.GTA.1"
FT   tRNA            join(47870..47908,47920..47955)
FT                   /locus_tag="ZYRO0G00594r"
FT                   /old_locus_tag="Zyro0G.tTyr.GTA.1"
FT                   /note="tRNA-Tyr (GTA) cove"
FT   gene            <48668..>50242
FT                   /locus_tag="ZYRO0G00616g"
FT                   /old_locus_tag="ZYRO-ORF1856"
FT   CDS_pept        48668..50242
FT                   /locus_tag="ZYRO0G00616g"
FT                   /old_locus_tag="ZYRO-ORF1856"
FT                   /product="ZYRO0G00616p"
FT                   /note="highly similar to uniprot|Q00684 Saccharomyces
FT                   cerevisiae YFR028C CDC14 Protein phosphatase required for
FT                   mitotic exit located in the nucleolus until liberated by
FT                   the FEAR and Mitotic Exit Network in anaphase enabling it
FT                   to act on key substrates to effect a decrease in CDK/B-
FT                   cyclin activity and mitotic exit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29103"
FT                   /db_xref="GOA:C5E1R0"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR026070"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029260"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1R0"
FT                   /protein_id="CAR29103.1"
FT                   /translation="MRRSLYLDNTIEFLRGRVYLGAYDYTPEDTDELVFFTVEDTIFYN
FT                   SFHLDFGPMNIGHLYRFAVIFHEILNDPDNTNKAVVFYSSTSTRQRANSACMLCCYMVL
FT                   VQGWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGVWRAKERGLIDLHSFN
FT                   LENYERYEHVENGDLNVLTPDFIAFASPQEDSRLINSNTVSSKSHLNQAFRSVLKFFAN
FT                   NNIQLVVRLNSPLYNKKHFEDVGIQHLDMIFEDGTCPDLSIVQNFVGAAETIIKGGGKI
FT                   AVHCKAGLGRTGCLIGAHLIYTHGFTANECIGFLRFMRPGMVVGPQQHWLYLHQNDFRE
FT                   WKYTMRLSLVPNDIIGNLYPLVSFDKYRSQKRRLKDERRHRVYRDGDENEAKDLAMTPP
FT                   SPKKIPTNFGAAAVPQNSPGQPRKGQNGTNTIEELQRAKAKRLGTRHAQAIADNNSDDD
FT                   MMQQDDTTSANSKVLNDVDKSAQFEDGDEDALLRQLLPKNKRISSGRRTASATGGVRKI
FT                   SGTSKKL"
FT   gene            complement(<50294..>51067)
FT                   /locus_tag="ZYRO0G00638g"
FT                   /old_locus_tag="ZYRO-ORF1854"
FT   CDS_pept        complement(50294..51067)
FT                   /locus_tag="ZYRO0G00638g"
FT                   /old_locus_tag="ZYRO-ORF1854"
FT                   /product="ZYRO0G00638p"
FT                   /note="similar to uniprot|P43605 Saccharomyces cerevisiae
FT                   YFR027W ECO1 Acetyltransferase required for the
FT                   establishment of sister chromatid cohesion during DNA
FT                   replication but not for its maintenance during G2 and M
FT                   phases also required for postreplicative double-strand
FT                   break repair interacts with Chl1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29104"
FT                   /db_xref="GOA:C5E1R1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR028005"
FT                   /db_xref="InterPro:IPR028009"
FT                   /db_xref="InterPro:IPR033257"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1R1"
FT                   /protein_id="CAR29104.1"
FT                   /translation="MAVKSSKKNGGKKLLQSRLQIGPTTNLTKCTKCGMTYSPSVIDDT
FT                   TTHKNYHEMHLKGKKWPATWGLGISLPSSDGSTALTPPSSSSKRGISNTKAERIVMVRS
FT                   DHQPEVRTTLHILDIVNDELHAPHNENEFWCRPNSNGKAFLYVKEDRAVGVITVELLKP
FT                   ERCRWMIYEDRSIVDGVEPRFILGVSRIWVCRTQRNKGIATKLLEAARSNTIYGKTIEK
FT                   WAMAWSQPTDSGGKLASHYNGVRHKSGKLLIPCYI"
FT   gene            <51346..>51418
FT                   /locus_tag="ZYRO0G00660r"
FT                   /old_locus_tag="Zyro0G.tAla.AGC.2"
FT   tRNA            51346..51418
FT                   /locus_tag="ZYRO0G00660r"
FT                   /old_locus_tag="Zyro0G.tAla.AGC.2"
FT                   /note="tRNA-Ala (AGC) cove score=70.19"
FT   gene            <51847..>52848
FT                   /locus_tag="ZYRO0G00682g"
FT                   /old_locus_tag="ZYRO-ORF1853"
FT   CDS_pept        51847..52848
FT                   /locus_tag="ZYRO0G00682g"
FT                   /old_locus_tag="ZYRO-ORF1853"
FT                   /product="ZYRO0G00682p"
FT                   /note="similar to uniprot|P38635 Saccharomyces cerevisiae
FT                   YFR025C HIS2 Histidinolphosphatase catalyzes the eighth
FT                   step in histidine biosynthesis mutations cause histidine
FT                   auxotrophy and sensitivity to Cu Co and Ni salts
FT                   transcription is regulated by general amino acid control"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29105"
FT                   /db_xref="GOA:C5E1R2"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1R2"
FT                   /protein_id="CAR29105.1"
FT                   /translation="MHSHHSHSGDYVAHGVDPLEDVTSKAIEKKFHTYCLTEHMPRINA
FT                   KFLYPEEQEGSIQQDAAVQRLQENFLNFLRHAKAIQDRPNASNTKFIVGTEIEGCDEEH
FT                   ISYGKQLMAQHNDVVKFCVGSVHHIRDIPIDFDQQCWNQALMACNNNLQTMLLSYFNLQ
FT                   YKMLTVLKPLVVGHFDIYKLYLPPTLRINPKTGDVSDESTAVPVSQVQPIHFWDSVHKA
FT                   VVRNLQFIESYGGLIEINTSALRKKLAEPYPGRDICELVKTYCGGRFVLSDDAHAVTQV
FT                   GVCYEQALKYITETLQLTQMYYLELNAQGDLSSKTLPIEQFKSNAFWGSNHL"
FT   gene            complement(<52966..>55011)
FT                   /locus_tag="ZYRO0G00704g"
FT                   /old_locus_tag="ZYRO-ORF1852"
FT   CDS_pept        complement(52966..55011)
FT                   /locus_tag="ZYRO0G00704g"
FT                   /old_locus_tag="ZYRO-ORF1852"
FT                   /product="ZYRO0G00704p"
FT                   /note="highly similar to uniprot|P38708 Saccharomyces
FT                   cerevisiae YHR020W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29106"
FT                   /db_xref="GOA:C5E1R3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1R3"
FT                   /protein_id="CAR29106.1"
FT                   /translation="MSVENSLAHLSVEDKIVEGAIPVKSLVFKPKTAKTATPVPVVVVA
FT                   LQSTVTPAPLIAQSTGTKEPRLARDELFQSFFKCESAKAFTVAYLLNAESEFHLLIDKQ
FT                   LETVKDSDVLKLNDTLFITKGEFVKFLSKFESSQKVVDFSQEVSKDAGNAKKSNAATPA
FT                   AAAATSAAIEDAKLIGITVDKSLDFSGWYQQILTKGEMLDYYDVSGCYILRPPSYSIWE
FT                   SIQRWFDDRIKAMGVQNAYFPLFVSSRVLEKEKDHVEGFAPEVAWVTKAGSSDLEEPVA
FT                   IRPTSETVMYPYYAKWIRSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAH
FT                   LTKADAEEEVLQILDHYAGVYEELLAVPVVKGRKTEKEKFAGGVFTTTVEGYIPQTGRG
FT                   IQGATSHHLGQNFSKMFNVSVENPLGPDHPKVNVFQNSWGLSTRVIGVMTMIHSDNKGL
FT                   VIPPRVSQYQAVVLPVGITKKTTEEQRAHIHSSAREIESRLKKAGVRAFGDYNDNYTPG
FT                   WKFAQYELKGIPLRLESGPKDIESNQVTVVRRNDFRKVTVKLDELETRIPELLEELQRD
FT                   LYLRAKELFDSHRVVVNEWKDFVSNLNKKNVILSPWCGVTECEEDIKESSAKRDDGEEF
FT                   EQDEKAPSMGAKSLCIPFEQPELKPGQKCVKCSHPAVQYCMFGRSY"
FT   gene            <55274..>56932
FT                   /locus_tag="ZYRO0G00726g"
FT                   /old_locus_tag="ZYRO-ORF1851"
FT   CDS_pept        55274..56932
FT                   /locus_tag="ZYRO0G00726g"
FT                   /old_locus_tag="ZYRO-ORF1851"
FT                   /product="ZYRO0G00726p"
FT                   /note="similar to uniprot|P38707 Saccharomyces cerevisiae
FT                   YHR019C DED81 Cytosolic asparaginyl-tRNA synthetase
FT                   required for protein synthesis catalyzes the specific
FT                   attachment of asparagine to its cognate tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29107"
FT                   /db_xref="GOA:C5E1R4"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1R4"
FT                   /protein_id="CAR29107.1"
FT                   /translation="MSVHINEKGGVDALTTVGSTEKPFQTAAFALYAQEELEHSEPKLL
FT                   VFKPEDNGYEEISASALKKAKKGAESLKKKALKQKELEAKKQQQEADKAAKQLEALDIK
FT                   IEEDKSLPQAQRVKINKAYESVGQRVKVNGWIHRIRNNKKLVFVVLRDGYGFLQAVLTG
FT                   NLALAKQTQELTLESSVALYGTVNKLPEGKSAPGGVELSVDYYEVVGLAPGGEDAFTNK
FT                   VSENADPSLLLDQRHLALRGETLSSMMKVRAIWMKCLRRFFENEGLTEVTPPCMVQTQV
FT                   EGGSTLFKLNYYGEEAFLTQSSQLYLETCLASLGDVYCVQESFRAEKSHTRRHLSEYTH
FT                   IEGELGFIDFDDLLSHLEKLFVETVGYIMEDPVGSAIVKQLNPDFKAPTYPFKRLDYKD
FT                   ALEWLNEHGVPNEDGEKFKFGDDIAEAAERKMVDTMGVPIFLIRFPAEIKSFYMPRCKD
FT                   DPRVTESVDVLMPNVGEITGGSMRTWNEADLLEGYQREKIDHTPYYWYLDQRKYGSVPH
FT                   GGYGLGTERILAWLCNRYTVRDCSLYPRFTGRCKP"
FT   gene            <57164..>58552
FT                   /locus_tag="ZYRO0G00748g"
FT                   /old_locus_tag="ZYRO-ORF1849"
FT   CDS_pept        57164..58552
FT                   /locus_tag="ZYRO0G00748g"
FT                   /old_locus_tag="ZYRO-ORF1849"
FT                   /product="ZYRO0G00748p"
FT                   /note="highly similar to uniprot|P04076 Saccharomyces
FT                   cerevisiae YHR018C ARG4 Argininosuccinate lyase catalyzes
FT                   the final step in the arginine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29108"
FT                   /db_xref="GOA:C5E1R5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1R5"
FT                   /protein_id="CAR29108.1"
FT                   /translation="MAENTQKLWGGRFTGETDPLMHLYNASLPYDWKMYRADLEGTRVY
FT                   TAGLNKLGLITPEELTKIHYGLGEIKKEWDEDKFVRHPNDEDIHTANERRLGEIIGRDI
FT                   AGKVHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKELVSVMVKRAEKEIGYLMPGYTHL
FT                   QRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQSPLGAGALAGHPYGIDREFLAEEL
FT                   GFQGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDLIIYSTAEFGFIKLNDAYST
FT                   GSSLMPQKKNADSLELLRGKSGRVFGDLAGFLMSLKGIPSTYDKDMQEDKESLFDSLTT
FT                   VEHSILIATGVISTLAVNSENMVNALTVDMLATDLADYLVRKGVPFRETHHISGECVAK
FT                   AENLGLSGIDKLSLEQYKTIDSRFEADLFETFNFEKSVERRDATGGTAKSAILKQLASL
FT                   QSQI"
FT   gene            complement(<58618..>59736)
FT                   /locus_tag="ZYRO0G00770g"
FT                   /old_locus_tag="ZYRO-ORF1848"
FT   CDS_pept        complement(58618..59736)
FT                   /locus_tag="ZYRO0G00770g"
FT                   /old_locus_tag="ZYRO-ORF1848"
FT                   /product="ZYRO0G00770p"
FT                   /note="similar to uniprot|P32792 Saccharomyces cerevisiae
FT                   YHR017W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29109"
FT                   /db_xref="GOA:C5E1R6"
FT                   /db_xref="InterPro:IPR013952"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1R6"
FT                   /protein_id="CAR29109.1"
FT                   /translation="MMYTRSQVTGKESMAQDIVDQVFDRVDSLYSKGSKVVSSVQDAVS
FT                   NTVSHIGGDPQWEAELAARSREEAGSPIVKSLSSLGSTIYRQLSGKVVIGCGFSALMAI
FT                   LFWRKERLLGLPEHLPKNQPKCCLVLGDMHDPIIRSQVMDLYRRRFTIFVCSRDAPSYR
FT                   EHEEDDDFLVHLDPTSSSDLANFVQSLNSTYELASILFMPNLSYHPSGEMSLSQLETEI
FT                   RSNTLLYYCTLMKLLPHLPHTQLILFDPSLTYNMKVAHHPVEIIVSGIVKSLYQSLARH
FT                   EKLDLYLIHLGILQLTAQPSNYKFLNLKGSNVNTALLEPVYRLIMAYNGNILRRMWLWI
FT                   VTFGFLNHHWYCGKYSWISTFSFITPLIKKWT"
FT   gene            <61277..>62797
FT                   /locus_tag="ZYRO0G00792g"
FT                   /old_locus_tag="Zyro0G.mRNA.104.p"
FT   CDS_pept        join(61277..61323,61435..62797)
FT                   /locus_tag="ZYRO0G00792g"
FT                   /old_locus_tag="Zyro0G.mRNA.104.p"
FT                   /product="ZYRO0G00792p"
FT                   /note="similar to Saccharomyces cerevisiae YFR024C-A LSB3
FT                   or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
FT                   YHR016C YSC84"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29110"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="InterPro:IPR033643"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1R7"
FT                   /protein_id="CAR29110.1"
FT                   /translation="MGLNNPVPRSLKSETKKAAKVLVSFIKPNQVLGTDQIIPPHVLKK
FT                   AKGLAIITVIKAGFLFSGRAGSGVIVARLPDGTWSAPSGIGMAGAGAGGLIGAELTDFV
FT                   FILNNQQAVDSFSRAGTLTLGGNISVAAGPLGRNAEADAAASAGGVATVFTYSKTKGLF
FT                   AGISVEGSAIVERKDANRKFYGASVSAKQILSGRVRPPPAADPLFRVLESRAFNFRVPD
FT                   ESYADSFYDDIPESFDSSDADTMGPGGRSNGRRGYGRYDDDFYSSDDDFGGSSGRYGRG
FT                   PPPDRFDRRGDPPDRFDRYGGGSRGRRSSYDDPNGVNEYYRSQMRGRPRGGSSRWDDAP
FT                   SEKDRFDKGSDRYDRYGDKYDRYDRDVDDLSNRFSRSRISSGGPASSGRAPRNEKAEFG
FT                   AASPSAGDTFSNTPKAVALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGRE
FT                   GIFPANYVELV"
FT   gene            complement(<63018..>64982)
FT                   /locus_tag="ZYRO0G00814g"
FT                   /old_locus_tag="ZYRO-ORF1841"
FT   CDS_pept        complement(63018..64982)
FT                   /locus_tag="ZYRO0G00814g"
FT                   /old_locus_tag="ZYRO-ORF1841"
FT                   /product="ZYRO0G00814p"
FT                   /note="similar to uniprot|P39684 Saccharomyces cerevisiae
FT                   or to YHR015W uniprot|P38760 Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29111"
FT                   /db_xref="GOA:C5E1R8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1R8"
FT                   /protein_id="CAR29111.1"
FT                   /translation="MFNSLSLRKPNILDNISLNVPRTAELPTKGIKQERINTVIQATES
FT                   FSILNENKSVSSRSSQSEFSDVVKLHGSMTQESGVATSNTNTQNGLDSQSVIESQPTIA
FT                   LFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYLNFSRRQDTLAATEE
FT                   FNYRPIFGKEVRIMPSLRNTFYRKNIGTNIFFSNLPLENSNLTTRVFYDTFKVYGNILS
FT                   CKLDKRKNIGFIYFDNDHAARVVIKEFNGSEFFGNKILCGIHFDKELRKFPEFEKRKSS
FT                   LNDITIPKEQLTLGPTDAKTVEHDSTQHLPHPNAIFVKNLPPSCPDDEILDYFSNLGPV
FT                   KSVFSSTSHKYESSWAFVTYKKGSDTNKAVKIYHGAQFKGRKLSVIKAESARNGHGSYN
FT                   KQSSKISYRPILYLQNLSSVCNEQFLLQMCMEERIKIENLGITDFFHDSFTYSGYVKCK
FT                   SKKDADKILKLLNNRLIGGCEVKITRKKLNNNNGNSSIPVIDVYHSKNQSKSPKHSTYN
FT                   GLSKQPQVHLQSAIFPMPIYSAPTPTPGAGPMYYPQPMVLTPKIATFNSSKETDEQLSQ
FT                   ILKYLRRQVKKGIDFLRYPTATNDENLLRITNYIFEHYWHCDLNQLTKFLLLMNANTQN
FT                   ESILNNHIEQTAKHLGFER"
FT   gene            complement(<65269..>67377)
FT                   /locus_tag="ZYRO0G00836g"
FT                   /old_locus_tag="ZYRO-ORF1840"
FT   CDS_pept        complement(65269..67377)
FT                   /locus_tag="ZYRO0G00836g"
FT                   /old_locus_tag="ZYRO-ORF1840"
FT                   /product="ZYRO0G00836p"
FT                   /note="similar to uniprot|P40215 Saccharomyces cerevisiae
FT                   YMR145C NDE1 Mitochondrial external NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29112"
FT                   /db_xref="GOA:C5E1R9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1R9"
FT                   /protein_id="CAR29112.1"
FT                   /translation="MLTRLIAAKGLPRLTNRFTKPISTGTHSNSIVRRCMPHHKGSVAG
FT                   KTVFERQFHSSRTAFNDKQQDTIGNNVSRGSIFSNGIGKLVQFTVMGAGVLALTCGGAL
FT                   FIFFIYDSTTYKESYVPDAIEVPNEALHPPSGGPENLPIFSEKLDNYDDETKQLTSYKP
FT                   KLVILGSGWASVGLLKNLKKGDYDVTVISPQNYFLFTPLLPSAATGTLEIKSLMASIRK
FT                   IVGDISGHYLEAKAEKIEFEDKLVKVSQVLQRGGEIRSFYVPYDKLVIAVGSTANTHGV
FT                   EGLEYCDRLKSAEDALNIKKKIKGNLEISCLPTTTEEERKKLLSFVVCGGGPTGVEFAA
FT                   EVFDLLNEDLPRSYPRVLRQQVSVHIIQSRSHILNTYDEKISEYAMERFKKESIDLLTN
FT                   ARVERILPDKVVFNQKNPETDEMEYKELPFGLCLWSTGVAQNPLAKHVVQSFQNNQRNK
FT                   RAIETDSQLRVVGNPAKDVYAIGDCSTVRTDLAENTVNYMRNFIIKKDIGAHQNSAIIT
FT                   DGDVRNISLSYDEIRALCRQVARLHPQTRESFVDLDDFLPRYDPENKGSLNFEQLSTLL
FT                   KETEAKVTSLPATAQRAHQQGSYLGKKFTKLARYTNDYIRSGQPVPAELEDGTCKPFKY
FT                   VHLGSLAYIGNSAVFDLPGYSFVGGLIAMYLWRGAYFVQTVSLRTRVLLFMDWLKRGLF
FT                   GRDFIDTS"
FT   gene            complement(<67767..>67838)
FT                   /locus_tag="ZYRO0G00858r"
FT                   /old_locus_tag="Zyro0G.tGln.TTG.62"
FT   tRNA            complement(67767..67838)
FT                   /locus_tag="ZYRO0G00858r"
FT                   /old_locus_tag="Zyro0G.tGln.TTG.62"
FT                   /note="tRNA-Gln (TTG) cove score=73.86"
FT   gene            complement(<68223..>68295)
FT                   /locus_tag="ZYRO0G00880r"
FT                   /old_locus_tag="Zyro0G.tAla.AGC.61"
FT   tRNA            complement(68223..68295)
FT                   /locus_tag="ZYRO0G00880r"
FT                   /old_locus_tag="Zyro0G.tAla.AGC.61"
FT                   /note="tRNA-Ala (AGC) cove score=70.19"
FT   gene            <68991..>69485
FT                   /locus_tag="ZYRO0G00902g"
FT                   /old_locus_tag="ZYRO-ORF1838"
FT   CDS_pept        68991..69485
FT                   /locus_tag="ZYRO0G00902g"
FT                   /old_locus_tag="ZYRO-ORF1838"
FT                   /product="ZYRO0G00902p"
FT                   /note="similar to uniprot|Q75BF8 Ashbya gossypii ADL396W
FT                   ADL396Wp and weakly similar to YNL246W uniprot|P53853
FT                   Saccharomyces cerevisiae YNL246W VPS75"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29113"
FT                   /db_xref="GOA:C5E1S0"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="InterPro:IPR037231"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1S0"
FT                   /protein_id="CAR29113.1"
FT                   /translation="MPHYEERDGIIAKIPNFWKIVLSQHDDFANYVRASDFKYIDAIQF
FT                   LVVKWQSPRDFDIIVGFQSVDQELPSQTVKKHFYHDGDEMKSQAVELKHNLPPRKRRNR
FT                   FFDWFQWQGLDDKGEFPNGDELARLIADEIYPLCVKFYTEAQRDVADEDSDEESSEPEL
FT                   L"
FT   gene            complement(<69728..>72070)
FT                   /locus_tag="ZYRO0G00924g"
FT                   /old_locus_tag="ZYRO-ORF1836"
FT   CDS_pept        complement(69728..72070)
FT                   /locus_tag="ZYRO0G00924g"
FT                   /old_locus_tag="ZYRO-ORF1836"
FT                   /product="ZYRO0G00924p"
FT                   /note="similar to uniprot|Q759V0 Ashbya gossypii ADR172C
FT                   ADR172Cp and weakly similar to YOR018W uniprot|Q02805
FT                   Saccharomyces cerevisiae YOR018W ROD1 Membrane protein
FT                   overexpression confers resistance to the GST substrate o-
FT                   dinitrobenzene as well as to zinc and calcium contains a
FT                   PY-motif which is required for Rod1p interaction with Rsp5p
FT                   a hect-type ubiquitin ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29114"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1S1"
FT                   /protein_id="CAR29114.1"
FT                   /translation="MFPLAKSNKAEPLLYDVRLHGTEHDVVLLKGSPDEASSVLLSGTV
FT                   VLSVREPIQIKNLSLKMTGKIRLNVPVQYQGPRGPAQRHVRYERTFYEHTWDNLNINSY
FT                   FENLYDNYGKRATINSKSSGNLADLHRRSKSSTSSLISLAGLGSSSGSHNHHHHHTLLQ
FT                   GNYEFPFSAILPGSLVESVEGLPNASITYKLEANIERNKFYSDLICKKHIRVVRTLSTD
FT                   AVELSETMAVDNTWPNKVDYSISVPAKAIAIGSLTPIHIEVVPLMKGLRLGPIKVTMIE
FT                   NSQYCGSFGNVATQERTVCKTKLKDPLGHVNRGPRDPEEEELTFQDRWQVDTFLQVPTS
FT                   LSRCTQDCTLLNSIKVRHKLKFVISLINSDGHVSELRASLPAQLFISPFVALTVRNPLR
FT                   PEYENGNGSSSSSRRTSLGDEEGDEDVIFAKTASELELANLINNWQVPSSVPDLMSPPN
FT                   YESHIYDRLWNDVSVPDTPHGSGTQTPIEGQSIGQVLDSQQNVDELEDNLMRLHLQRQE
FT                   GRNRSASTSNVIPGNPAKNPQETTIEGASNGNANAAVVPAATSPAQQALPMSRSGSAPL
FT                   VDQQPGIRGLPPAPLVTSGASVQHLSRSSSSILQIPQSPNKEVTLDNLSSVPSYEKAIK
FT                   SESAGNDLPPVYPADENPSHDRKHHLERPQVVHHRSSSSLLSKKSNSSIPSPQPSQAAL
FT                   VRRGSSSSSSGIPPPLQPHADSPSNGPAHNGKNQTVNKHFSFGMTPVGSSSSTGSFPLK
FT                   RSLSKGSLHERSSSLNNLRSLLKNHKK"
FT   gene            complement(<72544..>74184)
FT                   /locus_tag="ZYRO0G00946g"
FT                   /old_locus_tag="ZYRO-ORF1833"
FT   CDS_pept        complement(72544..74184)
FT                   /locus_tag="ZYRO0G00946g"
FT                   /old_locus_tag="ZYRO-ORF1833"
FT                   /product="ZYRO0G00946p"
FT                   /note="similar to uniprot|P43601 Saccharomyces cerevisiae
FT                   YFR021W ATG18 Phosphatidylinositol 3 5-bisphosphate-
FT                   binding protein of the vacuolar membrane predicted to fold
FT                   as a seven-bladed beta-propeller required for recycling of
FT                   Atg9p through the pre-autophagosomal structure"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29115"
FT                   /db_xref="GOA:C5E1S2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1S2"
FT                   /protein_id="CAR29115.1"
FT                   /translation="MPDTLPFINFINFNQTGTCISLGTSQGFKIFNCDPFGKFYSEESG
FT                   SYAVVEMLFSTSLLAVVGIGDQPSMSPRRLRIINTKKHSIICEVTFPTSILSVKMNKSR
FT                   LVVLLQEQIYIYDISNMRLLHTIDTNPNTRGIMAMSPSLENCYLVYPSPPKVINSEIKT
FT                   NATTNNINVTSTSGSIPQLQHQHQHQFDSSTGPAEDGLDPSSGDIPIQEELQSDPQNKK
FT                   SGSGNVIKNGDVILFNLKTLQPTMVIEAHKGEIASLALSLDGSLLATASEKGTIIRVFN
FT                   VETGIKINQFRRGTYPTKIHSMCFSEDNQFLAATCSSKTIHIFKVAPANGRQSEVHLEK
FT                   HDSDDSTIEEDVIDNASQTNSSVGGGGGGSGGNESIDEISSNADDQSSLERSREPYVDA
FT                   SRRTVARMIRKSSQRLSRHAAKTLGQIFPIKVSSLLEPSRHFASLKLPVESGHGIKSIT
FT                   AIGTPIEVDISEYPELFEYHQQPHTQEESNPAQQLNQQQQNLQNFENTSVQMLPIRVVT
FT                   SEGYLYNYVLDPERGGDCLLLSQYSLMLA"
FT   gene            <74705..>74805
FT                   /locus_tag="ZYRO0G00968r"
FT                   /old_locus_tag="Zyro0G.tSer.GCT.3"
FT   tRNA            join(74705..74741,74761..74805)
FT                   /locus_tag="ZYRO0G00968r"
FT                   /old_locus_tag="Zyro0G.tSer.GCT.3"
FT                   /note="tRNA-Ser (GCT) cove"
FT   gene            complement(<74957..>81352)
FT                   /locus_tag="ZYRO0G00990g"
FT                   /old_locus_tag="ZYRO-ORF1831"
FT   CDS_pept        complement(74957..81352)
FT                   /locus_tag="ZYRO0G00990g"
FT                   /old_locus_tag="ZYRO-ORF1831"
FT                   /product="ZYRO0G00990p"
FT                   /note="similar to uniprot|P34756 Saccharomyces cerevisiae
FT                   YFR019W FAB1 1-phosphatidylinositol-3-phosphate 5-kinase
FT                   vacuolar membrane kinase that generates
FT                   phosphatidylinositol (3 5)P2 which is involved in vacuolar
FT                   sorting and homeostasis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29116"
FT                   /db_xref="GOA:C5E1S3"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1S3"
FT                   /protein_id="CAR29116.1"
FT                   /translation="MSEPSNELVSLTQKVPAAVKPGPDKPEFLATQALIPRTTTDLDTN
FT                   PVLSNISLPQELSKNGNLPLQDAGMESSAAAAAAVAAAEKKKSGSSSSSNANHDDIDCY
FT                   NGNDIDGYNGNDIEGYNGSNNIKLELDNREKATRGIHSMGNQVRSPLSKSDRGINGRSL
FT                   TFSINNDANFKRSSIYESKSTVTAVPIRNPVTGAKQHYGDNDDASSSKSVSSSMTKSFL
FT                   FGFYNNQKKNENPTKGILSKQYWMKDDSAKECFTCGKAFTTFRRRHHCRICGQIFCSGC
FT                   TLLISGERFGYDKRMRVCKNCYQHADNYEDSSDEDSYGEQNSPHNDYNSAVQEASPDRW
FT                   SGDSVPPSPGLGLANHNPLMKQTDLFMMNDEDVKSIVTTAEDTKLFVSTPPPPPKMAIP
FT                   ATRQGESLEISFPSHRNENTLDNQHMESAGSTGKDRYTIKDVDMLTPYDLQYGSSSQLP
FT                   GRSANKNVKNSLRRSVFNYVNSSRHSLDKPSSSGSADSIIGNLGSKNFKFEFNYMKNAR
FT                   RPSSGSTKRDVNWLNHVQNEQEETGSSVSLQDDDTSEDEASMSIYSSLNDPFHSKNPIR
FT                   SMRNSTKSLQRAEASLQRMRFRRKSKSRPNNKDSDSIYKGLNVLTHSTPNLVSVVDEDN
FT                   AFGSQNGGSGGSSILAKPKNKLGNAGQWRRISSMAGLKVPKEKKNELNQVARLHMEALL
FT                   EQVMHDQNFETTEFWTPLLKDFLRKVQDIDLSARDSNTLDFRQNCVKIKRVTGGGISSS
FT                   EYINGIVFSKALPCKTMPRRLENPRILLIMFPLEYQRNENHFLSIETVFAQEQEYLDKL
FT                   VSRLVSLSPDIVFVGANVSGYALELLNKVGVVVQFNVKPQVMERISKLTEADIAISVDK
FT                   LAANVKMGECEEFEVKTYIYGNVSKTYTFLRGCNPSFGGTILLRGDSQEVLRKVKDVTE
FT                   FMVYVLFSLKLESSFFNDNFLQLPPTYYINERKRKEELEYTGYFADFLAKFNSRILTIS
FT                   PTVEFPVPFLLQRARELEQELLDKRRRHELLLQKDNTEDDPRIKALGLASKLTQRDLKY
FT                   LIRFLHEKEIKALELQFQKRSRHWELSYAQSHNLLGTGSHQCITVLYSMVSTKTATPCI
FT                   GPQLVTIDYFWDSDISVGQFIENVIATASYPCRQGCGGLLIDHYRSYVHGSGKVDVLIE
FT                   KFQTRLPKLKDIILTWSYCKKCGTSTPILQMSEKTWNYSFGKYLEVMFWSNNKGVTGIG
FT                   NCTHDFTKEHVKYFGYNDLVARMEYSDLEVHELITPQRRIIWAPYKDIKMKVELYYQIL
FT                   DKINSFYDSVSTRLTRVKLDSMDGDKLLAGQDKLEELKERVDDEKKAVLEELETLYQDS
FT                   PGDQHIKLNVIIKALHEKVVSWDTEFTEFGKKFLPSENDITRITSNQLKKLFTDFNKTQ
FT                   ETKSQHSKDHDKSFEMEDFHGSQNEKEKNFEKDKTNLSAFNGTQTTTNDPEDSGKTKND
FT                   SSFSLPNSRRLDSNDSTGSHANRFTRPSLRKTSSINSAGINNNDLRRSSLNSSLSGDSF
FT                   LTREHRTKTKVGELANFFDQMHFDALSKEFELQREKERVQLNRNKYQASRLHQSTPIVE
FT                   IYKNVKDAVDEPLHDQNKRSNREGLTKSKNESHDKNSSKASTQTQFDQKLESQLENSIY
FT                   QWGESVFHKGDSGKKERIDPELTSNAILNGGKEGITAAAAPPALTIANANKDEVSTQPE
FT                   KSLLMKALTNFWADRSASLWKPLNYPTHPTEHIFVDSDVIIREDEPSSLIAFCLSTSDY
FT                   KQKMAKLDSQQPINVAPPENSQTPDVSFSEMESQKSDDTYRNTSQIHPSKERFSSVTPD
FT                   DAQTQPPNLQQLPRDENEILEAIMTKKTAVHLRYQFEDSLSVMSCKIFFAEHFDAFRRI
FT                   CGCNEQFVQSLSRCVKWDSSGGKSGSGFLKTLDDRFIVKELSHAELDAFIKFAPSYFEY
FT                   MAQAMFHDLPTALAKAFGFYQIQVKSSISGSKNYKMDVIIMENLFYEKNPSRIFDLKGS
FT                   MRNRHVEQTGKENQVLLDENMVEYIYESPIHVREYDKKLLRASLWNDTLFLAKINVMDY
FT                   SLVVGIDNNGHTLTVGIVDFIRTFTWDKKLENWVKEKSIVGGNSIKKPTVVTPKQYKSR
FT                   FREAMERYILMVPDPWYQENA"
FT   gene            <81774..>82742
FT                   /locus_tag="ZYRO0G01012g"
FT                   /old_locus_tag="ZYRO-ORF1828"
FT   CDS_pept        81774..82742
FT                   /locus_tag="ZYRO0G01012g"
FT                   /old_locus_tag="ZYRO-ORF1828"
FT                   /product="ZYRO0G01012p"
FT                   /note="similar to uniprot|P43599 Saccharomyces cerevisiae
FT                   YFR018C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29117"
FT                   /db_xref="GOA:C5E1S4"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR037457"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1S4"
FT                   /protein_id="CAR29117.1"
FT                   /translation="MIRTLIWLLIWALATQGLIDYRDYHDEFLPRFLSLENASDDNLLL
FT                   PFNTTRTPGSKESLEIQKLIKNFYDGLESPWELEEDSFENKGLNFNNLVYTLGANSSSY
FT                   VVLSAHYDSKVEPEGFIGATDSAASCAILLYVSRFLDAFYQNGNSSLSDEKNGDVGFKI
FT                   VFFDGEESLKQWTAEDSLYGSRHLASKWIEQGLIDKIHLFVLLDLLGSNPAPIRSYFRE
FT                   THEAYERLASLESTLFKSPPQLDPMDHSILQLNGPSIDDDHIPFYRAGVPVLHLIPWPF
FT                   PSFWHTLQDDFNHLQQNEIDKWAVLLSEFLVEESSGFADRL"
FT   gene            <82897..>84528
FT                   /locus_tag="ZYRO0G01034g"
FT                   /old_locus_tag="ZYRO-ORF1827"
FT   CDS_pept        82897..84528
FT                   /locus_tag="ZYRO0G01034g"
FT                   /old_locus_tag="ZYRO-ORF1827"
FT                   /product="ZYRO0G01034p"
FT                   /note="some similarities with uniprot|Q92325 Saccharomyces
FT                   cerevisiae YOL025W LAG2 affects longevity involved in
FT                   determination of longevity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29118"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1S5"
FT                   /protein_id="CAR29118.1"
FT                   /translation="MDVQSVVKQYRATEDNDLKYMALKEELSPLDVCENLQNYVDQLLI
FT                   PILMEEANAEIVNLVSLQVFPYAVELCLINDKSGPWFDDIVVNPLIEKMVSARTTIAIQ
FT                   TLKTVSRKICERRIRLGTRPQLIEEFLQKCDDTVLSVEALYYLIQCYYDMHRGVPPPII
FT                   DQILKLARSGPQDDTTRLLIRESLSRANLDAILQVKTQLNLQELEFASECWWRFAPIFI
FT                   DIFHLQLLPSLSNHETRASALRTLLNFQPFYTIKRLDDDTLLGRNNEKLLIQSLQEIDQ
FT                   ELSRTAPETPDKNHEQEADSDSDSDPEQTAYLAELPSDEEIEFENEVEGPAEPLPRETN
FT                   IRNICQEILTKLKANFDSSPLSSTYEPLPSILNKLFKREEEDLLSLSQLQAALETLSQL
FT                   ASVRPTPNLPWSQICQDLVLPRIVLDKTFVQKLKAGNLTQSIDEGATLRASAQSTLQQL
FT                   LPLIDFKTICIMLEYELKNGIQDKDSGVKQLAAELVHSLLSTHYSEIIGLQWQWYAALL
FT                   KEEEDPRDLAAQALRTSLREDYPAVG"
FT   gene            <84782..>85069
FT                   /locus_tag="ZYRO0G01056g"
FT                   /old_locus_tag="ZYRO-ORF1825"
FT   CDS_pept        84782..85069
FT                   /locus_tag="ZYRO0G01056g"
FT                   /old_locus_tag="ZYRO-ORF1825"
FT                   /product="ZYRO0G01056p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29119"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1S6"
FT                   /protein_id="CAR29119.1"
FT                   /translation="MVSNTRNPIEEHPDMTMSEDFLSMEDPPAAKEMDFQWRPPSSGQQ
FT                   MDEQLPEEDSSQTKVRARRGAPDFKRRPSFEYEDYKKNAYNRLSIFDHQH"
FT   gene            <85279..>87249
FT                   /locus_tag="ZYRO0G01078g"
FT                   /old_locus_tag="ZYRO-ORF1824"
FT   CDS_pept        85279..87249
FT                   /locus_tag="ZYRO0G01078g"
FT                   /old_locus_tag="ZYRO-ORF1824"
FT                   /product="ZYRO0G01078p"
FT                   /note="similar to uniprot|P25038 Saccharomyces cerevisiae
FT                   YOL023W IFM1 Mitochondrial translation initiation factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29120"
FT                   /db_xref="GOA:C5E1S7"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1S7"
FT                   /protein_id="CAR29120.1"
FT                   /translation="MWRLAQSGRLQSGFLLGVRRYAKPSKKASTTISNSLKKLNFVIPN
FT                   YISVNKLSNLLNCRSERLVKDLTGLGFANVTQNYILSRDYVELILQEYNYELPASRKQL
FT                   NAQTVYDELKSPVNPKLLQKRPPVVTIMGHVDHGKTTIIDHLRKSSVVSQEHGGITQHI
FT                   GAFQVVTPVSKKKITFLDTPGHAAFLKMRERGANITDIIVLVVSVEDSIMPQTIEAIKH
FT                   AKNSGNETIIAITKIDKIKQPRERERALERVTADLIAHDIQLEQVGGDVQVVPLSARSG
FT                   ENMDLLEESIVLLSDVMDIRAEDSNKVAAEGWVLESQVKKSVGIVATVLLKKGCLQKGN
FT                   ILVCGNTYCRVRNLLDSAGRPVTKAMPADAVEVLGWKEIPEAGDQVIQAKNEAQAKKYN
FT                   AKRIALLEVEEQAINVEKLNLERGLKRDEDDAQDENEDGEDIDSTKQELGPKKVNFIVK
FT                   ADVSGSAEAIKESIASLGNEEVVCNVVSSSVGPPAESDLKMAQITDSKILCFNLGSLPT
FT                   EVINNRKGVDIRQYNVIYKLIEDVTQVLTDNLKPIYETKHVAQIDVREIFEFTLKKKVI
FT                   KIAGCRVENGKIFRNSTVQILRNDQVIFDGKLATLKQGKDDTLEVTKGNECGITFEKGF
FT                   EDYEAGDKIMVYERQRVPRYL"
FT   gene            complement(<87284..>88486)
FT                   /locus_tag="ZYRO0G01100g"
FT                   /old_locus_tag="ZYRO-ORF1820"
FT   CDS_pept        complement(87284..88486)
FT                   /locus_tag="ZYRO0G01100g"
FT                   /old_locus_tag="ZYRO-ORF1820"
FT                   /product="ZYRO0G01100p"
FT                   /note="similar to uniprot|P25040 Saccharomyces cerevisiae
FT                   YOL022C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29121"
FT                   /db_xref="GOA:C5E1S8"
FT                   /db_xref="InterPro:IPR007320"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1S8"
FT                   /protein_id="CAR29121.1"
FT                   /translation="MSLSASDDENFADKTSQVYLGFVDTPVKEEDDISIEDTFIGGEPK
FT                   WLHPDSKPNDDFLKCGACKSKDNMRLLLQAFAPLDYDQMEDLQSLSGLKNMRYINPDDD
FT                   RVLYVFICTKCPRKANSVRCIRGVKKNRPQTGSQKISDKMASLSVEKEFNINPFDTSKS
FT                   NPNPFGGNPFGQSSENPFSAPTSATNNDSKKEKADTDDQQISAKTARKMHENLKDKQFD
FT                   STRSFKSYLLYVEEESFKNKKPDHLKLPKNLKIDKNALELTGESESNLEKNPIKLDPRT
FT                   EKLSKFLDDETFQKFQEIVGYNPGQVLRYDLGGKPLLYVDTKVDLINTVANPGYNPSSK
FT                   RIFEMQLMPKMIIDLEEEVSLLDSMEWGTIMIFTDLENYVPQFDDNDVGYVEECVRVQW
FT                   E"
FT   gene            <88664..>88734
FT                   /locus_tag="ZYRO0G01122r"
FT                   /old_locus_tag="Zyro0G.tGly.GCC.4"
FT   tRNA            88664..88734
FT                   /locus_tag="ZYRO0G01122r"
FT                   /old_locus_tag="Zyro0G.tGly.GCC.4"
FT                   /note="tRNA-Gly (GCC) cove score=66.56"
FT   gene            <89341..>91599
FT                   /locus_tag="ZYRO0G01144g"
FT                   /old_locus_tag="ZYRO-ORF1818"
FT   CDS_pept        89341..91599
FT                   /locus_tag="ZYRO0G01144g"
FT                   /old_locus_tag="ZYRO-ORF1818"
FT                   /product="ZYRO0G01144p"
FT                   /note="highly similar to uniprot|P43535 Saccharomyces
FT                   cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
FT                   kinase activity forms a complex with Gcn1p proposed to
FT                   stimulate Gcn2p activation by an uncharged tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29122"
FT                   /db_xref="GOA:C5E1S9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1S9"
FT                   /protein_id="CAR29122.1"
FT                   /translation="MATIGSQVRSAAGSLDPVVTDYAVGYLNHLSNITFDAVQSKQVDL
FT                   STEVDFISNLLLDAGATNEKVKQLSENVLDRLNQQLDENRAKLEVTGDTSRRLLDINVL
FT                   QSHNGKANIDTSLNMLGVNGDIEHTGRKMDTRVDLKKLAKAEQKIAKKVAKRNNKFVKY
FT                   EASKLIAPQKEEDYDSFFLKINPLELGAGAGKSKDIHIDTFDLYVGDGQRILSDSRLTL
FT                   SSGHRYGLVGQNGIGKSTLLKALSRRELNVPKHISILHVEQEIKGDETQALQSVLDADV
FT                   WRKQLLGEESKINERLQEIEKLRTEFEEDSLEVKKLDNEQADLDNRLQQIAERLVDMES
FT                   DKAESRAASILYGLGFSQEAQKLPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLD
FT                   VPSIAYLSEYLKSYPSTILVVSHDRAFLNEVATDIIYQHNERLDYYRGQDFDTFYATKE
FT                   ERRKNAQREYDNQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPVLEPPEGEKSV
FT                   SFKFPECSKLSPPIIQLQDVTFGYNENNLLLKDVNLDVQLNSRIALVGANGCGKTTLLK
FT                   IMMETLTPLKGYVSRNPRLRLGYFAQHHVDAMDLNASAVEWMSKTFPGRSDEEYRRHLG
FT                   SFGITGSLGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSNHLDTSGIDALVDALK
FT                   NFTGGVLMVSHDISVINSVCNEIWVSEDGSARRFEGTIHDYKKYILESADKQGVVKRQ"
FT   gene            complement(<91672..>94653)
FT                   /locus_tag="ZYRO0G01166g"
FT                   /old_locus_tag="ZYRO-ORF1812"
FT   CDS_pept        complement(91672..94653)
FT                   /locus_tag="ZYRO0G01166g"
FT                   /old_locus_tag="ZYRO-ORF1812"
FT                   /product="ZYRO0G01166p"
FT                   /note="highly similar to uniprot|Q08162 Saccharomyces
FT                   cerevisiae YOL021C DIS3 Nucleolar exosome component
FT                   involved in rRNA processing and RNA degradation binds
FT                   Gsp1p/Ran and enhances the GEF activity of Srm1p implicated
FT                   in mitotic control homologous to the E. coli RNase R of the
FT                   RNase II family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29123"
FT                   /db_xref="GOA:C5E1T0"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033770"
FT                   /db_xref="InterPro:IPR033771"
FT                   /db_xref="InterPro:IPR041505"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1T0"
FT                   /protein_id="CAR29123.1"
FT                   /translation="MSVAAALPKRKRLSEGLTVTQKVFVRSRNGRASKIVREHYLRKDI
FT                   PCLSRACDKCPEIVVPDAKSELPSFVLSESPLELPSIGKHYVVLDTNVILQAIDLLENP
FT                   DCFSDVIVPQIVLEEVRNKSYPVYTRLRSLTKNSDDKKRFIVFHNEFNEFTFIDRLPEE
FT                   SINDRNDRAIRKACQWYGEHLEPYGIKIVLVTNDRLNRDAADKSKDSFISMSLFDYVQA
FT                   LPNGDEIKDSIPNFEVSSENTKDTEAKSEFTYPEYYSTSRIMGGLKNGALFQGNIQISE
FT                   YNFLEGSINLPNFSKPVLIVGPKNLNRAFNGDQVVVELLPQSEWKAPSSIALDSEHFDV
FT                   NDNADIDGDDDNSQVVLSDKQRKLLTQDAILAQKSNKVQPTARVVSITRRSWRQYVGQI
FT                   APNSVDAQNGGTQNVFVILMDKCLPKIRIRTRRAHELLSQRIVISVDSWPETHKYPLGH
FT                   FVRNLGEVESVQAETEALLLEHDVEYRPFSKKVLECLPPEGHDWKAPETLDDASAVSKD
FT                   PLLPKRRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPNTALD
FT                   GEGASRGTSVYLVDKRIDMLPMLLGTDLCSLKPYVDRFAFSVLWELNENADIVNVDFAK
FT                   SVIKSREAFSYEQAQLRIDDPNQQDELTHGMRALLKLSIKLKEKRINAGALNLASPEVK
FT                   VHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDSFPQTAMLRRHASPPST
FT                   NFELLNEMLQTRKGMSISLESSKALADSLDRCIDPKDPYFNTLVRIMSTRCMMAAQYFY
FT                   SGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLDLSHRDKNRMDM
FT                   ICKNINKKHRNAQFAGRASIEYYVGQVMRNNESVETGYVIKVLNNGIVVLVPKFGVEGL
FT                   IRLENLTKDTGSASFDEVEFKLSFTQATTGKRRDVHVFEKVDVQVRSVLDQVTSKRKAE
FT                   LLLI"
FT   gene            <95655..>97239
FT                   /locus_tag="ZYRO0G01188g"
FT                   /old_locus_tag="Zyro0G.mRNA.165.p"
FT   CDS_pept        join(95655..95676,95759..97239)
FT                   /locus_tag="ZYRO0G01188g"
FT                   /old_locus_tag="Zyro0G.mRNA.165.p"
FT                   /product="ZYRO0G01188p"
FT                   /note="highly similar to uniprot|P43593 Saccharomyces
FT                   cerevisiae YFR010W UBP6 Ubiquitin-specific protease
FT                   situated in the base subcomplex of the 26S proteasome
FT                   releases free ubiquitin from branched polyubiquitin chains
FT                   deletion causes hypersensitivity to cycloheximide and other
FT                   toxic compounds"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29124"
FT                   /db_xref="GOA:C5E1T1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1T1"
FT                   /protein_id="CAR29124.1"
FT                   /translation="MSDSKLEFNIKHAGKSYPISLGNNATAGELKSCVEDLTKVPLSRQ
FT                   KYMVKGGLVDDSAKLVDVIKPGSTLMLLGTADAGLVSKPAEKNQFIEDLAPEEQLQRSS
FT                   DLPIGFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADSTVESHKKIVLE
FT                   LQRCFQNLKNKSFKSVMPMVLLTALRKCYPQFAERDSQMGFYKQQDAEELFTQLFHSLS
FT                   VVFGDKFEDEFSINFKTTTTDSANENDVSVKEESDTKLQCHISSNTNFLKNGLVESLHE
FT                   TIEKRSEFTGANSKYVVDKQITRLPKYLTVQYVRFFWKRSTGKKSKILRKVSFPFQLDV
FT                   SDMLTPEYMKEKIKVRDEFRRIEKEKAEKDRDSKRRKIDSSNGSNLSSMTPRERYETEQ
FT                   ALAQSEREHWEAEFKKHTPSEVTEGENPSSLYELVGVITHQGANSESGHYQSFIRDDYD
FT                   EDKWYKFNDDKVSVVDKEKIESLSGGGESDSALILIYKGFGL"
FT   gene            complement(<97365..>97826)
FT                   /locus_tag="ZYRO0G01210g"
FT                   /old_locus_tag="ZYRO-ORF1809"
FT   CDS_pept        complement(97365..97826)
FT                   /locus_tag="ZYRO0G01210g"
FT                   /old_locus_tag="ZYRO-ORF1809"
FT                   /product="ZYRO0G01210p"
FT                   /note="similar to uniprot|P43594 Saccharomyces cerevisiae
FT                   YFR011C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29125"
FT                   /db_xref="InterPro:IPR012471"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1T2"
FT                   /protein_id="CAR29125.1"
FT                   /translation="MGSTTSKPSETRVFQPKTPVDFSETLLSQLESSNETNFTRKQLGE
FT                   RFVEQRVANRLSELEEETLKKFENKLDESLIKKDDEESPLTSQLLNEKVSSLDQKLAAL
FT                   KEKDDQKHSKFANHPARQQLTTCLLDNKGKPLNCYNQIENFKKLVEENS"
FT   gene            <98626..>98697
FT                   /locus_tag="ZYRO0G01232r"
FT                   /old_locus_tag="Zyro0G.tPro.TGG.5"
FT   tRNA            98626..98697
FT                   /locus_tag="ZYRO0G01232r"
FT                   /old_locus_tag="Zyro0G.tPro.TGG.5"
FT                   /note="tRNA-Pro (TGG) cove score=66.07"
FT   gene            complement(<99245..>99317)
FT                   /locus_tag="ZYRO0G01254r"
FT                   /old_locus_tag="Zyro0G.tThr.AGT.60"
FT   tRNA            complement(99245..99317)
FT                   /locus_tag="ZYRO0G01254r"
FT                   /old_locus_tag="Zyro0G.tThr.AGT.60"
FT                   /note="tRNA-Thr (AGT) cove score=74.49"
FT   gene            <99814..>100350
FT                   /locus_tag="ZYRO0G01276g"
FT                   /old_locus_tag="ZYRO-ORF1807"
FT   CDS_pept        99814..100350
FT                   /locus_tag="ZYRO0G01276g"
FT                   /old_locus_tag="ZYRO-ORF1807"
FT                   /product="ZYRO0G01276p"
FT                   /note="similar to uniprot|Q03677 Saccharomyces cerevisiae
FT                   YMR009W ADI1 Predicted acireductone dioxygenease of the
FT                   methionine salvage pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29126"
FT                   /db_xref="GOA:C5E1T3"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR027496"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1T3"
FT                   /protein_id="CAR29126.1"
FT                   /translation="MVATYFFDDNNSVDFREPHYSGQDVTLEHLGKLGVLYKYLPSQSD
FT                   VDSLAEERAYKNRDVVNLSPASFANDEEKLLEKLNVFYKEHLHEDEEIRYCLDGSGYFD
FT                   IKDSTIDQWIRVRLDKHDLLIVPAGIFHRFTVTTDNYIKALRLFQDEPKWQAINKPEAD
FT                   QNPVRKNYLATLQSA"
FT   gene            <100648..>101946
FT                   /locus_tag="ZYRO0G01298g"
FT                   /old_locus_tag="ZYRO-ORF1806"
FT   CDS_pept        100648..101946
FT                   /locus_tag="ZYRO0G01298g"
FT                   /old_locus_tag="ZYRO-ORF1806"
FT                   /product="ZYRO0G01298p"
FT                   /note="similar to uniprot|Q03687 YMR010W Saccharomyces
FT                   cerevisiae Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29127"
FT                   /db_xref="GOA:C5E1T4"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1T4"
FT                   /protein_id="CAR29127.1"
FT                   /translation="MDAAVSSSTLLSRSVTTVASSMVSASTSASPSESILSTLASASAS
FT                   ATADAVAAVAEGVPVPAPHANSGDILSSYLPRVDQFYIPEWLTMQFVANNLVSFTPLFS
FT                   YGTTILSIERSKTALGFSIDICATMMIASILRISYYLITPYEITLLRQSIVMIFIQLIL
FT                   LRTTLLYRPEEYKYHNLHDVESFSQLIRNVWYEYFACSKPPFFSKDWRLMLRSLSFKHL
FT                   TGFLYKCLLMACYKVLKFFDPSYKRFKSFWQWDDESKFWKFLVYFASFQLFLTFIISKV
FT                   LNWESLSTWIGSVIGSLGLLIESLLPLPQIAILYKLKSVQGFKLILLISWFCGDTLKIT
FT                   YLIFGASNISVIFLLFALFQMTLDFYIGGQYIYYRYYYPSLRNRREAPLRDEEENGEII
FT                   ELENFKMNNSDLELQTPPPHQHGRVRSHSLMGQ"
FT   gene            complement(<102166..>104355)
FT                   /locus_tag="ZYRO0G01320g"
FT                   /old_locus_tag="ZYRO-ORF1804"
FT   CDS_pept        complement(102166..104355)
FT                   /locus_tag="ZYRO0G01320g"
FT                   /old_locus_tag="ZYRO-ORF1804"
FT                   /product="ZYRO0G01320p"
FT                   /note="weakly similar to uniprot|P32606 YOR017W
FT                   Saccharomyces cerevisiae PET127 Protein with a role in
FT                   mitochondrial RNA stability and/or processing"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29128"
FT                   /db_xref="GOA:C5E1T5"
FT                   /db_xref="InterPro:IPR013943"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1T5"
FT                   /protein_id="CAR29128.1"
FT                   /translation="MRCTETTGILEDYQPIICLVSPLWPLSSMYRTSLFRTRYFYRGHS
FT                   FARSKLRRKPAKRYVINPDSDKGSSSANIPDASIVASVNNVQQMSVDPENGQFLGTKND
FT                   KSLVKTKPPRLTHDLARVLYQPLTLHQLQDSRTGVYNFEPELEMIAPDMLEPKDDGELP
FT                   FITPHKDETLHRMAKISKSEYVSSTSSMTSSLSQLHFLLSGFRPLNAVDLPLSRRFPDK
FT                   HLTYTQGAKLPASFILRKLDDKVTSIDSDKSLDREIVLSILGHSLEEFLTDRAQSQPES
FT                   YHYSQVDSFLLRSQLDAYDSKLPGTGVFDLKTRAVAAIRHDLSFVESNNNYTGYEIDRV
FT                   FGEFESLEREFFELVRSTLLKYSLQARIGKMDGIFVAYHNIARMFGFQYLPLEDLDFII
FT                   HSCYDSKFNFALSSKNHDLRSIYGDQVFFTQQQRDARKVASAVADKEFKISIHLFKNIL
FT                   MHVKNLLNSKGIKNWQKCKIMMQTVTSKDTNGSKSLRSVEKPVLKVVAVPLPDDYEDKP
FT                   LLTKDMDNNAISQQLAHIREENQQLLENLGDSIVGFQIKVSHEYRESQKKELKIPGFAR
FT                   PSQKVLTPESCDYVIAKLNQDYYRNFKNFKYPSFFHPKDLAGWKVRTQIYNINSTEQLK
FT                   SLYGTFLNQKLHVLEEQSVIISTNRSSNKEVSRRISDLMAEDFGGKVEKKDGQELSALK
FT                   SRLRAYAKKGETRRKLRDRLCSPKVKITWDSQDMD"
FT   gene            <104855..>106237
FT                   /locus_tag="ZYRO0G01342g"
FT                   /old_locus_tag="ZYRO-ORF1802"
FT   CDS_pept        104855..106237
FT                   /locus_tag="ZYRO0G01342g"
FT                   /old_locus_tag="ZYRO-ORF1802"
FT                   /product="ZYRO0G01342p"
FT                   /note="similar to uniprot|P23180 Saccharomyces cerevisiae
FT                   YHL021C FMP12 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29129"
FT                   /db_xref="GOA:C5E1T6"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1T6"
FT                   /protein_id="CAR29129.1"
FT                   /translation="MYLRSAFKKCTRFYSAAVPLLKNSNGIGFDVAALRDSGRIIKALS
FT                   NDKSTTITFVSDDLPDGKPYTVAFNNLFLRDSSRSPKSVDPTTGQKLLTTSQLSRNPLS
FT                   TTPISVQVTPEGKFVSIKWEDGDSYNYPLEFIYKFKGSSFVTESMRITSPNPKTLFWDE
FT                   ETLNNHRDEVMGTDYEAYTHDDNHLYQLLRTLQKFGIVFINGVPQGDHGAIKKIAERIG
FT                   PIRNTFYGETFDVKGANNETPNIAYSNLALPLHMDLLYMENVPEYQLLHTINNPKEGSG
FT                   GVNVFVDGFRAANEVRELDTISYQALQNVPINYHYSRGDKRYYQSKPMIEHHESHKGNT
FT                   LDDYFDGLIKAVNYSPPFQAPFTFGIHAKSPESDACKSKLAERHMFNDFTNGLELFEDC
FT                   ITDKSNQFEIKLPPNSCVILDNRRVLHARSAYSSDSRWIKGCYMDKDTIISRLNYLREK
FT                   FL"
FT   gene            <106296..>107411
FT                   /locus_tag="ZYRO0G01364g"
FT                   /old_locus_tag="ZYRO-ORF1801"
FT   CDS_pept        106296..107411
FT                   /locus_tag="ZYRO0G01364g"
FT                   /old_locus_tag="ZYRO-ORF1801"
FT                   /product="ZYRO0G01364p"
FT                   /note="similar to uniprot|P23179 Saccharomyces cerevisiae
FT                   YHL022C SPO11 Meiosis-specific protein that initiates
FT                   meiotic recombination by catalyzing the formation of
FT                   double-strand breaks in DNA via a transesterification
FT                   reaction required for homologous chromosome pairing and
FT                   synaptonemal complex formation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29130"
FT                   /db_xref="GOA:C5E1T7"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="InterPro:IPR034136"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1T7"
FT                   /protein_id="CAR29130.1"
FT                   /translation="MGKGLIDYMNDCSTKDDLYKSLLPRTRTIHMNMYDEDISGTIETI
FT                   LSLTKNSLEQHQQPVNILIRTKSKSPISLKFPDHGLYSSVAAHQNSNRIAIMLNLLQTI
FT                   QECLTSSTVKTNRDLFYSNVELYGKQVTVDRWINTIAQSLELTNARDNLNVIPAQKGLV
FT                   FTTQEIRILTKGSEERINPYHSSLIPHMDQNSLCQIVPGRNATTRLLVLEKEAVYNQLV
FT                   NDVQYSPSYYDDCIIVTGKGYPDFLTRLFLHKLQVSTTAIERWEIYTDADPYGVDIAMK
FT                   YVQNVKEPCRCNKLVHRGVFLFQLMSNQRQQVQYLPMTQRDTAVATRILQRVTESNLPN
FT                   MTTVQELQRQIFLQKKAEMNVMGRETYLGQK"
FT   gene            <107727..>108374
FT                   /locus_tag="ZYRO0G01386g"
FT                   /old_locus_tag="ZYRO-ORF1800"
FT   CDS_pept        107727..108374
FT                   /locus_tag="ZYRO0G01386g"
FT                   /old_locus_tag="ZYRO-ORF1800"
FT                   /product="ZYRO0G01386p"
FT                   /note="similar to uniprot|Q12450 Saccharomyces cerevisiae
FT                   or to uniprot|P39704 Saccharomyces cerevisiae YAL007C ERP2
FT                   Protein that forms a heterotrimeric complex with Erp1p,
FT                   Emp24p, and Erv25p; member, along with Emp24p and Erv25p,
FT                   of the p24 family involved in ER to Golgi transport and
FT                   localized to COPII-coated vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29131"
FT                   /db_xref="GOA:C5E1T8"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1T8"
FT                   /protein_id="CAR29131.1"
FT                   /translation="MQLQSILPHLLAVICCCLIPAVKAESSNYAPFSIALPAFSKECLY
FT                   YDLTDNEDSLVVSYQVLTGGNFEIDFEITSPDGTKIISEKQKKYSDFLLKSFGLGQYSF
FT                   CFTNSYGTALKKVEVVLELEKGNLGIPDENSSPQDAISNNAIEEIDRNLQKITKAMNYL
FT                   RAREWRNMYTVESTDSRLTWLSLLIMGLMVGISVLQAVVIQFFFKVRSKNYV"
FT   gene            complement(<108457..>109059)
FT                   /locus_tag="ZYRO0G01408g"
FT                   /old_locus_tag="ZYRO-ORF1798"
FT   CDS_pept        complement(108457..109059)
FT                   /locus_tag="ZYRO0G01408g"
FT                   /old_locus_tag="ZYRO-ORF1798"
FT                   /product="ZYRO0G01408p"
FT                   /note="weakly similar to uniprot|P18411 Saccharomyces
FT                   cerevisiae YAL008W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29132"
FT                   /db_xref="GOA:C5E1T9"
FT                   /db_xref="InterPro:IPR007014"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1T9"
FT                   /protein_id="CAR29132.1"
FT                   /translation="MRPFTAPRTLLNIFKTTSSRGISTTFRPTSTRATLSAFQLRPTKV
FT                   ATGLTLAASIGIGTPWVCKTIYNDAIVEVNSPASLHKGQELGLPSREPETTRARSRFNG
FT                   KLDYRQLCYGSILGVFLGVVVGKISSLLVFLGASAYLGLQFLQNRGVIDKGSTQRLLQG
FT                   FTVKTSRESIDLNTLVWERPSFKVSFLLTFILAAVNI"
FT   gene            complement(<109513..>111912)
FT                   /locus_tag="ZYRO0G01430g"
FT                   /old_locus_tag="ZYRO-ORF1796"
FT   CDS_pept        complement(109513..111912)
FT                   /locus_tag="ZYRO0G01430g"
FT                   /old_locus_tag="ZYRO-ORF1796"
FT                   /product="ZYRO0G01430p"
FT                   /note="similar to uniprot|P38903 Saccharomyces cerevisiae
FT                   YOR014W RTS1 B-type regulatory subunit of protein
FT                   phosphatase 2A (PP2A)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29133"
FT                   /db_xref="GOA:C5E1U0"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1U0"
FT                   /protein_id="CAR29133.1"
FT                   /translation="MMRGFKQKLIRKATGGSSSTNNKKKDKEKESSTSGGVSRSGSTSS
FT                   NSSSAQNTGIGGGSSNRSSLEKTRNPQGSSGSSSSSSKQHSSSSNSNKQKTSSSGSNGS
FT                   SSRGSNNNSRNATPVSSSSRTSGGGSTTPGPGTTSRSDNGSSTPTLTVTRDGSRQQQPN
FT                   ASPQTNSANGSQPTFIGATAAVPPSSPTGGGGGGGGGSPPVFASPLQSSAASMTGSAKD
FT                   LAGPQASPSSPTGIDIPRSSHSFERLPTPTKLNPDSELDLIKIPQRHSSSRFEPSRYTQ
FT                   LAKLPDFESVSPEETIPLFIAKVDQCNTMFDFNDPSFDIQGKEIKRTTLQELIEFIVTN
FT                   RFTYTHEMYAHVVAMFKVNLFRPIPPPVNPIGDVYDPDEDEPVNELAWPHMQLVYEFFL
FT                   RFVESPDFNHQIAKQYIDQDFIIKLLELFDSEDIRERDCLKTTLHRIYGKFLSLRSFIR
FT                   RSINNIFLQFTYETERFNGVAELLEILGSIINGFALPLKEEHKIFLVRVLIPLHKVRCL
FT                   SLYHPQLAYCIVQFLEKEPLLTEEVVMGLLRYWPKINSTKEIMFLNEIEDIFEVIEPLE
FT                   FIKVEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYFLNLCIENAEVILPIIFPALYELT
FT                   SQLEIDTANEEDGTSDPYMLVEQAINSGSWNRAIHAMAFKALKIFLETNPVLYENCNSL
FT                   YISSVKETQKRKQERQEEWHRLEEYVQKLRVSGNAPAKAPVGGVPFHSSTTTTTTTAAV
FT                   PTAILSSNNSTISSHDEGLKVTNPSRTKDFETTAAGAQLQYNQQQR"
FT   gene            complement(<112450..>113160)
FT                   /locus_tag="ZYRO0G01452g"
FT                   /old_locus_tag="ZYRO-ORF1792"
FT   CDS_pept        complement(112450..113160)
FT                   /locus_tag="ZYRO0G01452g"
FT                   /old_locus_tag="ZYRO-ORF1792"
FT                   /product="ZYRO0G01452p"
FT                   /note="similar to uniprot|Q04170 Saccharomyces cerevisiae
FT                   YDR391C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29134"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1U1"
FT                   /protein_id="CAR29134.1"
FT                   /translation="MSALTPPTHSIDLETGKHSRTVQPLDSLEELDQASKTLCRAFADS
FT                   SANDYLLRKFFKLSLDEPMSRCRLNAMLTYLIAWYHDLGGEVVQAKDFDAVGVWSSPGR
FT                   HLPHTYSDDPKFNEIFFERLDERKLEVLPAGMDYYYLFMIGKDPTQRNVRGSVRKILED
FT                   YKKRADEDNCACILEAINEHAKSVYEYFGYKVVQEFKFGEGEINEDGTLDPNGKGFTAY
FT                   LMIYYKAPELLKIN"
FT   gene            complement(<113623..>115341)
FT                   /locus_tag="ZYRO0G01474g"
FT                   /old_locus_tag="ZYRO-ORF1791"
FT   CDS_pept        complement(113623..115341)
FT                   /locus_tag="ZYRO0G01474g"
FT                   /old_locus_tag="ZYRO-ORF1791"
FT                   /product="ZYRO0G01474p"
FT                   /note="similar to uniprot|P32837 Saccharomyces cerevisiae
FT                   YDL210W UGA4 Permease that serves as a gamma-aminobutyrate
FT                   (GABA) transport protein involved in the utilization of
FT                   GABA as a nitrogen source catalyzes the transport of
FT                   putrescine and delta-aminolevulinic acid (ALA) localized to
FT                   the vacuolar membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29135"
FT                   /db_xref="GOA:C5E1U2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1U2"
FT                   /protein_id="CAR29135.1"
FT                   /translation="MSDSKSLRISPVPSLGKGDVQVYTSAGRIRSIRSRTGAGEVNYIN
FT                   AATSNDDNQLLAEIGYKPELERKFSTLQVFGIAFSIMGLLPSIASELDDGLAGGPVSTV
FT                   WGWFIAGIFIFLVGVTMAENSSAIPTAGGLYFWTYHYAPEGYKAAISFVIGIGNSLALA
FT                   AGVCSIDYGFAEEVLAAVVVSKDGNWDITQGKLYGVYAGCVILTIMVTCVASGWLAKMQ
FT                   SISIYSNLFIIVLFLIALPIGTKVNRGGFNDGSFIFGKFENLSDWSNGWQFFLAGFTPI
FT                   VWTISSFDSCVHQAEEAKDASKAVPIGIMGSIFVCWILGWVINIVLMACIDKDMNRVMN
FT                   SPYQLGMAQIIFDSLGKNWTIAFLALMAFCQFLMGASSMTAASRQIWAFARDDGMPLSN
FT                   ILKKVDSKFHVPFYASICSGLMSLVLGLLILIDDAAAEALFSLAIAGNYLAWVTPNFLR
FT                   LTWGRDVFRPGPFYLGKFWSPVVNWTTVVFMAFIIIMVMFPTQKNGINKENMNYACVIG
FT                   PGTWLLSLIYYWVYKKKEYHGPKSNLDDEEYADAVGPEVLDAILSTDYSTGYKAV"
FT   gene            <115840..>115939
FT                   /gene="SNR50"
FT                   /locus_tag="ZYRO0G01496r"
FT                   /old_locus_tag="Zyro0G_snoRNA_172"
FT   ncRNA           115840..115939
FT                   /gene="SNR50"
FT                   /locus_tag="ZYRO0G01496r"
FT                   /old_locus_tag="Zyro0G_snoRNA_172"
FT                   /product="snR50"
FT                   /note="C/D snoRNA monocistronic SNR50"
FT                   /ncRNA_class="snoRNA"
FT   gene            complement(<115965..>116783)
FT                   /locus_tag="ZYRO0G01518g"
FT                   /old_locus_tag="ZYRO-ORF1789"
FT   CDS_pept        complement(115965..116783)
FT                   /locus_tag="ZYRO0G01518g"
FT                   /old_locus_tag="ZYRO-ORF1789"
FT                   /product="ZYRO0G01518p"
FT                   /note="similar to uniprot|P18410 Saccharomyces cerevisiae
FT                   YAL009W SPO7 Integral nuclear/ER membrane protein of
FT                   unknown function required for normal nuclear envelope
FT                   morphology and sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29136"
FT                   /db_xref="GOA:C5E1U3"
FT                   /db_xref="InterPro:IPR005605"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1U3"
FT                   /protein_id="CAR29136.1"
FT                   /translation="MENLQSKLDETEANLEVSKKSTSTARSSRLNVSGSSISSQAGSER
FT                   KRSSSRTSSGKNVKSSSDITSASKIFRNLLILEDDLRHQAHRQKILKWEFTLFLSSLAG
FT                   VAGFAFYELYFTHDAITGFHRFILQFLLLFIAITVALFHLGGEYKRTIVIPRRFFTSTN
FT                   KGVRQFNVKLVKVHSTWNEQFTDYVRFVSRNVAFINIYMLTKTLRLSESNALVTFWRSV
FT                   TIRSQPRIGAVDVKLVLNPRAFSAEVREGWEIYRDEFWAREGARRRKTRL"
FT   gene            <117049..>118395
FT                   /locus_tag="ZYRO0G01540g"
FT                   /old_locus_tag="ZYRO-ORF1788"
FT   CDS_pept        117049..118395
FT                   /locus_tag="ZYRO0G01540g"
FT                   /old_locus_tag="ZYRO-ORF1788"
FT                   /product="ZYRO0G01540p"
FT                   /note="similar to uniprot|P18409 Saccharomyces cerevisiae
FT                   YAL010C MDM10 Subunit of the mitochondrial sorting and
FT                   assembly machinery (SAM complex) has a role in assembly of
FT                   the TOM complex which mediates protein import through the
FT                   outer membrane required for normal mitochondrial morphology
FT                   and inheritance"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29137"
FT                   /db_xref="GOA:C5E1U4"
FT                   /db_xref="InterPro:IPR027539"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E1U4"
FT                   /protein_id="CAR29137.1"
FT                   /translation="MLDYMDYVQRQFEKSTDWNYDNSYANILASSRNILDFPVPNQFKF
FT                   QLSNNSTPHTFNTMEVFSRKIFNGSMTYLYTDAENMDKLVHDSNSISLQDVTDTYRYVQ
FT                   PYYTHKPSSNGDNHVRSLYYGKMSYPSPNLEAMLIKRLNESTQLTLQCVSSFNGFNILT
FT                   GYWQHDTGRNRHEVIMSTNDLLCGYRYLHNFLGTPSKLKTSLYNNFSLSLGGEVWLGIV
FT                   TLSPGCSTTLRYCTHSPTTGRPQTLTLTWNPLFGHISSTYTAKTSSSSTFSTKYDFNLY
FT                   SIESNLSFGCEFWRRGYQESSPQLQEQINGHASEPKDRIMYYHMMAPDSRNSISPRANS
FT                   PQERQLLEDLTIAFSSSLKKIDKEKSMIEQFENRINQSNFTSVWKLSTSSKDKNLRLLW
FT                   EGKFKGFLLSAGTEFCKTNPRNEINEVPSTENKLTFYPNKFGIQLQYST"
FT   gene            complement(<118417..>120264)
FT                   /locus_tag="ZYRO0G01562g"
FT                   /old_locus_tag="ZYRO-ORF1787"
FT   CDS_pept        complement(118417..120264)
FT                   /locus_tag="ZYRO0G01562g"
FT                   /old_locus_tag="ZYRO-ORF1787"
FT                   /product="ZYRO0G01562p"
FT                   /note="some similarities with uniprot|P31376 Saccharomyces
FT                   cerevisiae YAL011W SWC3 Protein of unknown function
FT                   component of the Swr1p complex that incorporates Htz1p into
FT                   chromatin required for formation of nuclear- associated
FT                   array of smooth endoplasmic reticulum known as karmellae"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29138"
FT                   /db_xref="GOA:C5E1U5"
FT                   /db_xref="InterPro:IPR037651"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1U5"
FT                   /protein_id="CAR29138.1"
FT                   /translation="MPVILRSRHRPDSTPEETQRPAKTAGRRGKRSRRVDDEKDNSDSG
FT                   MSDSETGSYGKFNGNGRPFDIIAGLPCSLEVPQYNSALTHPLSVRDSAVLYDSLVISRR
FT                   TWVRGEMFELYFSKPARSIKEESNQNKQDAMSQAMTVQIRDKMQKMCDCNMMGGPHQFP
FT                   VRLFILKNEELEKRWQEEQDSKRKEKEERRKRDQEEKKRRVEEKKQSQLQKKQEKEKIM
FT                   QMHKENKARAKQEMEAMKLKRKEEVKKSKEEHKKYRKTGDSAPRTVVSPLRKTSPPPTN
FT                   QSVNDPKMIANLNLMAQKDSRLNTLMGTVANGEATLEQVEEFKKFIEVARKMPAPPGWS
FT                   PPPGLVQAKKDAPEPGVEKQQVREQEFKEEKMDNAIKVVVKEEEKKEEEKKEEAHNMVK
FT                   NEDNDTNASMAEPDKDKEPKRRRRPRGSVNEEEDKSMQLTAFQQKYVQDAQIIIEFTEY
FT                   THARYMLPRNAVLEYVEESNDYKLSWIMVHNKKEIDRYRNRRIKDMTKGKKTDEEKKAI
FT                   EEEYDVYGDEMCPSPLFTPMTVVFSGIHKKFNPIMVHSVEPLEKVQKEMSSILSVGTKL
FT                   SGYNLWYRLDGYDDKDLAESVRVDLTEHEYDLRGKRQKK"
FT   gene            <120582..>123848
FT                   /locus_tag="ZYRO0G01584g"
FT                   /old_locus_tag="ZYRO-ORF1784"
FT   CDS_pept        120582..123848
FT                   /locus_tag="ZYRO0G01584g"
FT                   /old_locus_tag="ZYRO-ORF1784"
FT                   /product="ZYRO0G01584p"
FT                   /note="similar to uniprot|Q08204 Saccharomyces cerevisiae
FT                   YOL034W SMC5 Structural maintenance of chromosomes (SMC)
FT                   protein interacts with Rhc18p and Nse1p to form a large
FT                   complex S. pombe homolog forms a heterodimer with S. pombe
FT                   Rad18p that is involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29139"
FT                   /db_xref="GOA:C5E1U6"
FT                   /db_xref="InterPro:IPR027131"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1U6"
FT                   /protein_id="CAR29139.1"
FT                   /translation="MASTTLNLAEYAEDGPASKKLKLGTVDYSPFHPGAIVKMRLENFV
FT                   TYTLTEFDLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKRVEDFIKNGEDRG
FT                   SIEITLKNSPKVEGMPGVDSEADTIKITRELIKSKSKSRYMINDRVVSEEDVRLLVSKL
FT                   NIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLLDVLELLKDLQAKEISSQRE
FT                   LDLNKQKYDELLVQKEKLSESVKAFKELESKKSELELHLQLLPYAKLKDHKEKLADYKR
FT                   DLDQAKANLKSLRKDKKPFSNAKQNLEERLEILSNKRDLKDKQLKEDQASYRRVEQELE
FT                   SIREEIEKKEQQIEYYRNRTKKLEETAAKTREELENKYKLLETIELPSQSVFDEITSQR
FT                   HDLILREANLNESILELDNRASGINHNMRHLEKQMDNRLNSLNSNDRIGVLDQNPDLKE
FT                   VKAAVLYIRSRPEMRGKVLEPPIMSVSVTNPAFARYLNHCVDYNTSKAFTIVDADSYEQ
FT                   FSDDVLKRFKVNLRELNDANVRPPLDRQVLRNAGFESYLSDFVTGDQNVIRMLCQICNL
FT                   HTVPVSRKELSSEQLSKLSKPAKNGEVLFRRIIHGNRVVDFRKSLYGSKQVFSVDSNIK
FT                   NTQFYNKSVMSEEQKTRINEEVAQLKSRHVGLRNDLDELSREKNDLKHQLNDNNLKNDM
FT                   IAQRAHSLNEIRKKHSLTKSNIESLEVKIRQITYESNKDVTQKIKDVEAEISTQLQKQT
FT                   RTLREMVSLVGKMNQHQRELADADIAELEAQNLNISMNDVLRSFIEREAELEEEYAAKK
FT                   RNAKEMRDTDEYREWKSQIQTYDEETKDKVNDRATNYEENHNFNVTYIQDIIDRLESEI
FT                   GMLNHDESSVTILSQVEKQLRGLQKTLPRQVEELNEIRNLLRENQHVLEPQLDAMISNI
FT                   STRFSKLFTSVGSAGTVHLEKPHLFAEWKIEIMVKFRDNAVLKKLDSHTQSGGERAVST
FT                   VLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENTSQYFLITPKLLTD
FT                   LYYHEKMRVHCVMAGPWIPDPMKRSDMINFGQTSNYVFYS"
FT   gene            complement(<123893..>127810)
FT                   /locus_tag="ZYRO0G01606g"
FT                   /old_locus_tag="ZYRO-ORF1781"
FT   CDS_pept        complement(123893..127810)
FT                   /locus_tag="ZYRO0G01606g"
FT                   /old_locus_tag="ZYRO-ORF1781"
FT                   /product="ZYRO0G01606p"
FT                   /note="similar to uniprot|Q01476 Saccharomyces cerevisiae
FT                   YOR124C UBP2 Ubiquitin-specific protease that removes
FT                   ubiquitin from ubiquitinated proteins cleaves at the C
FT                   terminus of ubiquitin fusions capable of cleaving
FT                   polyubiquitin and possesses isopeptidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29140"
FT                   /db_xref="GOA:C5E1U7"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR025305"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1U7"
FT                   /protein_id="CAR29140.1"
FT                   /translation="MLLKDESSEPAVGGSARGVASSSDLPPELVETEQIGETMSESEIS
FT                   EDPGKNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLS
FT                   NGILKSPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDV
FT                   TQQNVATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLT
FT                   FDSKDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDS
FT                   LDPTRIPTQPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFE
FT                   LHVEKDEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEA
FT                   VNRNPKVYRIFSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYID
FT                   RDIIRNYEAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVF
FT                   QIDSKEFDPHNLNDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADY
FT                   EPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALF
FT                   NFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFL
FT                   KLKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFS
FT                   ISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHA
FT                   QDRCVTPRKELAYLAFVPSGLGVEFELPNASQANANAPVEKENYVNIDSEPSPPPNDEP
FT                   LLIDLDDDSDPNNHSKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKA
FT                   DSGSSSNNSNKAVAMNTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPI
FT                   SLGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALD
FT                   LYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIY
FT                   MDRYSDTNNPVLINRKRETEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKS
FT                   DVLETQGIQIDNRTGLAQELDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSL
FT                   FAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLV
FT                   YVKQGHEQEIEPLKRVLEVTV"
FT   gene            <128396..>128968
FT                   /locus_tag="ZYRO0G01628g"
FT   CDS_pept        128396..128968
FT                   /locus_tag="ZYRO0G01628g"
FT                   /product="ZYRO0G01628p"
FT                   /note="highly similar to uniprot|Q06389 Saccharomyces
FT                   cerevisiae YDR373W FRQ1 N-myristoylated calcium-binding
FT                   protein that may have a role in intracellular signaling
FT                   through its regulation of the phosphatidylinositol 4-
FT                   kinase Pik1p member of the recoverin/frequenin branch of
FT                   the EF-hand superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29141"
FT                   /db_xref="GOA:C5E1U8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028846"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1U8"
FT                   /protein_id="CAR29141.1"
FT                   /translation="MGAKASKLSKDDLTSLRQSTYFDRREIQQWHKGFLRDCPSGQLTR
FT                   QDFVKIYKQFFPFGSPEEFANHLFSVFDKDNSGSVDFREFITVLSTTSRGTLEEKLVWT
FT                   FQLYDLNHDGFITFDEMLTIVTSIYKMMGSMVKLSDDEATPELRVRKIFKLMDKNEDGY
FT                   ITLDEFREGSRVDPSIISSLNLYDGLV"
FT   gene            complement(<129026..>129712)
FT                   /locus_tag="ZYRO0G01650g"
FT                   /old_locus_tag="ZYRO-ORF1777"
FT   CDS_pept        complement(129026..129712)
FT                   /locus_tag="ZYRO0G01650g"
FT                   /old_locus_tag="ZYRO-ORF1777"
FT                   /product="ZYRO0G01650p"
FT                   /note="highly similar to uniprot|P41735 Saccharomyces
FT                   cerevisiae YOR125C CAT5 Mitochondrial inner membrane
FT                   protein directly involved in ubiquinone biosynthesis
FT                   essential for several other metabolic pathways including
FT                   respiration and gluconeogenic gene activation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29142"
FT                   /db_xref="GOA:C5E1U9"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1U9"
FT                   /protein_id="CAR29142.1"
FT                   /translation="MLRTINPTTRRWFSVLSSLKNTAASEPVKEPVTAKAEPLSEAREA
FT                   YLERAVRVDQAGELGADYIYAGQYFVLANKYPHLKSVLQHMWDQEVHHHNTFNRWQTEN
FT                   RVRPSLITPLWKLGAFTMGAGTAAISSEAAMACTEAVETVIGGHYNQQLRCLANQYDLK
FT                   WTDGTNGPTKEIKSLTETIRQFRDDELEHLNTAIEHDSRKAVPYILLTEGIKGICRVAI
FT                   WTAERI"
FT   gene            complement(<129871..>130860)
FT                   /locus_tag="ZYRO0G01672g"
FT                   /old_locus_tag="ZYRO-ORF1776"
FT   CDS_pept        complement(129871..130860)
FT                   /locus_tag="ZYRO0G01672g"
FT                   /old_locus_tag="ZYRO-ORF1776"
FT                   /product="ZYRO0G01672p"
FT                   /note="some similarities with uniprot|Q06390 Saccharomyces
FT                   cerevisiae YDR374C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29143"
FT                   /db_xref="GOA:C5E1V0"
FT                   /db_xref="InterPro:IPR007275"
FT                   /db_xref="PDB:4U8T"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1V0"
FT                   /protein_id="CAR29143.1"
FT                   /translation="MDWYYVDRPVRTIEDSFKDLESIFKDKNNNDTPRIPLTDELYKPF
FT                   GDTNINLNSSISAENNNYVATPRLPLASATLEDSSAVCSPVQPVQSPLNTLQTLEAHAF
FT                   RSVVPKQIVSPQPQPQPPLQVDFQSQVHRAAAAATSVTSPIGGISTNANHSNWKPPQKK
FT                   SSAIIPPWIHVPDHSRFFVIKSSSLEHVKKSFYNGIWSSTFYGNKRLSEAYESLPQGAK
FT                   IYLLFSVNASGRFCGVAEMSSNLREDLDTSIWGDNSRYRHAFKVRWIVVRDVHNRSLKQ
FT                   FLIPANDMKPVTNSRDTQEIPATISKSILKLFKYEQSEVQSFLDDDYS"
FT   gene            <131064..>131285
FT                   /locus_tag="ZYRO0G01694g"
FT                   /old_locus_tag="ZYRO-ORF1775"
FT   CDS_pept        131064..131285
FT                   /locus_tag="ZYRO0G01694g"
FT                   /old_locus_tag="ZYRO-ORF1775"
FT                   /product="ZYRO0G01694p"
FT                   /note="similar to uniprot|Q2V2P8 Saccharomyces cerevisiae
FT                   YDR374W-A"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29144"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1V1"
FT                   /protein_id="CAR29144.1"
FT                   /translation="MGFDLGQYLLDQWRKRYEFVEEPSESERLILSSGFQEMLRKLLVE
FT                   AQSNAHRDGFNEVRPAHLEAALDELLDA"
FT   gene            complement(<131297..>132646)
FT                   /locus_tag="ZYRO0G01716g"
FT                   /old_locus_tag="ZYRO-ORF1774"
FT   CDS_pept        complement(131297..132646)
FT                   /locus_tag="ZYRO0G01716g"
FT                   /old_locus_tag="ZYRO-ORF1774"
FT                   /product="ZYRO0G01716p"
FT                   /note="highly similar to uniprot|P32839 Saccharomyces
FT                   cerevisiae YDR375C BCS1 Protein of the mitochondrial inner
FT                   membrane that functions as an ATP-dependent chaperone
FT                   required for the assembly of the cytochrome bc(1) complex
FT                   from the Rip1p and Qcr10p proteins member of the
FT                   CDC48/PAS1/SEC18 ATPase family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29145"
FT                   /db_xref="GOA:C5E1V2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014851"
FT                   /db_xref="InterPro:IPR027243"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1V2"
FT                   /protein_id="CAR29145.1"
FT                   /translation="MPETPAGPPSVENTSVASPVGSTSPNKSGPLGKFLDNVMENNPYF
FT                   AAGGGLMLLGTGLAVARSGVVRASRLLYRQMIVDLEIQSKDKSYSWFLQWMSNHPHRIS
FT                   KHLSVRTTYIQHDNGSASTKFALVPGPGNHWIRYKGAYIRIKRERSGKMIDITSGSPFE
FT                   IVTLTTLWRDRHLFNEILDEAKGIALKSTEGKTVIYTSFGPEWRKFGQPKAKRALPSVI
FT                   LDKGISGGIVEDIRDFMKNGKWYSDRGIPYRRGYLLYGPPGSGKTSFIQALAGELDYNI
FT                   CILNLSEGHLTDDRLNHLMNNMPERSLLLLEDIDAAFNTRKQSGENGFHSSVTFSGLLN
FT                   ALDGVTSSEEAITFMTTNHPEKLDPALMRPGRIDYKVYIGDATPYQVEKMFMKFYPGES
FT                   ELCKQFVDKIRNLDITVSTAHLQGLFVMNKDQPAKALHMADTLRNQNNFL"
FT   gene            complement(<132802..>133521)
FT                   /locus_tag="ZYRO0G01738g"
FT                   /old_locus_tag="ZYRO-ORF1773"
FT   CDS_pept        complement(132802..133521)
FT                   /locus_tag="ZYRO0G01738g"
FT                   /old_locus_tag="ZYRO-ORF1773"
FT                   /product="ZYRO0G01738p"
FT                   /note="similar to uniprot|P41734 Saccharomyces cerevisiae
FT                   YOR126C IAH1 Isoamyl acetate-hydrolyzing esterase required
FT                   in balance with alcohol acetyltransferase to maintain
FT                   optimal amounts of isoamyl acetate which is particularly
FT                   important in sake brewing"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29146"
FT                   /db_xref="GOA:C5E1V3"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1V3"
FT                   /protein_id="CAR29146.1"
FT                   /translation="MEYKKFLMFGDSITEFSFNTRPQPEENLGDQFALGAALTNDYSRK
FT                   LTVLQRGFAGYNSKWGLKILPKILEYEQNIVIGFIFFGSNDSCAGGPQRVPEDEYESNL
FT                   HKSVQMFKARSIKPILVGPAFYDSSKWEPSRQDEVRQGYARSNEGFIRYGKITASVASK
FT                   ENVPFLDLRAAMEREAGKNWTDFLVDGLHFNGKGYEVFYKELLQAISDHYPEYHPYNMA
FT                   ITPPYWKYVSEDESKLD"
FT   gene            <133707..>135182
FT                   /locus_tag="ZYRO0G01760g"
FT                   /old_locus_tag="ZYRO-ORF1772"
FT   CDS_pept        133707..135182
FT                   /locus_tag="ZYRO0G01760g"
FT                   /old_locus_tag="ZYRO-ORF1772"
FT                   /product="ZYRO0G01760p"
FT                   /note="similar to uniprot|P48360 Saccharomyces cerevisiae
FT                   YDR376W ARH1 Oxidoreductase of the mitochondrial inner
FT                   membrane involved in cytoplasmic and mitochondrial iron
FT                   homeostasis and required for activity of Fe-S cluster-
FT                   containing enzymes one of the few mitochondrial proteins
FT                   essential for viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29147"
FT                   /db_xref="GOA:C5E1V4"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1V4"
FT                   /protein_id="CAR29147.1"
FT                   /translation="MILDGLSLKFVRWASKRISVVGSGPSGFYTAYRLLNKSPDPIHVT
FT                   LWEKLPVPYGLSRYGVAPDHPEVKNCEDTFAECAETFNQGKDGRKFSFIGGVTIGSDEI
FT                   PLQQLLKQEDAVILAYGCQSSRALGIPGEDASGVFSSRDFVNWYNGHPGFANDKRFTEF
FT                   DWSQVHRVGIIGHGNVALDITRVLMTNRVDEIWQPTDISRVAIDKLKQAPIQEVKMIAR
FT                   RDFIHSKFTNRELRELWEMERFGVRGKIDQKYFHPTLFNDDQLKDRPFKRRVEMCQEYS
FT                   TPFDKRTKKNYKKHGPPPEERSHWVLDYLKTPLQTQTNDQGRVQSLQLCENELTPDNRV
FT                   KQLPNSELNYNVDLLITSLGYKGQPMSEFKPLAVKWLGDRIANDRGRVLTTENEPIERL
FT                   YAAGWIRRGSQGVIATTMEDSFQVADQVLHDLQNQQNLERIPPVDLSNIRHTTWQDWEK
FT                   INQSELNKGKQMGRVRSKYLTEPEIYNYLSMNH"
FT   gene            <135357..>135668
FT                   /locus_tag="ZYRO0G01782g"
FT                   /old_locus_tag="ZYRO-ORF1771"
FT   CDS_pept        135357..135668
FT                   /locus_tag="ZYRO0G01782g"
FT                   /old_locus_tag="ZYRO-ORF1771"
FT                   /product="ZYRO0G01782p"
FT                   /note="highly similar to uniprot|Q06405 Saccharomyces
FT                   cerevisiae YDR377W ATP17 Subunit f of the F0 sector of
FT                   mitochondrial F1F0 ATP synthase which is a large
FT                   evolutionarily conserved enzyme complex required for ATP
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29148"
FT                   /db_xref="GOA:C5E1V5"
FT                   /db_xref="InterPro:IPR019727"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1V5"
FT                   /protein_id="CAR29148.1"
FT                   /translation="MNPIARRSLSTLIPPKVVSSQNIGSAPNAKRIGNVVQFYKSLPQG
FT                   PAPAIKPTGLISKYKAKYFDGDNASGKPLWHLAVSILVMGYSLEYYFHLRHSKNGEHH"
FT   gene            complement(<135737..>136084)
FT                   /locus_tag="ZYRO0G01804g"
FT                   /old_locus_tag="ZYRO-ORF1770"
FT   CDS_pept        complement(135737..136084)
FT                   /locus_tag="ZYRO0G01804g"
FT                   /old_locus_tag="ZYRO-ORF1770"
FT                   /product="ZYRO0G01804p"
FT                   /note="some similarities with uniprot|Q06406 Saccharomyces
FT                   cerevisiae YDR378C LSM6 Component of small nuclear
FT                   ribonucleoprotein complexes involved in RNA processing
FT                   splicing and decay"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29149"
FT                   /db_xref="GOA:C5E1V6"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1V6"
FT                   /protein_id="CAR29149.1"
FT                   /translation="MVDVCMYVCMYTRGIGLTWSVDSTPIYKGDWSIIVTMAKIDSSQF
FT                   LSTIIGQNVHVKLHSGMLYRGRLESIDGFMNVALSSAKEHYETGENGLLRTYPTDVFLR
FT                   GTQVMYISEVK"
FT   gene            <136404..>139541
FT                   /locus_tag="ZYRO0G01826g"
FT                   /old_locus_tag="ZYRO-ORF1769"
FT   CDS_pept        136404..139541
FT                   /locus_tag="ZYRO0G01826g"
FT                   /old_locus_tag="ZYRO-ORF1769"
FT                   /product="ZYRO0G01826p"
FT                   /note="similar to gnl|GLV|KLLA0B13794g Kluyveromyces lactis
FT                   KLLA0B13794g gi|28565040|gb|AAO32603.1 Kluyveromyces lactis
FT                   MNN4 hypothetical start
FT                   KLLA0B13794g|KLLA-IPF6938|KLLA-CDS0444.1 and weakly similar
FT                   to YKL201C uniprot|P36044 Saccharomyces cerevisiae YKL201C
FT                   MNN4 Putative positive regulator of mannosylphosphate
FT                   transferase (Mnn6p) involved in mannosylphosphorylation of
FT                   N-linked oligosaccharides expression increases in
FT                   late-logarithmic and stationary growth phases"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29150"
FT                   /db_xref="GOA:C5E1V7"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="InterPro:IPR009644"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1V7"
FT                   /protein_id="CAR29150.1"
FT                   /translation="MGALAHNLKHIHTAPKRLTPPYIVLYRLAAAYSVPFNGGYFLTLS
FT                   YSVFWLALIPFSWFASAPTTVRKGVTACSSAGRKLQPGYRILFTVYKDPENPKPKRGTH
FT                   RTRTSIQPISNKLLQYCRDTQPLLYSTMTLLAKGGLRWVNSHKSLIQRVLLFSVIVFII
FT                   VKQASFSSSEDAEVPLIIGSAGSKLDQARALYRKFKFDTSMIWPDVYTLKGSLLTPSFG
FT                   AKKGQQLESIDDLHYYDSDPRLVWTVYLDHAMNTAMTYQHEAHADITNEEPLPEMPFSW
FT                   YDWIDHHDFDKLIAAVHDGGVELGCAFFYEKAFNSDKLDELEASVGDYLFSYQRVKYYD
FT                   AEWYRKIRNEKAAPENIPEGQCKSVNGPVKFNLPIQVHELHEDVRPEVYQMQARSYLIT
FT                   KLNNPLSLTVLEGARSAYRFPLRSQRSNLIESRLLDTYLSRHMTRADKNSDYKFDHLQT
FT                   FHDFLLSDAAFRSKVVIPDAQRTQEDESAIPLKPSDFEFDVRAKIKELEKLKDDKKISP
FT                   HEEQYLESLKVSISYHPALQPKYLSEAAHISQFAGMGYHRDKRFFNGGLVEEYQEYQAR
FT                   LNSLIRTWLKFTRVNGLLTWVAHGSLYGYLYNGKNFPWDNDYDVQMPIRHLHLLSQYFN
FT                   QSLILEDPREGNGKYLVDVGTSITVRTNGNGQNNIDARFIDVDSGLYVDITGISVSSNP
FT                   QRENFKDWYEEKKKGINLEQGMKDFDFPEKGDGYASMNITALSQYAKEHEEEFNNEQKD
FT                   WIKNVDKGERDHFKMRTAPQKGLTPEQRYYMNREVGAYNCRNNHFITMDFASPLVKTIY
FT                   HGVEALVPYKVIYDLRKEYYVPENLGFTVYQGNVYVPELRSWFNLSILKRFANINSWNA
FT                   NLREIKSPVHDLKQEDMDPLFENMHNIGYTDLFSLYYTSYNVSAYRLKELEIQYDTTLN
FT                   KIEKEDVLEILRHNIAPNMSSPVKDATLYVYEKRLWEGMTQKLTRNEINKVTDQVSYEV
FT                   YKDLTAAATAFYEKKSSLFVTTDEAGEIYDYNRIGIPIPKDNKLFEKDYSDDRRKK"
FT   gene            complement(<139724..>140968)
FT                   /locus_tag="ZYRO0G01848g"
FT                   /old_locus_tag="ZYRO-ORF1768"
FT   CDS_pept        complement(139724..140968)
FT                   /locus_tag="ZYRO0G01848g"
FT                   /old_locus_tag="ZYRO-ORF1768"
FT                   /product="ZYRO0G01848p"
FT                   /note="similar to uniprot|P40354 Saccharomyces cerevisiae
FT                   YJR062C NTA1 Amidase removes the amide group from N-
FT                   terminal asparagine and glutamine residues to generate
FT                   proteins with N-terminal aspartate and glutamate residues
FT                   that are targets of ubiquitin-mediated degradation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29151"
FT                   /db_xref="GOA:C5E1V8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="InterPro:IPR039703"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1V8"
FT                   /protein_id="CAR29151.1"
FT                   /translation="MSSLVKSNLAVNLKIAIVQLNSQIGQIQPAVGRTWELLKKFNNRV
FT                   SSTPKKPDIIIFPEFALTGYNFHSRDQILPYCCVPNKGPSYELACKVSSMFQCYTVIGY
FT                   PERTAAGDKLYNSAIVINPQGELVFNYRKSFLYQTDEEWDCLENPQGFQTFPLSFKDIA
FT                   RDQQGNVQDVTLKTSIGICMDLSPYKFKAPFHDYEFATYNVDQGTELIICPMAWLHSTS
FT                   AIAGDDNETELQASMDNIAKNCTRENIPTVGTQGEFDIDIDGHETPRLPREDEDDRNLF
FT                   RELNKPDMCNVNYWLLRFLPFLGLKERSEWSVAALAKLIVRGRLLRSSYIGAALDNYWS
FT                   FKNKNAVLAIANRCGIEEGKTVFAGSSGIYKFNGQEYENHDSLDSTNFSVELKGNLGKG
FT                   NEGIIYREVNFQVSR"
FT   gene            <141118..>141489
FT                   /locus_tag="ZYRO0G01870g"
FT                   /old_locus_tag="ZYRO-ORF1766"
FT   CDS_pept        141118..141489
FT                   /locus_tag="ZYRO0G01870g"
FT                   /old_locus_tag="ZYRO-ORF1766"
FT                   /product="ZYRO0G01870p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29152"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1V9"
FT                   /protein_id="CAR29152.1"
FT                   /translation="MIPFEEGYNRRNGIQEPDWNVIEPDMWAQQAKSGSEPRIQKSTEE
FT                   SMGSNNSTTSTAPIDPPGSTGSTGSTGPSDPPAYVPLHDPRNQLSSLVKNAQNNEEALQ
FT                   QRNQRVKQSKMRSRKEFGW"
FT   gene            <141651..>142028
FT                   /locus_tag="ZYRO0G01892g"
FT                   /old_locus_tag="ZYRO-ORF1765"
FT   CDS_pept        141651..142028
FT                   /locus_tag="ZYRO0G01892g"
FT                   /old_locus_tag="ZYRO-ORF1765"
FT                   /product="ZYRO0G01892p"
FT                   /note="highly similar to uniprot|P32529 Saccharomyces
FT                   cerevisiae YJR063W RPA12 RNA polymerase I subunit A12.2
FT                   contains two zinc binding domains and the N terminal domain
FT                   is responsible for anchoring to the RNA pol I complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29153"
FT                   /db_xref="GOA:C5E1W0"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR034004"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W0"
FT                   /protein_id="CAR29153.1"
FT                   /translation="MSVVGSLIFCLDCGDLLDNPSAVQGSEIECQQCQARYPKSKFSNL
FT                   KVVTSTADDAFPSSLKMKQSVVKTSIGRDDLGEGATIKEKCPKCGHDEMHYHTLQLRSA
FT                   DEGATVFYTCTSCGYKYRTNN"
FT   gene            <142245..>143924
FT                   /locus_tag="ZYRO0G01914g"
FT                   /old_locus_tag="ZYRO-ORF1764"
FT   CDS_pept        142245..143924
FT                   /locus_tag="ZYRO0G01914g"
FT                   /old_locus_tag="ZYRO-ORF1764"
FT                   /product="ZYRO0G01914p"
FT                   /note="highly similar to uniprot|P40413 Saccharomyces
FT                   cerevisiae YJR064W CCT5 Subunit of the cytosolic chaperonin
FT                   Cct ring complex related to Tcp1p required for the assembly
FT                   of actin and tubulins in vivo"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29154"
FT                   /db_xref="GOA:C5E1W1"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W1"
FT                   /protein_id="CAR29154.1"
FT                   /translation="MAAVPQAMEMPDMSNAIVAQDEMGRPFIIVRDQGNKKRQHGLEAK
FT                   KSHILAARSVSSIIKSSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQ
FT                   LSKSQDDEIGDGTTGVVVLASALLDQALELIEKGIHPIKIANGFEEAAKLAVQELEAKS
FT                   DDVIKEQKLFKDYLFEAAKTSLGSKIVSKDLDRFAQIAVNAVTSVMDEDRKDVDFELIK
FT                   LEGRVGGSLKDSKLINGVILDKDFSHPQMPKVVLPREGEDGVKLAILTCPFEPPKPKTK
FT                   HKLDISSVEEYQKLQDYEQQKFKEMIDHVKKAGADVVICQWGFDDEANHLLLQNNLPAV
FT                   RWVGGQELEQIAIATHGRIVPRFQDLSADKLGTCSKIYEMEFGTTKDRMLVVEKCKDAK
FT                   TVTCFIRGSNKMIVDEAKRALHDALCVVRNLVKDSRVVYGGGAAEVSMSLSVSEEADKQ
FT                   RGIDQYAFRAFAQALDTVPMVLAENSGLDPIETLTTLKSKQLKEQTSIIGVDCLGKGTN
FT                   DMRELFVVDPFIGKKQQILLASQLCRMILKIDNVIISGKDEY"
FT   gene            complement(<144085..>145470)
FT                   /locus_tag="ZYRO0G01936g"
FT                   /old_locus_tag="ZYRO-ORF1763"
FT   CDS_pept        complement(144085..145470)
FT                   /locus_tag="ZYRO0G01936g"
FT                   /old_locus_tag="ZYRO-ORF1763"
FT                   /product="ZYRO0G01936p"
FT                   /note="highly similar to uniprot|P47117 Saccharomyces
FT                   cerevisiae YJR065C ARP3 Essential component of the Arp2/3
FT                   complex which is a highly conserved actin nucleation center
FT                   required for the motility and integrity of actin patches
FT                   involved in endocytosis and membrane growth and polarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29155"
FT                   /db_xref="GOA:C5E1W2"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W2"
FT                   /protein_id="CAR29155.1"
FT                   /translation="MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWIFPTAIANAASSNAK
FT                   NTASSSSTGGAGLAASSTGGSSAASNPYFTNATSTTNFGNLTTASLMSNNLSGKRGTED
FT                   LDFYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLT
FT                   EPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGD
FT                   GVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLLRERGEVDTSLRTAERIKQEYCYV
FT                   CPDIVKEFNKFDRDAEKFAQYVVENQDKTRQKVVDIGYERFLAPEIFFNPEIASSDFLT
FT                   PLPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERL
FT                   SGARSTGVDVQVISHRKQRNAVWFGGSLLAQTPEFKGYCHTKKDYEEYGPEIVRNFSLF
FT                   NMV"
FT   gene            <146015..>153403
FT                   /locus_tag="ZYRO0G01958g"
FT                   /old_locus_tag="ZYRO-ORF1761"
FT   CDS_pept        146015..153403
FT                   /locus_tag="ZYRO0G01958g"
FT                   /old_locus_tag="ZYRO-ORF1761"
FT                   /product="ZYRO0G01958p"
FT                   /note="highly similar to uniprot|P32600 Saccharomyces
FT                   cerevisiae YKL203C TOR2 putative
FT                   protein/phosphatidylinositol kinase involved in signaling
FT                   activation of translation initiation distribution of the
FT                   actin cytoskeleton and meiosis phosphatidylinositol kinase
FT                   homolg"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29156"
FT                   /db_xref="GOA:C5E1W3"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR009076"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR024585"
FT                   /db_xref="InterPro:IPR026683"
FT                   /db_xref="InterPro:IPR036738"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W3"
FT                   /protein_id="CAR29156.1"
FT                   /translation="MLSLRRKAGGHHHTRKKLTSSSRSADDISTTSAHDGGGIVTADGT
FT                   RVTNGSGSDVKNYVDNEASIAIVDSNFSTFNLIFDKLRSPIPQERIAASYELKTSLISL
FT                   VREVSVEQFQRFSNKINNKIFELIHGSDPDEKIGGILAVDTLIGFYAHTEELPNQTSRL
FT                   ANYLRVLIPSNDIEVMRLAANTLGKLAVPGGTLTSDFVEFEVKTCIEWLTTSPENSSSS
FT                   SKQEYRKHASLLIITALANNSPYLLYPYVNSVLDNIWRALRDTKLVIGMDAAVTLGKCL
FT                   SIIQDRDAPLTKQWVQRLFKGCVYGLTLNTNESIHATLLVYRELLTLKGFYLDGKYDEI
FT                   YQSTMTYKDHKYDVIRKEVYAILPLLASFDPQLFANKYLDQTMVHYLTILNNMSTSAAN
FT                   HSDKSAILVSIGDIAYEVGSNIMPYMDPILDNIRDGLQTKFKNRKKFEKELFYCIGKLA
FT                   CAVGAALSKHLNRGLLSLMLLCPLSDYMQETLLIINEKIPALEPTINSSLLDLLCTSLS
FT                   GDKFKQPGSPMSLKSLSIERARQWRNQSILRKTGEVNDDTNDAQILTQALRMLHTINHK
FT                   SSLTEFVRLVVILYIEHENPHVRKLAALTSCDLFVKDNICKQTSLHALNSVSEVLSKLL
FT                   TVAITDPIADIRFEILQHLDSSFDPQLAQPDNMRLLFMALNDEIFAIEMEAIRIIGRLT
FT                   TVNPAYVVPSLRKTLLELLTELRYSNMPRKKEESATLLCALISSSREVTKPYIEPILDV
FT                   LLPKSKDGSSAVASTALKAVGELSVVGGEDMKQYLSELMPLIINTFQDQSNSFKRDAAL
FT                   KTLGQLSASSGYVIDPLLDYPELLGVLINILKSESAQNIRRETVRLIGILGALDPYKHR
FT                   EVEVTSNAKISVEQNAPSIDIALLMQGMSPSNEEYYPTVVINTLMKILRDSSLSSHHTA
FT                   VIQAIMHIFQTLGLRCVQFLGQIIPGIITVMHSCPPSLLEFYFQQLGLLVSIVKQHIRT
FT                   HVDEMYEVIEEFFPITKLQITIISVIESISKALEGEFKRFVPNTLTFFLNVLENDKSNK
FT                   KAVSIRILKSLVVFDSNLEDYAHLIIPTVVRMAEYSPGTLRMMAVVTLGKLAKSINLSQ
FT                   MSSRIVQALVRVLNTEDRELVRATMNTLSLLLLQLGADFTVFIPIINKTLVKNHIQHSI
FT                   YDQLVNKLLNNEGLPTNILSDREFDNNKREPTEAESAAKKLPVNQLVLKNTWDCSQQRT
FT                   KEDWQEWIRRLSIQLLKESPSHALRACSGLAGIYYPLARELFNASFASCWTELYTQYQE
FT                   DLIQSLCSALSSPQNPPEIHQTLLNLVEFMEHDDKPLPIPIQTLGKYAQRCHAYAKALH
FT                   YKEVEFIQEPSTSTIESLISINNQLHQTDAAIGILKHAQRHHDLQLKETWYEKLQRWED
FT                   ALTAYNQRENAGEDSLEVTMGKMRSLHALGEWEQLADLSSEKWSISKPDVRNVMAPLAA
FT                   GAAWGLGQWDKIEQYISVMKPQSPNKEFFDAVLSLHKNNFDEAEKHIFNARDLLVTEIS
FT                   ALINESYNRAYSVVVRSQIIAELEEIIKYKQLPLNSEKRIMIRNTWNKRLLGCQKNVDV
FT                   WQRVLRVRSLVVKPKQDMQVWIKFANLCRKSGRMGLAQKALNSLLEEGGDPEHPNTARA
FT                   PPPVVYAQLKYLWATGSQKEALRHLIGFTSRMAHDLGLDPSNMIAQSVPQNSIIAPHHV
FT                   EDYTKLLARCFLKQGEWRISLQSNWRMENPDAILGSYLLATHFDDNWYKAWHNWALANF
FT                   EVISMITSGSKDKSINGLRPSTNGVYKIENGMMGSDTFTPEGNSYPIELIQRHVVPAIK
FT                   GFFHSISLSEASSLQDTLRLLTLWFTFGGIPEAAQAMHEGFSMIKIGYWLEVLPQLIAR
FT                   IHQPDKVVSRSLLSLLSDFGKAHPQALVYPLTVAIKSESVSRQKAALSIIEKMRMHSPV
FT                   LVDQAELVSHELIRVAVLWHELWYEGLEDASRQFFGEHNTEKMFATLEPLHEMLKRGPE
FT                   TLREISFQNLFGRDLNDAYEWVLNFKRKKDVSNLNQAWDIYYNVFRRISRQLPQLQTLE
FT                   LQHVSPKLLMARDLELAVPGTYAAGKKIIRISRFEPVFSVISSKQRPRKFSIKGSDGKD
FT                   YQYVLKGHEDIRQDSLVMQLFGLVNTLLQNDSECFQRHLDIQQYPAIPLSPKSGLLGWV
FT                   PNSDTFHVLIREHREAKKIPLNIEHWVMLQMAPDYDNLTLLQKVEVFTYALDNTRGQDL
FT                   YKVLWLKSRSSESWLERRTTYTRSLAVMSMVGYILGLGDRHPSNLMLDRNTGKVIHIDF
FT                   GDCFEAAILREKFPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMRVLRANNESLMAI
FT                   LEAFAFDPLIHWGFDLPTQTIMERTDIQMPLTNTSELLRKDVITVEEAAKMEIEQKNEI
FT                   RNARAMLVLRRITDKLTGNDFRRFQELNVPEQVDKLIQQATSVENLCQHYIGWCPFW"
FT   gene            complement(<153430..>153876)
FT                   /locus_tag="ZYRO0G01980g"
FT                   /old_locus_tag="ZYRO-ORF1758"
FT   CDS_pept        complement(153430..153876)
FT                   /locus_tag="ZYRO0G01980g"
FT                   /old_locus_tag="ZYRO-ORF1758"
FT                   /product="ZYRO0G01980p"
FT                   /note="similar to uniprot|P47118 Saccharomyces cerevisiae
FT                   YJR067C YAE1 Essential protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29157"
FT                   /db_xref="GOA:C5DZ73"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="InterPro:IPR038881"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ73"
FT                   /protein_id="CAR29157.1"
FT                   /translation="MSNSLDDVWGSDSDDDGSVVQESPDFKKLRDIHFKRGYVDGISGS
FT                   KEAKLQEGFDTAFPLGSRLGMEVGRLIGILQFLDFKYGKDDEELHGDFQLAQKELKIDR
FT                   VLIKSMFDSDLNLMGEHQVISKWRRIVKVHCNKYAASISSTIGN"
FT   gene            <154079..>155137
FT                   /locus_tag="ZYRO0G02002g"
FT                   /old_locus_tag="ZYRO-ORF1756"
FT   CDS_pept        154079..155137
FT                   /locus_tag="ZYRO0G02002g"
FT                   /old_locus_tag="ZYRO-ORF1756"
FT                   /product="ZYRO0G02002p"
FT                   /note="highly similar to uniprot|P40348 Saccharomyces
FT                   cerevisiae YJR068W RFC2 Subunit of heteropentameric
FT                   Replication factor C (RF-C) which is a DNA binding protein
FT                   and ATPase that acts as a clamp loader of the proliferating
FT                   cell nuclear antigen (PCNA) processivity factor for DNA
FT                   polymerases delta and epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29158"
FT                   /db_xref="GOA:C5DZ74"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ74"
FT                   /protein_id="CAR29158.1"
FT                   /translation="MFEGFGANKRRKVNIEEEPEHTKPWVEKYRPKKLDDVSAQDHTIS
FT                   VLKKTLTSANLPHMLFYGPPGTGKTSTIFALTRELYGPELSKTRVLELNASDERGIAIV
FT                   REKVKNFARLTVSKPSKEALEKYPCPPYKIIILDEADSMTADAQSALRRTMENHSNVTR
FT                   FCLICNYVTRIIDPLASRCSKFRFKSLDESNAIGRLKEISQLENVPHEEGALQRILEIS
FT                   NGDMRRAITLLQSAAKRLGFGELDKITSQEVEELAGLVPTHILQEMLNKVSQGNVNEII
FT                   EYVNEFVKNGWSAVSVVNQLHDYYITSNDYGTDFKNKISLLLFDADAKLANGTNEHLQL
FT                   LNLLVQISQVPT"
FT   gene            complement(<155297..>157360)
FT                   /locus_tag="ZYRO0G02024g"
FT                   /old_locus_tag="ZYRO-ORF1755"
FT   CDS_pept        complement(155297..157360)
FT                   /locus_tag="ZYRO0G02024g"
FT                   /old_locus_tag="ZYRO-ORF1755"
FT                   /product="ZYRO0G02024p"
FT                   /note="weakly similar to uniprot|P36041 Saccharomyces
FT                   cerevisiae YKL204W EAP1 eIF4E-associated protein binds
FT                   eIF4E and inhibits cap-dependent translation also functions
FT                   independently of eIF4E to maintain genetic stability plays
FT                   a role in cell growth implicated in the TOR signaling
FT                   cascade"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29159"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ75"
FT                   /protein_id="CAR29159.1"
FT                   /translation="MDDPVVAASAGSETETIGTDMQNPQRSSADEIAKFFDDIRSRQGI
FT                   FNGQQSQQVTDGIDFSADENVKAAAEQYNCDYKPPITLNKQNVYSINELISISKQLPEG
FT                   LVEEIVFTLPKKKFWRLNHKQPDHANQGKPMGHRGSNKGLNGSSNGKGFSGEDTNSLFE
FT                   KKGNKGKYSRMANGKKNGKFVKHERSGFMEEKDINVNHDDLQALEEEFEPTGNSMADFE
FT                   SWKAKMKEMERRKKGLPPAESSGNSKPSLSATSSSISDFLGLNKIQNDTATNPAQPESI
FT                   ETEKSLDDEINNLNKDLHSDSGKGSYSRFSSFFTQSSSSSSLPTMRNSHDPENLANKNS
FT                   HSNIGESTPNSRNPSVPGGSKLLSFFNKEAGTPKGSRNQASLNTEDVRQKPINSSVVPP
FT                   SQPHGQVPPQPPIRLPEQQLQHRQHQQHHQQLQQQQQQQQQRVMPPPVIAPDQLQTNNA
FT                   FFQNLLSKGELQNQKGTGPSGPPPGVMLPPPGGQSGIPLGQQPPRVSAQGGQPPAGMGM
FT                   SAPFPMGMPPGPGAFPPGLAPGGQAGMPLGLQPPGTGSPAGKPRGSGGQPPMNDNHSNG
FT                   AKGARNAGGANSRESGSRMQQTQQPPPPLQPGMVPPQFIPGMAPPGFPMMPPNFNPMYG
FT                   PPQGGLMPPPAGQGFFPPMPPPSGNMNFNAFPMQPPVFNQQHQEANSTESKK"
FT   gene            complement(<157899..>161087)
FT                   /locus_tag="ZYRO0G02046g"
FT                   /old_locus_tag="ZYRO-ORF1752"
FT   CDS_pept        complement(157899..161087)
FT                   /locus_tag="ZYRO0G02046g"
FT                   /old_locus_tag="ZYRO-ORF1752"
FT                   /product="ZYRO0G02046p"
FT                   /note="similar to uniprot|P33418 Saccharomyces cerevisiae
FT                   YKL205W LOS1 Nuclear pore protein involved in nuclear
FT                   export of pre-tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29160"
FT                   /db_xref="GOA:C5DZ76"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040017"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ76"
FT                   /protein_id="CAR29160.1"
FT                   /translation="MINRIQEVVAIANSPTTDAVTKKQALDFLTQIKSEPNAVQVFAPL
FT                   LSDSQSDDVTKFVALQVLADLAQQQTSDLQFIRTTAVELLRHKVVNGIRDPEYVKNKIA
FT                   EVLTNLFYSMYGEINGNQWSTFFTDMVEILSIRQLCNDSTKEFIPLGLDYFLRICLAVN
FT                   SSIGDQTFVRSKDVQVKNNSLKDTMRIQDVQTLVTVWLNTLKSIVPQEQSDLAVLTLSC
FT                   VGSYISWIDVQLIVNPLYITVIYGYLDFAETKVACSQCLCEVISKKMKPLDKLSLLGML
FT                   SLTDKVTSVGNDELEVYEQLAKLSSSMGFELAKVIEQCNENDSTPEVQQVATAADNQII
FT                   EQVAPLVLKFMEHEYDSVTQQCFLFVSQYLSVLKKQFALGGKPGSAIAVNSKRLPIDPP
FT                   HEMFLTSLLLAGFKKMRIDESCDEDSEDEIDEFFDTIRSKLKVFQDSVAMINPALYLQN
FT                   ISNHIQECLSKVDWRDLELGIYQMHNLSESIRNNLFGIGKQEIANSEATMVMTKFMSVL
FT                   LQNSSVFQMESPYVQVLFFELVVRHYQFLGSDEKDELALLNIFCSPFGMFNKREKVRLR
FT                   TWYLFTRLIKTTRLKLTTPVLSQILIKISPLLGIRAIPPNPDGTDYDTTFDNQLYLFEG
FT                   VGFLIGGNSDCNYDIIDEILSPLFAGLETCISSQLQSPDIVLQSHHLLMAIGTLARGVH
FT                   GGLVPDNQVNNALVSKKLIHKSLIEKFSNIAEVVLVSFSYFNKHENVRDASRFTFSRLI
FT                   PILNSDIVSFASKLIALFLESELSTVEMCDFLGFLGQMIHMFHTDNGCYELFDNLLTPV
FT                   IDKVHAIIDRIDQESALETESWYNGSTPAVTNPEAAGGTRDNNGKNVVVTDSFRDKIQL
FT                   KKAYYGFLQSFISNSITSLLLTDRNRVTLSTILMDLLVFIPQEIQETSTIKLALNVLTN
FT                   FVKCFGSGKCTDPNDMHASDIGSLEGLNEFFITKIVPLVFEIPFKPDYKFNIRDGSCRV
FT                   VACDLSRLLKELYIQCGGGTDPMANPSLKYMGQVYFPQIQFPSDMGLELIQALALADSK
FT                   DFEKYYVNLINNLT"
FT   gene            complement(<161725..>162303)
FT                   /locus_tag="ZYRO0G02068g"
FT                   /old_locus_tag="ZYRO-ORF1751"
FT   CDS_pept        complement(161725..162303)
FT                   /locus_tag="ZYRO0G02068g"
FT                   /old_locus_tag="ZYRO-ORF1751"
FT                   /product="ZYRO0G02068p"
FT                   /note="highly similar to uniprot|P47119 Saccharomyces
FT                   cerevisiae YJR069C HAM1 Protein of unknown function that is
FT                   involved in DNA repair mutant is sensitive to the base
FT                   analog 6-N-hydroxylaminopurine while gene disruption does
FT                   not increase the rate of spontaneous mutagenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29161"
FT                   /db_xref="GOA:C5DZ77"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR027502"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ77"
FT                   /protein_id="CAR29161.1"
FT                   /translation="MVDIVFVTGNANKLKEVQMLLAPEEGVPPPFTLTNNPLDLLEVQD
FT                   ASLEAIGIAKCKQAVQELGKGQAVFVEDTALRFDEFNGLPGAYIKWFLKSMGLDKIVKL
FT                   LEPFSNKGAEAVTTIVYADEQGQFHTFQGITRGNIVPSRGPTTFGWDSIFEPLESNGKT
FT                   YAEMEKTEKNLISHRGKAFQDFKKFLYAQ"
FT   gene            complement(<162473..>163441)
FT                   /locus_tag="ZYRO0G02090g"
FT                   /old_locus_tag="ZYRO-ORF1749"
FT   CDS_pept        complement(162473..163441)
FT                   /locus_tag="ZYRO0G02090g"
FT                   /old_locus_tag="ZYRO-ORF1749"
FT                   /product="ZYRO0G02090p"
FT                   /note="highly similar to uniprot|P47120 Saccharomyces
FT                   cerevisiae YJR070C LIA1 Protein that binds to the C-
FT                   terminal domain of Hyp2p (eIF5A) has four to five HEAT-
FT                   like repeats"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29162"
FT                   /db_xref="GOA:C5DZ78"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027517"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ78"
FT                   /protein_id="CAR29162.1"
FT                   /translation="MSTDFERRLEEQVDDCSLEQLRDILVNKSGQTQLTNRFRALFNLK
FT                   CAAEEFESKPEDASKAAKYIAEAFNDDSELLKHEVAYVLGQTKNFECVPYLKDCVLNLN
FT                   QQCMVRHEAAEALGALGDQSSLDVLEKVQKEDPSLEVRETCELAIDRIKWQHSEAGAKE
FT                   RLQPSLYSSIDPAPPLALEQNYDIPELQKLLNDKKKPLFERYRAMFRLRDFGTDEAALA
FT                   LATGFDDDSALFKHEIAYVFGQMGNTCIVPKLIEVLGRRNEEPMVRHEAAEALGSIASD
FT                   DVVPVLKGYLNDEVAVVRESAHVALDMYEYENSNELEYAPA"
FT   gene            <163931..>164776
FT                   /locus_tag="ZYRO0G02112g"
FT                   /old_locus_tag="ZYRO-ORF1748"
FT   CDS_pept        163931..164776
FT                   /locus_tag="ZYRO0G02112g"
FT                   /old_locus_tag="ZYRO-ORF1748"
FT                   /product="ZYRO0G02112p"
FT                   /note="similar to uniprot|P36040 Saccharomyces cerevisiae
FT                   YKL206C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02112g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29163"
FT                   /db_xref="GOA:C5DZ79"
FT                   /db_xref="InterPro:IPR016562"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ79"
FT                   /protein_id="CAR29163.1"
FT                   /translation="MTRTLLIPLVSTGNVPQLTTDLVLHSLSKEFQFVKCLDSTYLHPF
FT                   VGPLDYVFEQQEPVLFNKSNVNKNYSTALELFYNESRSLYVIQQRTPVIQGYLNNFVKE
FT                   IICPLVQEFKITDVVILDSFGALDEDIVANTSRTSKTNSFYSDAICQVRSVGEVVREME
FT                   SGLHLNPASEQQSNNNVISTLFQFTNDSVQQEVSTRQQAFKFAYHLLNSPVSELQRIKY
FT                   CSAFVHEGDNSYDAHLLCDHLPNVIEGFAKINVHTPPISWKGVYGTRPIPTSFDEGIYI
FT                   "
FT   gene            complement(<164812..>165969)
FT                   /locus_tag="ZYRO0G02134g"
FT                   /old_locus_tag="ZYRO-ORF1747"
FT   CDS_pept        complement(164812..165969)
FT                   /locus_tag="ZYRO0G02134g"
FT                   /old_locus_tag="ZYRO-ORF1747"
FT                   /product="ZYRO0G02134p"
FT                   /note="highly similar to uniprot|P47122 Saccharomyces
FT                   cerevisiae YJR072C NPA3 Cytoplasmic protein required for
FT                   cell viability identified by association with pre-
FT                   ribosomal particles"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29164"
FT                   /db_xref="GOA:C5DZ80"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030230"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ80"
FT                   /protein_id="CAR29164.1"
FT                   /translation="MPLKTVICIGMAGSGKTTFMQRLNSHMRSKQNPPYVINLDPAVLK
FT                   VPYGANIDIRDSIKYKKVMENYGLGPNGAIVTSLNLFSTKIDQVIKLVENKRDKIEHCI
FT                   VDTPGQIECFVWSASGSIITESFASTFPTVIAYIIDTPRNSSPTTFMSNMLYACSILYK
FT                   TKLPMILVFNKTDVCSADFAKEWMTDFEAFQRALRDDQEVNGNSGLGSGYMGSLINSMS
FT                   LMLEEFYSQLDMVSVSSFTGQGFDDFLNVVDNGKINEYDQYYKVERERVLKLKEEKEKQ
FT                   RKDKSLEGLMNDLGINDKKKSKDEDDSADVVSDLEEGENDGLVVPDEFEDTEREYTFAP
FT                   SDRTQGEVNAQSAPDLQKAYEEAANRVGKSASSETAENIARYLRQ"
FT   gene            complement(<166192..>166995)
FT                   /locus_tag="ZYRO0G02156g"
FT                   /old_locus_tag="ZYRO-ORF1746"
FT   CDS_pept        complement(166192..166995)
FT                   /locus_tag="ZYRO0G02156g"
FT                   /old_locus_tag="ZYRO-ORF1746"
FT                   /product="ZYRO0G02156p"
FT                   /note="similar to uniprot|P36039 Saccharomyces cerevisiae
FT                   YKL207W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29165"
FT                   /db_xref="GOA:C5DZ81"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ81"
FT                   /protein_id="CAR29165.1"
FT                   /translation="MALSVWSVWSLITAGSAGAVAELTLDPKLKYWVLLPISIVMVLTG
FT                   ILRQYIMDLIAPNTKGVPRVKLTESQWIYKAQALLANGSNLSAEAFQLRKEHLIEVLAG
FT                   GKYLVKLNTDGQAPSPLSDPNLSENMFSMAKGNLANFIPQTIIMWWVNHFFAGFVLMKL
FT                   PFPLTPRFKEMLQSGVMTADLDVRWVSSISWYFISVLGLNPVYNLLLSDTESIDINAAQ
FT                   QPPTMGGPGEPQPEAVMKGLANDLTIAENESCFDDIEQRVLEKYS"
FT   gene            complement(<167163..>167834)
FT                   /locus_tag="ZYRO0G02178g"
FT                   /old_locus_tag="ZYRO-ORF1745"
FT   CDS_pept        complement(167163..167834)
FT                   /locus_tag="ZYRO0G02178g"
FT                   /old_locus_tag="ZYRO-ORF1745"
FT                   /product="ZYRO0G02178p"
FT                   /note="weakly similar to uniprot|P36038 Saccharomyces
FT                   cerevisiae YKL208W CBT1 Subunit of complex involved in
FT                   processing of the 3' end of cytochrome b pre-mRNA involved
FT                   in RNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29166"
FT                   /db_xref="GOA:C5DZ82"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ82"
FT                   /protein_id="CAR29166.1"
FT                   /translation="MCRNYQLLKALDAPRFVYRYSRTRSTVPRLQNKLECRVLAQRYSK
FT                   YLSEYNTFALFQWHSPKDLKFDKDYFWKEFAHDVSSSNQNAIFLEDKVHNEAMNNSLKS
FT                   SIISPSDDTEYRCTFQTVSEPHPIEYMLRLTGKPNTKLQLHTLGLRTEGNIIASYIQSL
FT                   LEESENMYKDLSYEKLLSIAKRSRSDRDKPIKELLNNLAENGITNSRIMGTEQWLVLSK
FT                   A"
FT   gene            <168123..>168194
FT                   /locus_tag="ZYRO0G02200r"
FT                   /old_locus_tag="Zyro0G.tThr.CGT.6"
FT   tRNA            168123..168194
FT                   /locus_tag="ZYRO0G02200r"
FT                   /old_locus_tag="Zyro0G.tThr.CGT.6"
FT                   /note="tRNA-Thr (CGT) cove score=77.16"
FT   gene            complement(<168322..>168972)
FT                   /locus_tag="ZYRO0G02222g"
FT                   /old_locus_tag="ZYRO-ORF1743"
FT   CDS_pept        complement(168322..168972)
FT                   /locus_tag="ZYRO0G02222g"
FT                   /old_locus_tag="ZYRO-ORF1743"
FT                   /product="ZYRO0G02222p"
FT                   /note="similar to uniprot|P05375 Saccharomyces cerevisiae
FT                   YJR073C OPI3 Phospholipid methyltransferase (methylene-
FT                   fatty-acyl-phospholipid synthase) catalyzes the last two
FT                   steps in phosphatidylcholine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29167"
FT                   /db_xref="GOA:C5DZ83"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="InterPro:IPR024960"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ83"
FT                   /protein_id="CAR29167.1"
FT                   /translation="MGLEEKFQDLQSIYMELLNDVDFDKPSFRITMYFIIFNPVFWNIV
FT                   ARLEYHTHFLSRFTGSARSGCYTLAGSIFLLGLGRDVYFRRALNDQPKSALLDDDRIAV
FT                   AGRFLAIIGQVLVATSMWKLRITGTYLGDYFGILMDEIVTDFPFNVSSNPMYQGSTLTF
FT                   IGYTLMEGKAAGLLLSFMVYSMYYFALKFEEPFTAMIYAKRDEERANRKKKVT"
FT   gene            <169369..>173190
FT                   /locus_tag="ZYRO0G02244g"
FT                   /old_locus_tag="ZYRO-ORF1742"
FT   CDS_pept        169369..173190
FT                   /locus_tag="ZYRO0G02244g"
FT                   /old_locus_tag="ZYRO-ORF1742"
FT                   /product="ZYRO0G02244p"
FT                   /note="similar to uniprot|P12866 Saccharomyces cerevisiae
FT                   YKL209C STE6 ATP-binding cassette (ABC) transporter
FT                   required for the export of a-factor catalyzes ATP
FT                   hydrolysis coupled to a-factor transport contains 12
FT                   transmembrane domains and two ATP binding domains expressed
FT                   only in MATa cells"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29168"
FT                   /db_xref="GOA:C5DZ84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030246"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ84"
FT                   /protein_id="CAR29168.1"
FT                   /translation="MGFHNNIYSYLQGKKDVILLGFVSASTIASGLVPAALSILTGRVF
FT                   NLLNEYTQWSDPIHELRLRSMVILALGAGSIVIIWICISSWMLLGERQNFRVRTQLIDS
FT                   YLQKPMKWYDDNDTLTGDLTQTNRCVEELRSSSAEASALTWKNLVTILALTVTSFYYSW
FT                   SLTLVTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQL
FT                   VEVQNFQLAVKKCSKNFMKMCLYASANTAILKFLTLTIFVQAFWFGSTMIRKHKLRIED
FT                   VITCFQSCVLLGATINGTLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFYLDG
FT                   GISEKIELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYD
FT                   DYNGSISIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETDELVRDESL
FT                   KAACRISLLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVS
FT                   ALDIIHRGLLMNAIRNWRSEKTTIILTHDLSEIGPDDMIYLLEDGEVVEQGQQRNLLLN
FT                   QQGRFFNMVSLGAGTDLADSSSLITTIEIPGRFKTSTYEDSLIEYELNTPRIDEDSGSL
FT                   MEICSIPLDDFSHRQKDRSKAPRVTIQEKLNEKDLSSDEKGSEKDRSQDLMSILEIMKR
FT                   MYSSSSRKGVLYLGIVCSLYAGISNPIFSYTFSYLLNGIVPDGNSDRGSSGYLLKWAFI
FT                   VMGIAAADSGLTLLKEFILGYHSEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSAL
FT                   LMNDLRDLRTSTSNFISFVSSFVIVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYG
FT                   ILLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRA
FT                   IVTGFGVAVSNGLTMSIQGILYYYAIKLVIHGEYTTKKMFETFTLLLFTIMTCNNLVNQ
FT                   IPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENPTGPIIRFNDLSFAYPTAP
FT                   TVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSLFVDNTDVNDWALP
FT                   KLREQIAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFNMLKYVGIYDFFATLPEGLET
FT                   KIDSGLLSGGQNQRLCIARALLQRPKILILDECTSALDTMSSHIINEIIREGPPTMLTI
FT                   SITHDEQMVRACNKVAVLDQGHIVEMGNREDLLRQKGQLWKLVTRIGD"
FT   gene            complement(<173494..>176529)
FT                   /locus_tag="ZYRO0G02266g"
FT                   /old_locus_tag="ZYRO-ORF1740"
FT   CDS_pept        complement(173494..176529)
FT                   /locus_tag="ZYRO0G02266g"
FT                   /old_locus_tag="ZYRO-ORF1740"
FT                   /product="ZYRO0G02266p"
FT                   /note="highly similar to uniprot|P22515 Saccharomyces
FT                   cerevisiae YKL210W UBA1 Ubiquitin activating enzyme
FT                   involved in ubiquitin-mediated protein degradation and
FT                   essential for viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29169"
FT                   /db_xref="GOA:C5DZ85"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR018075"
FT                   /db_xref="InterPro:IPR018965"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="InterPro:IPR032418"
FT                   /db_xref="InterPro:IPR032420"
FT                   /db_xref="InterPro:IPR033127"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR038252"
FT                   /db_xref="InterPro:IPR042063"
FT                   /db_xref="InterPro:IPR042302"
FT                   /db_xref="InterPro:IPR042449"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ85"
FT                   /protein_id="CAR29169.1"
FT                   /translation="MSAGEIDESLYSRQLYVLGKEAMLKMQHSNVLIIGLKGLGAEIAK
FT                   NVALAGVKSLSLYDPQPVTIQDLSTQFFLTESDIGKQRATVSREKLAELNSYVPIKVVD
FT                   SLIDEKSLLEFEVVVATETVSLQEKVNLNNLCHAAGIGFISTETRGLFGNVFVDLGDEF
FT                   TVLDPTGEEPRSGIVSDIEPDGTVTMLDENRHGLEDGNYVKFSEVEGLEKLNDGSLFKV
FT                   EVLGPFAFRIGPVSQYGKYIKGGIFTEVKQPQKLSFKTLQQSFAEPEYLFSDFAKMERT
FT                   PQLHLAFQALQQFASTHGGELPRPLNASDAAEVVKHAQQIAAHEPNVLGGAPVDEKVIA
FT                   ELSYQARGDLPGIVAFFGGLVAQEVLKACSGKFSPLKQYMYFDALEALPEQKQFVRTEE
FT                   TTKPINSRYDNQIAVFGLEFQRKIANLSVFLVGSGAIGCEMLKNWALLGLGTGSEGGIV
FT                   VTDNDSIERSNLNRQFLFRPKDVGRNKSEVAAQAVAAMNPDLTGKIDAKIDKVGPETES
FT                   IYNDQFWESLDLVTNALDNVDARTYVDRRCVFYRKPLLESGTLGTKGNTQVVVPLLTES
FT                   YSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFSDAPENVNMYLTQPNFVEQT
FT                   LKQSGDVKSILETISDSLNHKPIKFDDCIAWARLEFQKKFNHDIQQLLYNFPKDAKTSN
FT                   GAPFWSGPKRAPTPLKFDINNPDHLHFIVAAANLRAFNYGLTGDSGAPNLEHYKQVLSK
FT                   INVPEFSPRSDVKIQVNDDDPDPNSDRGENDLSVLAGSLPEPSQMAGYKLDPVEFEKDD
FT                   DTNHHIEFITACSNCRAENYFIEPVDRQKTKFIAGRIIPAIATTTGLVTGLVNIELYKI
FT                   ADAKTDVEKYKNGFSNLALPFFGFSEPIHSPKGEYNGKSYDRIWDRFDINGDIKLNDLI
FT                   KHFQEKESLDITMLSYGVSLLYASFFPPKKLKERLNLTITELVKFITKSEVPPHVRTMI
FT                   LEICADDKDGEDVEVPYITIHL"
FT   gene            <176807..>177319
FT                   /locus_tag="ZYRO0G02288g"
FT                   /old_locus_tag="ZYRO-ORF1736"
FT   CDS_pept        176807..177319
FT                   /locus_tag="ZYRO0G02288g"
FT                   /old_locus_tag="ZYRO-ORF1736"
FT                   /product="ZYRO0G02288p"
FT                   /note="similar to uniprot|P47123 Saccharomyces cerevisiae
FT                   YJR074W MOG1 Conserved nuclear protein that interacts with
FT                   GTP-Gsp1p which is a Ran homolog of the Ras GTPase family
FT                   and stimulates nucleotide release involved in nuclear
FT                   protein import nucleotide release is inhibited by Yrb1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29170"
FT                   /db_xref="GOA:C5DZ86"
FT                   /db_xref="InterPro:IPR007681"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ86"
FT                   /protein_id="CAR29170.1"
FT                   /translation="MKPVSLYGGALRTVLPPGFIDASLLRPVPDTQEVYVNGRQEGEDY
FT                   GDGLGLNESITVDLLERIEASNDEDALKEHVTEIFDLNGSTNCQMDQLHRINSSVYACI
FT                   AHDVNLVLCVGLIRLPQYGTDVVITINVPGQAVRTGEELPKEVQATNKVLTTILNQFEV
FT                   VDGSLFV"
FT   gene            <177479..>178666
FT                   /locus_tag="ZYRO0G02310g"
FT                   /old_locus_tag="ZYRO-ORF1735"
FT   CDS_pept        177479..178666
FT                   /locus_tag="ZYRO0G02310g"
FT                   /old_locus_tag="ZYRO-ORF1735"
FT                   /product="ZYRO0G02310p"
FT                   /note="similar to uniprot|P47124 Saccharomyces cerevisiae
FT                   YJR075W HOC1 Alpha-1 6-mannosyltransferase involved in cell
FT                   wall mannan biosynthesis subunit of a Golgi-localized
FT                   complex that also contains Anp1p Mnn9p Mnn11p and Mnn10p
FT                   identified as a suppressor of a cell lysis sensitive pkc1-
FT                   371 allele"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02310g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29171"
FT                   /db_xref="GOA:C5DZ87"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039367"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ87"
FT                   /protein_id="CAR29171.1"
FT                   /translation="MAKSREGVTLKRLLLFIIPSIACLVLLFRFFNNSKAADLQKLLQN
FT                   LPKEISQSINLAASHQKSDADLIQSFENLANELKKKQEDQAREFERHRQELEKKLQELK
FT                   LSPEHATLREKLAYNFRYDERKRFPAYIWQIGGVSGTEELKNLEEQERNWRDKNPGFVH
FT                   EIVTDEMMNALVRHYFSSVPDVINAYNALPSKVLKVDFFKYLILLARGGVYADIDTDPL
FT                   QPVPNWIPENMDPANIGLIVGVEHEAESPDWRSRYVRRLQLGTWIIQAKPGHPVIREVV
FT                   ANITETTLQRKNEGTLNINLRSDKNIMTWTGSGVWTDVIFSYLNDYLRSGNTDRITWGW
FT                   FNQLKEPRQIADILAFPPFSFNAPKTINNDDVNKPLYLIHHQAKKSWKTVPKLEN"
FT   gene            complement(<178700..>178813)
FT                   /gene="SNR64"
FT                   /locus_tag="ZYRO0G02332r"
FT                   /old_locus_tag="Zyro0G_snoRNA_184"
FT   ncRNA           complement(178700..178813)
FT                   /gene="SNR64"
FT                   /locus_tag="ZYRO0G02332r"
FT                   /old_locus_tag="Zyro0G_snoRNA_184"
FT                   /product="snR64"
FT                   /note="C/D snoRNA monocistronic SNR64"
FT                   /ncRNA_class="snoRNA"
FT   gene            complement(<179058..>180305)
FT                   /locus_tag="ZYRO0G02354g"
FT                   /old_locus_tag="ZYRO-ORF1734"
FT   CDS_pept        complement(179058..180305)
FT                   /locus_tag="ZYRO0G02354g"
FT                   /old_locus_tag="ZYRO-ORF1734"
FT                   /product="ZYRO0G02354p"
FT                   /note="highly similar to uniprot|P32458 Saccharomyces
FT                   cerevisiae YJR076C CDC11 Component of the septin ring of
FT                   the mother-bud neck that is required for cytokinesis
FT                   septins recruit proteins to the neck and can act as a
FT                   barrier to diffusion at the membrane and they comprise the
FT                   10nm filaments seen with EM"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29172"
FT                   /db_xref="GOA:C5DZ88"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ88"
FT                   /protein_id="CAR29172.1"
FT                   /translation="MASIIEASSTLRKRKHLKRGINFTVMVVGQSGTGRSTFINTLCGQ
FT                   QVVDVSTTVMLPTDTSTDIELQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNTPSFE
FT                   LISDYIRHQYDEILLEESRVRRNPRFKDGRVHACLYLINPTGHGLKEIDVEVMRQLGPI
FT                   VNVIPVISKSDSLTPEELKLNKRLIMDDIDKFQLPIYYFPFDEDDISDEDYRTNTYLRS
FT                   LTPFSIIGSNDVDELPDGTVIRGRKYPWGTLDVEDASISDFVVLRNTLLISHLHELKDY
FT                   THEILYERYRTEALSGESVPHTRSSSRTNDVDSRRGAPSQSYGTQQQHANGSDHTLPPS
FT                   NNESAPHRQESNSQDTYLAREEQIKLEEERLRAFEERVQQELIYKRKELLMREQELRDI
FT                   EDRLEKEARMKQELDL"
FT   gene            <180544..>182091
FT                   /locus_tag="ZYRO0G02376g"
FT                   /old_locus_tag="ZYRO-ORF1732"
FT   CDS_pept        180544..182091
FT                   /locus_tag="ZYRO0G02376g"
FT                   /old_locus_tag="ZYRO-ORF1732"
FT                   /product="ZYRO0G02376p"
FT                   /note="highly similar to uniprot|P00937 Saccharomyces
FT                   cerevisiae YKL211C TRP3 anthranilate synthase Component II
FT                   and indole-3-phosphate (multifunctional enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29173"
FT                   /db_xref="GOA:C5DZ89"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ89"
FT                   /protein_id="CAR29173.1"
FT                   /translation="MTNIITSMKTHQYSSILEIIPLIPPSKALHINMAARKVILIDNYD
FT                   SFTWNVYQYLCEGGADVEVYRNDKITVDGIIALNPDMLVISPGPGHPKTDSGISRDCIR
FT                   KFAGKIPIFGICMGEQCMFDVFGGQVEYAGEIVHGKTSLVNHDNKGLFKNIPQGVAVTR
FT                   YHSLAGSAVTVPEELEVSATLENGIIMGVRHKKYTIEGVQFHPESILTEEGHLMIENML
FT                   NVYGGTWEENEKKDTRGQSGSILDRIYAQRREDVDAQSHIAGFTTKDLETNFQLGLAPT
FT                   VQDFYQRLKNSPGRAAVLAEVKRASPSKGDICPDANSAQQALRYAKAGAATISVLTEPH
FT                   WFKGSLQDMINVRKALDVEFSSNPKGRPCVLRKEFVFCKYQILEARLAGADTVLLIVKM
FT                   LSQDELVELYQYATKEMGFEPLVEVNTKQEMERALQIGAKIIGVNNRDLHSFTVDLDTT
FT                   SNLVDSVPKDVLLIALSGITTAQDAEKYKSEGVHGFLVGEALMRSSDPSTFIRQLTA"
FT   gene            complement(<182333..>184201)
FT                   /locus_tag="ZYRO0G02398g"
FT                   /old_locus_tag="ZYRO-ORF1731"
FT   CDS_pept        complement(182333..184201)
FT                   /locus_tag="ZYRO0G02398g"
FT                   /old_locus_tag="ZYRO-ORF1731"
FT                   /product="ZYRO0G02398p"
FT                   /note="similar to uniprot|P32368 Saccharomyces cerevisiae
FT                   YKL212W SAC1 Lipid phosphoinositide phosphatase of the ER
FT                   and Golgi involved in protein trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29174"
FT                   /db_xref="GOA:C5DZ90"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ90"
FT                   /protein_id="CAR29174.1"
FT                   /translation="MGGPLLFAKTSEGLLFRSTTPSKKDAVIHLSDQEQAVRVEGLEEF
FT                   PVEGNITKIPALLGFIRLKLNKYAVIASKVEEAGRINDHLIHKVVEHLIVPAKEKARID
FT                   SDESEYLRLLKLQLNKATLYFSYTYDLTNSFQRNASITKPSWKTTDSRFFWNHYLTQEL
FT                   QELSAKDAAAGEFIQPVIYGYVKLVDYIFRSTPISVGLISRRSRFRAGTRYFRRGIDEQ
FT                   GNVSNFNETEQVLVVQTNTASVSHLFSFLQTRGSVPVYWAEINDLKYKPQLVLKEGSSL
FT                   DAAEKHFAEQKALYGENYLVNLVNQSGHELPVKDAYESTVNALDDPKIHYVYFDFHHEC
FT                   SGMKWHRVKLLIDHLSNMGLKNSDFFHAIISSEGTIKRVVNEQKSAVRTNCMDCLDRTN
FT                   VVQSVLAHWVLQKELETAGVIPDDEPWENSSSLLLAFQSLWADNADAVSCSYSGTGALK
FT                   TDFTRTGKRTKMGALNDFINSATRYYKNNLSDGPRQDSYDLFLGNFRPYMASLKSPFAD
FT                   SRPFSVQVIPLVLYAALTVLGATVVFPKGEFTSKKNMAFFLGASVIFAFAFFNLVTDGI
FT                   QYVNWPKLVDVGFLVTQHSRNKDKSHEGVKYIKNPRFMKPGASKKD"
FT   gene            <184509..>186686
FT                   /locus_tag="ZYRO0G02420g"
FT                   /old_locus_tag="ZYRO-ORF1729"
FT   CDS_pept        184509..186686
FT                   /locus_tag="ZYRO0G02420g"
FT                   /old_locus_tag="ZYRO-ORF1729"
FT                   /product="ZYRO0G02420p"
FT                   /note="similar to uniprot|P36037 Saccharomyces cerevisiae
FT                   YKL213C DOA1 WD repeat protein required for ubiquitin-
FT                   mediated protein degradation forms complex with Cdc48p
FT                   plays a role in controlling cellular ubiquitin
FT                   concentration also promotes efficient NHEJ in
FT                   postdiauxic/stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29175"
FT                   /db_xref="GOA:C5DZ91"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013535"
FT                   /db_xref="InterPro:IPR015155"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR033510"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR038122"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ91"
FT                   /protein_id="CAR29175.1"
FT                   /translation="MYQLSATLQGHTQDVKDVVVLSNEQLGSVSRDGSVMIWNLGTDGQ
FT                   WQGIVVQKRDLFVNSCCYRSQDAIVFYGSKDGLINGVPVYGKLGEDPVYTLIGHGSNVC
FT                   CLSTDGDNVLSGSWDKTAKVWENGVVKWDLQGHSASVWDIKAIPTMPGHYLTASADKTI
FT                   KLWQGSQCIKTFTGIHDDVVRHLEIINSDEFVSCSNDGKIKISNFQGVVQRTLEGHESF
FT                   VYSVKAFPNGDLVSCGEDRSVRIWTSSGHLKQVITVPAISVWCVDILPNNDIVVGTSDS
FT                   ILRVFTQDEKRIASQEQIKEFQEQLQGSSINSQVMGVDESKLSPFEVLQAPGKKEGQIV
FT                   VVKAPNGVVEAHQYSQGQWMKVGDVVSSSGSDQKKEFQGKLYDYVFDVDIEEGQPPLKL
FT                   PVNANDNAYTVADQFLARYDLPASYRDQVVNFIFQNTSGVSLDPTGAPGGSAVPQQPAQ
FT                   PTQTIQPPPLAEGLKILPVKQYLSLTNYNPDSIFMGITKLNAKEQTFSDEDLAQMGTAL
FT                   HDLEHNWEVLYLFALTMRSKWAVKTPAYDILRLVVSKLSSSDDISEFVEEGLGNKNIAI
FT                   AMLTVRIFANCFQNEKWGIDLLSSPKVYNSLFETIETNFEDAKAQQLQNLAIAVATLLF
FT                   NYSALIVQDPVKLADAVAPISDALNTKFGTHETFQASEEAAYRLLVAFGNLSTVEPTLK
FT                   QFAGSISWIKNIKAYYGNIPRFQDILVDIGA"
FT   gene            <186876..>187553
FT                   /locus_tag="ZYRO0G02442g"
FT                   /old_locus_tag="Zyro0G.mRNA.382.p"
FT   CDS_pept        join(186876..186917,187086..187553)
FT                   /locus_tag="ZYRO0G02442g"
FT                   /old_locus_tag="Zyro0G.mRNA.382.p"
FT                   /product="ZYRO0G02442p"
FT                   /note="some similarities with uniprot|P36036 Saccharomyces
FT                   cerevisiae YKL214C YRA2 Member of the REF (RNA and export
FT                   factor binding proteins) family when overexpressed can
FT                   substitute for the function of Yra1p in export of poly(A)
FT                   mRNA from the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29176"
FT                   /db_xref="GOA:C5DZ92"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR025715"
FT                   /db_xref="InterPro:IPR034396"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DZ92"
FT                   /protein_id="CAR29176.1"
FT                   /translation="MSVDNVLDKLVDEKKYRRRDLRNSLASRIGIEDRPSSTPREPPKK
FT                   RLRFTNVPLDVSDFTLEDMVKEFAEPIYCNFYDLKDSRTAVFEFEDPSVMERVVEKYNE
FT                   TPLNGGTVTVEIFEQERRPDRRRRTQRDNRRGNGRGSRGSHYKRQDRPAMEDELNAELE
FT                   DYMKSS"
FT   gene            <189398..>189727
FT                   /pseudo
FT                   /locus_tag="ZYRO0G02464g"
FT                   /old_locus_tag="pseudo-Zyro0G-189398-189727"
FT   gene            <190261..>192108
FT                   /locus_tag="ZYRO0G02486g"
FT                   /old_locus_tag="ZYRO-ORF1720"
FT   CDS_pept        190261..192108
FT                   /locus_tag="ZYRO0G02486g"
FT                   /old_locus_tag="ZYRO-ORF1720"
FT                   /product="ZYRO0G02486p"
FT                   /note="similar to uniprot|Q0P727 Saccharomyces paradoxus
FT                   HDF2 HDF2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29177"
FT                   /db_xref="GOA:C5DZ93"
FT                   /db_xref="InterPro:IPR005161"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="InterPro:IPR024193"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ93"
FT                   /protein_id="CAR29177.1"
FT                   /translation="MAECSGFIVDVSPHMIQHDNVSKVQAYLEYSLLEKCKRKRKTDWI
FT                   SCYLANCAISKNSQGIEGVFQVQDWVAPVTITETLRVLRQLQSYSQDLRDGNVTNPSSS
FT                   ASSSMVQCLLVSSLDCRDHFHVRKMRRQLVVFTDDMEGLDLSDEEVGVLAEELNLSIIL
FT                   VDCRVENHRNGSAVPDYGIWGKLVDVIEGSRIYHVNDLLREISSLPSGVVRPVMVFSGE
FT                   LRLGADVAVHTDQDSQDDEHSLTIKVEGYPATKAVSSISRKMVVKREIHGKDVYKPVKS
FT                   VVEYEIQGDDEKSLPIQVSPKSIAKAYRYGADYVVLPSSLEDPPRKYASRPGMDILGFI
FT                   DQKALPRHFLHSESRFITADTRYGGVQDVVALSALVDALKESNQLAIVRFVAKPTSDVQ
FT                   VGVLCPIHVEDNHTLVYCRLPFAEDQRVSDFPRLVNRTTTSGKKIEQDKSQGNIDSMMS
FT                   KYIDAFDMDNEPQTEENHYYKLMEGPSSTNLPLPQLPAHPGRVKPDTELVDEDPLIVPA
FT                   IHLHRTQQVLLEWIHLCIINESKFYVPEMPDFLANKISSRYEPSPELDESIARLKKLLD
FT                   IKRSRRRGSSREDQDEESDVADQDIPDLQSLLSRGQRDY"
FT   gene            <192411..>194120
FT                   /locus_tag="ZYRO0G02508g"
FT                   /old_locus_tag="ZYRO-ORF1719"
FT   CDS_pept        192411..194120
FT                   /locus_tag="ZYRO0G02508g"
FT                   /old_locus_tag="ZYRO-ORF1719"
FT                   /product="ZYRO0G02508p"
FT                   /note="highly similar to uniprot|P37012 Saccharomyces
FT                   cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
FT                   conversion from glucose-1-phosphate to glucose-6-phosphate
FT                   which is a key step in hexose metabolism functions as the
FT                   acceptor for a Glc-phosphotransferase and to YKL127W
FT                   uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
FT                   Phosphoglucomutase, minor isoform; catalyzes the conversion
FT                   from glucose-1-phosphate to glucose-6- phosphate, which is
FT                   a key step in hexose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29178"
FT                   /db_xref="GOA:C5DZ94"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ94"
FT                   /protein_id="CAR29178.1"
FT                   /translation="MSFSVETVATKAFQDQKPGTSGLRKRTKVFAEEPNYTENFIQAIL
FT                   EAIPEGVKDSVLLVGGDGRYYNDVVLQKIAAIGAANGVKRLVVGQNGILSTPAASHVIR
FT                   SYSKAKVTGGIILTASHNPGGPNNDFGIKYNLANGGPAPENVTNAMWEASKRLTSYKIV
FT                   TDFPHVDLSALGEKQYGSLTVDVIDSTKAYVDFLKTIFDFPLIKSFVNHQRETKNWKLL
FT                   FDGLNGVTGPYGRAIFADELGLPEDEVLQNCHPKPDFGGLHPDPNLTYARTLVDRVDRE
FT                   NIAFGAASDGDGDRNMIYGAGPAFVSPGDSVAIIAEYASEIPYFQREGIYGLARSFPTS
FT                   QAIDLVAKHHNLSCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIA
FT                   WLNILAIYHKRNPEKDVSIKTIQDEFWDKYGRTFFTRYDYENVSGEAANRVIEFFQNFV
FT                   SQPGVKGSNFPLDESLKVVDAGDFEYKDLDGSVSSNQGLFLKLSNGVRTVLRLSGTGSA
FT                   GATIRLYVEQYSDDASKYGLTAEEFLRPAIQQLVSFFKFQEILGTETPTVKT"
FT   gene            <194463..>196577
FT                   /locus_tag="ZYRO0G02530g"
FT                   /old_locus_tag="ZYRO-ORF1718"
FT   CDS_pept        194463..196577
FT                   /locus_tag="ZYRO0G02530g"
FT                   /old_locus_tag="ZYRO-ORF1718"
FT                   /product="ZYRO0G02530p"
FT                   /note="highly similar to uniprot|P12688 Saccharomyces
FT                   cerevisiae YKL126W and highly similar to uniprot|P18961
FT                   Saccharomyces cerevisiae YMR104C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29179"
FT                   /db_xref="GOA:C5DZ95"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ95"
FT                   /protein_id="CAR29179.1"
FT                   /translation="MYYWKISKFKFGKNKDDKEAEKEKEKEKNGNHKSHNGVFHHHKDS
FT                   SRHNDGNDTVNGDNNNEIGSMRPSSERKETIVPSNSSIAPVRLSHDASSTSSTVRESSG
FT                   GRSSDDAFNSTPDTHRSDDPSPPEISITAPAQSTSTPGILTIKVYNGDGFTLPFPITSN
FT                   EQILGKLLSSGVTSKRSSLSGEVDGLVSQLSRMQLQNQGPVDENLLPGDVSTRFIPSTI
FT                   MLPGSEHLNPLLYFTIEFDNTVATIEPEYGSMVQPVFNKISTFDVTRKLPYFKIDVFAR
FT                   IPSILLPSKTWQQEMGARDEKLRDMFNKINTNQDIHLDSFLLPVNLKIDSAANIRLYNH
FT                   HWVRLENGLGNINFSVDYKPSKNKSLSIDDFDLLKVIGKGSFGKVMQVKKKDTQKVYAL
FT                   KAVRKSYIVSKSEVTHTLAERTVLARVECPFIVPLKFSFQSQEKLYLVLAFINGGELFY
FT                   HLQKEGRFDLSRARFYTAELLCALETLHGLDVIYRDLKPENILLDYQGHIALCDFGLCK
FT                   LNMKDKDKTDTFCGTPEYLAPELLLGQGYSKIVDWWTLGVLLYEMLTGLPPYYDEDVPK
FT                   MYKKILQEPLRFPDGFDHDAKDLLIGLLSRDPKRRLGYHGAEEIRSHPFFSQLSWKRLL
FT                   MKGYIPPYKPPVSSAMDTSNFDQEFTREKPIDSVVDEYLSESVQKQFGGWTYVGNEQLG
FT                   SSMIQGRSIR"
FT   gene            <196897..>198798
FT                   /locus_tag="ZYRO0G02552g"
FT                   /old_locus_tag="Zyro0G.mRNA.co.1.p"
FT   CDS_pept        join(196897..197067,197137..198798)
FT                   /locus_tag="ZYRO0G02552g"
FT                   /old_locus_tag="Zyro0G.mRNA.co.1.p"
FT                   /product="ZYRO0G02552p"
FT                   /note="some similarities with uniprot|P36070 Saccharomyces
FT                   cerevisiae YKL125W RRN3 Required for transcription of rDNA
FT                   by RNA Polymerase I DNA-independent RNA Polymerase I
FT                   transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29180"
FT                   /db_xref="GOA:C5DZ96"
FT                   /db_xref="InterPro:IPR007991"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ96"
FT                   /protein_id="CAR29180.1"
FT                   /translation="MMAFENSGKRPGQDSMGLELKKRKVEFALPDETDDDKEFTTEMYR
FT                   RFLKSALGDLEKNDSSQLDMVTHRVSQPANSDSRISTENLGILLDVLAKNINKIDTSKG
FT                   TPLIQSIINFEKWWELPPYTLSKYILFIRILCSSIPKWWQDVSISLISGFHLPPEKTEK
FT                   HHSMLKYFLQMIPSSMGYIDVYLAKFFPNNNDTSKKLVNYISNILTLTTYCKELQFQAW
FT                   SLIMEKTISLDVALQNELDELDDDIDDFEESEEEEEEDDDEEEEEDDEEEEDDGDRIKS
FT                   VQDEDDDSDEDEDAMEGEEEYNVEVSQSIKDLSTKLDNILTLVSSRLGKDVTPQSLMTG
FT                   EGVTIFNTLTTLFKSHVLPTYYTKSIQYIMFHISQQQAELMDAFLVTLIDISFSPTETS
FT                   EKKIKSLQYLGSYIARAKKLSRTQIIFVASYLTSWLNRYVLEREEEVDQPGGMERFKHF
FT                   YAAFQALCYIFCFRYQMFRDPDGSWECELDKLFPRMVITKFNPLKYCNENVMLMFARIA
FT                   QHEDVAFCFSIIENNNNERLRGIIGRGDSNQKSSSQPVAASTWSLATRQQFIDLQSYFP
FT                   YDPLFLKHYKRMMKDYYIEWSEAGGEYESDEYED"
FT   gene            <199099..>200814
FT                   /locus_tag="ZYRO0G02574g"
FT                   /old_locus_tag="ZYRO-ORF1714"
FT   CDS_pept        199099..200814
FT                   /locus_tag="ZYRO0G02574g"
FT                   /old_locus_tag="ZYRO-ORF1714"
FT                   /product="ZYRO0G02574p"
FT                   /note="similar to uniprot|P32343 Saccharomyces cerevisiae
FT                   YKL124W SSH4 Suppressor of SHR3 confers leflunomide
FT                   resistance when overexpressed (putative) involved in ER
FT                   functions"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29181"
FT                   /db_xref="GOA:C5DZ97"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027713"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ97"
FT                   /protein_id="CAR29181.1"
FT                   /translation="MFLPLDDESVVSFYKTELDGVNDPYPGPPIDDSGTISLAFLISLS
FT                   VTFALLMVVLVVVAIYVTFCGADEAEYDEETGAGSRGSNGGLQAFFSKRRSGILLDSSF
FT                   TSPGQFDDEAALQQQEDQELPRMSDFEVELYRHAKEFQKMNPPNVKEFGTFLNETDLQF
FT                   IRDRGLQSYFFLPSINDNTDADGNFLPSLLVQDKLDVTFTKFNKSSSTVLNYPLPFNKK
FT                   AAVYFEVKVFKHVSDSNSIFSIGLTTCPYPYFRIPGMSIYSIAYESTGKLRINNPFTPS
FT                   TLLPKLQEGDVVGFGYRYRTGTIFITHNGKKLMDVTQNVGIDLFISLGSMNGAFTRTYT
FT                   RDGLLEDPDNIELRSALAENRDIELPKDLQRVHDVRQEGDLPTDEVELNVNLGQLGFVF
FT                   VEANVKKYAFGSLFGEIGIPPSYNGAEIKKDTVLQKGEDLPPKYADDEDPDSFFGNINI
FT                   NVGNSVERSRQQQQLGQREEEEAEESQDEWQRNQSEISRIVNPNTNTNTNETGYERNTS
FT                   AYDREHNLTDEETEPRANEEERPLIKQSKPTSGSRSNAKKKRNKNKNKKKRSKK"
FT   gene            complement(<200939..>201391)
FT                   /locus_tag="ZYRO0G02596g"
FT                   /old_locus_tag="ZYRO-ORF1711"
FT   CDS_pept        complement(200939..201391)
FT                   /locus_tag="ZYRO0G02596g"
FT                   /old_locus_tag="ZYRO-ORF1711"
FT                   /product="ZYRO0G02596p"
FT                   /note="similar to uniprot|P32342 Saccharomyces cerevisiae
FT                   YKL122C SRP21 Component of the signal recognition particle
FT                   (SRP) ribonucleoprotein (RNP) complex that functions in
FT                   protein targeting to the endoplasmic reticulum (ER)
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29182"
FT                   /db_xref="GOA:C5DZ98"
FT                   /db_xref="InterPro:IPR039432"
FT                   /db_xref="InterPro:IPR039914"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ98"
FT                   /protein_id="CAR29182.1"
FT                   /translation="MSVKPIDSFISQSVGLFEANPSQTTFAISYKNRLPAQLPQVSFKT
FT                   HNPHLNCHYKFQTCKSKDVSRLLSALGPRGVTVTLGKVERTKKLKKLPKRHRKQSRVKD
FT                   VVGLSSLMVNTDVKEYVPPAVQETSGASAKPDAKKKKSKSKNKKKR"
FT   gene            <201987..>204629
FT                   /locus_tag="ZYRO0G02618g"
FT                   /old_locus_tag="ZYRO-ORF1710"
FT   CDS_pept        201987..204629
FT                   /locus_tag="ZYRO0G02618g"
FT                   /old_locus_tag="ZYRO-ORF1710"
FT                   /product="ZYRO0G02618p"
FT                   /note="similar to uniprot|Q03177 Saccharomyces cerevisiae
FT                   YMR102C Protein of unknown function transcription is
FT                   activated by paralogous transcription factors Yrm1p and
FT                   Yrr1p along with genes involved in multidrug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29183"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040324"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZ99"
FT                   /protein_id="CAR29183.1"
FT                   /translation="MRSNGISHHEEELSKPTFGEKFGRSSKESDLNLTSDMGKGHHRNH
FT                   QEKSNLNQEFPADLRPLGFKRHADPELSKTPKQPPASLAKVRERLVKNGGSNGAANAGT
FT                   TENIIRGVLGLIDRDQFEEYLKNPPYIKLMKKGKNLKQFRRLFLAQELRIQGENVNGTV
FT                   PTKGEQSDSKAIWVNKFSVNGKYMAAGSKDGSIWIWKVLSSPVERWEMDYKEEIHAAVK
FT                   RKTSILQQHHNSNLPSNGSSSNLSKKGQKLAEKNGKETEKLSEKLSATNLYAPVFKPQP
FT                   YRIYREHGSSVLDLDWSQNGFLVSASMDKAVKLWHVEREQSLKTFLHPDFVTCIKFYPL
FT                   DDRFFVSGCLDHKCRMWSILDDEVIFEFDCEDLITSMVLTPETGDYTILGTFNGYIYIL
FT                   ETYGLRLVSSFHVKDKETQNHHVSQGLSPGSKHHHGPRVTYLQYFKSPNDESSKLMTVS
FT                   NDSRVRIFDLKTKKCVEILRGFESGASQHSAQLVTSSSQAIVVSGSNDHWVYGWKLQSA
FT                   SIPSDKLQRNATSKRSGSIKRSGSLRNLLNKNKSKTVPESSGTDFKNDNNGRHNHRTHN
FT                   PLNLKNIIKHGHNNGSDQYIKNNYSISFHAHHSPVTTANLAPPETSKALSLSNDLICEL
FT                   SSLLYKNDDELGLVGISKNLQKSSNDTSDDSDVEPTDWDSSINLPNDRVVPSSIDAIGT
FT                   ILITTDTTGLIRIFRADMPSAIRRRVLNRLENPPQNENPHKNKSGSTDSLTSIQNVARS
FT                   NSLNGGINGLSSPQTANGHNSSTFSPQSASDSFNQPRPPLRNRRSCSVFRNALLSQSNT
FT                   SIASLKRSSLSSNPGEGDRGRSNSSVGHRLRCDVCGGTKFNLLSRGSFSGRENGYYCTD
FT                   CSTMNNSFR"
FT   gene            <205008..>205985
FT                   /locus_tag="ZYRO0G02640g"
FT                   /old_locus_tag="ZYRO-ORF1708"
FT   CDS_pept        205008..205985
FT                   /locus_tag="ZYRO0G02640g"
FT                   /old_locus_tag="ZYRO-ORF1708"
FT                   /product="ZYRO0G02640p"
FT                   /note="similar to uniprot|P32332 Saccharomyces cerevisiae
FT                   YKL120W OAC1 Mitochondrial inner membrane transporter
FT                   transports oxaloacetate sulfate and thiosulfate member of
FT                   the mitochondrial carrier family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29184"
FT                   /db_xref="GOA:C5DZA0"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZA0"
FT                   /protein_id="CAR29184.1"
FT                   /translation="MSGAEPPYEEMKRASELSPAQKVSKFGSFVAGGLAACVAVTVTNP
FT                   IELVKTRMQLQGEMSATNQQVYKNPIQAMVIIFRNEGFVSLQKGLLAAYVYQIALNGSR
FT                   LGLYEPSRGFVNKIFYPDEEPHKVQNPAINVFCGAAAGVFGAVLGSPLYMVKTRLQSYS
FT                   STVSIGEQTRYNGVWDGLKTVYRGEGIKGLFRGIEAAMLRTGVGSAVQLPIYNVVKGFI
FT                   KDNDLMREGTSLHLTASTVAGIGVGIAMNPWDVILTRIYNQKGDLYKGPIDCFIKTVKI
FT                   EGPGALYKGFQAQLFRIAPHTILCLTMMEKTMNLVYNIEQRTFA"
FT   gene            <206222..>207262
FT                   /locus_tag="ZYRO0G02662g"
FT                   /old_locus_tag="ZYRO-ORF1706"
FT   CDS_pept        206222..207262
FT                   /locus_tag="ZYRO0G02662g"
FT                   /old_locus_tag="ZYRO-ORF1706"
FT                   /product="ZYRO0G02662p"
FT                   /note="similar to uniprot|Q03175 Saccharomyces cerevisiae
FT                   YMR101C SRT1 Cis-prenyltransferase involved in dolichol
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29185"
FT                   /db_xref="GOA:C5DZA1"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZA1"
FT                   /protein_id="CAR29185.1"
FT                   /translation="MRVPGFVRSRIIAPSDPAAAEVSSKVLKQIYPIIDKIVSWLRAFQ
FT                   LFIKLQQLLQNLLINILAAGPVPQHISFIMDGNRRFAKKMNMPVKRGHEAGGVTLLSLC
FT                   YVLKKMGVRCVSAYAFSIENFNRPPEEVNALTNMFAVKLDEFARKANDYRDPLYQSRLK
FT                   IVGDHSLISEEMREKIKRVEEMTNDGDEFTLFICFPYTSRNDIWHATQTSVEECVQQSL
FT                   EPRALTVEEFNKKMYLNDYSHKCDLLIRTSGHLRLSDYMLWQVHESGDIKFSPTLWPDF
FT                   KFFQLYLMILNWSFFTTIQRYIFHGSKKSQSKPAFWNRKKSSKYSLEDLPAAPVAVSIT
FT                   GERDPS"
FT   gene            complement(<207259..>207888)
FT                   /locus_tag="ZYRO0G02684g"
FT                   /old_locus_tag="ZYRO-ORF1705"
FT   CDS_pept        complement(207259..207888)
FT                   /locus_tag="ZYRO0G02684g"
FT                   /old_locus_tag="ZYRO-ORF1705"
FT                   /product="ZYRO0G02684p"
FT                   /note="similar to uniprot|P32341 Saccharomyces cerevisiae
FT                   YKL119C VPH2 Protein involved in vacuolar H -ATPase
FT                   assembly or function required for the biogenesis of a
FT                   functional vacuolar ATPase (V-ATPase) but not part of the
FT                   final enzyme complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29186"
FT                   /db_xref="GOA:C5DZA2"
FT                   /db_xref="InterPro:IPR021013"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZA2"
FT                   /protein_id="CAR29186.1"
FT                   /translation="MFQIKLNDQLKRHIEELKKSNASNKELDMILEKDCVSIEALIKMY
FT                   EDHWQNRVPLSQLLKPLNFQFKPKRIARSDYKPEFKEYLENLKLQQQEKDYQQLISANR
FT                   ELSTYEDEDKPLTPAQINRELKEQVTTVFNILVSVVSVAFAFWYWSGSSSGMALHYRVL
FT                   ISLFFGILILIAEVVVYNSYLQRVSDAKAKEKVKTERTKVVKRIVI"
FT   gene            complement(<208111..>210192)
FT                   /locus_tag="ZYRO0G02706g"
FT                   /old_locus_tag="ZYRO-ORF1703"
FT   CDS_pept        complement(208111..210192)
FT                   /locus_tag="ZYRO0G02706g"
FT                   /old_locus_tag="ZYRO-ORF1703"
FT                   /product="ZYRO0G02706p"
FT                   /note="similar to uniprot|Q03162 Saccharomyces cerevisiae
FT                   YMR100W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02706g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29187"
FT                   /db_xref="GOA:C5DZA3"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZA3"
FT                   /protein_id="CAR29187.1"
FT                   /translation="MRDSNHRSVLANRPVVTITSTVYDRRALDLNSNVPLINSLNHLTY
FT                   LTSNSGKVRETIANDGALERLVSILHGCHIPLYGLLQLDLKKISKHRRAKMVSKQKNLA
FT                   MCAWKWTLAFQCLVLTGTRGTEQIRKKVVLSGVVPVLATVLDNYLLYHKNYDHLKGTKI
FT                   DVDLRSLDSEQSYRQLRKGEDESFAEYLEYLTGREDLRLSEDPDFISEDLRSISATLPS
FT                   DFADIWSTFNEHGQSSADENSGGNSNGNDDGLLDKEVSDDTCFMVDEDNKLSISIPRDF
FT                   FLGRIIPKQDDVIWSLQLLAFISKYTYMKQQLQNVRLIESLSFRSVVERVHKRRNGNNN
FT                   NKIPTKMCSPVLSPLSNTHEFDIPILEQEEDPFLVELQELANKCKQAQREKEFDGVVPI
FT                   QNPYQYYNKGLPSPKVSPRIKRENQLVENFKNKWNYKNLVTDLDDETWAYSSLKESLNL
FT                   FPLVERYTVSSKNPHDMVYWSSVIMRNSCRKNEVTGVRQCANFACGKWEDYPRQFAKCR
FT                   RCKRTKYCSRDCQLKAWTYHRYWCHEVGSGMNTAASNTGANTPGGSTASSSAHVPTGHN
FT                   GTIMAIGNTNGTITDTEVTGTDAGVTGLGVHLRGANVGQTTDVTTTITNNVGVNRTTAI
FT                   AATNATTTNTTNNSTDINNDRNSTNNPGMGTTRRIPNVALDQEDDMITTDDNDNDNFT"
FT   gene            <210549..>210621
FT                   /locus_tag="ZYRO0G02728r"
FT                   /old_locus_tag="Zyro0G.tAla.AGC.7"
FT   tRNA            210549..210621
FT                   /locus_tag="ZYRO0G02728r"
FT                   /old_locus_tag="Zyro0G.tAla.AGC.7"
FT                   /note="tRNA-Ala (AGC) cove score=70.19"
FT   gene            <210982..>211284
FT                   /locus_tag="ZYRO0G02750g"
FT                   /old_locus_tag="ZYRO-ORF1701"
FT   CDS_pept        210982..211284
FT                   /locus_tag="ZYRO0G02750g"
FT                   /old_locus_tag="ZYRO-ORF1701"
FT                   /product="ZYRO0G02750p"
FT                   /note="similar to uniprot|Q82BJ9 Streptomyces avermitilis
FT                   SAV5706 Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29188"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZA4"
FT                   /protein_id="CAR29188.1"
FT                   /translation="MVAKVLFAQMKAVAGQQEFVAQALTKMAENVRKEPGNVRFEVYTL
FT                   PDGTFHVEETYKDEAAFQAHMGTQHGKEFNASIVDKVEGGGSTVVFMTPVSTTQA"
FT   gene            <211637..>212143
FT                   /locus_tag="ZYRO0G02772g"
FT                   /old_locus_tag="ZYRO-ORF1699"
FT   CDS_pept        211637..212143
FT                   /locus_tag="ZYRO0G02772g"
FT                   /old_locus_tag="ZYRO-ORF1699"
FT                   /product="ZYRO0G02772p"
FT                   /note="similar to uniprot|P28707 Saccharomyces cerevisiae
FT                   YKL117W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29189"
FT                   /db_xref="GOA:C5DZA5"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZA5"
FT                   /protein_id="CAR29189.1"
FT                   /translation="MPLTPEVLWAQRSSDSDAEKNYLLVTIAIPDCEEPKLKLEPNYLE
FT                   FSAKNKGHVGDEASHQYHLHIDFFKEVVPEKSLHKVENGLSYFLKIYKKDLDAEYWPRL
FT                   TKEKVKYTNIKTDFNKWVDEDEQETAPADAGDFGDLMGGGTPDLEALKAQLGQTGGLDQ
FT                   GEEEE"
FT   gene            complement(<212229..>213119)
FT                   /locus_tag="ZYRO0G02794g"
FT                   /old_locus_tag="ZYRO-ORF1698"
FT   CDS_pept        complement(212229..213119)
FT                   /locus_tag="ZYRO0G02794g"
FT                   /old_locus_tag="ZYRO-ORF1698"
FT                   /product="ZYRO0G02794p"
FT                   /note="highly similar to uniprot|Q03161 Saccharomyces
FT                   cerevisiae YMR099C ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29190"
FT                   /db_xref="GOA:C5DZA6"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZA6"
FT                   /protein_id="CAR29190.1"
FT                   /translation="MSVEDLGDRVVLTHPDDKSNTATILKYGATVFSWKLNGAEQLWLS
FT                   DAAKLDGSRPVRGGIPLVFPVFGKNTTDDHLSKLPQHGLARNSTWEFLGQTKSNPPTVQ
FT                   FALSPENANKELTQLWPFDFTLLLTVQLGQDYLKTDIEVQNPSTTQELKFNWLFHTYLK
FT                   IEDIEGTLVSNLTGVKLYDQLLKQSYIDKHPVITVSDETDLIYQNVDENRLIQVVDRGQ
FT                   PVHTVKRHNLPDAVVWNPWTEKAGGMADFEPKDGYLQMVCIEPGHVHDLVTLAPGQSWS
FT                   AYQLLYKEQLKYQAI"
FT   gene            complement(<213421..>214980)
FT                   /locus_tag="ZYRO0G02816g"
FT                   /old_locus_tag="ZYRO-ORF1697"
FT   CDS_pept        complement(213421..214980)
FT                   /locus_tag="ZYRO0G02816g"
FT                   /old_locus_tag="ZYRO-ORF1697"
FT                   /product="ZYRO0G02816p"
FT                   /note="similar to uniprot|P28708 Saccharomyces cerevisiae
FT                   YKL116C PRR1 Protein kinase with a possible role in MAP
FT                   kinase signaling in the pheromone response pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29191"
FT                   /db_xref="GOA:C5DZA7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZA7"
FT                   /protein_id="CAR29191.1"
FT                   /translation="MSDEVQGPPTPRIQQQEFKTQSNPKVPTYQAPSSTSSDSPMNKEP
FT                   SGAHPNLLKVNTDLPVSSPQELEQQRTPLSLVISSFDNVQTLPTPMAYTPPAIQPRSPI
FT                   DQLHVVKRRDPNRARNLNLSPGKQQRYLSEIFPLPDSSVQRVNSLPTVSETATLDTALA
FT                   DSATEDEKPLLDVGEDILTGYLVDHYKEPLYWRKLDEIGSGNFSTVFRYESLDQAHAEL
FT                   RQVAVKRIKYPEELIRGKCDDDSDTKYKELLSRLESSLTRELSVLKSLSHPCVVKLFGI
FT                   NNPTFLQSGKPLRDLMNQNSGLPPCDMIMSYCAGGDLLTAAADCNGKIEMWLIQRIFAE
FT                   LTLAVKYLHESHVIHRDLKLENVLLKYPLPALIGMKDSPLFLQTNFIELADFGLCKRIK
FT                   PGELSTARCGSEDYVSPEILMGVPYDGRLSDTWALGVILYGLLECRLPFDPPPNATARQ
FT                   RNRATAHRIARFDWKWYQWANADIPAKEIVENTLARKTNRWMIDKIYESQFVKEAATQF
FT                   AF"
FT   gene            complement(<215365..>216456)
FT                   /locus_tag="ZYRO0G02838g"
FT                   /old_locus_tag="ZYRO-ORF1696"
FT   CDS_pept        complement(215365..216456)
FT                   /locus_tag="ZYRO0G02838g"
FT                   /old_locus_tag="ZYRO-ORF1696"
FT                   /product="ZYRO0G02838p"
FT                   /note="highly similar to uniprot|P22936 Saccharomyces
FT                   cerevisiae YKL114C APN1 Major apurinic/apyrimidinic
FT                   endonuclease 3'-repair diesterase involved in repair of DNA
FT                   damage by oxidation and alkylating agents controls
FT                   spontaneous mutations"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29192"
FT                   /db_xref="GOA:C5DZA8"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZA8"
FT                   /protein_id="CAR29192.1"
FT                   /translation="MGKDQSEMSKFVRSTTSKYKFGAHISGAGGISNSVTNAYKVGCNA
FT                   FAMFLKSPRKWVSPAYSKDEIEKFKENCKKCNYNPLTDVLPHGQYFINLANPDEEKAQK
FT                   AYDSFIDDLSRCEQLGIGLYNLHPGSSLKGDHESQLKQLASYLNKAIKETKFVKVVLEN
FT                   MAGTGNLIGSNLKDLKYVIDLIEDKDRIGVCVDTCHTFAAGYDIGTKEAYEKFWKQFDE
FT                   IIGYQYLKGIHLNDSKAPLGANRDLHEVLGEGFLGLEVFRLISHDEHLQGLPIILETPQ
FT                   PTDEGYGDEVNLLEWLETVSIPEDEELTKKSKELQEKGSKSRKDQIAKYDAKQKKGTKR
FT                   SKPDSNNDIAAHLSKQKKVSKKE"
FT   gene            complement(<216597..>217736)
FT                   /locus_tag="ZYRO0G02860g"
FT                   /old_locus_tag="ZYRO-ORF1695"
FT   CDS_pept        complement(216597..217736)
FT                   /locus_tag="ZYRO0G02860g"
FT                   /old_locus_tag="ZYRO-ORF1695"
FT                   /product="ZYRO0G02860p"
FT                   /note="highly similar to uniprot|P26793 Saccharomyces
FT                   cerevisiae YKL113C RAD27 5' to 3' exonuclease 5' flap
FT                   endonuclease required for Okazaki fragment processing and
FT                   maturation as well as for long-patch base-excision repair
FT                   member of the S. pombe RAD2/FEN1 family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29193"
FT                   /db_xref="GOA:C5DZA9"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DZA9"
FT                   /protein_id="CAR29193.1"
FT                   /translation="MGIKGLNAIISEHVPSAVRKSDIKAFFGRKVAIDASMSLYQFLIA
FT                   VRQQDGAQLSTESGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPILKSFELKKRSDK
FT                   RVDTEKKLEEAVDQAEKLKQERRLVKVSPEHNDEAKYLLKLMGIPYIVAPCEAEAQCAQ
FT                   LAKDGKVYAAASEDMDTLCYKTPYLLRHLTFSEAKKEPIHEIDTELVLQGLELTQEQFV
FT                   DLGIMLGCDYCESIRGIGPVTALKLIKEHGSLEKIVEFIESGQANNKWKVPEDWPYNEA
FT                   RQLFLNPDVVNSQDINLKWNPPDEEKLIEFLCHEKKFNEERVKSGIKRLQKGLKSGVQV
FT                   RLDGFFQKVPKTKEQLAAATAKAKAAKKTKGKTGKVSKR"
FT   gene            <218040..>218111
FT                   /locus_tag="ZYRO0G02882r"
FT                   /old_locus_tag="Zyro0G.tAsp.GTC.8"
FT   tRNA            218040..218111
FT                   /locus_tag="ZYRO0G02882r"
FT                   /old_locus_tag="Zyro0G.tAsp.GTC.8"
FT                   /note="tRNA-Asp (GTC) cove score=55.70"
FT   gene            <220115..>221710
FT                   /locus_tag="ZYRO0G02904g"
FT                   /old_locus_tag="ZYRO-ORF1693"
FT   CDS_pept        220115..221710
FT                   /locus_tag="ZYRO0G02904g"
FT                   /old_locus_tag="ZYRO-ORF1693"
FT                   /product="ZYRO0G02904p"
FT                   /note="similar to uniprot|P12630 Saccharomyces cerevisiae
FT                   YIL015W BAR1 Aspartyl protease secreted into the
FT                   periplasmic space of mating type a cells, cleaves and
FT                   inactivates alpha factor allowing cells to recover from
FT                   alpha-factor-induced cell cycle arrest and to YLR121C
FT                   uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
FT                   Aspartic protease, attached to the plasma membrane via a
FT                   glycosylphosphatidylinositol (GPI) anchor and to YLR120C
FT                   uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
FT                   Aspartic protease, attached to the plasma membrane via a
FT                   glycosylphosphatidylinositol (GPI) anchor and to YDR144C
FT                   uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7 GPI-
FT                   anchored aspartyl protease (yapsin) involved in protein
FT                   processing; shares functions with Yap3p and Kex2p and to
FT                   YIR039C uniprot|P40583 Saccharomyces cerevisiae YIR039C
FT                   YPS6 Putative GPI-anchored aspartic protease, member on
FT                   vGLC.1466."
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29194"
FT                   /db_xref="GOA:C5DZB0"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033876"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZB0"
FT                   /protein_id="CAR29194.1"
FT                   /translation="MKWTILFAACCVLLSETVQCISVRHYLEEEEASSPKLVKFSFNKH
FT                   QGRTFTASEELSKRDKDVTFDLKNEQNFYSIKLSVGTPGQEVVVLLDTGSSDLWIPGSD
FT                   NPYCKESSSFSISNQGKENGAEGPFQTLPGGVTATNMSGGSTASATLDCKEFGTFNRED
FT                   SKTFHSNDTEFSVSYGDTSYAIGTWGYDSININDVNLTNVSIGVANKTNSSVGIMGIGL
FT                   SNLENTYTGVENVKNRNTHKYLNFPMLLKEQGFIEKNVYSLFLNRREAFEGSILFGAVD
FT                   HSKYSGQLYTVPMLNLYQQQGLKDPLQLQVTLQGVGIEANNMTNTTSTTPVPALLDSGT
FT                   TLVYLPDKMLAMLAEQLNAHWDRGIGYYVTDCSRVDNTNLYFNFGGFNIVSNMSTYVVS
FT                   RSNENSCVLGLQPGGPEAAILGDMFMQHAYIVFDLDDFEISMAQANYAGGKNQLEAVTQ
FT                   QVPSAMKAPGYSHTFSGSQGITGGGNIFYATSYSSSSGSSTSTRTWSGRNAAVDLAPAP
FT                   MLAFFAHFIYSFLI"
FT   gene            <222200..>223378
FT                   /locus_tag="ZYRO0G02926g"
FT                   /old_locus_tag="ZYRO-ORF1692"
FT   CDS_pept        222200..223378
FT                   /locus_tag="ZYRO0G02926g"
FT                   /old_locus_tag="ZYRO-ORF1692"
FT                   /product="ZYRO0G02926p"
FT                   /note="some similarities with uniprot|P14164 Saccharomyces
FT                   cerevisiae YKL112W ABF1 DNA binding protein with possible
FT                   chromatin-reorganizing activity involved in transcriptional
FT                   activation gene silencing and DNA replication and repair"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29195"
FT                   /db_xref="GOA:C5DZB1"
FT                   /db_xref="InterPro:IPR006774"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZB1"
FT                   /protein_id="CAR29195.1"
FT                   /translation="MTSLYEYRHPIINKSLASSADENAGRRFPTLESWYQVVNDYEFQA
FT                   RCPIILKNSHRNKHFTFACHLKDCPFKVLLSYCGGQRSIEEEDEDRSNGLVPLDKKDGG
FT                   EKLKNGNGTGAGAGGSATNPGGEDAEDDDVSAAIAAAVAAVQDSRHTKDEYEENSGVRG
FT                   PFVVTKIEPYHNHPLESNLTLQEFVLTKVPRILQHDLNFDQILESLCNEDDNTVSKFRV
FT                   SQYVEESGLLDILKERYGLTDAEIDKKLLSQISRRVTTYKARFVLKKKKNGEYGTDANN
FT                   FQYRQPRVRREPEILDADAQEAQAAAQAAIGEAVALKRHIDEEEETPRKRQMVKLDEVM
FT                   PLEDTQDDKLPRDVAEQLRLLSSHFKDVEAQTAEEKKEDISDENIQPELRGQ"
FT   gene            <223577..>225328
FT                   /locus_tag="ZYRO0G02948g"
FT                   /old_locus_tag="ZYRO-ORF1691"
FT   CDS_pept        223577..225328
FT                   /locus_tag="ZYRO0G02948g"
FT                   /old_locus_tag="ZYRO-ORF1691"
FT                   /product="ZYRO0G02948p"
FT                   /note="similar to uniprot|Q03153 Saccharomyces cerevisiae
FT                   YMR098C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29196"
FT                   /db_xref="GOA:C5DZB2"
FT                   /db_xref="InterPro:IPR025210"
FT                   /db_xref="InterPro:IPR040152"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DZB2"
FT                   /protein_id="CAR29196.1"
FT                   /translation="MLRISRALRGSRTVGLVRARSVLSSNSTSLRYFSRLPTCYQEKTN
FT                   NSTTTIPWYLKVGDRERALKQSIFKAQEINYPSNSPDSLRHISQYLCDELGLSDIIIFD
FT                   LRKGEFETAAAKISDFMVIATARSPKHCQTSFDKLNSLIKQEYESVAYVEGQFNAREEK
FT                   KRQRRLARKPKLSSNSTSNVPTESWFLIDCKVDKIFVNILTENRRQEINLEELYAPEHE
FT                   RHKYERKESSVEGREAPQEDDILAGLRRLVNQRRQYSTVAPSVVLCRQLLANLESSDFN
FT                   GAISLINNNREYSLNFMKTIHDWVSGLEIDAAKEIPWKKWVTTFESCWPLVLPEESASL
FT                   YWSLRMNFFKMINIADKEHYNINQFFNDYLLAKKSLGYPITSQDLIEFFKLTIINVRGD
FT                   GEKSRGYWEIVNRNALVSRALRLVEDVKDGNSIVQDGTLVSMLLRTMVSGEEEVPNHML
FT                   HATYEVIDYLVDTFGAAMDPTAIGGVLEVLAAARSWNKYMAFWEAGVGGLVPGEDHRPW
FT                   SQFIKLVVDSGDSEMIRKLLSEGHLLWLKRFEVKMTDDIKEQLDRLFEKGYSQGLWFEE
FT                   LKEHIYV"
FT   gene            complement(<225370..>226311)
FT                   /locus_tag="ZYRO0G02970g"
FT                   /old_locus_tag="ZYRO-ORF1690"
FT   CDS_pept        complement(225370..226311)
FT                   /locus_tag="ZYRO0G02970g"
FT                   /old_locus_tag="ZYRO-ORF1690"
FT                   /product="ZYRO0G02970p"
FT                   /note="similar to uniprot|P34253 Saccharomyces cerevisiae
FT                   YKL110C KTI12 Protein associated with the RNA polymerase II
FT                   Elongator complex involved in sensitivity to G1 arrest
FT                   induced by Kluyveromyces lactis toxin zymocin"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29197"
FT                   /db_xref="GOA:C5DZB3"
FT                   /db_xref="InterPro:IPR013641"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZB3"
FT                   /protein_id="CAR29197.1"
FT                   /translation="MPLVLFTGFPSTGKSTKARELVELLQKRIQNDPSLASKNYKVILH
FT                   SDESLGIKHSDYSTSQGERKLRSEIFSAVRRDLSKSNVVVVDSLNYIKGFRYQLHCEVK
FT                   GSSTTYCLINTMCPIDSIHDWNKNRKDPWDEDLLEQLIQRYEEPNANNRWDSPLFPILS
FT                   TQDSMESWIDDICSALFRTAAGKGSSDHRDPLSKALQAPNNATILKPASQSNFIQILDS
FT                   QTGNVVKKIMDHVRLLNSLGGSSGGERIIVSEVTDINDEKCCFVDLPPQSVTLPHLQRL
FT                   KRQFVNFNKLRDLDQDRIVPLFAEYLNKNLND"
FT   gene            <226466..>227461
FT                   /locus_tag="ZYRO0G02992g"
FT                   /old_locus_tag="ZYRO-ORF1689"
FT   CDS_pept        226466..227461
FT                   /locus_tag="ZYRO0G02992g"
FT                   /old_locus_tag="ZYRO-ORF1689"
FT                   /product="ZYRO0G02992p"
FT                   /note="similar to uniprot|Q03151 Saccharomyces cerevisiae
FT                   YMR097C MTG1 Peripheral GTPase of the mitochondrial inner
FT                   membrane essential for respiratory competence likely
FT                   functions in assembly of the large ribosomal subunit has
FT                   homologs in plants and animals"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29198"
FT                   /db_xref="GOA:C5DZB4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZB4"
FT                   /protein_id="CAR29198.1"
FT                   /translation="MPKFIPRFDFPRYNIPIADFKGHQLKALRRFEKLKPQFHLVLELR
FT                   DLRAPLSTRNVLLDQVVDKRHHERLVIYTKRDCFPSSSPYLDRLAQWHAELEENFLMVD
FT                   SRHRNASNHILRCIHWHHELHREKNYGLAPPLGFKVLVTGMPNVGKSTLINSMRGSSGK
FT                   VARTGSEAGVTRSTSESIKIGQDGNGVYLIDTPGVGLPARLSDANRMLALTLCGCVKRS
FT                   LVDPWIQADYLLYLMNLQLPYGTDNIKEAERKLSTYPGALEEPTNDLEVVLNRLRRHPR
FT                   ESDTSVALRWLEEPRSGLVLDPELLLPCADFSMSQHVKQELKHARKAMRK"
FT   gene            <228069..>228239
FT                   /locus_tag="ZYRO0G03014g"
FT                   /old_locus_tag="ZYRO-ORF1687"
FT   CDS_pept        228069..228239
FT                   /locus_tag="ZYRO0G03014g"
FT                   /old_locus_tag="ZYRO-ORF1687"
FT                   /product="ZYRO0G03014p"
FT                   /note="weakly similar to uniprot|P41902 Saccharomyces
FT                   cerevisiae YOR031W CRS5 Copper-binding metallothionein
FT                   required for wild-type copper resistance"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03014g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29199"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZB5"
FT                   /protein_id="CAR29199.1"
FT                   /translation="MLSEILNQACVSCKDSCQCGSSCCDNCTKCPCSNKPQCQSCGTNC
FT                   TCTNGKSCGCH"
FT   gene            <231742..>233376
FT                   /locus_tag="ZYRO0G03036g"
FT                   /old_locus_tag="ZYRO-ORF1682"
FT   CDS_pept        231742..233376
FT                   /locus_tag="ZYRO0G03036g"
FT                   /old_locus_tag="ZYRO-ORF1682"
FT                   /product="ZYRO0G03036p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03036g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29200"
FT                   /db_xref="GOA:C5DZB6"
FT                   /db_xref="InterPro:IPR018287"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZB6"
FT                   /protein_id="CAR29200.1"
FT                   /translation="MVVVKHLPPIQPYPVQHDAPVHIAPSDNGLGSDQAKRRQGGSRKG
FT                   LVIRTSKHWVLPPRPKPGRKPSERRRTAPSATAGATAPAATTPAPVTIPAPASATSTLA
FT                   SAPTVPTSVPVSASTSSPSAAVPPSTPVSPGTSSIKKDLSKLPIKNINQSSKAHPSANT
FT                   ASASVSESGCNNNNRDYTNTDDQSANSLTPCVSPSPPKRTKTSLKREIQHIKSENTKLK
FT                   QELGLLVGNLQDLKQKCRRVEAHEDSRNNDENVHCNRKRPLDESLAFLKFEEDEETLPP
FT                   LLSSNKMKTSSSVSSRTNLTDDEDLLTASSSTPNSLFSLDLQHSHSSSSSCSRSHSKSS
FT                   PSNEKSQLRFLDTFEQSEFNDKHAEKSMTAPAITATTSANPPTMAPSVELPLSSIKEEE
FT                   SDQFPWIDPAKEEASILDFLQTQQEIYTDPINDKDFFDNSITNNNGNDINDKNDEANGD
FT                   DNYNNDVTNHNNNTENDDLFQNLSLAAPPTATTTTTACYVPPSLEELMEEQDGGFVNNS
FT                   NANTTLTNVNDYDDDFDMLRTQVFDMA"
FT   gene            complement(<233580..>234464)
FT                   /locus_tag="ZYRO0G03058g"
FT                   /old_locus_tag="ZYRO-ORF1679"
FT   CDS_pept        complement(233580..234464)
FT                   /locus_tag="ZYRO0G03058g"
FT                   /old_locus_tag="ZYRO-ORF1679"
FT                   /product="ZYRO0G03058p"
FT                   /note="highly similar to uniprot|P43545 Saccharomyces
FT                   cerevisiae YFL059W SNZ3 Member of a stationary phase-
FT                   induced gene family transcription of SNZ2 is induced prior
FT                   to diauxic shift and also in the absence of thiamin in a
FT                   Thi2p-dependent manner forms a coregulated gene pair with
FT                   SNO3 and uniprot|P53824 Saccharomyces cerevisiae YNL333W
FT                   SNZ2 and YMR096W uniprot|Q03148 Saccharomyces cerevisiae
FT                   YMR096W SNZ1"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29201"
FT                   /db_xref="GOA:C5DZB7"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZB7"
FT                   /protein_id="CAR29201.1"
FT                   /translation="MSEFKIKSGLAQMLKGGVIMDVVTPEQAKIAERAGACAVMALERI
FT                   PADMRKSGQVCRMSDPKMIKEIMANVSIPVMAKVRIGHLVEAQILQALEVDYIDESEVL
FT                   TPADWAHHIAKNEFKVPFVCGAKDLGEALRRIDEGAAMIRTKGEAGTGDVSEAVKHISK
FT                   IRGQIQELKKELKTEEQFAQAAKEMRVPVELLKSTLEAGKLPVVNFAAGGVATPADAAL
FT                   LMQLGCEGVFVGSGIFKSSNPERLARAIVEATTHYNDPLKLLEVSSDLGELMSGQTVDG
FT                   IRQHGKQLANIGW"
FT   gene            <235025..>235684
FT                   /locus_tag="ZYRO0G03080g"
FT                   /old_locus_tag="ZYRO-ORF1678"
FT   CDS_pept        235025..235684
FT                   /locus_tag="ZYRO0G03080g"
FT                   /old_locus_tag="ZYRO-ORF1678"
FT                   /product="ZYRO0G03080p"
FT                   /note="similar to uniprot|P43544 Saccharomyces cerevisiae
FT                   YFL060C SNO3 Protein of unknown function nearly identical
FT                   to Sno2p expression is induced before the diauxic shift and
FT                   also in the absence of thiamin and uniprot|P53823
FT                   Saccharomyces cerevisiae YNL334C SNO2 and uniprot|Q03144
FT                   Saccharomyces cerevisiae YMR095C SNO1"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29202"
FT                   /db_xref="GOA:C5DZB8"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZB8"
FT                   /protein_id="CAR29202.1"
FT                   /translation="MTTSNTQGPQSSKTIGVLALQGAFIEHIQHLNRCIEQNSYNLKVI
FT                   AVRTAEELNQCDALVIPGGESTSMSLIAQRTGMYQPLYEFVHNPSKAIWGTCAGLIYIS
FT                   KEVSNEKDLLKPLELLEVKVKRNAFGRQAQSFIKDCDFSSFAPGVHDFPAVFIRAPVIE
FT                   EILDPKHVKPLYSLDNGLIVAAVQNENILATSFHPELAEDDIRFHDWFIKRFVIKQ"
FT   gene            complement(<235674..>236951)
FT                   /locus_tag="ZYRO0G03102g"
FT                   /old_locus_tag="ZYRO-ORF1677"
FT   CDS_pept        complement(235674..236951)
FT                   /locus_tag="ZYRO0G03102g"
FT                   /old_locus_tag="ZYRO-ORF1677"
FT                   /product="ZYRO0G03102p"
FT                   /note="similar to uniprot|P35203 Saccharomyces cerevisiae
FT                   YMR094W CTF13 Subunit of the CBF3 complex which binds to
FT                   the CDE III element of centromeres bending the DNA upon
FT                   binding and may be involved in sister chromatid cohesion
FT                   during mitosis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29203"
FT                   /db_xref="GOA:C5DZB9"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZB9"
FT                   /protein_id="CAR29203.1"
FT                   /translation="MDVAFFLGLPIDIRKQVYFHLDGQFVDLGPDIVQGLYFADVIKLP
FT                   AEPYKPSRHQQLLRKRLYSIFEPYLNIFDYVPSLVDRWLEYSLWLRYDCIVLDCMRLNH
FT                   LYEGELIGPINLIYLDGRVRVSFFDKNYMLWNWYTYREYAKWIDDENDQIELTYLKLNL
FT                   EYLRYDLVARILHDMQRDKVLDFVNQIQFEQEDEDDEPIEIDDQDDFETASYRIKDPTV
FT                   IKVIQTMDLMKGLQRLIFRGDRLYESLVNFHGVRDNPGKTINYMAKKRIVFLQLLQAGS
FT                   LCKTGVADFTRWENLRELKLVRVGEIDFNKMLLPPNCRLLTVRGAQTLYWWDVVDRIEQ
FT                   MVGDCYTSEVHGNVCHRTLDPKSMNIETFFQCQIIVKDSFQHLNFIKLQDIYELKGRKI
FT                   VVPRSLFYNKRILMSGEIGADQIIIV"
FT   gene            <237122..>238213
FT                   /locus_tag="ZYRO0G03124g"
FT                   /old_locus_tag="ZYRO-ORF1676"
FT   CDS_pept        237122..238213
FT                   /locus_tag="ZYRO0G03124g"
FT                   /old_locus_tag="ZYRO-ORF1676"
FT                   /product="ZYRO0G03124p"
FT                   /note="similar to uniprot|Q75DR2 Ashbya gossypii ABL045W
FT                   ABL045Wp and weakly similar to YKL108W uniprot|P34252
FT                   Saccharomyces cerevisiae YKL108W SLD2 Protein required for
FT                   DNA replication phosphorylated in S phase by S-phase
FT                   cyclin-dependent kinases (Cdks) phosphorylation is
FT                   essential for DNA replication and for complex formation
FT                   with Dpb11p potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29204"
FT                   /db_xref="GOA:C5DZC0"
FT                   /db_xref="InterPro:IPR021110"
FT                   /db_xref="InterPro:IPR040203"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZC0"
FT                   /protein_id="CAR29204.1"
FT                   /translation="MSLDQLKIELKTWEYEFQNKNERPPTKDDIKRLPEIKKMYKQYQA
FT                   LKRQNTDVSQVPKVVVMPSKNDTSPKKAVTTKKNDFNNVELGPTPQIYGKAISIFEMKL
FT                   SPVKKALNFEEINETSSDQPVDAVQDDTKRQLEFPSNTPNSSPFKKPKPVELKYYGPNS
FT                   PLKLEEENIRLSIRNGSPLKRTPQKNMNSNNDLTSFSPSPLVKRPLTKSLLELAKEHEE
FT                   FLREFNENNGKENIFTQETEDSSDEQHEDDGQVEYQEKKTKKRKILRRLVTSEESKVVP
FT                   KDISKELLKLKKQQVNEFLGNEAAEEDEENDHNDTDKANETQTPAPKPKPRKRASKYNL
FT                   VSNNFRRLKLPRKHAGNRRWPRR"
FT   gene            complement(<238354..>239886)
FT                   /locus_tag="ZYRO0G03146g"
FT                   /old_locus_tag="ZYRO-ORF1675"
FT   CDS_pept        complement(238354..239886)
FT                   /locus_tag="ZYRO0G03146g"
FT                   /old_locus_tag="ZYRO-ORF1675"
FT                   /product="ZYRO0G03146p"
FT                   /note="highly similar to uniprot|Q04305 Saccharomyces
FT                   cerevisiae YMR093W UTP15 Nucleolar protein component of the
FT                   small subunit (SSU) processome containing the U3 snoRNA
FT                   that is involved in processing of pre-18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29205"
FT                   /db_xref="GOA:C5DZC1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018983"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZC1"
FT                   /protein_id="CAR29205.1"
FT                   /translation="MSSTRPRIVTAKAPVLPQQTTPEQRYWRQYSSAQLVKEHNSVTHI
FT                   AFNPVHPHDFAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDATGL
FT                   VSVYDSYNPRALLVSINASTHPTHVTKFHSHDSKSLVTASDDRITRVWDISQSYEPQLE
FT                   LKGASDYVRSVNFVPAAPHLVMTGSYDGHVRLYDTRVNGAAPVYSLDHGVPVEDIVAVS
FT                   PTQVASCGGSNFKVWDLTSNKKLYERGNFNKTVTCLDYVESSDSAAQSTLLASSLDGHV
FT                   KVFDPLDNYRVKFGWKFSGAVLSCALSPGDAQGTKHLVAGMSSGLLAIRTKGKNKQADS
FT                   LPSTAPRATKSNNYQRMMRGSEYQGDQEYIIHNDKLRQTQRIRAFEKNINQFKWAEALD
FT                   SAFIPGMAKELTLTVLQELRKRGKIRVALYGRDEASLEPLLNWCLKGIEDVRSAPVVAD
FT                   WIAVVLEMYGSALENSIVLRELVLSLKDKVRQEVYNAKEAQKIEGMLQLLTN"
FT   gene            <241103..>242923
FT                   /locus_tag="ZYRO0G03168g"
FT                   /old_locus_tag="ZYRO-ORF1673"
FT   CDS_pept        241103..242923
FT                   /locus_tag="ZYRO0G03168g"
FT                   /old_locus_tag="ZYRO-ORF1673"
FT                   /product="ZYRO0G03168p"
FT                   /note="similar to uniprot|P46680 Saccharomyces cerevisiae
FT                   YMR092C AIP1 Actin cortical patch component probable
FT                   binding site on actin lies on front surface of subdomains 3
FT                   and 4"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29206"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZC2"
FT                   /protein_id="CAR29206.1"
FT                   /translation="MSAIELKSVIPPQPSTERNFTTHLSYNESKNAIAYPCGKSAFIRF
FT                   LGEDEDAVVQFVGHATANVNVVRFSPIPGSEYVASGDDFGKVIVWSFLRDEKTGEFETK
FT                   IKAEFEVLAGPISDISWDFEGRRLCVVGEGRDRFGAFISWDTGNSLGEISGHSQKINAC
FT                   HFKQSRPMRAFTVGDDGSVVFYQGPPFKFTASDRTHHDSGKFVRDVQFSPGAGEHAVTV
FT                   GYDRRIVCFDGKTGEFIKYIEDQDEPVQGGLFALSWLDATRFVTASADFTLRLWSVTES
FT                   KCLQKWTLPQSLGHQQVGVVTAKDDQIISLSLDGTLHFFQVGKEGVVKSLKGHNKGITA
FT                   LAVNPLVSGSFDGRVMTWNSEPSEMHSDHTNLVLAIDNSKHPDYATIAWDDTLKVSGTA
FT                   KHQFKDQPRVAQVASGEGVVAVVTTGESLLIINSFTGEVIQETKLSEPATAVGIGKQFV
FT                   AIALERSKYIEVFKASDLSVSYKLPTALRAAGSYISFSPSEKYLAVGEVMGKITLFDLE
FT                   TKEIKTSRWAFHTSRINAISWQPSEKEDLVATGSLDTNIFIYSVEKPMKVIKRLNAHKD
FT                   DITAVLWENPETLVSAGSDACIKKWAVKFE"
FT   gene            <243282..>244610
FT                   /locus_tag="ZYRO0G03190g"
FT                   /old_locus_tag="ZYRO-ORF1671"
FT   CDS_pept        243282..244610
FT                   /locus_tag="ZYRO0G03190g"
FT                   /old_locus_tag="ZYRO-ORF1671"
FT                   /product="ZYRO0G03190p"
FT                   /note="similar to uniprot|P32832 Saccharomyces cerevisiae
FT                   YMR091C NPL6 Nuclear protein that may have a role in
FT                   nuclear protein import"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29207"
FT                   /db_xref="GOA:C5DZC3"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZC3"
FT                   /protein_id="CAR29207.1"
FT                   /translation="MSDEKELENSIGPQAEEEARPRSRSASARPDYKVDNEEFDLKEED
FT                   DDDEYHENEDIDAEENIGDEDADDDFEDKRSRSHKRARADDENKSETEDSRGGSVLPGT
FT                   PSGIKKPHYSIPVDDMGAPLPVVNEEYDLPDDEEGETKITKNGELLGGRQFLVRSFTLL
FT                   DKGRRRFMLSTEPARAVGFRDSYLFFQYHPNLYKYIISQEQKNDLIDRSILPYSYRNRQ
FT                   IALVTARSVFKEFGAKIIVNGKNITDDYYATRLREEGHVVEGTYAREPPKKVVRPTDSL
FT                   DYAIGAINPAKNAVEFFDKRHQTHNSAAAGAASTNKVTATNWLYQHAAACSRFNSDLFY
FT                   DRVRVLLIEQHGIRDPYTNTLHIPLSTQSTSVVGVRKLPIKRDSRDNDQDYQIKHETLI
FT                   ADPDLTRIKTGLLGIPSEIYEDVVSDEVKEAIREQQKFEKTLL"
FT   gene            <245037..>247529
FT                   /locus_tag="ZYRO0G03212g"
FT                   /old_locus_tag="ZYRO-ORF1670"
FT   CDS_pept        245037..247529
FT                   /locus_tag="ZYRO0G03212g"
FT                   /old_locus_tag="ZYRO-ORF1670"
FT                   /product="ZYRO0G03212p"
FT                   /note="similar to uniprot|P40341 Saccharomyces cerevisiae
FT                   YMR089C YTA12 Component with Afg3p of the mitochondrial
FT                   inner membrane m-AAA protease that mediates degradation of
FT                   misfolded or unassembled proteins and is also required for
FT                   correct assembly of mitochondrial enzyme complexes"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29208"
FT                   /db_xref="GOA:C5DZC4"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZC4"
FT                   /protein_id="CAR29208.1"
FT                   /translation="MLAISRPCLKLLTRSHARPVISRTLAVRPLLVRNFHPASTLLLRK
FT                   NSPRNNKNNSGDKDQDNNRHEDATDEDLERVRQEVEKYINSVKDNKNVSLEERRKRIDE
FT                   GVRRLEETITRQEARDQASQTYETEGEEDRKVKNGNPFTFESKKTDEAHEKTNKKKDNE
FT                   ERKNEEMNAFNDPNGSMSNNIGLFQLGLVFLILSFVLSFFNDVEENREITWQDFHSKLL
FT                   SKGFVSKLIVINKSYVKVLLNDAGKNQAEHNGHDYYHFTLGSVDSFEHKLQKAQDDLKI
FT                   EQDFRVPVVYVQEGNWSRAMMQLLPTALMIAGIIWLTRKSASAAGGGRGGIFGMGRSKA
FT                   KQFNTETDVKVKFKDVAGCDEAKEEIEEFVSFLKEPSRYEKMGAKIPRGAILSGAPGTG
FT                   KTLLAKATAGEAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMIFVDEIDAI
FT                   GKARQKGNFSGANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDILDRALLRPGRFD
FT                   RHVNIDKPELSGRQAIFEVHLKKIKLAGDIFDLKNRLAALTPGFSGADIANACNEAALI
FT                   AARNESDSVKLVHFEQAIERVIGGVERNTKLLSPEEKKIVAYHEAGHAVCGWFLKFADP
FT                   LLKVSIIPRGQGALGYAQYLPGDIYLLSEQQLKDRMTMALGGRVSEELHFSSVTSGASD
FT                   DLKKVTRMATAMVTQLGMSPKIGWINYQRKDESDLTKPFSSETGDVIDSEVFRIVQECH
FT                   DRCTQLLKEQASSVEKVAQLLLEKEVLTREDMISMLGKRPFPERSDAFDKYLNENETRK
FT                   IEEKEQENTDGEKPNSPA"
FT   gene            <247798..>249486
FT                   /locus_tag="ZYRO0G03234g"
FT                   /old_locus_tag="ZYRO-ORF1669"
FT   CDS_pept        247798..249486
FT                   /locus_tag="ZYRO0G03234g"
FT                   /old_locus_tag="ZYRO-ORF1669"
FT                   /product="ZYRO0G03234p"
FT                   /note="similar to uniprot|Q04301 Saccharomyces cerevisiae
FT                   YMR088C VBA1 Permease of basic amino acids in the vacuolar
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29209"
FT                   /db_xref="GOA:C5DZC5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZC5"
FT                   /protein_id="CAR29209.1"
FT                   /translation="MDDDTAPLIPPESRDEESLEAEYHRYNLSLPKLPILTSLWLGSFI
FT                   GSLDGTIVANIMNRVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTA
FT                   HFFFGLGCLLTCFAQSVEQFALARAICGIGGGGINACSSIAVSDICTAKERGSYQGYAN
FT                   IVFGTGQMLGGPIGGLLIDTIGWRAIFAVQVPIIMFCSFLTYKNITIKLSHIPPVSERF
FT                   TWMNLSRIDIMGSSSLVVVICGILFICSTNWNKVILSTFTIVGFLFFIVTETYFAKECI
FT                   LPLKLLKGASGLCSLVTVLSSFITFGEIFRAPIYYQVVQDMSVTKTGLFVLFPAVSVAV
FT                   GSVVTGTALRHTKLDLGHYCYLIILRSIFTQLIGLLLAYVVINGTEPTIGASSSTFAVH
FT                   WFQFSSDSIWWKILLVSAGCMVSYGYSGLLVATLVSIVCSVEKSEQATLTGIFYLWRSI
FT                   GSVLGTSLTLVIYENSLTKSLWGAMFGSRNDDSYHYTKKEYYNLIGDSSYLRSHFPVQS
FT                   IEYLLKAYRGSFLISYLPSIGLAILGIVTSWVLITVNRFSRQKTF"
FT   gene            complement(<249502..>250284)
FT                   /locus_tag="ZYRO0G03256g"
FT                   /old_locus_tag="ZYRO-ORF1667"
FT   CDS_pept        complement(249502..250284)
FT                   /locus_tag="ZYRO0G03256g"
FT                   /old_locus_tag="ZYRO-ORF1667"
FT                   /product="ZYRO0G03256p"
FT                   /note="similar to uniprot|Q04299 Saccharomyces cerevisiae
FT                   YMR087W Putative ADP-ribose-1''-monophosphatase that
FT                   converts ADP-ribose-1''-monophosphate to ADP-ribose may
FT                   have a role in tRNA splicing contains an A1pp domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29210"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR028071"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZC6"
FT                   /protein_id="CAR29210.1"
FT                   /translation="MKVILCDTNEAICKSWVKFLGRNIRSSSEARFQFHIHHGSLEPLL
FT                   KGESSTNCAVVSPGNSFGYLGGGFDLAIRNYLGGEKFESWFRQQIGPGYHHVGSSTVVD
FT                   LGVGSGSGSQIWGNRGIRYIIHVPTMVAPSKPLYDPNFPMRTGYEPVFNATWNSLASSI
FT                   SLNVDTLIIPGLCSGWVGVPVEVTCKSMCFALRLYAMRNQMSVDLQNALIMYFLKYPFK
FT                   PFMRSSFKEECRELNINVNQLKNFDAERDSIESIMPGM"
FT   gene            <250775..>252088
FT                   /locus_tag="ZYRO0G03278g"
FT                   /old_locus_tag="ZYRO-ORF1665"
FT   CDS_pept        250775..252088
FT                   /locus_tag="ZYRO0G03278g"
FT                   /old_locus_tag="ZYRO-ORF1665"
FT                   /product="ZYRO0G03278p"
FT                   /note="similar to uniprot|Q01802 Saccharomyces cerevisiae
FT                   YKL106W AAT1 Mitochondrial aspartate aminotransferase
FT                   catalyzes the conversion of oxaloacetate to aspartate in
FT                   aspartate and asparagine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29211"
FT                   /db_xref="GOA:C5DZC7"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZC7"
FT                   /protein_id="CAR29211.1"
FT                   /translation="MSNWLQCSRRCFWNRTNYGTRALSSFDKIPRAPPDKILGLTEQFS
FT                   KDKNAKKVNLTVGVYKDNQGLVTTFPTVAKAQKILDQDENMNSDLSYLPIIGSPAYRKS
FT                   TLNFLFRDSCPESGPKLLEQERVSFVQTLSGTGALVVAADLLAQFVSRTVWIPNLSWPN
FT                   HTNIFKRHGFNDVRQYSYYENGKLTVDKWIDNLKKNVKKNDGSRHCIILHACCHNPTGV
FT                   DPTVEQWRKILDAVRELEMIPIIDMAYQGLVSGNPAKDAYVLRMCLDESRYGNWPHGLF
FT                   LCQSFAKNMGLYGERVGSLSVVVPPNQPESKGNVESQLKQIVRSMYSSPPAYGCRVATL
FT                   VLSSDDFKRDWYKDVESMVQRLLNVRQGMYDRLGWEGLINFEQQHGMFFYTGLKPHALN
FT                   RLRDEYSIYMTMDGRLSLSGVNDHNIDYVCDAFKAILD"
FT   gene            complement(<252293..>255502)
FT                   /locus_tag="ZYRO0G03300g"
FT                   /old_locus_tag="ZYRO-ORF1664"
FT   CDS_pept        complement(252293..255502)
FT                   /locus_tag="ZYRO0G03300g"
FT                   /old_locus_tag="ZYRO-ORF1664"
FT                   /product="ZYRO0G03300p"
FT                   /note="some similarities with uniprot|Q04279 Saccharomyces
FT                   cerevisiae YMR086W Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29212"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZC8"
FT                   /protein_id="CAR29212.1"
FT                   /translation="MISQKRLSRGLEKPVDGEAVKAASVIGKAMNHNGKVLGQNNHFRA
FT                   PASRSGSLMGNSNNSNNNQVRRTFSMTGSRQSSLRSPSMNSSSGAVRTRSVMRSDPRQK
FT                   DTGVSRSYSLTVPKRNVTQQDAQSAFDEFGGPQHRGVIHRSPSVSSIPKGAKTVRKYVP
FT                   SAKGLIAIDVPVEEAQQQEQLAQQQIQRNRSLTRSNSRNYSLTKNNSRTNSLTGSRTNS
FT                   LTGPRSVSLNSARTNSIRRSSSRTSSLTGSKPNLQPPKRYSSLTSASLVNGSRRDQFMS
FT                   TPLEEEEEDVKPPVRTQTKPGQTKPGQMNPGQTKPGQMNPGQTKFGQTKPGQTKTGQTK
FT                   FGQTVSGNSTVSPRTVTTKTVSKKPLGAPEPSGRAKTIPTVKNKVPTTVHSTERAPLHK
FT                   PLSSSSPPASETSDLSMNHHEKESHEQAGESQDTILEDEREDHYDDSGNRLWDDKLENV
FT                   IKQGFEDGPQQATSTSTPVSSPTPVENSKPSILPSAPAEEHAKQPIPQELQQPMEEKAP
FT                   VTKGREDESRKENENDEDYKPQEHKNLDEPKPQGNHREDSSNREEIHDQSEKTPAVTVG
FT                   QVNDKTTAVSQPPVNESSQNRLKDYLQGEDEQLENSGIESVASDQNPNESLVQPLKISS
FT                   RESPQADTSTSAQEDELAKEVRQELDIMGHNSSNDNSDQNSDDLFVDSREDILDDFDAN
FT                   GNQAGRKVPSLPERNPKRGNGNKAQADGGVLKTTSPIKSALKKTTSENSNPSMYTESSP
FT                   ANQAYLSLTTAENTRLNAQLTGSDTIPRKSSLKSINRSRTMLNNRATHSLSPPPREALV
FT                   PKRHSHHVGNKTSADRKATGTPPARSRNSMLNAPSRSQKPLKGESSNSAAKSKLNNPIL
FT                   YPREPPQKRSSFEKTRNKDNNVGMSKLSLRDGALLENNYQQSSLDNHFRGATAAPSVPS
FT                   SGTENGNSTALFSSSGFKSRFQDSDSEDEGLPVNGVGGKPDQQANATNSNGNGFSLFKH
FT                   KDSGESEGFGKKLGKLSLKSSNGSDQGVDYSTTKRFGNGGGVESKVRTLRDEIPADNEL
FT                   ADGGKKNAFGKKLKKLFGRHK"
FT   gene            complement(<255923..>258088)
FT                   /locus_tag="ZYRO0G03322g"
FT                   /old_locus_tag="ZYRO-ORF1659"
FT   CDS_pept        complement(255923..258088)
FT                   /locus_tag="ZYRO0G03322g"
FT                   /old_locus_tag="ZYRO-ORF1659"
FT                   /product="ZYRO0G03322p"
FT                   /note="highly similar to uniprot|P14742 Saccharomyces
FT                   cerevisiae YKL104C GFA1 Glutamine-fructose-6-phosphate
FT                   amidotransferase catalyzes the formation of glucosamine-6-
FT                   P and glutamate from fructose-6-P and glutamine in the
FT                   first step of chitin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29213"
FT                   /db_xref="GOA:C5DZC9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZC9"
FT                   /protein_id="CAR29213.1"
FT                   /translation="MCGIFGYCNYLVERSRGDIIDTLVEGLQRLEYRGYDSTGIAIDGD
FT                   TPESTLLYKQIGKVDALKQEIARDAPERSTTFASHCGIAHTRWATHGEPRQINCHPQRS
FT                   DPQNEFTVVHNGIITNFRELRTLLANRGYTFESDTDTECIAILFKHLYDENLSNGHELD
FT                   FHELTKLVLTELEGSYGLLCKSVHYPEEVIATRKGSPLLIGVKSDKKLKVDFVDIEFPD
FT                   DAAGKPDTPLGSKSGTPNASSRNLLNANRRTRPYEGNNFLPLAANEFNLRHSQSRAFLS
FT                   EDGTPNPVEFFVSSDAASVIKHTKKVLFLEDDDIAHIYDGELHIHRSRRPEVGASMTRS
FT                   IQTLEMELAQIMKGPYKHFMQKEIFEQPDSALNTMRGRIDFENGTVMLGGLKAWLPAVR
FT                   RARRLIMIACGTSYHSCLATRAIFEELSEIPVSVELASDFLDRKCPVFRDDVCCFVSQS
FT                   GETADTMLALNYCLERGALTLGIVNSVGSSISRATHCGVHINAGPEIGVASTKAYTSQY
FT                   IALVMLALSLSDDRVSKIERRKDIIRGLHKIPDQIKEVLKLETRIKELCHNDLKDHKSL
FT                   LLLGRGYQFASALEGALKIKEISYMHSEGVLAGELKHGVLALVDEQLPIIAFGTRDSLF
FT                   PKVVSSIEQVTARKGRPIIICNTNDEVWAKKAETNKLLTLEVPQTVDCLQGLLNIIPLQ
FT                   LISYWLAVNRGIDVDFPRNLAKSVTVE"
FT   gene            complement(<258593..>260107)
FT                   /locus_tag="ZYRO0G03344g"
FT                   /old_locus_tag="ZYRO-ORF1656"
FT   CDS_pept        complement(258593..260107)
FT                   /locus_tag="ZYRO0G03344g"
FT                   /old_locus_tag="ZYRO-ORF1656"
FT                   /product="ZYRO0G03344p"
FT                   /note="similar to uniprot|P14904 YKL103C Saccharomyces
FT                   cerevisiae LAP4 Vacuolar aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29214"
FT                   /db_xref="GOA:C5DZD0"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZD0"
FT                   /protein_id="CAR29214.1"
FT                   /translation="MSDQRAIIDHLTKTLELLSVEKSQPQQQKSVPEPRRVDTQDLVEY
FT                   SHSYIDFTYDNPTIYHLTASLSQKLEKAGFTYLSEKENWQDKLTKGQGGKFYTVRNGTN
FT                   LSAFVVGDKWDQYKGVGAIGAHADSLTAKLKPLSKKKSVEGYELLGVAPYGGTLNDLWF
FT                   DRDLGIGGRVLYKDGDQFKSKLISSAPHPIARIPSLAPHFGAPALPPFDKETQAVPVVG
FT                   FSQGEEEEAATEQEKGSVLFGKHSLQLLRYVAQLAGLDVAQLVQLDLDLFDVQKGTIGG
FT                   IKNDFLFAPRIDDRICSYASLIALLEYAANVDLANSDTFALVALFDNEEIGSLSRQGAI
FT                   GGLLKTTVERSARAFHEGPVDFHSLWANSIILSADVNHLFNPNFAEVYLENHRPKPNVG
FT                   VTLSIDTNQHMVTDVIGTTFAEELGRINGDRVQYFHIKNNSRSGGTIGPYIASQTGART
FT                   IDLGIPQLSMHSIRATTGSKDVGLGVKFFRGFFKNWRPVLDRFGDL"
FT   gene            <261014..>265864
FT                   /locus_tag="ZYRO0G03366g"
FT                   /old_locus_tag="ZYRO-ORF1653"
FT   CDS_pept        261014..265864
FT                   /locus_tag="ZYRO0G03366g"
FT                   /old_locus_tag="ZYRO-ORF1653"
FT                   /product="ZYRO0G03366p"
FT                   /note="similar to uniprot|P34244 Saccharomyces cerevisiae
FT                   YKL101W HSL1 Nim1p-related protein kinase that regulates
FT                   the morphogenesis and septin checkpoints associates with
FT                   the assembled septin filament required along with Hsl7p for
FT                   bud neck recruitment phosphorylation and degradation of
FT                   Swe1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29215"
FT                   /db_xref="GOA:C5DZD1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZD1"
FT                   /protein_id="CAR29215.1"
FT                   /translation="MPAPMGNRYATRSQRSSNVAKKAARNAMMKVPGGTANTNVKTAVN
FT                   TDTNDPTAGVTQNQLDRVVQSVNDATNRLSQPESAFSISTTTKSSKRRSRDTVGPWKLG
FT                   KTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFSATMNTTTN
FT                   TNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLISHSNILGLYEVWENKSELYLVLE
FT                   YVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLLLDKKNKS
FT                   IKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILFALLTGH
FT                   LPFNDDNIKKLLLKVQSGKFHMPQNLSAEAKDLMSKILVVNPFKRIATEEILNHPLLTK
FT                   YDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIVDLRSREDIDDSIVSNLQILW
FT                   HGASRELIVAKLLQPRMSEEKLFYSLLLSYKEKHSPKPESEAPPQFEPTQPTDEIQQPQ
FT                   LAPLQPPSLEPTLAPEVVQQSLPAQDEEDEEELTKSQTTNEEDSSQLNESQDTSAPKLP
FT                   QKSQFSASSIDQHSMSGFSSMQSAALSGVPSVPANSLPPAMPIFTAPSSRTFKNSGPAL
FT                   SIPSKKSLKHSASKTSLNHSASKKSLHHSASRKSLVHASPSTTSLHNSASKKSLHNSPP
FT                   KKTLQNSASKRSLYSQTSISKRSLNLSEYVATENAVISEMEQQLKPNLPSSESNGDFEK
FT                   LCEQILFGNALEKILEEEEDDGASATTSNTSQRTLTKVDASQRSPHSSDSKNKTPAAKT
FT                   IPPAFELNTPESEEEQQLRASAHKNLLAEENNRYPFKDITNNPTLAPSDSKPSKSKRDV
FT                   SQKSDLSEVLNSNQFGGSTFSSNDVLRNNSRKSEFKPSLRVTNDVRSASENQSKPVQPS
FT                   YSLDPRRNATQPVNPKVVASLLKRAKTKKNIRDARKSGDWSYISGSHFNTNTDINFDDK
FT                   LENIFDHGFNNRLDGNLERGLVDSGLKRASEDTRSSLWQPSLRDSHVESDAEHNTSGTN
FT                   EFFDTSDVNVLAHSSIIQKPNDVTRQPSLLSHTGTFKNLSEYLHKEGNANNIANRSHEE
FT                   NPSNVMRKKSTELNLAPRSTLTAALDPKDRSMYTNSFMSNMSDMSYVMEMPSRTYEAQA
FT                   IEVSNNSSADDITDLPVNSDREFGQSSSQGQHTTATFEDNNVNIFEDAPVDSDSSDTAS
FT                   EDSQQNVRRKAVSIDTLHTTNVLTPATNVRVSLYLNNNNHTESPLKRETTEEIISKFKL
FT                   SPEKSSQPLVQKRYSALAANRNSDIHSTMTMFKDLEEEQDAEDISQWKPSESPAGEGQE
FT                   KPNRVTMLFDNEEEMPQLEHQITPTPEVPQKNENRSVPDTKSTRASEEKSMKSIDEGLQ
FT                   KAEELPHTNESSKQLKEPPMHAPPQPKSKVKSSGSPLPAKSKKSKPMKEKSQTATAAST
FT                   ATPSAPPNVSNSAAATPSSASPAPRKQNWFTKLFGGFKSQKSDLGRLQQDHFTKISFDD
FT                   AHLLTLHEFDKNAVEYHLKSLDHKLHDEKVEYDCKFPTGFAFKIKITTTVLGQKNSTIL
FT                   TVKKKGRNTSSDVKGAFQMFNQNVANVIREAEMGYNV"
FT   gene            complement(<265952..>267064)
FT                   /locus_tag="ZYRO0G03388g"
FT                   /old_locus_tag="ZYRO-ORF1651"
FT   CDS_pept        complement(265952..267064)
FT                   /locus_tag="ZYRO0G03388g"
FT                   /old_locus_tag="ZYRO-ORF1651"
FT                   /product="ZYRO0G03388p"
FT                   /note="similar to uniprot|P07246 Saccharomyces cerevisiae
FT                   YMR083W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29216"
FT                   /db_xref="GOA:C5DZD2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZD2"
FT                   /protein_id="CAR29216.1"
FT                   /translation="MLRTRTLLSRFGPFGQLRLSSTISIPSTQKGVIFYESGGKLHYKD
FT                   LAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGAGVVVAKGENVKN
FT                   FEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHADLSGYTHDGTFQQYATADAIQAAHIP
FT                   KGTDLAGVAPILCAGVTVYKALRSSGARPGEWVAISGAAGGLGSLATQYARAMGLRVVG
FT                   IDGGEDKAKLFKSLGGEIFIDFTKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVEY
FT                   VRPQGTVVLVGLPANAVIKSNVFNHVVKSFSIKGSYVGNRADSREAVEFFSRGLVKSPI
FT                   KIVGLSELPKIYELMEAGKILGRYVVDTSK"
FT   gene            complement(<269170..>270291)
FT                   /locus_tag="ZYRO0G03410g"
FT                   /old_locus_tag="ZYRO-ORF1646"
FT   CDS_pept        complement(269170..270291)
FT                   /locus_tag="ZYRO0G03410g"
FT                   /old_locus_tag="ZYRO-ORF1646"
FT                   /product="ZYRO0G03410p"
FT                   /note="similar to uniprot|P07246 Saccharomyces cerevisiae
FT                   YMR083W ADH3"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29217"
FT                   /db_xref="GOA:C5DZD3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZD3"
FT                   /protein_id="CAR29217.1"
FT                   /translation="MLRFSQTLSGLKRVGQLRLQSSFTIPKVQKGVIFNKFGGPLLYRE
FT                   DLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVAKGKDVK
FT                   TFEIGDLAGVKQLVSSCMGCESCEIGHEFGCEQAEMSGSSHDGTFQQYVAIDALQAPPL
FT                   PANVDLAAVAPIFCAGVSVYKALKNGNLQTNQWVAIFGATGGLGSIAVQYAKAMGYRVL
FT                   GIDGPGEERKQLFHSLGGEVFLDYTQVDNIPAAVKQATQGGAHCVLNVTASLAAYDQTI
FT                   KCVRPLGTVVPVGVPPDSGLLKTDIFTIVQHGFSIKGSASGSRADTREAVDFFTRGLIK
FT                   SPIKILGLSELPKAFELLESGQTTGRLVLDTSK"
FT   gene            complement(<270661..>270732)
FT                   /locus_tag="ZYRO0G03432r"
FT                   /old_locus_tag="Zyro0G.tGlu.TTC.59"
FT   tRNA            complement(270661..270732)
FT                   /locus_tag="ZYRO0G03432r"
FT                   /old_locus_tag="Zyro0G.tGlu.TTC.59"
FT                   /note="tRNA-Glu (TTC) cove score=60.23"
FT   gene            complement(<271038..>272471)
FT                   /locus_tag="ZYRO0G03454g"
FT                   /old_locus_tag="ZYRO-ORF1644"
FT   CDS_pept        complement(271038..272471)
FT                   /locus_tag="ZYRO0G03454g"
FT                   /old_locus_tag="ZYRO-ORF1644"
FT                   /product="ZYRO0G03454p"
FT                   /note="some similarities with uniprot|P32945 Saccharomyces
FT                   cerevisiae YPL179W PPQ1 Putative protein serine/threonine
FT                   phosphatase null mutation enhances efficiency of
FT                   translational suppressors"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29218"
FT                   /db_xref="GOA:C5DZD4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZD4"
FT                   /protein_id="CAR29218.1"
FT                   /translation="MGNSPSRSNNNFAVPSASNGILQTSDDNNNEPNEPDDSGPTKSID
FT                   IGIGNNGTSNGNGNGMGCNRERYRRCSADSGTTMVGGSGSSSNRNNGGGDIGEKGFLLN
FT                   VGISTAKAFGGAGSVGSDSASSENTLISPRQNRTCSYDSQGSSYGSTSIPNYRSKQHRV
FT                   VLQRYPNDPSNNECLDLDDAIEKLLQIGETRHYKSRDFPFRTWEIQLICCHAREILLSQ
FT                   PSLLQLQAPIKVVGDIHGQFTDLLRIFKLSGVPPETNYLFLGDYVDRGKQSLETILLLL
FT                   CYKVKYKDNFFMLRGNHESANVTKIYGFYDECKRRTSSKVWKTFVDVFNTLPFAAIIQD
FT                   KIFCVHGGISPDLKSLQRIAQIARPTDIPEEGLLTDLLWSDPDSQISNWSDNDRGVSFT
FT                   FGKKNVLDFCSQFNFDLVIRGHMVVEDGYEFFAKKKLVTVFSAPNYCGEFNNWGAVMSV
FT                   TTGLMCSFELLKPHGRRKS"
FT   gene            <273211..>274854
FT                   /locus_tag="ZYRO0G03476g"
FT                   /old_locus_tag="ZYRO-ORF1641"
FT   CDS_pept        273211..274854
FT                   /locus_tag="ZYRO0G03476g"
FT                   /old_locus_tag="ZYRO-ORF1641"
FT                   /product="ZYRO0G03476p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29219"
FT                   /db_xref="GOA:C5DZD5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZD5"
FT                   /protein_id="CAR29219.1"
FT                   /translation="MSSKPNFLIIVADDLGFTDVGQFGGEIDTPNLDALTGDGLRFTGF
FT                   HTASACSPTRSMLFSGTDNHLAGLGQMAEFARDFPEKFGGKPGYEGYLNFKVAALSEIL
FT                   SPEYYTILSGKWHLGLDEPYWPDKRGFEQSFSLLPGAGNHYKFNLQEKQFLPSIYQENG
FT                   RLLDAEKELPDDFYSTDYFTTKFLDYLEDEKRKDRPFLGLLTYTAPHWPLQAPPKTIEK
FT                   YKGVYDKGPLELRKKRLQRAQELGIVPPDVVPHLVETISEAGWDELDEKTKAYSSRVME
FT                   TYAAMVDELDQHIGRVINHLKKTGEFENTVIMFLSDNGAEGMMMEALPFGGKLFKDRIS
FT                   AKYDNSYENIGRGDSFVYYGDMWAQAATAPRYMYKMWASEGGINCPLIFHYPKLHGEGG
FT                   KITEQFTTVMDILPTVLDLSNVPHPGTTFQGRQVYKPKGKSWVPYLAKSSDRIHDEDTV
FT                   TGWELFGQRAIRRGPFKALYIPKPFGSGAWQLFDASKDLGEINDLSGQLPEILEELLGH
FT                   WSTYCAETGLVELEELPSKDNVKFRVIQDN"
FT   gene            <275243..>276802
FT                   /locus_tag="ZYRO0G03498g"
FT                   /old_locus_tag="ZYRO-ORF1640"
FT   CDS_pept        275243..276802
FT                   /locus_tag="ZYRO0G03498g"
FT                   /old_locus_tag="ZYRO-ORF1640"
FT                   /product="ZYRO0G03498p"
FT                   /note="weakly similar to uniprot|Q6B1X3 Saccharomyces
FT                   cerevisiae YPL181W CTI6 Protein that relieves
FT                   transcriptional repression by binding to the Cyc8p-Tup1p
FT                   corepressor and recruiting the SAGA complex to the
FT                   repressed promoter contains a PHD finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29220"
FT                   /db_xref="GOA:C5DZD6"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZD6"
FT                   /protein_id="CAR29220.1"
FT                   /translation="MDQDDSEQAMPGVKQEIPHESSPDGISEPQDTEGGDEEGETRCIC
FT                   KELDPPDDSGLYIQCEQCGAWQHGYCVGISDGEDSYLEKYWCEQCKPELHRLYTVDSAG
FT                   TLRSLYQPIQEKRRHIRRNSRQRPNSNPTSGSQLEDSQHDSSNSSLRETPEKNPTDDSR
FT                   ESRSRSSRSRRSLEKSIGNDIREADQDQENDGNNGHNNTNDNGKRNNSNSELDRLGESP
FT                   LSEDPIEDGDEDDKKLQDRKRATFSAREEKHYQWMLEKAIRESRRTSKHEDDSHDAGDG
FT                   QKLGLEADLTNEEVPDQAQESKESRTHQGRNDYWHNGEENVAVTENEHSQSPPVNLQEF
FT                   HGYGASNSAANSGTSASGAAASATNRTRDDPLLSRSASMNSNSEDDSKRPKKSKRGPNR
FT                   GNRSSGNGNGARASTPPKGKLELGVNKPMKPRLPSQRTSLNEMRRRVGAILEFISRTQW
FT                   ELSEDQSSRDDLIRFVENQQFVQQVDTIFESHDHTLKLMDDLTRSLLLWEKKYSNGPTI
FT                   QD"
FT   gene            complement(<276847..>278595)
FT                   /locus_tag="ZYRO0G03520g"
FT                   /old_locus_tag="ZYRO-ORF1638"
FT   CDS_pept        complement(276847..278595)
FT                   /locus_tag="ZYRO0G03520g"
FT                   /old_locus_tag="ZYRO-ORF1638"
FT                   /product="ZYRO0G03520p"
FT                   /note="similar to uniprot|P38932 Saccharomyces cerevisiae
FT                   YGL095C VPS45 Protein of the Sec1p family essential for
FT                   vacuolar protein sorting required for the function of both
FT                   Pep12p and the early endosome/late Golgi SNARE Tlg2p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29221"
FT                   /db_xref="GOA:C5DZD7"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="InterPro:IPR027482"
FT                   /db_xref="InterPro:IPR036045"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZD7"
FT                   /protein_id="CAR29221.1"
FT                   /translation="MDLFTVADFYINRLVNSQARAGSTSLVEQNRIKALILDKDTTSTI
FT                   SMCATQSELLNHEIYLVDTIENDNRDVMRHLRCLVYVKPTEETIQALIRELENPRYGDY
FT                   HIFFNNTVTKSQLERLAEADSMECVSKVEEIFQDYFILNEDLFSFDLPPENLFTNSLLW
FT                   DEVGLTDCTKSLTSLLLSLKLKPEIRFDAPSRLCGKLAKEISYEINQNERSLFDFPPMD
FT                   SPPVLVLLDRKTDPLTPLLQPWTYQSMINEYIGVKRNMVDLSKVPDIDKDLQKVTLSPR
FT                   QDSFFKDTMYLNFGELGDKIKQYVDNYKDKTNTNSQINSIEDIKNFIEKYPEFRKLSGS
FT                   VAKHMAIVGELDRQLQMRDVWEVSEVEQNLSVHKDDPEDFRDLVKILESPKIDKYYKLK
FT                   LACIYALRQGNNNSQLNEIVQILQKQPLFPVDDINLFHKFRRIFGQNQAVDEGQGRYWE
FT                   RDDLLSELTKRFNSKVRNADSGNVFMQHIPKISKLLTDFSKNKVPKEQFKTLEETETSR
FT                   NANASPPSQDLIVFVVGGVTFEEARFVHEFNETMRGKMRVILGGTSVISTHEYMESIRQ
FT                   TNNSGI"
FT   gene            <278843..>281212
FT                   /locus_tag="ZYRO0G03542g"
FT                   /old_locus_tag="ZYRO-ORF1637"
FT   CDS_pept        278843..281212
FT                   /locus_tag="ZYRO0G03542g"
FT                   /old_locus_tag="ZYRO-ORF1637"
FT                   /product="ZYRO0G03542p"
FT                   /note="similar to uniprot|Q08921 Saccharomyces cerevisiae
FT                   YPL180W TCO89 Tor Complex One"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29222"
FT                   /db_xref="GOA:C5DZD8"
FT                   /db_xref="InterPro:IPR018857"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZD8"
FT                   /protein_id="CAR29222.1"
FT                   /translation="MGHKNKIRSELDSMAAQSSSKGLQNMTSNSASGHTTRPFRQFSTK
FT                   SRAKSTASFKGLHRITPHDSGSDADSHHSGESVFRKSGSSDSLYRKRAISGLNMTALTR
FT                   VKSNPSQMPGSRSSSVNSSTSYSLGAVSTGLKPSTSKPTHSVVGLHGDDKDIDNDTTTD
FT                   EEVEYFSDEEENENGKSQKSSPIGENMPRENSNNKVKRTPEENKMLSKSFSELTLPYER
FT                   AENEAPHLVNQPSYKAPSSLINPQQEQLLSNSYKEVNDGNNDTNTENNDGGNAKPESNE
FT                   LKRQESDETANDKILHDDGDDRIDNNNLYPAAVDTSMEAGAHSLKRQGKNFQDPQENGL
FT                   SLMGEDESPRGTGNYISQRRNSDHEQYIPSMILSQSTGVERRFDQPASIQNSLANNYQV
FT                   MPPLEEAQNGAIKEYNMGLNKENQIIDSPSFQNVNRDQLLQQQQHQQQEEQHQQPQPPQ
FT                   PPPLQQQPSQRQPHFQHFHQPQLQQHSQVPPQQYQQPQQHHLSRQKQANNTNSNTQHSF
FT                   STSISSLTSSLQKMAPENVYNTSRKSHLLRKKPSQISFLGSSFRGSNAEVPNSYLHRES
FT                   PPASSDINNFAQFLKSDNMDGESRTQRKLWLQRENSILDLSSQHEASDSIFMASNIEVK
FT                   REFERISHEYTNVRRFSNPIEEALARVDSEQKHTVIKSTTSQDSEMLDSLIPRPINEGK
FT                   EIDELLPKSQSAKLHKVLQSIWREESALFNKDTNPVNRNKSPISGHVTNTSRTSLKNVM
FT                   NPGSALQHQRVINSLQPTTRAVNRRMENALHNQQRL"
FT   gene            complement(<281481..>284786)
FT                   /locus_tag="ZYRO0G03564g"
FT                   /old_locus_tag="ZYRO-ORF1635"
FT   CDS_pept        complement(281481..284786)
FT                   /locus_tag="ZYRO0G03564g"
FT                   /old_locus_tag="ZYRO-ORF1635"
FT                   /product="ZYRO0G03564p"
FT                   /note="similar to uniprot|P53010 Saccharomyces cerevisiae
FT                   YGL094C PAN2 Essential subunit of the Pan2p-Pan3p poly(A)-
FT                   ribonuclease complex which acts to control poly(A) tail
FT                   length and regulate the stoichiometry and activity of
FT                   postreplication repair complexes"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29223"
FT                   /db_xref="GOA:C5DZD9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR028881"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZD9"
FT                   /protein_id="CAR29223.1"
FT                   /translation="MNNWKPSLTDFLDLTEHLKKPFYRHDSREKEASKVVFDDLSNLIW
FT                   VGDSYARVSSYYGGSLSLYSRYTANIGGLPVNDILTHREGILSLNEDSLHFANRRGVTM
FT                   MNLTSVDVAAFSGLRSMCFGGAEYVNHVYCAGTNPNSGIVRIDLNRGTPSSVISYPHKV
FT                   KHMCSNNKVISVGKQTGGVDILDPRSNSVVRTFSAHSGTISSMDSKDYTLVTVGKSKRF
FT                   NNMYADPFVNVYDLRTMQQLPPISFSKGTTMGAGGADFVQLHSLLPTVMVVGSASGSFD
FT                   FVDLANPTLRTQYIHPSQSIKSMALSPNGDYLAFTGDDNTLTTWNRTDDSHNFTNTPIP
FT                   LEYSDFVDDGLLPHLTDVDDQSYHLSSVGMPYYSQQLISAWPNSIFRSPGTIPTPLDEH
FT                   MPITKPRPKSNPGAYPLQKYDRSKYGRRNALESYVCLKEIRKKFASGIIPSDMLKYKST
FT                   EECEVPKAYMKLPLTHGRYGTDNFDFQAFNQTSYSTLDNDVDNVYTNSILQLYRFVPEL
FT                   FNFVVGSLKDENFGLHSLLTELGYLYDMMDRSKGKVCRSANFQSTLNSIDGFKEQGLTT
FT                   PLSTDLTFLERLKINDEPITSPSMERLRKSLVQKFNEFVLHRLMNEESEKVPSTVTLKE
FT                   LYGFQLDSTIRTSCNYQEVLKSVEPTLTVLSPTRNSIKYANKKMNSQTILPYIESSMRR
FT                   VKHTTSTCSKCNKQELTTYERVMRNLPPILSLDILLSESEWAVVKSVKNWLSKEFFAAM
FT                   TKEKALLQSSPQELRGISPIFKYELNGYVARISDRNGESRLVTFIRKYESEENIFKWYM
FT                   FNGYLAVEVDEEEALNISYWWKTPETIIYCDAEEIRKPFFSVDTYRINYDVLYRNHFAN
FT                   GVGITAKTQYELLCKEEAPKPGTLVAIDAEFVVLSEELSEIDCTGVKTIVKPKKTALAR
FT                   LSVLRCEEGAQFGVPFIDDYIFNKEHIENYLTRYSGISPGDLDLEKSDKPLVSREVTYR
FT                   KVWLLMQLGCVFVGHGLSNDFKHININVPKEQIRDTALYFLRGKRFLSLRYLAYALLDK
FT                   NVQEGNHDSIEDAYTALILYKKYLDLKEKGTLEHVLDTIYAEGRASNYRVPFQ"
FT   gene            <285054..>287969
FT                   /locus_tag="ZYRO0G03586g"
FT                   /old_locus_tag="ZYRO-ORF1633"
FT   CDS_pept        285054..287969
FT                   /locus_tag="ZYRO0G03586g"
FT                   /old_locus_tag="ZYRO-ORF1633"
FT                   /product="ZYRO0G03586p"
FT                   /note="similar to uniprot|Q08924 Saccharomyces cerevisiae
FT                   YPL183C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29224"
FT                   /db_xref="GOA:C5DZE0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZE0"
FT                   /protein_id="CAR29224.1"
FT                   /translation="MHSVSHYGPALSVKFLDRFVYAGYGPFLHVYEYATGKLANKCLIF
FT                   NKNKVHGVRIGDNGLILCYGSRSVNLTSIQDVHEKSSIVESEKHTSEWIISGEFNSDCS
FT                   QFYLLTCYDRVLTCDLECHVVKKSAVYGERSILYSGSIKVVSEDKVFINAGTVMGGIIV
FT                   WELFSETLVANLLGHSGSIFYVEMNRDGSLIASCSDDRSVRLWDLKSQKELSVGWAHTA
FT                   RIWHLLFYNNDTRLISVSEDCTCRVWDIQSGKLLQSAIHEVHLTKNVWCVDVNEKDQLA
FT                   ITSGNDGRLRLISLTEQESLQRNFTIKQISDDSKVPFAKQEIIKGFHWFSFGLVAITSE
FT                   GKILQYGNQWKFLMQNPQFKSYSMTNGISKDNIVIFSNNKCNLLILKFNSEGSEIVASR
FT                   ELHVDTLTKSQNCMVCRHHDRNEFFVTLESPNPHDPFMCLKFDTDSLNLRGQFGLKKPE
FT                   SFASSCLEIYESFLLVGSRFSVIAIFDLNNTSQESLVSRRLTPGDTTTSIHLVEFSIGG
FT                   PVFVVTNRDGYYNFIRLKLGNPIEELEIIHSNRTARGFLEGAYYDNNGDLITYGFKSEL
FT                   FYIYNETQCYEKAVRVCGGAHRQWELARTPEGFMLVFIRASDLHFTRVIEPKVPEVLQC
FT                   GTHGREIRDIALLKDFKYKNGHLFCTASEDTTIKLCHVHESTGQVTTFWTLRKHVSGLQ
FT                   RCKFLSSKLMISSSAREELFLWELTTDCNTKPYIKFRQALPISGNNPDLRITDFSVKFE
FT                   GSNFILAAVYSDSAVKLWRYNHLQNRFQLAVEGHYKTCCILNASLFEFKNQSYLMLSAT
FT                   DGHLSLYNLTNTMNGGTVCPLPSVESSIQIHQSSIKAMNISVDDQNDAVRVYTGGDDNA
FT                   LAICAFHWESQTKRLLPHLKDVQRSAASSTITSSELINDDKQLVTASVDQIVRIWDTEN
FT                   DKLVLQEQKYTTVADTGSLDAVSNLLLIGGVGLSVWKTEHH"
FT   gene            <288530..>289138
FT                   /locus_tag="ZYRO0G03608g"
FT                   /old_locus_tag="ZYRO-ORF1631"
FT   CDS_pept        288530..289138
FT                   /locus_tag="ZYRO0G03608g"
FT                   /old_locus_tag="ZYRO-ORF1631"
FT                   /product="ZYRO0G03608p"
FT                   /note="similar to uniprot|Q07843 Saccharomyces cerevisiae
FT                   YLL033W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29225"
FT                   /db_xref="GOA:C5DZE1"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DZE1"
FT                   /protein_id="CAR29225.1"
FT                   /translation="MAGRTILTRNAVINSTHTLIKCPEKYLLPSLEVSNLPSFVRMAYR
FT                   RLFRLQSFISNRKMVRDTYGEYLRYKFKKENYDTKRSIVVGDTPKAPLREEIRNSVMFV
FT                   VKAVSHLPETKDSKFAIARDNTTCRQVLKNLLTIEYEKQSLIARYRPPTKRRDMVGPYQ
FT                   IYRKDFTHMQELNKSAQWRVFGEFDICTVYLNEILQTRL"
FT   gene            complement(<289222..>291534)
FT                   /locus_tag="ZYRO0G03630g"
FT                   /old_locus_tag="ZYRO-ORF1630"
FT   CDS_pept        complement(289222..291534)
FT                   /locus_tag="ZYRO0G03630g"
FT                   /old_locus_tag="ZYRO-ORF1630"
FT                   /product="ZYRO0G03630p"
FT                   /note="similar to uniprot|Q07834 Saccharomyces cerevisiae
FT                   YLL032C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29226"
FT                   /db_xref="GOA:C5DZE2"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZE2"
FT                   /protein_id="CAR29226.1"
FT                   /translation="MHIYTHFNSSAFVELPHVFQTGRLWKSNKDKSAAWGSAVWGNSRC
FT                   LVNGVPQDAKCVSVVRREDQQGVYTIQGVTEVCDTEPVVCTAIPVRDLATNVESFLGEL
FT                   RQRLIELANEFDVEIVVTKEPVYGASQLAGNFPLYVHILGFQSHVVAGEIHLWSLVELY
FT                   RSSRGAGPALFVEYLDLDAHSLLPSVAGIDMANLKYVQQAFQTQAYVSALTLPMDRDSG
FT                   RESRFRPQVVLCGKVYSLVLAAKDFLAHMAQRPPQSPVYFRRFNSLSSGKLLYIQKHYR
FT                   LELNRLMIKYQSLVKVTDSCIEFRSTCLPLLEALIKAFTINILHRILEVQVTMDKNFQF
FT                   NEDSIRQVVMEDLIVVTIPSKENQLLVIGNHSPTATDHTSTIFKQVAAIHPASAVRQLR
FT                   AIFEIHMDYEDFISGKKNGKLTRVMETVHCLIKLERLEDDDNMFLTLIADSTPEFIRAC
FT                   NLVINELPAEEAFFIPEIYHRPVIGPGGSVIQATMKKYNVFVQFSSTFFLPQNDLSCTR
FT                   YDNVVIRCPYKNVSAIPQAREELALLAQECSKLRPLALVKLSRGQYRFLLSSSSPSIAQ
FT                   TIANIEKNHKAFVDFPTEEPTDNYLLEVRGTDNNCLQAAKELISGSYGCETIVKLDQPM
FT                   VLDHDFYNSIVIPFKHAMGIEVTASSDTIRLVYKRGNGSLNKSLEVLSDYVRSHRRKVM
FT                   TTELERNFLVTFEDQQENQKKAIDETTANAIKLQQFHIDSQLAVLPPLYHRDMQYLQKS
FT                   EDSREPLNLVQYGYTAR"
FT   gene            <292070..>292143
FT                   /locus_tag="ZYRO0G03652r"
FT                   /old_locus_tag="Zyro0G.tVal.AAC.9"
FT   tRNA            292070..292143
FT                   /locus_tag="ZYRO0G03652r"
FT                   /old_locus_tag="Zyro0G.tVal.AAC.9"
FT                   /note="tRNA-Val (AAC) cove score=67.58"
FT   gene            <292557..>292643
FT                   /locus_tag="ZYRO0G03674r"
FT                   /old_locus_tag="Zyro0G.tLys.TTT.10"
FT   tRNA            join(292557..292593,292608..292643)
FT                   /locus_tag="ZYRO0G03674r"
FT                   /old_locus_tag="Zyro0G.tLys.TTT.10"
FT                   /note="tRNA-Lys (TTT) cove"
FT   gene            <292925..>293920
FT                   /locus_tag="ZYRO0G03696g"
FT                   /old_locus_tag="ZYRO-ORF1628"
FT   CDS_pept        292925..293920
FT                   /locus_tag="ZYRO0G03696g"
FT                   /old_locus_tag="ZYRO-ORF1628"
FT                   /product="ZYRO0G03696p"
FT                   /note="similar to uniprot|P28321 Saccharomyces cerevisiae
FT                   YKL094W YJU3 Protein of unknown function localizes to lipid
FT                   particles"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29227"
FT                   /db_xref="GOA:C5DZE3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZE3"
FT                   /protein_id="CAR29227.1"
FT                   /translation="MPILRNPLRRSKTASSMPQTQGYPTSSEFPYPYKPKTEIPAKKFI
FT                   EFNDANFATLFWPSVSKPKGRVLIVHGFGEYSRLQHRLMDQLALNGYESWTFDQRGAGE
FT                   TSEGKERGRTNEFHVFNDLDHFIELNYKETQEKGIPLILFGHSMGGGITLNYGIRGTHK
FT                   EKIAAYSTTGPLVVLHPHSAPSSAIILVAPLLATFLPNFQINSGLDVDAIAGDPQYKKF
FT                   LLHDEPLGMPLIGTLRQIYDFLQRGKQLDENSDGYVTKFVKRPLFIMHGANDTINDPAA
FT                   TKRFYNNSTLTDKKLEVYPGMVHSLLSLENDENFAKVFDDYREWLDSKFA"
FT   gene            <294505..>294996
FT                   /locus_tag="ZYRO0G03718g"
FT                   /old_locus_tag="ZYRO-ORF1626"
FT   CDS_pept        294505..294996
FT                   /locus_tag="ZYRO0G03718g"
FT                   /old_locus_tag="ZYRO-ORF1626"
FT                   /product="ZYRO0G03718p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29228"
FT                   /db_xref="InterPro:IPR031443"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZE4"
FT                   /protein_id="CAR29228.1"
FT                   /translation="MSVTPSVGISFHELVLQEEYLMSLRPILMYASTKRPTSCRSQDIF
FT                   ERAVQDPFGWSSEDSPPSFSGFNGFSKSDSFNGFDRWCMGGNNGSDSSTSSTKDGNGVP
FT                   KSSQSPPRSNSIPTHLFGLERYVSSGLDELSARDCAPLGKQRKKSFIEMSLASSFSRDE
FT                   "
FT   gene            <296534..>299368
FT                   /locus_tag="ZYRO0G03740g"
FT                   /old_locus_tag="ZYRO-ORF1622"
FT   CDS_pept        296534..299368
FT                   /locus_tag="ZYRO0G03740g"
FT                   /old_locus_tag="ZYRO-ORF1622"
FT                   /product="ZYRO0G03740p"
FT                   /note="similar to uniprot|P30771 Saccharomyces cerevisiae
FT                   YMR080C NAM7 ATP-dependent RNA helicase of the SFI
FT                   superfamily required for nonsense mediated mRNA decay and
FT                   for efficient translation termination at nonsense codons"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29229"
FT                   /db_xref="GOA:C5DZE5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018999"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040812"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZE5"
FT                   /protein_id="CAR29229.1"
FT                   /translation="MSHNASSESDNGFDDIQDVDVDVLDAQDVPDVDVPEMQAQDAQDV
FT                   LGTLDQQASSEHACAYCGIDSPSCVVKCNSCRRWFCNSKNGASTSHIVNHLVLAHHNVV
FT                   SLHPESDLGDTVLECYNCGCKNVFLLGFVSARGEAVVVLLCRIPCAQAKNANWDTEQWQ
FT                   PLIENRQFLNWVAEEPNDEERLEARLITPTQISKLEAKWKSDKNATINDIDAPEEQEEI
FT                   PSALLRYQDAYEYQRSYGPLIKLEADYDKTLKESQALEHISVTWSLGLNNRHLASFALS
FT                   TFESNELKIAVGDEMILRYSGSLHPEWHGRGYIVRPPNSFQDEFTLELKPSKTPPPTHL
FT                   GTGFTAEFIWKGTSYDRMQDALKKFALDKKSISGFLYYKILGHQVVDIAFDVPLPKEFS
FT                   IPFFAPLNASQSHAVEHALQRPLSLIQGPPGTGKTVTSATIVYHLSKLHKDRILVCAPS
FT                   NVAVDHLAAKLRMLGLKVVRLTARSREDVESSVSDLALHNLVSRSAKGELKKLLKLKEE
FT                   VGELSVKDTKKFVKMVKIAESDILKKADVVCCTCVGAGDRRLGAKFKTVLIDESTQASE
FT                   PECLIPIVKGAIQVILVGDHQQLGPVILERKAGDAGLKQSLFERLISLGHVPLRLEVQY
FT                   RMNPHLSEFPSNMFYEGSLQNGVTIEQRTVPNSTFPWPIHEVPMMFWANYGREEISANG
FT                   TSYLNRIEAMNCERIITRLFKDGVKPEQIGVITPYEGQRAYILQYMQMNGSLDTDLYVN
FT                   VEVASVDAFQGREKDYIILSCVRANDQQSIGFLSDSRRMNVGLTRAKYGLVILGNPRAL
FT                   STNVLWNNLLIHFREKGCLVEGSLNNLQLCTVQLTRVRQHKKGRQDKFPFNLGPEVGEF
FT                   SSSNDFDTQSLMSFGGQADTFNDVYAATNELASYLNNEAWNAKEYRPSTDKKSTQQKED
FT                   VTAELNKQVESLNI"
FT   gene            complement(<299653..>302688)
FT                   /locus_tag="ZYRO0G03762g"
FT                   /old_locus_tag="ZYRO-ORF1618"
FT   CDS_pept        complement(299653..302688)
FT                   /locus_tag="ZYRO0G03762g"
FT                   /old_locus_tag="ZYRO-ORF1618"
FT                   /product="ZYRO0G03762p"
FT                   /note="similar to uniprot|P33314 Saccharomyces cerevisiae
FT                   YKL092C BUD2 GTPase activating factor for Rsr1p/Bud1p
FT                   required for both axial and bipolar budding patterns
FT                   mutants exhibit random budding in all cell types"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29230"
FT                   /db_xref="GOA:C5DZE6"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR039360"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZE6"
FT                   /protein_id="CAR29230.1"
FT                   /translation="MSDSSVRSSFSRARFDLDKFLSTMQSLRGSFGGDVYWSYDLHSSN
FT                   SWNKNRCQITDVGSLRCCKETDESDLIDHLQNCKVKFIEKHNGVFPTIQVSVGLKKIYL
FT                   RVQDASTFEELVCALMWWSGLRKNGIFEKFTPQKPVLDGDDGATNLLVSQLYVFGPVLN
FT                   KIVPVDNKLNKPDFLPNSEIEEGWFPAMGVLKSNGVLDLLLQQDGTLIYSLNIAVLLRS
FT                   EIRIPDSSLGTENYLFLKAIPSLRKSLKLVRNQKFIHTSKHAHNSAILLKFPLKIDVED
FT                   WFVALKSFAIAENFSLIAADKSNHVRVSNSFSLSILEGRFKESEVDDELPSLYVELSMW
FT                   GYKCGRTPVVDQSYSPFWREIFKFHESLLVNDLRLDIKKRSFDAKTPDKTIGYIELSQE
FT                   NINDPKLIKETRLPVMSAIRKNEEIGTLCIKIVSSLILVLPSSNFTRMEKLLQIVDPEE
FT                   LCGLVQDFSDGVDVKIDNISDIFLDIFQALNRENDWFGALLKRELSVVDSSIARNTIQN
FT                   KTSSHIYSTLFRGNSVLTISMEKYFYRVGHEYLDKSIGDVLRDVIDKQVSCELDPARIE
FT                   ERDPALVQEIVARNKETLSHYVGQLWHRIYTTSNDLPMSIREQMRTFRKKLELICMEDD
FT                   FNTTLNCVSGVLFLRFFCPVILNPKLFNWVSEHLDETSQRNLTLICKVLLNLSNITYFG
FT                   NKEPFMILMNEFIESHKSELLDYIDKVTLKKIDFSPKKLKLAGCVARPNLTMNKEELKE
FT                   LPMNPYLIDKHLRETEIFTFLASITIRKEGNLHLLKNMKFGTDDVICDRPVMGQKLMIR
FT                   GLEFEKITENNTEIFGSDLLKYLEGGETPTSDDNKPHENPNLNEDIIEQLKQESMLLYH
FT                   KIGNLTQMLTDYEYPSEVVLNQPNYSEFLADNTYFTKDKKLIANLRGDLGDLKGLEKLF
FT                   DFKTKKSALFDNIVTWGGIDCLDTTDGPPVYASTSESSSSLSRNITRLKSKRLPKIIPG
FT                   SSKEKNRDKSPGKLKRLFKRST"
FT   gene            complement(<303087..>304082)
FT                   /locus_tag="ZYRO0G03784g"
FT                   /old_locus_tag="Zyro0G.mRNA.3307.m"
FT   CDS_pept        complement(join(303087..303992,304074..304082))
FT                   /locus_tag="ZYRO0G03784g"
FT                   /old_locus_tag="Zyro0G.mRNA.3307.m"
FT                   /product="ZYRO0G03784p"
FT                   /note="highly similar to uniprot|P24280 Saccharomyces
FT                   cerevisiae YMR079W SEC14
FT                   Phosphatidylinositol/phosphatidylcholine transfer protein
FT                   involved in coordinate regulation of PtdIns and PtdCho
FT                   metabolism products of which are regulators in Golgi to
FT                   plasma membrane transport functionally homologous to
FT                   mammalian PITPs"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03784g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29231"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZE7"
FT                   /protein_id="CAR29231.1"
FT                   /translation="MVTAAEKEIFESYPQSCRPEAGSGTPGNLDDAQKKALAELRSILE
FT                   SAGYTERTDDSTLLRFLRARKFDVKLAKEMYVNCENWRKENGVDTILKDFRYDEKPLVA
FT                   KYYPQYYHKTDVDGRPVYFEELGSVNLTEMYKITTQERMIKNLIWEYESFCKYRLPACS
FT                   RYSGYLQETSCTIMDLKGISISSAYQVLSYVKEASNIGQNYYPERMGKFYLINAPFGFS
FT                   TAFKLFKPFLDPVTVSKIFILSSSYQKDLLKQIPAENLPEKFGGKSKVSESEGGLYLSD
FT                   VGPWRDPKYIGPEGEGPKMFSMN"
FT   gene            <304402..>306522
FT                   /locus_tag="ZYRO0G03806g"
FT                   /old_locus_tag="ZYRO-ORF1616"
FT   CDS_pept        304402..306522
FT                   /locus_tag="ZYRO0G03806g"
FT                   /old_locus_tag="ZYRO-ORF1616"
FT                   /product="ZYRO0G03806p"
FT                   /note="similar to uniprot|P49956 Saccharomyces cerevisiae
FT                   YMR078C CTF18 Subunit of a complex with Ctf8p that shares
FT                   some subunits with Replication Factor C and is required for
FT                   sister chromatid cohesion may have overlapping functions
FT                   with Rad24p in the DNA damage replication checkpoint"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29232"
FT                   /db_xref="GOA:C5DZE8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZE8"
FT                   /protein_id="CAR29232.1"
FT                   /translation="MDSTVPNCTSIGESFLFGGSGGEKESVKEVGKNDSNNGDREFVSG
FT                   SGKVVRLRKRVNSSVENYGGSLWREDETYGININALLDKIESESASNGHHQDEKASNLH
FT                   DNELWVEKWRPRRFIDLVGNEKTNRRVLRWLRQWSPAVFQESLPQPLYENEFDPLQRPA
FT                   KRILLLHGPPGIGKTSVAHVIAKQAGYTVAEINASDERGGWQVRDKILNTLFNHTFNQS
FT                   PVCLVADEIDGTLESGFIKVLIDVVNSDARATRKMGVPKKGKKNRDKLLLRPIIAVCNN
FT                   LYAPALEKLKPLCEIVPFKRPSDFSLNERLDTICRVEGVKIHSKSLKDLIDLSQGDVRN
FT                   CVNNLQFWATGTSSQASSSSMDTDPMGKDFSSSWYGLVNSIFQRDPHRESRDQLSSLSQ
FT                   QIELNGNYDRIVQGCHSIFPRVKYSDNGVIKPSRIADWLYFHDLMNKSLYQHNGELMRY
FT                   CAAVPLQFAHMFGDIANKEDIQVKNSQYEFNELRKFTMDITNCIAHQTLKRSPAVQTFT
FT                   SRQSLIFETLPYLDSMISADVSKCKNLKVKQAIYDNLAELLNFYQLNVVARNHDSLEGK
FT                   KILSIDPPLDQIVLLDNKRKQEVLSKRPGSLNFLLAKFEENKARKRHVDQTMEKRERED
FT                   EVRVKRSKTAMASGNTVDFFKTQYGINEPNKLDTEVPISKHQEDEIRTWVRYKEGFSDA
FT                   VRKNVAWSSLWS"
FT   gene            <306789..>307433
FT                   /locus_tag="ZYRO0G03828g"
FT                   /old_locus_tag="ZYRO-ORF1614"
FT   CDS_pept        306789..307433
FT                   /locus_tag="ZYRO0G03828g"
FT                   /old_locus_tag="ZYRO-ORF1614"
FT                   /product="ZYRO0G03828p"
FT                   /note="similar to uniprot|Q04272 Saccharomyces cerevisiae
FT                   YMR077C VPS20 vaculolar protein sorting (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29233"
FT                   /db_xref="GOA:C5DZE9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZE9"
FT                   /protein_id="CAR29233.1"
FT                   /translation="MGQRPSRVKITKNDRAILQLKRSKDEIHKFAKRTDNLIASERVRL
FT                   KTMIQEDPKHYKENPKIRFLLKRIHYQNHLLEQAGDQLINLENLVSTLEFKLVELQFVK
FT                   GLEHGNEILSKLNKEFKGADQLMDNVQSQTSYQNEINDVLARSVVGVDDFEEELDKELD
FT                   QLEEQFILKKEPQKEPEIQMPSTEGLPDLKSEEQDSAEHASEEIIGERALA"
FT   gene            complement(<307633..>308889)
FT                   /locus_tag="ZYRO0G03850g"
FT                   /old_locus_tag="ZYRO-ORF1613"
FT   CDS_pept        complement(307633..308889)
FT                   /locus_tag="ZYRO0G03850g"
FT                   /old_locus_tag="ZYRO-ORF1613"
FT                   /product="ZYRO0G03850p"
FT                   /note="similar to gnl|GLV|CAGL0J01936g Candida glabrata
FT                   CAGL0J01936g and some similarites with uniprot|P40564
FT                   YIR004W Saccharomyces cerevisiae DJP1 Cytosolic J-domain-
FT                   containing protein, required for peroxisomal protein
FT                   import"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29234"
FT                   /db_xref="GOA:C5DZF0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR026894"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZF0"
FT                   /protein_id="CAR29234.1"
FT                   /translation="MVVDTEYYDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAAT
FT                   ERFQSISEAYQVLSNKDLRANYDKSGKEKAIPKGGFEDAAEQFSVIFGGEAFAAYIGEL
FT                   TLLKNLQKQEELHAEEEAEKEKEKEKKEDEKKKQKEKEEEIKQKGDNIDQLNKDMSHLT
FT                   VYDEQNQPKDTAKKSKLAEFEEELKAEKEKNNEKLVKILIDRLSILTESAYDNDCKRSF
FT                   ERKFEEEANLLKMESFGLDILHTIGSVYVERAKIYLASHKAFGLGGMFQSMKARGGVFM
FT                   DTLRTVSAAIDAQSSMKELESMKEASESTTPQHDKQGNEISKPTPEEVAHQEEILMGKV
FT                   LSAAWYGSKYEIMSTLRTVCDRVLEDESYDKLTRDRRAEALILLGKVFQRTYRTKVEQE
FT                   EAQIFEQLVAEATKKKRHT"
FT   gene            complement(<309117..>312716)
FT                   /locus_tag="ZYRO0G03872g"
FT                   /old_locus_tag="ZYRO-ORF1612"
FT   CDS_pept        complement(309117..312716)
FT                   /locus_tag="ZYRO0G03872g"
FT                   /old_locus_tag="ZYRO-ORF1612"
FT                   /product="ZYRO0G03872p"
FT                   /note="some similarities with uniprot|P40563 Saccharomyces
FT                   cerevisiae YIR003W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29235"
FT                   /db_xref="InterPro:IPR021582"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZF1"
FT                   /protein_id="CAR29235.1"
FT                   /translation="MSSEELPPVPSRPQRQAGSPSPIPTIPARPNSKSPPPQVPTRRPT
FT                   RVKTSDLKDLMQNTDDQLEQMQNLIQKRSDDSKVHSEQLRNQEDSWQRGKEDLIGTNEM
FT                   EFELQEEKERLLKKKEIELKERNIHQANREKELEMLERRREELMREREKERQQELKRQQ
FT                   QLELEDQRQRELERKQELELEAKRKELEQLEREQQLAREKAVKLQETKHQFEEKRTLDT
FT                   ESKEKTTSDNEPVLEKADEDFGIRNETKEEPEIPRIPERPRRSQSPTDTESKSNVEIPK
FT                   IPGIPERPKRSQSPTDTESKSDVEIPKIPERRPRPIGRRSIETPVVAEKRPESLENKLG
FT                   EPPVVPGKRPESLEEKVSEPLASLEQKPEFLERKVSEPLASLEQKPESLEEKVNEPLTA
FT                   PENKLESIKKEASTEFPSVPAKRPEHLKKELPDEFTAPLEKKPEPFEKEPSEFSFLPEE
FT                   KPNSLEKKLSNESSLSQKNPEPIGKKPSAELSVASEERPEPVEKNSTSESLVLPEKRPE
FT                   ALEKELSTGINAQSEKELETLKKEPSNDSTTVPERTTESEEKKSSTEPLKKESTASSLE
FT                   SEKRISVESKPEFPSVPDRKPEFNERNSTFDEPGFAEKTPELSSKPEAEQPYSEDWKTT
FT                   SSNVSKQASIESPVNSEKLQEKPGIEDNNSKLSTSDINENKRDSDIKHQEKKSEESAKE
FT                   PVKKKAPPVPKKPSSRIVAFQEMLRKQQMEEMQGSHRKGPEPVNEAPKDSKNGADSSES
FT                   SQPSLPQRPARQPINAERSKFANNLNGLFALPGMSPMGGLPQSFAKKLDPAASTPGPEE
FT                   KKENQATPPSVSNVRSSRARGPRGRKLPSNVASVEKVNSESKTNEIEIFKTWKTVVHKK
FT                   EEPAVPERPPSLSKKPTESGNEKAVDVTNPTHFDLDNDKAVRPLEETTKAKDHDDNSHG
FT                   TDDILTSPKEDTRIIEEKLEESKTSGNPSSLEESQESKNQTEKPLVPERPSKNQEKKHP
FT                   LVPERPLTSESARSDELAQNSEPLVSERPVKHDEKEHELAEEPSILERSSKNQEEKHPL
FT                   VPERPLTSESLKSDEPAKNSEPLVSERPAKHEKQEHKHAEEPSILERPKKHTEESEKPS
FT                   KPALPEEQLEYEKSLDFPKKFPEATEPVPETTFAFGTENNSKESSNVDLLSAVKDTGQS
FT                   QLEHSDSELNQFTKDSDLAEKLKQELKQEDKEE"
FT   gene            complement(<312974..>313351)
FT                   /locus_tag="ZYRO0G03894g"
FT                   /old_locus_tag="ZYRO-ORF1605"
FT   CDS_pept        complement(312974..313351)
FT                   /locus_tag="ZYRO0G03894g"
FT                   /old_locus_tag="ZYRO-ORF1605"
FT                   /product="ZYRO0G03894p"
FT                   /note="highly similar to uniprot|P33331 Saccharomyces
FT                   cerevisiae YER009W NTF2 Nuclear envelope protein interacts
FT                   with GDP-bound Gsp1p and with proteins of the nuclear pore
FT                   to transport Gsp1p into the nucleus where it is an
FT                   essential player in nucleocytoplasmic transport"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29236"
FT                   /db_xref="GOA:C5DZF2"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZF2"
FT                   /protein_id="CAR29236.1"
FT                   /translation="MSLDFSTLAQQFTQFYYNQFDTDRSQLGNLYRDESMLTFETSQLQ
FT                   GTKNIVEKLVSLPFQKVGHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFH
FT                   LIPDGSSYYVFNDIFRLNYSA"
FT   gene            <313613..>317911
FT                   /locus_tag="ZYRO0G03916g"
FT                   /old_locus_tag="ZYRO-ORF1604"
FT   CDS_pept        313613..317911
FT                   /locus_tag="ZYRO0G03916g"
FT                   /old_locus_tag="ZYRO-ORF1604"
FT                   /product="ZYRO0G03916p"
FT                   /note="weakly similar to uniprot|P33332 YER008C
FT                   Saccharomyces cerevisiae SEC3 Non-essential subunit of the
FT                   exocyst complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p
FT                   Exo70p Exo84p)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29237"
FT                   /db_xref="GOA:C5DZF3"
FT                   /db_xref="InterPro:IPR019160"
FT                   /db_xref="InterPro:IPR028258"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZF3"
FT                   /protein_id="CAR29237.1"
FT                   /translation="MMKSARSPFKKKSHSRDNSVEDRGFFHRRSTSGSNIPSAQHSRQA
FT                   SNGGLNMGPPVSGNNATAHKRTVSNSSRSSQSSNFLAEQYERDRRGILASCFSNDGKSS
FT                   GPPNSYITHVRIIEDARYPSSRPALDSKLENKKKRVLILSSKANNPKAVQLHKGRENAD
FT                   GRFQVGRTWSLKELLAIERDVEVNEGFMLTMSKKYYWETNSAKERVVFIKSLVNTYMQA
FT                   FDGHVPELVNWDLSMFYLDERAYQRAVIRNRNARPTVTPPVGSVSGSSSGTGSPGAPLS
FT                   NLNTRIANPDPAVPSPRSPTRAFGGSSSFNDHFAQNKQAAPVKPSPNMSGYSNSPTLSN
FT                   EGNNSYDQHHEQKQQQQQQQQRQAVAQQKMWQQEQDQQQQQAHQAHLAWKSHQAQKDQQ
FT                   VRKEQVLRQQEQMRQQELARQQELARKEEQQRQHMARQAQFEREALQAQEATVESDPFY
FT                   PYPVAHGNRDFLPGTSPRELSNKSSFAGLNSAHNSPNMAGSPSLNSPQQFPAKQPQIAT
FT                   SEIPQIKQNPVKQGSPVSMGSAGEMGDVPRKGSASQNKQDNLLEDLNNVLAGPSSAHAL
FT                   PDAHSSVSQDRSEELYNGVPSGKGVSSMDIPSLSIPQTEPLNTKSTPTSEMVDADDMAG
FT                   DLNASSMDAQQDNSNDLSFERGDEASFSTNLAPNPPHVYHEVSTIQEEAPPVDGQKKSV
FT                   IAPGAIDESSEDQKRDMKKDAAYIEDEELLGILTDINWEMGDAADDLIEKLTIKMAETA
FT                   YTLNNGLLSLEDVGPSLLPYEKQVDEVCDKMNPVFSLFLMEMGNVAEDIEYIEGQKNGL
FT                   QIESANKKNLWSTLTELMNTVSLDDATLNELLNSPVSEKTLLRMESQLKSLFRALKAIS
FT                   GESEEENYDLGNMQALKERRETYERVTEVFLKRLVDAFSGMFVNIYKDNTTEDYLTSFL
FT                   NRLLVFSSLTLFCKDVDRESYNIILDKWITSIQVVYNHICEKMISNLRKYKLDKREQPA
FT                   VANENALGNLLIQWESYKKTRTLPEVVPSSAKSVAHLKSSLESLGKLCVCYQNFIDSFF
FT                   HVSSSLDFEAYLEQYGDPTTRIVPLYSVKPMQSDRESALKEANLVSRIFRPNITKMNSY
FT                   FTTILRADCSRAPAIMLFLEEKIKSLESSNQEFLLTAMSQMLDQVKQLWSEYIEDEVVH
FT                   LERAVINMSSRSLSPSVLGFVLFVKNSNDYISYAQSQSELKSIQSLEAIKIFESDSGKL
FT                   GNAIIKLLSRKDGGASMLAGVRGAAAEASSTDRIVTLLLNCYWLIEVLSMLNVRGSFDS
FT                   TIQSAKKIFDSEKEVYAAFLLRDAMPKLTSFVHGASSLVGTSSQGGDSNLVKSAAYSRQ
FT                   NLDNILAGYTSSEVDVLVKRLYQQMIRHLSHESNDLMKGTLGDRLWSSIQGQTVSLYLK
FT                   LYTLIEKHYKGALVRFTKNDIITAFERYKE"
FT   gene            <318186..>321206
FT                   /locus_tag="ZYRO0G03938g"
FT                   /old_locus_tag="ZYRO-ORF1600"
FT   CDS_pept        318186..321206
FT                   /locus_tag="ZYRO0G03938g"
FT                   /old_locus_tag="ZYRO-ORF1600"
FT                   /product="ZYRO0G03938p"
FT                   /note="similar to uniprot|P40562 YIR002C Saccharomyces
FT                   cerevisiae MPH1 Member of the DEAH family of helicases"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29238"
FT                   /db_xref="GOA:C5DZF4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039686"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZF4"
FT                   /protein_id="CAR29238.1"
FT                   /translation="MAPFGGEDSDLDDYELDSLSRQGVNRVVKETVTKKNIPVQRDLLG
FT                   QILPGQNSYYEEIKRDVTFRPTHHALNEKNLSHYVYPTNYEVRDYQYDIVKKALFQNVL
FT                   CAIPTGMGKTFIASTVMLNFFLWTIRGKIIFMAPTRPLVAQQIKACLGMTGIPHDQTAI
FT                   LLDKSRKNREEIWDTKRVFFTTPQVVENDLKRGALNPKDIVCLVIDEAHRATGSYAYTN
FT                   VVKFIDRFSTSYRLLALTATPGTDLESVQEVIKNLDISKVEIRTEESMDIVKYMKRRIQ
FT                   EKIQVEPLFEMLEIVEQLGIAILPVLRQAVELGIYENCDPAQINAFKAMQQSQKIVANP
FT                   NIPEGIKWRNFFILQLLNHVGQMLKRINIYGIRTFYNYFSDKSLEFTTKYGMGKSSNKT
FT                   AAEFYYHPILKNMTTQCENLLADPKFLGHGKLRHVRDELVDFFARGKSDSRVIIFTELR
FT                   ESALEIVRCVDAMDYRHIVPHIFIGQAKGKEGFDEVSFTRNNKAKGRKKVDRLKRQEED
FT                   QQIEEEKKKRKKQEALERVSRRTGSSEEAQANGMTQKQQKEVIQKFKDGEYNVLVCTSI
FT                   GEEGLDIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGRIILLFSSNESNKFDQAMKDY
FT                   ANLQKVITQNILEYQKSDRIIPADVDPQCREQFITISEEDQEVNDMDDSEEVIRFATDC
FT                   MLGKQRKSKRNAKVGQPKKQKRFFMPDEVETGIITADKLVRKVKKPKKELPLLDNLEND
FT                   SLELSSPVKSEFEGSQATMPTITDAQLKPTDPLPLPDSPPSIKRERSPSQDARVPSFSP
FT                   DRPVTSNLNLGPPPPVKVKAEPFSPEQTTSDLIDFVSVGQKIDSDENRHSSPPLNRRGQ
FT                   DKIFDDFSNNNGGLLTPQEREYFQRNYSVNDTVAIDTLPDFSQYTKTAHIPHSTRNQGF
FT                   LNLFQDMKRNEKARIIEMNRTRCIARGLQNGVLNQAKELVDPNQHAVLQNNGIQPLSRE
FT                   GTRLEDLDEILGSDSDF"
FT   gene            <321336..>321490
FT                   /gene="SNR14"
FT                   /locus_tag="ZYRO0G03960r"
FT                   /old_locus_tag="Zyro0G_ncRNA_156"
FT   ncRNA           321336..321490
FT                   /gene="SNR14"
FT                   /locus_tag="ZYRO0G03960r"
FT                   /old_locus_tag="Zyro0G_ncRNA_156"
FT                   /product="U4 RNA"
FT                   /note="SNR14 (U4 RNA)"
FT                   /ncRNA_class="snRNA"
FT   gene            <322285..>327141
FT                   /locus_tag="ZYRO0G03982g"
FT                   /old_locus_tag="ZYRO-ORF1598"
FT   CDS_pept        322285..327141
FT                   /locus_tag="ZYRO0G03982g"
FT                   /old_locus_tag="ZYRO-ORF1598"
FT                   /product="ZYRO0G03982p"
FT                   /note="some similarities with uniprot|P32521 YIR006C
FT                   Saccharomyces cerevisiae PAN1 Part of actin cytoskeleton-
FT                   regulatory complex Pan1p-Sla1p-End3p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29239"
FT                   /db_xref="GOA:C5DZF5"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013182"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZF5"
FT                   /protein_id="CAR29239.1"
FT                   /translation="MYNPYQNTGYFQQQPQQQQQQQQQQHSFGQQNPQASGFGGMPGSL
FT                   SSTPMNFPQLQAQQQPSRFGGANTAVNPTGMSNLMPQSQSSFGSQQNTGMMGMPGPSNT
FT                   ASATSNQGNFVNQPQQQHPQSTGYFQSNALPLQQPQLQSQPTGFQNPLLSNPTGGMQPL
FT                   LPQSTGFYHPTGGMPQAPLEPLKPTATGLVNSFANGGLNHDIKIPARRLSFITSNDQAK
FT                   FETLFRSIVPKGSNTISGEDCKKIFLKSGLQASELAKIWKLSDTTRAGELLFPEFALAM
FT                   HLVNDVLQGDSIPYELDTKTKNEVGSFVDAINLSIARGDGDPGPKTPFDDLMMGGLKPQ
FT                   STGFMPPTSFGMPLQGQVTGGGAGLLNPQRTGFMPQTSFGMPMQPTGGAQFNPMGNMGG
FT                   NAGVGIQSTGFMPQTSFGAPLQSQLTGGAVQRQPTGGFQNNFMPNMQPQNTGGFAALQP
FT                   QKIQPQATGSLLPQGTGGLRPQTTGSFQQQQQQQQQLGGFQPQPTGGFQPQPTDGFQPQ
FT                   LNGGLQPQGTGGFQQQGFGGGIQPQLTGGFQQPQPSGGFQQPQPTGGFQQPQPSGGFQQ
FT                   PQPSGGFQQPQPSGGFQQPQPSGGFQQPQPSGGFQQAQPSGGFQQPQPTGGLQPQSTGP
FT                   LQPQGTGFGQQGGGVPPLQPQGTGSFNGNLPQQPNGGFQGVPPPQQQPQLTGGLMPQAT
FT                   GGASTAVPIQQTGLSTQSTGFLPPSGFNPTQPLSAQKTGFGNNEIYTQSSFSQDFNGQN
FT                   LDDILPEEKSLFYKIFQTYDTDKRGILDASKAVEIFRKSGLNRGDLEHIWALCDINNTG
FT                   QLNKQEFALGMHLVYRKLNGFQLPNRLPLNLIPSSTKILDDVKNQIKSSVGTEDRRSST
FT                   KTDALSYKNNDDEDVLPSFRNRRKVFGANAPPATTNQDASAPAASASASAASQQAKPNV
FT                   SDLKRAINERRQRLDTEKARLQTTTSDDDLRFISSLKSQIGELPSISVVNDSVPADLKE
FT                   RYETLLVKLPNLFVQIDEIDTQIRNAKLQLFKMKNPFSISGSGPNGEITDEDRKKAKSK
FT                   ALLKSRMNALTGKPSGPIGSFEEEEVKYNEEIKKINAGCNSNKEIIGDIKSSIADIAAS
FT                   LESGLSGGSIHANPGDFEVWEFGTRLEPEVRDFVYSLRTKTSQREQGNSSTVSAEANYS
FT                   QQNYSQPAAQDVSRQTYGNLPQSTSNGYSQQPVDNNSTPVTSSNSQSYNFTDPSGNYRS
FT                   QATVNSYSYSSNGNRSDNYNSGGSNQTSRQPSYAGGTSHNQPSSNEVVNGDDGEDEEEK
FT                   QLRDKLEMLKLKKKSEKEKRLADLRRQIEEAKADGDEEAEVAALQNVANQRSTSSISIS
FT                   QDPAPSAASPALNQGRDGHPNVNSSHPSYGSAPAAHAGVNATRSSTVMSASPVSSVASP
FT                   QPSGQGGRNAFFKQTPSTSSSFDLRAAETQRRLQRGLDDDESEGWSDDDNANAQTASPP
FT                   KEPVPSAPYQQAPTPVAPAPVAPAPVAPAPVAPSNEEPKPMAPSLPQVKDDGPPVPVAP
FT                   PLPQVQHQGPPVPVAPPLPQMQSESKPFFAGPPPLMPNEDENGGHGHGHGHEEEKHYAD
FT                   ENDDDDDSLSIPESVGSDEDNFEMAHSAPSNIPPPPPLP"
FT   gene            complement(<327232..>327735)
FT                   /locus_tag="ZYRO0G04004g"
FT                   /old_locus_tag="ZYRO-ORF1593"
FT   CDS_pept        complement(327232..327735)
FT                   /locus_tag="ZYRO0G04004g"
FT                   /old_locus_tag="ZYRO-ORF1593"
FT                   /product="ZYRO0G04004p"
FT                   /note="similar to uniprot|P40565 YIR005W Saccharomyces
FT                   cerevisiae IST3 Component of the U2 snRNP required for the
FT                   first catalytic step of splicing and for spliceosomal
FT                   assembly"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29240"
FT                   /db_xref="GOA:C5DZF6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZF6"
FT                   /protein_id="CAR29240.1"
FT                   /translation="MNQIKAIERINEAELSQGILTHEQSWHYEYRNQAYIFIGGLHKEL
FT                   TEADVLTVFSQYGVPVDLKLVRDRENGESRGFAYLKYEDQRSTVLAVDNLNGAIVAGRR
FT                   IRVDHALYEPRDDDWDYREAVREELDKDKVLVPGERQLPSREDDKNHRDQSQEDDELAD
FT                   PMGS"
FT   gene            <327866..>328720
FT                   /locus_tag="ZYRO0G04026g"
FT                   /old_locus_tag="ZYRO-ORF1592"
FT   CDS_pept        327866..328720
FT                   /locus_tag="ZYRO0G04026g"
FT                   /old_locus_tag="ZYRO-ORF1592"
FT                   /product="ZYRO0G04026p"
FT                   /note="similar to uniprot|P40011 Saccharomyces cerevisiae
FT                   YER010C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29241"
FT                   /db_xref="GOA:C5DZF7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZF7"
FT                   /protein_id="CAR29241.1"
FT                   /translation="MLRTYNAPLVRIYWKILSRPARTGLDICKPVVDGYVQQGSVRTFI
FT                   PSSRLNKMSDPRFDELTPCDVSDGLLNKYKIDNGGYLPNLTQWSGHSKGTIHGKAYTVL
FT                   FAPANDTRPSVNYIDSVPQGAFLVIALTRDLQLPYAPYVKPTQAVYGGLMSTRAQYLKA
FT                   AGTLVFGRIRDLKEHKSLEHPVFSYGVGSCAAKAAVKPIGINVPLEILTSNGEVEIIKP
FT                   GDYMVGDANGIVKVPSEVELDSLVGYVRKSVEADELVTTDIKNGRPAKEAQKDRRATLK
FT                   NYL"
FT   gene            complement(<328792..>330717)
FT                   /locus_tag="ZYRO0G04048g"
FT                   /old_locus_tag="ZYRO-ORF1591"
FT   CDS_pept        complement(328792..330717)
FT                   /locus_tag="ZYRO0G04048g"
FT                   /old_locus_tag="ZYRO-ORF1591"
FT                   /product="ZYRO0G04048p"
FT                   /note="similar to uniprot|P40549 Saccharomyces cerevisiae
FT                   YIL014W MNT3 Alpha-1 3-mannosyltransferase adds the fourth
FT                   and fifth alpha-1 3-linked mannose residues to O-linked
FT                   glycans during protein O-glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29242"
FT                   /db_xref="GOA:C5DZF8"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZF8"
FT                   /protein_id="CAR29242.1"
FT                   /translation="MIKRFLHPRSLRRYAFLIIFVLIVYSITTASSRSQFKLETGLGPN
FT                   VSGRRRANALSAFSWIDNRRKHTLELVNGSKNSRSPFDLLPWGKEDNKVSEAEQNLLVK
FT                   LEDAPLDMKCRYMIDAIYVAHKGWNNQQMTKYHSSEEANDMLASLLGERVRLFDHCFIS
FT                   GGLKVKDVMNMDSLVSEDKLGSPEDFIERMFPFLQQGNLVWPKMYDLRRGKELKMPAVA
FT                   QDTYANFWNNWIKLSKGKGIAATFNPTELTLFHRQLRVLSKLNNTLPIQVVTSGFEFTR
FT                   AQVDQLSQYARDTDQEVTLIDCSTILIKEFTQNNVEKFVNKWLAALFNTFEEVLLLDVD
FT                   TVPFVDVEEFFKEPQYRATGMALFKDRAMMDEHTYGYCLETLAGLEPSHEENKLMGTKL
FT                   LFESTQKELPQTEAASVYRRFFHDGVLHHVDSGLVPVNKVKNFGGLLFSFMINLDTKIQ
FT                   GCVHGDKEFFWLGQLYAGKNYAIYPQDAGVIGLIEDKPMEALTQTSYTICGSQLAHTFY
FT                   SLTKEAHQLVWTNGGLSTCKVPHGAEMDFQRLPDYFMARYGDVETTKQVYAAPLHIQAM
FT                   IIPDSEKSTWLQLRECGDSAFCASAVEDTADGRNSVSTLIQFTPEEQDFLDSISFAWNG
FT                   RTFTDG"
FT   gene            complement(<331258..>331330)
FT                   /locus_tag="ZYRO0G04070r"
FT                   /old_locus_tag="Zyro0G.tThr.AGT.58"
FT   tRNA            complement(331258..331330)
FT                   /locus_tag="ZYRO0G04070r"
FT                   /old_locus_tag="Zyro0G.tThr.AGT.58"
FT                   /note="tRNA-Thr (AGT) cove score=74.49"
FT   gene            <331742..>332374
FT                   /locus_tag="ZYRO0G04092g"
FT                   /old_locus_tag="ZYRO-ORF1588"
FT   CDS_pept        331742..332374
FT                   /locus_tag="ZYRO0G04092g"
FT                   /old_locus_tag="ZYRO-ORF1588"
FT                   /product="ZYRO0G04092p"
FT                   /note="weakly similar to uniprot|P40573 Saccharomyces
FT                   cerevisiae YIR017C MET28 Transcriptional activator in the
FT                   Cbf1p-Met4p-Met28p complex participates in the regulation
FT                   of sulfur metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29243"
FT                   /db_xref="GOA:C5DZF9"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZF9"
FT                   /protein_id="CAR29243.1"
FT                   /translation="MALIPMSEDTDAVNISQYLQDLISSNSELGSRLLSLLLVSSGNGK
FT                   EIMDAINKGDLGSIRNLDLAVDLKMPNGGENRDIKTSNARQQLALISNGGKSQQQEQPS
FT                   FQKSQGQAQEENGTDSSSDTLNNPKGEKRKKNTEASARFRIRKKQKEQERLNKLKELNI
FT                   KITGLYKRIDVLLEENQHWKQKLEELNERKSREMLDRIRKRNANSPL"
FT   gene            complement(<332525..>334720)
FT                   /locus_tag="ZYRO0G04114g"
FT                   /old_locus_tag="ZYRO-ORF1587"
FT   CDS_pept        complement(332525..334720)
FT                   /locus_tag="ZYRO0G04114g"
FT                   /old_locus_tag="ZYRO-ORF1587"
FT                   /product="ZYRO0G04114p"
FT                   /note="some similarities with uniprot|Q08206 Saccharomyces
FT                   cerevisiae YOL036W Protein of unknown function potential
FT                   Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29244"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZG0"
FT                   /protein_id="CAR29244.1"
FT                   /translation="MSAKEHKSNNSAEGSPTVSNGCGSSNAHLQDIKEEDDGVKEDLLL
FT                   PPLPCSIEKNESDPFDLSKALEIPCSVTSRDNNSVSGGNNVNNAHSVKENSEGNNISSG
FT                   GSGVSLSSPRISLKKKFSNALLNTGESSPVPFPSESSFSEFDAGTLVRPVSEFRSQSSS
FT                   NANSFQHILPTLNKAIDDGNADTSNSSSNNTTSSEAHLAQFFDIRKPSRKFSTSSSSNS
FT                   SHSDTSVSEEFFQKIPSPKMSFKSRSRSRSNSNSNLISTSLSLEGGGTTPTTVMNTPNS
FT                   SSNNIYGRDVEAKRTPLLRRASSAILRKNSRRNVVATGPGGVSIVGNGTSGNSASSTPI
FT                   LQQSAFFEMADPIQRTPPRDRIFSNSTDDTDYWPSERSILPDDDDSMNYVTKLGRTTSR
FT                   NPSIGSKVKRGFSRIMSSGGSMRKAVSSTSLRSDYKFAQQQQQQQQHQHQQQQQQYPQQ
FT                   QYPQQQQQQQQQQQQQQQRQSFENIFNRGGSNIPRNSLAGVLDSGVNNINSSSSGNVTP
FT                   ISTSTIMSPKSNHWPRNSQGHPNQFNETPQPTMGLGMEWKSTGDSMPKEKTNYLSNSLH
FT                   PSGSPDSMKSDITVDLDKLTKTVPVITVTDDLRTEGCTPIQIQSNISLDEVFTRNDAGA
FT                   RSGNFKNAHNNNSSSDEFTNTNISTEKPEMMSLTDYIRVLVKQQQVEDERLAIIEKNFK
FT                   DSGWCSKDDLKNLRLKRVIISKKWAERISHYQSRLDS"
FT   gene            complement(<335007..>335771)
FT                   /locus_tag="ZYRO0G04136g"
FT                   /old_locus_tag="ZYRO-ORF1585"
FT   CDS_pept        complement(335007..335771)
FT                   /locus_tag="ZYRO0G04136g"
FT                   /old_locus_tag="ZYRO-ORF1585"
FT                   /product="ZYRO0G04136p"
FT                   /note="highly similar to uniprot|P40303 Saccharomyces
FT                   cerevisiae YOL038W PRE6 20S proteasome alpha-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29245"
FT                   /db_xref="GOA:C5DZG1"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZG1"
FT                   /protein_id="CAR29245.1"
FT                   /translation="MSGYDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLG
FT                   CERRSTLKLQDSRITPSKISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPV
FT                   SVEYLTRYVAGVQQRYTQSGGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQT
FT                   IGRNSKTVREFLEKNYNRDEPPATADECVRLTTRSLLEVVQTGAKNIEITVVRPGSKIE
FT                   ILSSEQIGKYVEEIEQEKKEHQEQLARKKRRD"
FT   gene            <336548..>336814
FT                   /locus_tag="ZYRO0G04158g"
FT                   /old_locus_tag="ZYRO-ORF1584"
FT   CDS_pept        336548..336814
FT                   /locus_tag="ZYRO0G04158g"
FT                   /old_locus_tag="ZYRO-ORF1584"
FT                   /product="ZYRO0G04158p"
FT                   /note="some similarities with uniprot|Q08176 Saccharomyces
FT                   cerevisiae YOL026C MIM1 Mitochondrial outer membrane
FT                   protein that mediates assembly of mitochondrial beta-
FT                   barrel proteins also proposed to be involved in
FT                   mitochondrial import"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04158g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29246"
FT                   /db_xref="GOA:C5DZG2"
FT                   /db_xref="InterPro:IPR013262"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZG2"
FT                   /protein_id="CAR29246.1"
FT                   /translation="MTEATPIEPGKDLTLPDEPLETIEESPSALSRVGSFTASCAINLV
FT                   LPFINGLMLGFGELLAHEVCWRKSIFPPTNRGYQIYPERRKFL"
FT   gene            complement(<336864..>337295)
FT                   /locus_tag="ZYRO0G04180g"
FT                   /old_locus_tag="ZYRO-ORF1583"
FT   CDS_pept        complement(336864..337295)
FT                   /locus_tag="ZYRO0G04180g"
FT                   /old_locus_tag="ZYRO-ORF1583"
FT                   /product="ZYRO0G04180p"
FT                   /note="similar to uniprot|P40571 Saccharomyces cerevisiae
FT                   YIR015W RPR2 Subunit of nuclear RNase P which cleaves tRNA
FT                   precursors to generate mature 5' ends not shared between
FT                   Rnase MRP and Rnase P in contrast to all other Rnase P
FT                   protein subunits"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04180g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29247"
FT                   /db_xref="GOA:C5DZG3"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZG3"
FT                   /protein_id="CAR29247.1"
FT                   /translation="MSYNITNPMAKGSNRVENGVLLTPPPRNVGNKEHYQRMNYLYQLA
FT                   MWNTMSGNDGGEQALARLYAKNMDLVSKRTRAEMLPQLKRTICKKCHRVLVPKKTMRVQ
FT                   TDSGSLQLVCSCGAVRNFPIHLNGGYRCYAERDENLISM"
FT   gene            complement(<337325..>337939)
FT                   /locus_tag="ZYRO0G04202g"
FT                   /old_locus_tag="ZYRO-ORF1582"
FT   CDS_pept        complement(337325..337939)
FT                   /locus_tag="ZYRO0G04202g"
FT                   /old_locus_tag="ZYRO-ORF1582"
FT                   /product="ZYRO0G04202p"
FT                   /note="weakly similar to uniprot|P40570 Saccharomyces
FT                   cerevisiae YIR014W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04202g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29248"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZG4"
FT                   /protein_id="CAR29248.1"
FT                   /translation="MVNSGGPVSMKQLTVISYLCVYIRFVKDGSLLLALLAWATVNLGE
FT                   FMGSVMSAYQDSVDSDAEDMEGAGRLSVVKAVMHKGLKYTQAILMLQVIYAVSYHMKMD
FT                   LEGDFCRRRGAYILLLLVGEQECGRGGRWMLLALDWVILLMQLVLITMELTPDDGRNCH
FT                   ELDQLDTDRYGALAILQFNPYSEPSSMPELPVTRGNHYGSI"
FT   gene            <338031..>339875
FT                   /locus_tag="ZYRO0G04224g"
FT                   /old_locus_tag="ZYRO-ORF1580"
FT   CDS_pept        338031..339875
FT                   /locus_tag="ZYRO0G04224g"
FT                   /old_locus_tag="ZYRO-ORF1580"
FT                   /product="ZYRO0G04224p"
FT                   /note="some similarites with uniprot|Q08179 Saccharomyces
FT                   cerevisiae YOL027C MDM38 Mitochondrial Distribution and
FT                   Morphology"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29249"
FT                   /db_xref="GOA:C5DZG5"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="InterPro:IPR033122"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZG5"
FT                   /protein_id="CAR29249.1"
FT                   /translation="MAKRISQKLSFISTTIHSWIRSVTFKVGPRHFQIFYKSIFIMLST
FT                   KIIGSVRPAARVVPLYPLRYSQLQRYQSNVKQNSSSNSGVNANTTTNATKAAKPKPKEP
FT                   LSQRIKHEVKHYVNGTKLLGYEIKISAKLLFKFMQGYELSRRETNQLRRTTSDVFRLVP
FT                   FSAFILVPFAELLLPIALKIFPNLLPSTYESGTDKQKKTDSLIDVRRKTSNFLRETLEE
FT                   SNLLSYNSIETAEKKKKFLTFFKKLYSPKDGKTNVFTHDEILLVAQMFKNDSVLDNLSR
FT                   PQLVAMSKFMSITPFGNDNVLRYRIRHKLKQIMEDDRIIDYEGIGSLSEYEIYQACVSR
FT                   GVKAYGVSKEELVDNLKVWLELRLRHKVPSVLLVLSSTFTFGGLEKKQVLDSKAYSPQV
FT                   EHKEQKSRYDELMDLYYDGILHVLSSIPDPVYNVAKLDVSESKQPSATVTKEAALARAQ
FT                   AAESALQSAIEKQAPEGIERAKRAVTEANEELAKAEAAAQETPSQPAPEAEPATKEKPE
FT                   VKEPAPAAEKVKTEAEPKPEEKEEEEEEVVPTTDDNEFKLRVLKEQEELIKKETEDAKA
FT                   RKTAEHLSDDITLDEEDKPTTPIPAEEGAKKSVIEKKN"
FT   gene            <340188..>341492
FT                   /locus_tag="ZYRO0G04246g"
FT                   /old_locus_tag="ZYRO-ORF1578"
FT   CDS_pept        340188..341492
FT                   /locus_tag="ZYRO0G04246g"
FT                   /old_locus_tag="ZYRO-ORF1578"
FT                   /product="ZYRO0G04246p"
FT                   /note="similar to uniprot|P40574 Saccharomyces cerevisiae
FT                   YIR018W YAP5 bZIP transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29250"
FT                   /db_xref="GOA:C5DZG6"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZG6"
FT                   /protein_id="CAR29250.1"
FT                   /translation="MMDTDRSDTALDKFPKLQPKSSPDDELTISKVHISKNWKLPPRLK
FT                   PGRRPQIKLKDLDEDECSTPEDETKKKKQNRDAQRAYRERRANRLQELEDTVNTLRNAM
FT                   KNWKRRCMDLEAELQDARKDNSSLKHQLDMIRSNLCNDCLKDPCICHNESVTLLQDPFL
FT                   QNMVKNFKPMKAVNLKKRKLSSSKLSESPAPQQHIVSVASGGCGFCSDRTTCVCKDLEV
FT                   SDTEQHEIQQQQHLEESVTATLGHCSSNDKGHCKNCSDIDKSCISTESAPAPAKTTQKS
FT                   TSANWEPGSCAQCQADPASKVFCKSICNSANIIAAVEVGGKKDDCSSNLAFEPGSCSQC
FT                   QVDPQHKEFCEAVFSNGEQQLNADEKADTDLIPVSHAYQRIKNYMTDGNIENVHSNLSL
FT                   PPMKQIASGIRIRGREVESKSVDDALRDMDKNALG"
FT   gene            complement(<341614..>343077)
FT                   /locus_tag="ZYRO0G04268g"
FT                   /old_locus_tag="ZYRO-ORF1575"
FT   CDS_pept        complement(341614..343077)
FT                   /locus_tag="ZYRO0G04268g"
FT                   /old_locus_tag="ZYRO-ORF1575"
FT                   /product="ZYRO0G04268p"
FT                   /note="similar to uniprot|Q08193 Saccharomyces cerevisiae
FT                   YOL030W GAS5 Putative 1,3-beta-glucanosyltransferase has
FT                   similarity to Gas1p localizes to the cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29251"
FT                   /db_xref="GOA:C5DZG7"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZG7"
FT                   /protein_id="CAR29251.1"
FT                   /translation="MKISTIGTVIAAAVFSSSVVQADSSDLPPIKIDGNAFFNSKNGQR
FT                   FYIRGVDYQPGGSSKLQDPLADSDNCKRDIPVFKDLGINTIRVYSVDNSKDHSDCMEQL
FT                   QEAGIYLVLDVNTPQASLSRLDPKCSYNANYLQNVFATIDAFAKYDNVLGFFAGNEVIN
FT                   DVNNTFTAPYVKAVVRDMKKYMKSQNYRQIPVGYSAADIASNRELAAQYFNCGDEDDAR
FT                   IDMFGVNDYSWCGDSSFEKSGYSTKVETYENYSIPIFLSEFGCNQGVSDGRPFTEIGAI
FT                   YSDKMSSVFSGGLVYEYSGEANGYGLVDIDGDSVSKNQDYQNLKKQYAAQSNPSGDGGY
FT                   STSKKHSDCPSYKKDVWEANNTIPDMPSAASAYFKKGAGTPQGTKASTQNDCGSDVHVV
FT                   PAGGSDSSDSGNGNNSTSSSGGSSSSTSTSSSTSGISSHKSSSSASITTSTKGDASTKG
FT                   KNNKSVGAGAVLQVPSFFRAMAQVVDLVL"
FT   gene            complement(<343479..>343551)
FT                   /locus_tag="ZYRO0G04290r"
FT                   /old_locus_tag="Zyro0G.tThr.AGT.57"
FT   tRNA            complement(343479..343551)
FT                   /locus_tag="ZYRO0G04290r"
FT                   /old_locus_tag="Zyro0G.tThr.AGT.57"
FT                   /note="tRNA-Thr (AGT) cove score=74.49"
FT   gene            <344316..>345917
FT                   /locus_tag="ZYRO0G04312g"
FT                   /old_locus_tag="ZYRO-ORF1573"
FT   CDS_pept        344316..345917
FT                   /locus_tag="ZYRO0G04312g"
FT                   /old_locus_tag="ZYRO-ORF1573"
FT                   /product="ZYRO0G04312p"
FT                   /note="weakly similar to uniprot|Q08157 Saccharomyces
FT                   cerevisiae YOL019W Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery and vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29252"
FT                   /db_xref="GOA:C5DZG8"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZG8"
FT                   /protein_id="CAR29252.1"
FT                   /translation="MLSPLLAGITLLQFVAMAFLVIACLTAPVFHQIGLSNQSGTTYGV
FT                   FGYCGDITGCSKAKAQYSVPTVQALGDNWLFNKNARQKLGHLLIATPVAAGLNFFAFLS
FT                   LMMTLMSALMSRKNSSSSAVAFFINLFLIVLAFLGSTFVCLVCFFTFWPHVTWVTWILI
FT                   PAAVLPLIEIPTVFLAHARGNADGSGFIKHRRPINLEEPDDKFASNEPRDDDSFAEDKP
FT                   LVLPDYAKRQNPEPVFKVDTASSDKSWKEKHAAEERTRELSREHSYENSYENSYENLYD
FT                   EPLAVSNNPQQAASVIRSDSQLGSPEKQAHSMLSMGSSEYSEPVQRNTDSRAVLEDIIK
FT                   DTLGTGDQHTEVSDHQDAESNFTSISQRATARSAGPETAAMLQQQQQQPMPQALPGQGA
FT                   IHRNYMGPPPQQRAGYGYQPQWYPPRPHTHPRHMYGRPNGYMMPPRLAQPHPMAMRNSG
FT                   YGPAPHPMAMRGPQQHPMMAPSAGPPSQMAAPAAGVPMGSAPANGPHYKPAYKKRMGAQ
FT                   NAIPSAAALNNTYGFR"
FT   gene            complement(<346017..>347096)
FT                   /locus_tag="ZYRO0G04334g"
FT                   /old_locus_tag="ZYRO-ORF1571"
FT   CDS_pept        complement(346017..347096)
FT                   /locus_tag="ZYRO0G04334g"
FT                   /old_locus_tag="ZYRO-ORF1571"
FT                   /product="ZYRO0G04334p"
FT                   /note="similar to uniprot|Q08144 Saccharomyces cerevisiae
FT                   YOL018C TLG2 member of the syntaxin family of t-SNAREs"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29253"
FT                   /db_xref="GOA:C5DZG9"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR028673"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZG9"
FT                   /protein_id="CAR29253.1"
FT                   /translation="MFRDRTNLFLSYRRTFPHNARFSSSRRSLEDPFADEDEEAYPMQE
FT                   LGVKSSDALPPSFVDMTQEVDESLAEVDRLMVQLSKLYRKNALPGFEDKSHDEKEIESL
FT                   SFKLIQLFQRCYGVMKRLQRVEEDQQYMGRQLQRDDLVILENLRKRYAQKIQIQSNKFR
FT                   VLQNNYLKFLNKDDSKPVFPKSEGTSQLLLEEEEEEKGQNRDIEAYSRQTLQRQRTSNQ
FT                   NATQQFLRERDEEITQLAKGVLEVSVIFREMQELIIDQGTIVDRIDYNLENTVIELRSA
FT                   ERELKSATRYQKKTQKCKIILLLSLCVFALFLFVMLKPHNSTKTIRPPPEAPVPAQHPD
FT                   VPERPELPPKADPEARNLD"
FT   gene            <347602..>349968
FT                   /locus_tag="ZYRO0G04356g"
FT                   /old_locus_tag="ZYRO-ORF1570"
FT   CDS_pept        347602..349968
FT                   /locus_tag="ZYRO0G04356g"
FT                   /old_locus_tag="ZYRO-ORF1570"
FT                   /product="ZYRO0G04356p"
FT                   /note="weakly similar to uniprot|Q92274 Saccharomyces
FT                   cerevisiae YOR129C Putative component of the outer plaque
FT                   of the spindle pole body may be involved in cation
FT                   homeostasis or multidrug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29254"
FT                   /db_xref="InterPro:IPR012860"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZH0"
FT                   /protein_id="CAR29254.1"
FT                   /translation="MSTPCTANVDYLLTAEFDNRFGPVVRDQYPSVIPGFEYEMREGHS
FT                   QNNAVFNLASLMIPNNAEYNTGDEPDTTVFMLYRNRETVKYELFPSKQVDQVICFVNVV
FT                   YAQEDKSNSRGTNIKAVALGTTMVDFIAFKPFVLECLHKFMKLKNKDDITPMLKSCFKL
FT                   LNRAELSFVKRLHSNPIRQSLLRSLGDDTRLEKWIDEASFGRFMFKGLLRCHHHDKYTN
FT                   RITLRRGKISIKLQGYRPKREFADLSKIPLEFDAVTWGSINWNVKYDTKISKFLLNFIP
FT                   LLHKRDANDSFHFKLVIYSSQYKGSGLSQFAIALSNLMGLTNGTRSFSNKPCLTLPFVD
FT                   VSIIGPLKEYLALQDRGIFLIMGTTNPIFKSQDGLYDYYYDLDNELISEAANGEGKITP
FT                   ITSNKWDMTAFKRLLTINSISPTSSIETPRIGFLQKIIESIDEKAINFSEIVLAFQKVN
FT                   VMQLLQLDCRMENINPGDLFDEYITKYRDGVVFQEIFEAESFRILQLLRTINDIMSRLY
FT                   QLNLPLLDRTDLLCLLDDLFSEIYSFINTDEDHLEKFLAACLRYPFVFPCSQYNLQEDN
FT                   LVKVNLKQELKNCFKEDKFWLSLVEDPMEQSSILSKFIKDRSLSLICLPLLFNPNIKVK
FT                   KSPASEPSEAVITPPANVSVRRRKSVSIKQMLNIGKNRESIAETSPLRSNSEASTTSNT
FT                   SINGRFFRSESSSVPPSKLDHVDVNKKTKNIRSLAYKIICVIQVHFIGKPIIDQSLAPF
FT                   FKSVLASFQSEQSVKEGTPSSSDSSDTRSSTTTRE"
FT   gene            complement(<350070..>351911)
FT                   /locus_tag="ZYRO0G04378g"
FT                   /old_locus_tag="ZYRO-ORF1567"
FT   CDS_pept        complement(350070..351911)
FT                   /locus_tag="ZYRO0G04378g"
FT                   /old_locus_tag="ZYRO-ORF1567"
FT                   /product="ZYRO0G04378p"
FT                   /note="similar to uniprot|Q06408 Saccharomyces cerevisiae
FT                   YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
FT                   decarboxylation of phenylpyruvate to phenylacetaldehyde
FT                   which is the first specific step in the Ehrlich pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29255"
FT                   /db_xref="GOA:C5DZH1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZH1"
FT                   /protein_id="CAR29255.1"
FT                   /translation="MGPVSYESQDIRTKRIPFGEYLFKKLVQSGSKSIFGVPGDYNLPL
FT                   LEHLYDDSVKDIGCRWIACCNELNAAYAADGYSRYTNKLATLITTYGVGELSAINGVAG
FT                   SSAENVKVLHIVGVVKSDAPECNYHHLIPQLQHSNFIGPNRKICYDMVKDRVACSAEYL
FT                   EDIETAPEKVDKVITEIYKHSKPGYLFVPADFADKLVDTTCLNNEINLCNSIERTPSEK
FT                   LDSIVDGVLQWIYQSQTPAILADGNVDRFGLISQLNQFIERTQMVNFTTIMGKSIIDET
FT                   NPRYQGLYAGKSCTDLVRSKFLSCDLILHFGVEKNEVNYCAQGFPYGPQAKVIEFHQSY
FT                   IRLFDTLNGDEQLFENVNFVDVLTALHQRIDISKLNLQYDKAIFTTYEPSQLNLPEEDT
FT                   SDVTQIYLQKKFPEILAPGDILVSDTGSFQFGVRDYKLPTQSKFMAQSTWLSIGMGLPA
FT                   ALGVGIGMQDYPRIHICDQSKVPAGYKPKLVLGVGDGAAQMTVQELTTMLRYHVDINVF
FT                   VWNNNGYTIERAIMGENSDYNDIMPWRWTKLFEAFGDFDGKYSNSSLVKTRQELDQKIE
FT                   DINKGGKGIELVEVKLGVMDYPAQLQMMLSNMKNAKK"
FT   gene            <352778..>354490
FT                   /locus_tag="ZYRO0G04400g"
FT                   /old_locus_tag="ZYRO-ORF1564"
FT   CDS_pept        352778..354490
FT                   /locus_tag="ZYRO0G04400g"
FT                   /old_locus_tag="ZYRO-ORF1564"
FT                   /product="ZYRO0G04400p"
FT                   /note="uniprot|Q9UVE6 Zygosaccharomyces rouxii ade2
FT                   Phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29256"
FT                   /db_xref="GOA:C5DZH2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016301"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZH2"
FT                   /protein_id="CAR29256.1"
FT                   /translation="MNSQTVGILGGGQLGRMVVEAANRLNIKTIILDAPNSPAKQINAL
FT                   NEHVDGSFSNPADIEKLAEKCDVLTVEIEHVDVPTLKKLQSKHPNLKIYPSPETIGLIQ
FT                   DKYVQKNHLVANNIAVAESIPIESTTSEGLALAGRQLGYPYMLKSRTMAYDGRGNFVVK
FT                   SEESIPKALEFLKDRPLYAEKWAPFTKELAVMIVRSIDGRVFSYPTVETIHKDNICFLC
FT                   YAPARVPDSVQLKAKLLAENAVRAFPGCGIFGVEMFYLETGELLINEIAPRPHNSGHYT
FT                   IDACITSQFEAHLRAILDLPMPKDFSSLSTSCTNAIMLNVLGEDVKNQELQTCERALET
FT                   PGASVYLYGKESRPKRKLGHINVVTSSMEECERRLSFITGETSEPVKITVAQKIDSESN
FT                   GKPVVGIIMGSDSDLPVMSKACAILEEFEVPFEVTIVSAHRTPQRMNKYASEASSRGLK
FT                   AIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSSLDGVDSLHSIVQMPRGVPVATVAINN
FT                   STNAALLAVRFIGAFEPKYHKKMQQYLLKQEVEVLEKAKKLENSGYKNYMGLE"
FT   gene            <354683..>354922
FT                   /locus_tag="ZYRO0G04422g"
FT                   /old_locus_tag="ZYRO-ORF1562"
FT   CDS_pept        354683..354922
FT                   /locus_tag="ZYRO0G04422g"
FT                   /old_locus_tag="ZYRO-ORF1562"
FT                   /product="ZYRO0G04422p"
FT                   /note="highly similar to uniprot|Q3E785 Saccharomyces
FT                   cerevisiae YDR379C-A Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29257"
FT                   /db_xref="GOA:C5DZH3"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZH3"
FT                   /protein_id="CAR29257.1"
FT                   /translation="MAKRLSGLQKEVLHLYRASVRVAHTKPKQNQPHFINYIREEFGKH
FT                   KDLPKRDFTTIEHLLRVGNKRINLYSSPELKDIN"
FT   gene            complement(<355149..>358784)
FT                   /locus_tag="ZYRO0G04444g"
FT                   /old_locus_tag="ZYRO-ORF1561"
FT   CDS_pept        complement(355149..358784)
FT                   /locus_tag="ZYRO0G04444g"
FT                   /old_locus_tag="ZYRO-ORF1561"
FT                   /product="ZYRO0G04444p"
FT                   /note="uniprot|Q9P8F2 Zygosaccharomyces rouxii rga1
FT                   Pheromone response protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29258"
FT                   /db_xref="GOA:C5DZH4"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZH4"
FT                   /protein_id="CAR29258.1"
FT                   /translation="MDLGTSLTEFTTANGNQFPNCVRCQDEITSGHAYELGDDRWHTHC
FT                   FSCYRCEKPLSCDSDFLVLGTGTLICFDCSDACRSCGKKIDDLAIILSSSNEAYCSECF
FT                   KCCKCSSKIRDLRYAKTRKGLFCISCHEKLLAKRKCYEERKRRLRKDLPELPPELSTPP
FT                   SIPVKSPRRPQYDLPQRSMKSNSESVISQYLDDIDSKVSGDPNEDSNPIETRDSRASTQ
FT                   ESLGSEREKVEAAKENQQDGVAAPATKGKNRHHRQVSIDDILNSTLEEPDAFGLRNSIG
FT                   GLSKTPLRNQDSSEHLAKSPVRFRHGMVVNDDDDDDHEDDDDDDDDDDDQDMEEGLGQV
FT                   KQRKQFQLIPDLSNDDISELTEEEEKKPLENKGLALNLPSQKKDEDTLTLGLDDVPASP
FT                   PSKIKAPQSSWSETKAIPEIKSTPEKKSPPENKLTSPQPKTSVSRHTPTVKSSPRYSPK
FT                   PSSSSSSIKHAHSPRQPPSSISSISTPGNPSSASTASTLQGSSTGGNNLAPNFLIAEEK
FT                   SKGGGSKLGRSLSMKSKHLVHNLKSRTTGILDPKPIPSSPPSHNREKLGFSAFPSSPSN
FT                   YSISDATTKAESDTHTGWGVTNEKASIPRSPSMHRTTPKGKSDSNVHSGSVSPNINHNR
FT                   STSGAELPDHRRARSHASVSSSTATNVSMYRTPPLENNPVFGKLTNSSAKSHHRNFSWQ
FT                   AANEVVKEEDSSASQEADITNNSESSENEHFLKKELAEAELSLRRVKLELRELESKKRH
FT                   LTSDVDHLKTTKEGLTRDIEGLKSEKERYILESLGQLQHQQQREQREPHHPQREQSQRE
FT                   QTQREQTQREQPQREQPQREQPQREQPQNHSQQSNSTVPQQQHRQQSQQHLQTPSLTNS
FT                   GLSGNKQDISIDDISPPRQADTASIARPASKPRFWKIFSGGGKQAATPTHTPQHQNYSS
FT                   QPAANSSTGAASIHNGGSNNNSKLEISNPVLQNPHEFSDMKLFPITNSNSESSSRTSPS
FT                   RSDGSMLYGSNLVSRCAYEQNDIPMIVTVCVSHIESNENYMKAEGIYRKSGSQLLIEDI
FT                   EKAFADCYAKPSPEVLKLMSEDIHAVASVLKRYLRKLPNPVLTFQIYEPLIKLVREHRL
FT                   LNTLPLKSGGNTDKNPLYLNALESVTKILKNLPREHYDLLRYLSRHISKITSYSEWNLM
FT                   NLYNLSLVFAPGLIRDYNGDKDILDMKERNYIVGFLLGNYKDIFD"
FT   gene            complement(<359309..>360262)
FT                   /locus_tag="ZYRO0G04466g"
FT                   /old_locus_tag="ZYRO-ORF1558"
FT   CDS_pept        complement(359309..360262)
FT                   /locus_tag="ZYRO0G04466g"
FT                   /old_locus_tag="ZYRO-ORF1558"
FT                   /product="ZYRO0G04466p"
FT                   /note="some similarities with uniprot|P17106 Saccharomyces
FT                   cerevisiae YJR060W CBF1 Helix-loop-helix protein that binds
FT                   the motif CACRTG (R"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29259"
FT                   /db_xref="GOA:C5DZH5"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZH5"
FT                   /protein_id="CAR29259.1"
FT                   /translation="MSKREHGEEDDESIKRQKQDDNIDAALLNEGEAQSGSQQYETAAT
FT                   AAAVAHAAYGDLIQHPGDEGKSGGAGDDDDDDEGAENHGSAGVHAHTGAEGGAGDNEGG
FT                   EDEEEDEEEEEDVDDQIKDPDHVPEDDDDENRGKQSHRRSSGSIKSGLGGNTSARSGSG
FT                   SADVDLEDAAGADDDVDDDEKKMFARRARRAPAATGSDEWRKQRKDSHKEVERRRRENI
FT                   NTAINKLSELLPVKESSKATVLARAAEYIQKLKETESANIDKWTLQKLLSEQNQSRLST
FT                   ANERLQDELGRAYKEIESLRQKLKEAGIEVETSNEN"
FT   gene            complement(<360635..>362545)
FT                   /locus_tag="ZYRO0G04488g"
FT                   /old_locus_tag="ZYRO-ORF1556"
FT   CDS_pept        complement(360635..362545)
FT                   /locus_tag="ZYRO0G04488g"
FT                   /old_locus_tag="ZYRO-ORF1556"
FT                   /product="ZYRO0G04488p"
FT                   /note="similar to uniprot|P47116 Saccharomyces cerevisiae
FT                   YJR059W PTK2 Putative serine/threonine protein kinase
FT                   involved in regulation of ion transport across plasma
FT                   membrane enhances spermine uptake"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29260"
FT                   /db_xref="GOA:C5DZH6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZH6"
FT                   /protein_id="CAR29260.1"
FT                   /translation="MPQKAESMNPFRALGKKLKEHAEGKNHASGGSSRADSPDKNGRNR
FT                   SASFASKKGTPVPNAPHNLKPANSSASLQNIMAHNHNPFAAHQDPQRSGVPARRNTHSS
FT                   DKKHPARQASHPVLSHEKMVYNPYGLNNPRNGGSMNGGHGNNDLSFYMHDGDAHVRVLP
FT                   LPISDPNGFLPEDMKQISVALTDNFTFDSDNQALGSGGSSEVRKIRSSHHPRNLYALKK
FT                   LNMIYDETPEKFYKRCSKEFVIGKHLSHSVHVANTYCLVKVPTTTYTTRGWGFVIEICA
FT                   KDLFQLMERSGWRTVPLSEKYCIFKQIANGVKFCHEQGIAHRDLKPENVLLTHDGVCKL
FT                   TDFGISDWYHTDPQDPNSPVKTCEGMIGSSPYAPPEVMVYDSKKNFPQSAQKPFDPLLM
FT                   DSYALGIILMSLVNNVLPFFESCNVDSRYRDYATAYEQYVHYQNSHFRDKGCHRPGPGA
FT                   EYLLARNFNSSDAARVAWRLADPKASTRYTMEDLFNDPWFQSIETCVDPEEEPTLNAPE
FT                   LRAPASQISTNGTAGSINTSGPSAEEPTKPRSMVDIAESPTAPSAHNNIAQITRKMSDI
FT                   SVSSSNHSIQQSTSMAHQNSSVSLRSQATSRPKKRRLQHNHLEVPASIAPSSSARAMSS
FT                   R"
FT   gene            complement(<363004..>366159)
FT                   /locus_tag="ZYRO0G04510g"
FT                   /old_locus_tag="ZYRO-ORF1554"
FT   CDS_pept        complement(363004..366159)
FT                   /locus_tag="ZYRO0G04510g"
FT                   /old_locus_tag="ZYRO-ORF1554"
FT                   /product="ZYRO0G04510p"
FT                   /note="similar to uniprot|P24004 Saccharomyces cerevisiae
FT                   YKL197C PEX1 AAA-family ATPase peroxin required for
FT                   peroxisome biogenesis contains two 230 amino acid ATP-
FT                   binding AAA cassettes upregulated in anaerobiosis Pex1p and
FT                   Pex6p interact via their N-terminal AAA-cassettes"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29261"
FT                   /db_xref="GOA:C5DZH7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015342"
FT                   /db_xref="InterPro:IPR025653"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZH7"
FT                   /protein_id="CAR29261.1"
FT                   /translation="MTASKAGELHFSGIRVVSANDIKGNFVRLPSSIVQTLESTGISIQ
FT                   EFGISIVRESKEILHTGWDGYESQGYANGQSTIDINPILAREFGLVMGSLVDLTICKYG
FT                   ASQTATEVHVEPESSDDWEIIESNSMFFQDEILHQTRIVTVGEVLICYIDNVVSKFRIN
FT                   RIFPETLKSARINTGSLIVIAPRENRARHPVENVKARELNKPMDTVARLRRTIITTDST
FT                   ELQGLQARVHPGELESEYALVSILYNSLDMKHLQALKKASGKYASDIACTVAIDGTVPS
FT                   GHIMLSPLVWDCLCTAPENGIKLKIEFCLGQNFANDSSNSVKVLVKSLVSEEEAAKRDK
FT                   RRVLHSSNLQKGPSQTILDLMGKLQTTVLTHKMIFAKENVTIELLVENSGKHPIITDFN
FT                   ENPIGDNWQYLPLEEVKLPLNELNYKLEGSTFVKKSMELDSLVTTDLIKQLSNFLTLPV
FT                   TPSSCAMLEGGSGMGKTTLLQQLAKELILKHGKYVKYVDCDSLMESSNLTRMKQFLQDC
FT                   CSLCYWHGPSVLLLDNASTLFPNMKSEDPQQQAQLQRGGPTSTKLAMTLIHGIQMISRK
FT                   NSEAVRVVICDKNKHELNGSFFDKHFVSETFKIKALDTDGRTNMIQFFIKKTHTELADD
FT                   LQFRDIALETEGYSPLDLELLVEKMFYNLTILQSHQNSEGLLDKKLFQETLKSFTPSSL
FT                   QGVKLTKSTGVKWDDIGALKAPKRLLLETLEWPVKYAPIFANCPLQLRSGVLLYGYPGC
FT                   GKTLLASAVAQQCGLNFITVKGPEILDKYIGASEQNVRELFERAQSVKPCILFFDEFDS
FT                   IAPKRGHDSTGVTDRIVNQLLTQMDGVEGLDGVYVLAATSRPDLIDPALLRPGRIDKSV
FT                   LCNIPSLVDRHDILRAITSKMDILQGTDLYPVAQQTEGHTGADLQGLCYSAYLKAVHRE
FT                   LDEHEKSQEADQNQDKDSTQDIVHSVINGGDPSSLLQNVRLFTSKQNSDLQYGKGTTDQ
FT                   KLPKPKISLKDLLDAAKETKSSISTHELYKLRSIYDRFQDNRDGQMPNGEGSVETGTRT
FT                   SLA"
FT   gene            <366337..>366780
FT                   /locus_tag="ZYRO0G04532g"
FT                   /old_locus_tag="ZYRO-ORF1553"
FT   CDS_pept        366337..366780
FT                   /locus_tag="ZYRO0G04532g"
FT                   /old_locus_tag="ZYRO-ORF1553"
FT                   /product="ZYRO0G04532p"
FT                   /note="highly similar to uniprot|Q00381 Saccharomyces
FT                   cerevisiae YJR058C APS2 Small subunit of the clathrin-
FT                   associated adaptor complex AP-2 which is involved in
FT                   protein sorting at the plasma membrane related to the sigma
FT                   subunit of the mammalian plasma membrane clathrin-
FT                   associated protein (AP-2) complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29262"
FT                   /db_xref="GOA:C5DZH8"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR027156"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZH8"
FT                   /protein_id="CAR29262.1"
FT                   /translation="MAIKFILCFNKQGIVRLVRWFELSASEAQRTQDVMVQIYRLISSR
FT                   DHKHQSNFVEFSDSTKLVYKRYAGLFFVMGVGLQDEEPIYLSHIHLFVEVLDAFFGNVC
FT                   ELDIVFNFYKAYMVMDEMFIGGEIQEISKDMLLERLSTMDRLE"
FT   gene            complement(<366792..>367448)
FT                   /locus_tag="ZYRO0G04554g"
FT                   /old_locus_tag="ZYRO-ORF1552"
FT   CDS_pept        complement(366792..367448)
FT                   /locus_tag="ZYRO0G04554g"
FT                   /old_locus_tag="ZYRO-ORF1552"
FT                   /product="ZYRO0G04554p"
FT                   /note="similar to uniprot|P00572 Saccharomyces cerevisiae
FT                   YJR057W CDC8 Thymidylate and uridylate kinase functions in
FT                   de novo biosynthesis of pyrimidine deoxyribonucleotides
FT                   converts dTMP to dTDP and dUMP to dUTP essential for
FT                   mitotic and meiotic DNA replication homologous to S. pombe
FT                   Tmp1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29263"
FT                   /db_xref="GOA:C5DZH9"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZH9"
FT                   /protein_id="CAR29263.1"
FT                   /translation="MARGLLILVEGLDRTGKSTQASILLDKLKPNAELVKFPDRTTPIG
FT                   QLINRYLTDESFQLPDQSIHLLFSANRWELSQSLQNTLLSGKHVIMDRYVYSGIAYSLA
FT                   KGIDGMDFDWCIQPDKGLIKPDLLFFLSNRDSLDTASREGFGQERYESLAFQEKVRDQF
FT                   YRVLERLENYSQGTDSNRLQMINVTNQSIDQVSITIWEIVNRKLQNEPPTDFAFF"
FT   gene            <367722..>367807
FT                   /locus_tag="ZYRO0G04576r"
FT                   /old_locus_tag="Zyro0G.tTyr.GTA.11"
FT   tRNA            join(367722..367760,367772..367807)
FT                   /locus_tag="ZYRO0G04576r"
FT                   /old_locus_tag="Zyro0G.tTyr.GTA.11"
FT                   /note="tRNA-Tyr (GTA) cove"
FT   gene            complement(<367996..>368337)
FT                   /locus_tag="ZYRO0G04598g"
FT                   /old_locus_tag="ZYRO-ORF1551"
FT   CDS_pept        complement(367996..368337)
FT                   /locus_tag="ZYRO0G04598g"
FT                   /old_locus_tag="ZYRO-ORF1551"
FT                   /product="ZYRO0G04598p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29264"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZI0"
FT                   /protein_id="CAR29264.1"
FT                   /translation="MADCLCENFPNYNFMGSKRTADFEDRSQEECVVRYNKKIKREPLT
FT                   PPRESSCEVENKGCSPYWEVEEYMVRGYESIQDVQCSLYDLTPEEELERQCDDDDGEVP
FT                   RIDCDIDMM"
FT   gene            <368774..>369502
FT                   /locus_tag="ZYRO0G04620g"
FT                   /old_locus_tag="ZYRO-ORF1549"
FT   CDS_pept        368774..369502
FT                   /locus_tag="ZYRO0G04620g"
FT                   /old_locus_tag="ZYRO-ORF1549"
FT                   /product="ZYRO0G04620p"
FT                   /note="similar to uniprot|P47115 Saccharomyces cerevisiae
FT                   YJR056C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29265"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZI1"
FT                   /protein_id="CAR29265.1"
FT                   /translation="MERLNTLGSSLPPEQPPTNQVIESLSSELSQEFKLAANAVTKLYR
FT                   VANERNSLLKHQGYLQCLEDILSIMGQNPSASTDVIHLWCLKQKNEMLSHGSGISPDSS
FT                   ATTNSNKFDFNFDNPNVSNINNTDVSVPKFRLSNPPPSVEHTTTNHKPKKTRWIKRQPT
FT                   WAKEDKILRDDESIGDDQRSPHRKSDSDKVQEHHIYHPHHHHHHYYNDNNDRTKMGTEP
FT                   ETDLGPKKKQRLDKTDSIGD"
FT   gene            <370067..>371029
FT                   /locus_tag="ZYRO0G04642g"
FT                   /old_locus_tag="ZYRO-ORF1546"
FT   CDS_pept        370067..371029
FT                   /locus_tag="ZYRO0G04642g"
FT                   /old_locus_tag="ZYRO-ORF1546"
FT                   /product="ZYRO0G04642p"
FT                   /note="weakly similar to uniprot|P54003 Saccharomyces
FT                   cerevisiae YML052W SUR7"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29266"
FT                   /db_xref="GOA:C5DZI2"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZI2"
FT                   /protein_id="CAR29266.1"
FT                   /translation="MGLLSISNWILRFSTILFFAGNVLLLILIIISGGSNNYPISRFYW
FT                   VEGDTSGIPHAPNVTRWTYWGACSRSDGHTHCGGTLGPAYPISPVDNFGTKTNVPSKFI
FT                   SRRSSLYYLTRLSFSFFWIALSFISTSFLIYAGSWFSHGVSYVTWVLTFVGCIFNILAV
FT                   IFQTAASVMARDAFTDAHRHGKLGAPLFGMAWASVFLCLIEIASVVVTHFLGRRPDGTI
FT                   PQDQENYDYERAQLPNVKGPSRRTTHPFRSFFSRPQNDSGNEYHEDVNDEEKLRHPDTS
FT                   SVEQPEVHSNVANGEHAHGDDLNFSNVKRHQDADSLQSV"
FT   gene            <372009..>373322
FT                   /locus_tag="ZYRO0G04664g"
FT                   /old_locus_tag="ZYRO-ORF1544"
FT   CDS_pept        372009..373322
FT                   /locus_tag="ZYRO0G04664g"
FT                   /old_locus_tag="ZYRO-ORF1544"
FT                   /product="ZYRO0G04664p"
FT                   /note="similar to uniprot|P04387 Saccharomyces cerevisiae
FT                   YML051W GAL80 Transcriptional regulator involved in the
FT                   repression of GAL genes in the absence of galactose
FT                   inhibits transcriptional activation by Gal4p inhibition
FT                   relieved by Gal3p or Gal1p binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29267"
FT                   /db_xref="GOA:C5DZI3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZI3"
FT                   /protein_id="CAR29267.1"
FT                   /translation="MYHNKRSAVSTVPNEDPIRVGFIGLSFSKGWALKTHRPAILQLSS
FT                   QFVITAVYDEDEKMAIDTIERLKLVHAKPFTDLESFSTFENVDMIVVSVQASQQYEIVM
FT                   PLLEFSRRNSNLKYLFIEWAFASNLQQAEKVYQAAAIRGLQTIIALQGRKSPYIQRAKE
FT                   LIHENNIGEINSIEISCNACWYGYERSRKVANGMFEMGNGLDLVTTTFGHTIDLLQYIT
FT                   ESYFSKINALIFNNIPEQMLVDDLGNPMGRTSPKTVPDHLLFHGCLQRGNVPVSCTIKG
FT                   DKPTKKFTKNFIIDIHGTRGDIKIEGDAGFAEMSNLVLYYSGIRVNDIPIASDNGHPVQ
FT                   PSLDQGKEFMEVYHLRNYDAVHGNVFRLYQSIADFHFNTKNIPNLPSQFVMQGFEFEGF
FT                   PTLMDGLIIRRLIDSVYRSNSMGATLDVTHILQFPSSV"
FT   gene            complement(<373311..>373799)
FT                   /locus_tag="ZYRO0G04686g"
FT                   /old_locus_tag="ZYRO-ORF1543"
FT   CDS_pept        complement(373311..373799)
FT                   /locus_tag="ZYRO0G04686g"
FT                   /old_locus_tag="ZYRO-ORF1543"
FT                   /product="ZYRO0G04686p"
FT                   /note="similar to uniprot|P46973 Saccharomyces cerevisiae
FT                   YJR055W HIT1 Protein of unknown function required for
FT                   growth at high temperature"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29268"
FT                   /db_xref="GOA:C5DZI4"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="InterPro:IPR040197"
FT                   /db_xref="InterPro:IPR040722"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZI4"
FT                   /protein_id="CAR29268.1"
FT                   /translation="MGPKIAEKCGICHDNDAKYKCPKCGIKYCSLTCYKDEARHKDPVD
FT                   STDQKEEQIGKNEKPANSAKPPQLASPEYSKIYTETPEIQELLKYNTVKFHLSKVHRIL
FT                   SSEVADPNESNMNNEMKRQLAVDYLNTLRYGGIHYNEAIEEFCQLSLSKLNNPDQSNA"
FT   gene            <373979..>374959
FT                   /locus_tag="ZYRO0G04708g"
FT                   /old_locus_tag="ZYRO-ORF1541"
FT   CDS_pept        373979..374959
FT                   /locus_tag="ZYRO0G04708g"
FT                   /old_locus_tag="ZYRO-ORF1541"
FT                   /product="ZYRO0G04708p"
FT                   /note="similar to uniprot|Q04689 Saccharomyces cerevisiae
FT                   YML050W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29269"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DZI5"
FT                   /protein_id="CAR29269.1"
FT                   /translation="MVFHYRSILKYQVFRAYFHRQYEQVRIHTGGSQLLTCDCQNYSSR
FT                   LNQSLPNEFKLDVDSPLPSKVPSYKKHALVLSLQNKSADELEWMTNWQSKLELNPMWPY
FT                   SIIGDLKTHLKHTKFGSDVLVNAISIHSGNLSAPSRDPHERAHIFVIPDMKLYKISPQD
FT                   VVSFAHFLGGGHTRQVADHQLSFADFLKGADNVVNKTELVSEPSNADHAFPHEDCKRDW
FT                   ILVCGHNQRDRRCGILGKELINEISAKGLDKDKNVALISHVGGHKFAGNLILYNYVGTN
FT                   EKTGENQLDSLWFSRVLPPNLGTLLEHVDAKKIPQEYYRGGTSMN"
FT   gene            complement(<374995..>378903)
FT                   /locus_tag="ZYRO0G04730g"
FT                   /old_locus_tag="ZYRO-ORF1540"
FT   CDS_pept        complement(374995..378903)
FT                   /locus_tag="ZYRO0G04730g"
FT                   /old_locus_tag="ZYRO-ORF1540"
FT                   /product="ZYRO0G04730p"
FT                   /note="similar to uniprot|Q04693 Saccharomyces cerevisiae
FT                   YML049C RSE1 RNA splicing and ER to Golgi transport
FT                   involved in secretion and RNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04730g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29270"
FT                   /db_xref="GOA:C5DZI6"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZI6"
FT                   /protein_id="CAR29270.1"
FT                   /translation="MFGENDELILFHLTLQRQTNYVHSCIGHFIDVNDDSSQEVTGSKV
FT                   NRKRHLQLCISTQTHLELYDVSEGSLRSLAVVPLFATITAMETLNLENSPSSFLALTSD
FT                   SGNLTISRFASIEPQGKIVLQALINQPLTRSGLRRLSPISHLQVDLHGRCLFLSAIERN
FT                   KLCFVANQIGQDGISIQDPLEALVPNTLTLDTAVCDVRYDNPCFASLELQQGNHHLVFY
FT                   VLDLGLNHIVKRASYKIDETANFLMGLPDLSKYRISTYMDSNEHHHGDYDEINPFVLVG
FT                   FEDFVMIKDLHGFYNIKVPIPRRKDVSMPTTIICFAIQTLKNNFFVLLQSNHGDLFKLK
FT                   IEPNKEDSNRPVAFISYFDTIPQATDLHIFKNGFLFANVEFYDNRLFQFESLGDDTPIE
FT                   GTFEPSSTLRNLSLVETQKNLNPLISSQVTSTTPLTLAANSMNKTRFMVNGVDFDVHVS
FT                   SGVNVDARELWSIKFPSDNYHRLLFLASHDLTMILETEAGAMGELAGEQHEFKTKSDRT
FT                   VFVGSMGSKSVVQVCVNELRQVVFNADSKKYEKKLEWFPPAGIRVVAADCNYSQLAVGL
FT                   SNGEICYFEIDTESLSDSLHELQNRVEIDEQIKGLAMIPEPRSDYLAVGTKEANLKVLS
FT                   LKKNDMDNFLEVVSLQALMAPVSDLKITRTERDVELHIGLINGLYSRSKLNRYDGQLYD
FT                   VRNKFLGPKEVTLSVLPSMSFLKKTSDEEEEEEEDDEDEDEGTETTKQHDDIEKDAKTG
FT                   AKGPCVMLHSIKTWVSYEHDSLLYIRPMLLRHPGNFVKMCQFSTENLKINGCCAIDTIS
FT                   SGASLTIGALENFVFRDKWFQTKDKICLPVGAVEEDHEDNEERIWPRLYDGCKIITFDD
FT                   DRKMNLFIENSYDGNQVRVSLARSQKFFNSQVSNSQFEILENMRAITAAITKFSSNTYY
FT                   LVVSTTHNQLYTFELIIRRAPKDKSIRDCVGEFHMKLLHKTPTEDKVHAMVGFRDKLLI
FT                   PVFGSLILYGLGKKQLLKRSISSTTASITKISSLANWKNQRIAVGDNRESATILQFDST
FT                   NNIFVPIADDVVKRHVTALTFIDQSTVIGGDKFGNIWTLRLSREQESLIRSNFPHSLDR
FT                   LQQYADLKNKAPNIMACPLKLSLINHFYVNDIPTGFYLAEAVQVSDRPIILYCGLQGTI
FT                   GSLVPLLTKSEVNSLRSLENVMSDADDIFYLEQENQNGSSTDQPVDEDGLDKDVARPLG
FT                   SSSNAVRIPEGAYSIVGRDSFKYRSYYAPVRNVIDGDLCETFLNLSLSEQTKLCKETSG
FT                   SNPEGVCKQLNDIRTNYI"
FT   gene            <379677..>380894
FT                   /locus_tag="ZYRO0G04752g"
FT                   /old_locus_tag="ZYRO-ORF1538"
FT   CDS_pept        379677..380894
FT                   /locus_tag="ZYRO0G04752g"
FT                   /old_locus_tag="ZYRO-ORF1538"
FT                   /product="ZYRO0G04752p"
FT                   /note="similar to uniprot|Q04697 Saccharomyces cerevisiae
FT                   YML048W GSF2 ER localized integral membrane protein that
FT                   may promote secretion of certain hexose transporters
FT                   including Gal2p involved in glucose-dependent repression"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29271"
FT                   /db_xref="GOA:C5DZI7"
FT                   /db_xref="InterPro:IPR022757"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZI7"
FT                   /protein_id="CAR29271.1"
FT                   /translation="MEVSVRFNADVEKDFAFQVDREDRLRDKIARIFRKNGTGMGHFMV
FT                   LRPTIFHKEEPAGYYKSMHPGYMTEGGCILYDYDADSSEYMQLLDEEKPVFEQVWPSQL
FT                   ILPKWDVSKVNVFTYAFIMLAWLYTDLPDCISPTPGICLTNCMSKLLIPVLDYLELYDL
FT                   SSHLRLEVTPGYSSLLAQWGFFTFHVFKVLLITLFFAVGLCNPVSFNPFKVMRITKMDL
FT                   TQPSIKNLVKSLGWVGIRKGTQEQYQATFYEYIMKQYGNTVKASKAGKLRVAINPGVPL
FT                   SDGEGFQTPLSQRFEIDTFEKAEKEGKFYFSEAYFIELENNLKSNVEKCRGDIGLMNAE
FT                   VKRFRRYGLFEPNAKIERLVEIRKRTFEKLHEEEEAEIERKRLEKVAKRREGERIKEEK
FT                   ETKKIR"
FT   gene            complement(<381107..>381178)
FT                   /locus_tag="ZYRO0G04774r"
FT                   /old_locus_tag="Zyro0G.tArg.CCT.56"
FT   tRNA            complement(381107..381178)
FT                   /locus_tag="ZYRO0G04774r"
FT                   /old_locus_tag="Zyro0G.tArg.CCT.56"
FT                   /note="tRNA-Arg (CCT) cove score=74.84"
FT   gene            complement(<381313..>382842)
FT                   /locus_tag="ZYRO0G04796g"
FT                   /old_locus_tag="ZYRO-ORF1536"
FT   CDS_pept        complement(381313..382842)
FT                   /locus_tag="ZYRO0G04796g"
FT                   /old_locus_tag="ZYRO-ORF1536"
FT                   /product="ZYRO0G04796p"
FT                   /note="some similarities with uniprot|P47114 Saccharomyces
FT                   cerevisiae YJR054W Vacuolar protein of unknown function
FT                   potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29272"
FT                   /db_xref="GOA:C5DZI8"
FT                   /db_xref="InterPro:IPR031606"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZI8"
FT                   /protein_id="CAR29272.1"
FT                   /translation="MFRNDWKYTANAKTFESIDLSLFRNTKFWTVLNCIIFVWGIIILK
FT                   FLLFASDIYTCIKLLAFNSWSNNIIQPYLPFRISKWLFSSCILASVILLIWEFIRGIRI
FT                   YRTRNISLTYVNNFSRTAYSMFDYSKYCIYFKITPKGKFQKSAFFTFFELKDSLRLLFA
FT                   DTPRQVINGLTLWSVLITVNNENSNIAHGHLESFNGLITKLKTIAKTNHEEAVILSFML
FT                   FSFAIWAIFITKLAIAMIMSVYVYYKLIQGQQYSGLKEFVCVTINHNVDALVEKQKKKK
FT                   GLMSQPYRLSTLSRSSIFDDDIENKAATFATSSETALSNLHNDSTTALIDSGNFNDHKN
FT                   PGLAKIPTNGSWDSRYDQEVDLSQEPLKTTSMIYENDRDRDRVVMFDVAKHLKGPRYNI
FT                   VAMHSSDSLPSSESLVSQQALLRQKSLSSSTSSHRARPPPPPLLGAQNSYMRLAQDENP
FT                   EYERIYTPLRAYTRDGETRNNRFPDRYNSLLDRRERIANEDYGHYLNRHKY"
FT   gene            complement(<383195..>385003)
FT                   /locus_tag="ZYRO0G04818g"
FT                   /old_locus_tag="ZYRO-ORF1534"
FT   CDS_pept        complement(383195..385003)
FT                   /locus_tag="ZYRO0G04818g"
FT                   /old_locus_tag="ZYRO-ORF1534"
FT                   /product="ZYRO0G04818p"
FT                   /note="similar to uniprot|P47113 Saccharomyces cerevisiae
FT                   YJR053W BFA1 Component of the GTPase-activating Bfa1p-
FT                   Bub2p complex involved in multiple cell cycle checkpoint
FT                   pathways that control exit from mitosis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29273"
FT                   /db_xref="GOA:C5DZI9"
FT                   /db_xref="InterPro:IPR034586"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZI9"
FT                   /protein_id="CAR29273.1"
FT                   /translation="MSIRPVNLDEFPETSFEDMESTFGKINTNQDQEPAPVSPLGRNHG
FT                   VLPTPSSASSNGTTFSISKGKRLSVGSSSRTDEEGEEDEDDFLNDFQEFQGKKDDIDDA
FT                   FKTYFNLNDNDNNTNNNNNDNNNKDNSGPRKRKSIDFIKDFDEKLNLRSSRGSSRLRQR
FT                   QSMMELKPHLKPSSSFSRIPNSLSAGDLRIRPNASVRFKKSMPALSNFNGMIREEDELE
FT                   DDLPTLKRPQRFLDNFEEAREEEEQDDKDFVFDESLIQPQFLNRAPESPLRLSPSQYDI
FT                   IRDDTLLTPRLHRRHRDWNSKDQLDSFKERRKSEQQQQHQQKQRRKGYHHHNRPQTASR
FT                   IQIIKQEIDQNTPIKNGSMYYNPKTMKWEGNEHILDKFNKLESQDEKPLLIRARTSAQE
FT                   PLNSATDGSHIEKISKRNSNRGKSKQSHQRIVGKMMFDEENLKWVNIDEDEEDADPFAN
FT                   VEDVAPLPTAPGFDGAHDENTLKAPSSGANNNGNKHISPFLRSHSQILPSGANSLDRLN
FT                   SSATTRYHSVGFTRSDNTNPQFQLNSRQLEKFWHEENKWNRKVGAWFIMGDSSDAQPGD
FT                   LADFNEVKNPRSFMYEIRNMVLNSTR"
FT   gene            <385234..>387135
FT                   /locus_tag="ZYRO0G04840g"
FT                   /old_locus_tag="ZYRO-ORF1532"
FT   CDS_pept        385234..387135
FT                   /locus_tag="ZYRO0G04840g"
FT                   /old_locus_tag="ZYRO-ORF1532"
FT                   /product="ZYRO0G04840p"
FT                   /note="similar to uniprot|P39682 Saccharomyces cerevisiae
FT                   YML046W PRP39 U1 snRNP protein involved in splicing
FT                   contains multiple tetriatricopeptide repeats"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29274"
FT                   /db_xref="GOA:C5DZJ0"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZJ0"
FT                   /protein_id="CAR29274.1"
FT                   /translation="METVIGIDDGNQSVSNALAELDPSFLKENPLLVNAYTKIKWDDTN
FT                   SLNALISAVEQIVVKYKDPNVTIKGTIEKIYDQLLGKYPLFFGYWKRFTAVEYQLFGLQ
FT                   KSIDTLTRAVETFPTSIELWCDYLNVLCANNPNEIDLIRRKFRTAKSLVGYQFLSHTFW
FT                   DKYIEFETKHEEWGNLGNIYQELVTIALHQYAKYGAAYKAYLRSGNAAFQDPDVDAKLR
FT                   KTQNLVNAIWPFESKIKQSFFNLTPVAQTELQNWDQYLDFILSNRQKFNFTNPFIISVF
FT                   ERCLIPCFYYEHFWIRYVSWFEDWEELPHVVELYQRGSAVLPLNCKTFRIRFLGFLKKS
FT                   FRINKDYVYSLFEETAASYMERFPSDAFIMTDYLALLKRHQFLSSIDQNDEEILQKQVC
FT                   YAKYLETAITNYLQSKIAKDIPLQEMLNDINIPIVVVELIKITWLVLKNTMQARKYFIF
FT                   YSKNPLMKSSVTYWLTYYKFEKWCQNYTKLNRFINDLGTKIFLPTAIVNDLLEDYRNFY
FT                   LANSNVMHFQNFVQSTNERKEMDPILLTEFKMNDPNWLPGIHRESNDWHKTREFRENGH
FT                   PGIIDERPQITNLICQYKSKFFDNQPPSIPAFRNLEKINQPLKYNDYLTKEYLGIGD"
FT   gene            complement(<387238..>388368)
FT                   /locus_tag="ZYRO0G04862g"
FT                   /old_locus_tag="ZYRO-ORF1531"
FT   CDS_pept        complement(387238..388368)
FT                   /locus_tag="ZYRO0G04862g"
FT                   /old_locus_tag="ZYRO-ORF1531"
FT                   /product="ZYRO0G04862p"
FT                   /note="highly similar to gnl|GLV|CAGL0J11154g Candida
FT                   glabrata CAGL0J11154g and similar to YNL175C uniprot|P53883
FT                   Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29275"
FT                   /db_xref="GOA:C5DZJ1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034226"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZJ1"
FT                   /protein_id="CAR29275.1"
FT                   /translation="MTEETKPANEEQLQQALQDPTKKRKAEDEIEIDLERSVPLSKKQK
FT                   RLLRRGKVTIEELNAKYNLDPASVEQYKKESSEADKESTGPDEEEGKTDPKKKEKGYGV
FT                   WIGNLSFDTSKEDITRFLVAKTRELEESDQISENAILRIHMPFAQNDGKKIKNKGFCYV
FT                   DFKTIEQMESAVKLSESQLNGRNLLIKNSKNFEGRPDKDDLVAASKNPPSRILFVGNLS
FT                   FDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALKDKSCRKIA
FT                   GRSIRMEYGEDRSKRQVRRKPESSSSSSTEKPFDLPNQVHSNDASNSEERKPTRKPFTK
FT                   RPVDSNHRPKSSVALASAQRASSAIVPSEGKKVTFD"
FT   gene            complement(<389014..>392835)
FT                   /locus_tag="ZYRO0G04884g"
FT                   /old_locus_tag="ZYRO-ORF1529"
FT   CDS_pept        complement(389014..392835)
FT                   /locus_tag="ZYRO0G04884g"
FT                   /old_locus_tag="ZYRO-ORF1529"
FT                   /product="ZYRO0G04884p"
FT                   /note="some similarities with uniprot|P38845 Saccharomyces
FT                   cerevisiae YHR146W CRP1 Protein that binds to cruciform DNA
FT                   structures"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29276"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZJ2"
FT                   /protein_id="CAR29276.1"
FT                   /translation="MSTVNYSFSWPSGPKDVVVTGEFDEWKSIFHLEKSPTTGEFEITL
FT                   PIKIPEEKDRVFFKFIVDGQWVTSGFYKIGTDPAGIENNYISKQELHHLVEKKDEKNEK
FT                   HKSDIAAGIATTASPKPTKTRSAAAPQQGDTPEAVVARSSKNLNVKPSTPQTASPSAHP
FT                   QKPQSSHSHEHEHAAATTTPTASNDPLAATAAASALRKVKIKRKIKINKKTGERIVVSE
FT                   ERIPLDEDDEAVLGSTTFEEEELSPAGKASTNSSAQGTPGLSNAAAGAAGIPPSVTGTT
FT                   TPTPTRQRQKQQQQPRTPLGSVNSPSNSPSVRKTRPLSTSGAPKSSSGIRSRSGSTKER
FT                   PVSTVGRPTSPSRSKSSTPMSSSGSAAASAGATAATAAAARKDRPTSAAIGDSTPSSAL
FT                   KTVSRGGSTKKNTNESANAEVTGPLGTRLPDNAGEETFHILPIETPSGGDQAAFKSLAG
FT                   EPGPFVPSNQEQLKAFSEVNDNVDPQAFNERLNKQFKAEHNTPEKKASEKLDKKIDSQA
FT                   NTENLDKQKSLDDLDKKANESKLEQISKGDAVGKLKNDDELQKLGKDSLQGKEDKKDAF
FT                   DTLKNDKGNLTDAGKSLASDAKKSASGPGADTGADSSDAKDTFGKLGEDDTLKQLGKDA
FT                   AEGKVNKDDALDKLGKDSTLKDTGEGVAAGALGGASSGKNKNKNKKKNKNKKNKNKAEK
FT                   SSEKESKEKTGTSDASISGDLESGERQIPGDYNTEKVTQENKGVKSDLSETGDLSSTDG
FT                   IRGANEHGYVPGKAGPELDENDSSAHGGVSAQGSTPGSTGQVVGKDAAPLRSSAQGETA
FT                   GVTGPSASKGATESLAPGAAAGAAGAAGATGISTTNAGEKELGNEATEYGKKTGLDDKT
FT                   DLDKEISALGGKTELDQDANLLSKEAVPLSEDKTSATGAAAGTSITKVPADKEKEVTQD
FT                   YPKKNEPSELQNKGETEEKKSKEVKRTGSQKKEAALPTLDPRARKSAGDPNSGARPTSS
FT                   QQYVDTDNDEKNKDYSDPLTKDTSEIAGQHAPKAATTTGGSAAGVAGVAGAAGAAVSSK
FT                   DTTKTSKSTPPPNKSAETNGTTPTKANRHSVADAEAKPSKSAHSKSTRPKSVAGSVKKE
FT                   SKGSTAKGTPGSAGSAGTTSAKSKKEIATDALKKGKSKAEVSKGKNTKDTAADLVKTGK
FT                   SGVEDGKSRKEVAKDALKQGKSEAGSAKGKNAKEAVSDAAKSCKKEVGASKGKGVANET
FT                   ANAGKSESGAAAAAEQKPPGQSTLANAANRTDKKKKIGLWARIKRILK"
FT   gene            <394040..>394111
FT                   /locus_tag="ZYRO0G04906r"
FT                   /old_locus_tag="Zyro0G.tPro.TGG.12"
FT   tRNA            394040..394111
FT                   /locus_tag="ZYRO0G04906r"
FT                   /old_locus_tag="Zyro0G.tPro.TGG.12"
FT                   /note="tRNA-Pro (TGG) cove score=66.07"
FT   gene            <394534..>399576
FT                   /locus_tag="ZYRO0G04928g"
FT                   /old_locus_tag="ZYRO-ORF1522"
FT   CDS_pept        394534..399576
FT                   /locus_tag="ZYRO0G04928g"
FT                   /old_locus_tag="ZYRO-ORF1522"
FT                   /product="ZYRO0G04928p"
FT                   /note="similar to uniprot|P53886 Saccharomyces cerevisiae
FT                   YNL172W APC1 Largest subunit of the Anaphase-Promoting
FT                   Complex/Cyclosome (APC/C) which is a ubiquitin-protein
FT                   ligase required for degradation of anaphase inhibitors
FT                   including mitotic cyclins during the metaphase/anaphase
FT                   transition"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29277"
FT                   /db_xref="GOA:C5DZJ3"
FT                   /db_xref="InterPro:IPR024990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZJ3"
FT                   /protein_id="CAR29277.1"
FT                   /translation="MNDILNLDESDDGGIDASSKENFYWDRNNRGDIWISSDRKTVEWQ
FT                   VANQCIRRFYFQQPVIKANFVDFEKAPNCLVIVLKDVAHVYYISQGDSTIVCFPFPIAN
FT                   VFWYSQGLVLERKVTGTNWGENDNHRFITLSDPMLPFGFLGFSTHQRHGSDLKDIRMVL
FT                   FPEDDNLKITVLFDNCQKKLHFYYTQVTGRSNDHSSNGSFNRRDQHLLGGGMNNNPLLA
FT                   NNSGSIISSGSSSDAKKNLRKISILNRRATSATLGTGDSSEIPSSSLKSADSLSSSHKT
FT                   NGGTRRSLSATLDRMSSGLASPVAEFSNSSIPQSHNDALHQRISTRDVTLTKISSMTLP
FT                   QHLAHRIKCLKCISLKLQNREAVAIFDPNTRFYKLWMTDLLPEVINSLSFKVYGNSPND
FT                   MIRLSNFNVDAPIIDMCIYHSYHFPGTLALVHESNHISLYNPFFELASPKIQLPQQGGP
FT                   QKLYYISDDRMVLDKTTISSTNIGLSLFPYPKKSSVILCFEAMKWICSPSIFQAVVFLW
FT                   QFSLQLNDKHICHMEAEFSALEYTLTALMLPPTEEADNFKDIHESSAYIFLAKFGLPYL
FT                   LPKIIMGLHLIREEMTLNVLQKNDVLRWGKFLQYATTIMDWPILWREYYATSGSQSIAT
FT                   DCDPLPGVFAHPLDEPPSIMKSLYSVTENSYTPITPFITFSRLVEMDSKIDHLITPRSY
FT                   KVIRFYEMTHASDYSDEFLLQVLTRLEITKQEINTFPLGLLAPLCKMLAKIEEKLCQVD
FT                   VNLDLSVISRHDLERCVFTIRQLRNDTAMAEDQSKSLNPYRAPLKLSQNNTKVSPKDIY
FT                   TVLAEVVKSTNRFTLERGSIEENADMDDFDEGYTLKKNAGLIFSDDRRFYHVLSLLVYY
FT                   KPRKIQFLSSETEYTKLLKQKKSIARVMSLRTCTSGIGFGAVAYATEKPLATQKWIKAS
FT                   LDFTYLFPDNTKVSIDPDELDQETLLWGEFHSGVSSGLRISKKSKDINGSWIAFNKPKE
FT                   LDAQHGGFLLGLGLNGHLKGLEEWHVYNYLSPKKTHISIGLLLGMSASMKGTMDLKLTK
FT                   VLSVHIVALLPPGSSDLNINLKVQTAGLIGIGLLYQRSQHRRMCDVLFSQLKSLIVVNE
FT                   EQVSDESYRLAAGISLGLINLGVGDLASGDDLNDIPDDIDVPEPLPIGGMGPDEKITRG
FT                   LLEIITKNRDVEEDWIPENSFIGAIMALMLTFLKTGNLNVAESIKPDLKYIPTKVDYRP
FT                   EIFMYREWAYHMILWETIGTDISFIMSDFTNIFDSEINTDKLPVYYTMAGRVLSIGIRY
FT                   ASSGDIRIRDCLLYLVDKFLPFYQYPGDARLDFKLTILGINALLNVLLVSTSLVMCGTG
FT                   DLETFRRTRYLHEIVLGKHSDVFKSQAPTKKTSSDKGAETADAEMSIEEVENSEEASAP
FT                   EVVINETNDDQEELPDVTAETEEKTDDENQYSKYIATSMSLGFLFLGSGQYALKTSSLE
FT                   CLSYLIISVLPTYKRDAPLQETKHFWSMAVEPRCLVIRDAETEKSISNIPIEITVRMTD
FT                   SLKEEMRELVAPCLLPDVRKIRCLRVKSPLYYPLEINFDHEIQSTEFFKNGTILYVQRR
FT                   RPQSDKPPHYRSIDDIQLALRKRMDHSEDETDTATNLSFADKLFKNLECTDSTMMELEK
FT                   EVETPSNEQNYNLEMLCSDINSGDVTDCQLELWKRKHRTLIE"
FT   gene            complement(<399715..>401187)
FT                   /locus_tag="ZYRO0G04950g"
FT                   /old_locus_tag="ZYRO-ORF1517"
FT   CDS_pept        complement(399715..401187)
FT                   /locus_tag="ZYRO0G04950g"
FT                   /old_locus_tag="ZYRO-ORF1517"
FT                   /product="ZYRO0G04950p"
FT                   /note="highly similar to uniprot|P39006 Saccharomyces
FT                   cerevisiae YNL169C PSD1 Phosphatidylserine decarboxylase of
FT                   the mitochondrial inner membrane converts
FT                   phosphatidylserine to phosphatidylethanolamine"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29278"
FT                   /db_xref="GOA:C5DZJ4"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033661"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZJ4"
FT                   /protein_id="CAR29278.1"
FT                   /translation="MLPVKSALSQGRTIITMPMGRIITKIQLRNRTALIWNRGFSSKSL
FT                   VPQKHRSDEFARPPQNSEVRVRSSMIKWAVLTSVTIVIGTILLRAQNEKQRLEDVEEEK
FT                   ESIKKRQRIRIFDNNWLFFCYSTLPLNAISRLWGQVNSLTLPLWMRPWGYKCYSYMFGV
FT                   NLDEMVDPELTHYANLSEFFYRNIRPECRPIAPGTSVIACPSDGKVLQLGVIDSERGEI
FT                   EQVKGLTYSIKDFLGTHSRQGVSRSSSTIDLSSEEDKHREFAKVNNFQIKGPDDDHPIT
FT                   IRNEGDKAVEQPFLPVTKTLKLLSELSITTTPLKKTFQEPIDTELYYAVIYLAPGDYHH
FT                   FHSPVDWVCQVRRHFPGDLFSVAPYFQRNFPNLFVLNERVATLGHWTHGFFSMTAVGAT
FT                   NVGSIKLSFDKELVTNMKRNKHAEPYTCYEATYDNSSKVLGGMPLIKGDEMGGFMLGST
FT                   VVLCFEAPKDFKFSINVGDQVKMGQKLGAPEK"
FT   gene            <401728..>402804
FT                   /locus_tag="ZYRO0G04972g"
FT                   /old_locus_tag="ZYRO-ORF1515"
FT   CDS_pept        401728..402804
FT                   /locus_tag="ZYRO0G04972g"
FT                   /old_locus_tag="ZYRO-ORF1515"
FT                   /product="ZYRO0G04972p"
FT                   /note="similar to uniprot|P06773 Saccharomyces cerevisiae
FT                   YHR144C DCD1 Deaminase required for dCTP and dTTP synthesis
FT                   expression is cell cycle regulated"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29279"
FT                   /db_xref="GOA:C5DZJ5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZJ5"
FT                   /protein_id="CAR29279.1"
FT                   /translation="MIYVYPKLRDSILFLGIARNALKFESRCREKSSKTATCQYNKEIP
FT                   HDIMFVIISGTKYSGVDIAVTALVNNHGFQRIYEDANEDELISYVTKNYVKDLVMSCTN
FT                   LSLVEKLDKRPSAVHFSLDAPVAIRMKNFQRLAPGKDVNQFFAELDSYDFNPNSIELRE
FT                   RSHIKIKCMNKDIANFETRISDAINQQLESLREPNDTLNPPLRPSWDTYFMKLATLAAS
FT                   RSNCMKRKVGCVIVRERRVIATGYNGTPRHLTNCFNGGCPRCNDGDSQNLHTCLCLHAE
FT                   ENALLEAGRDRIGAHATLYCDTCPCLTCSVKIVQTGITEVVYSQSYRMDEASFKVLISA
FT                   GIRVRQFSFVKEPKLVMI"
FT   gene            complement(<402843..>403628)
FT                   /locus_tag="ZYRO0G04994g"
FT                   /old_locus_tag="ZYRO-ORF1514"
FT   CDS_pept        complement(402843..403628)
FT                   /locus_tag="ZYRO0G04994g"
FT                   /old_locus_tag="ZYRO-ORF1514"
FT                   /product="ZYRO0G04994p"
FT                   /note="highly similar to uniprot|P53889 Saccharomyces
FT                   cerevisiae YNL168C FMP41 The authentic non-tagged protein
FT                   was localized to mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29280"
FT                   /db_xref="GOA:C5DZJ6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZJ6"
FT                   /protein_id="CAR29280.1"
FT                   /translation="MSFNYLKNAKKIICIGRNYAAHIKELNNPTPKQPFFFLKPLSSVV
FT                   TPITQSQRRKSLPNGFSYRGLNEDGTNPSPILVPNGVTVHHEIELALIMDKYISNVSPG
FT                   DFKPQDVYDSISGVSLALDLTARNVQDEAKKKGLPWSIGKGFDTFCPISQFIPKEQFKS
FT                   DSQNLQDLFRLTCSVNGVKKQDGTSDLMLNSLHKIIQHISTMISLEPGDIILTGTPAGV
FT                   GELHPGDNIQGKLYYHDKKLVDMAFDCEARPGPYLYKET"
FT   gene            complement(<403936..>406116)
FT                   /locus_tag="ZYRO0G05016g"
FT                   /old_locus_tag="ZYRO-ORF1512"
FT   CDS_pept        complement(403936..406116)
FT                   /locus_tag="ZYRO0G05016g"
FT                   /old_locus_tag="ZYRO-ORF1512"
FT                   /product="ZYRO0G05016p"
FT                   /note="some similarities with uniprot|Q02100 Saccharomyces
FT                   cerevisiae YNL167C SKO1 Basic leucine zipper (bZIP)
FT                   transcription factor of the ATF/CREB family that forms a
FT                   complex with Tup1p and Ssn6p to both activate and repress
FT                   transcription cytosolic and nuclear protein involved in the
FT                   osmotic and oxidative stress responses"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05016g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29281"
FT                   /db_xref="GOA:C5DZJ7"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR020956"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZJ7"
FT                   /protein_id="CAR29281.1"
FT                   /translation="MSTTNQKNGVSAFDLEPNPFEQSFASTKEQQSEGSSAPPSQAYLP
FT                   QDSQHFQQRPESRPPVNVGRGADGKSPFLYGSQKPNILSPPLLTPGGFRRLPPLLLSPS
FT                   CVPSQNSGANNNNNNNNNNNNHPHNHNHNNNNNNNNNNGVGVGPVSASQTSGIAVNNSN
FT                   NTSSTSTGGGANNGSVSIKAEPSRTPSFFLNLSKTGLTPNESSLRTGLTPGILAPGQQH
FT                   HHYPALPALNGANQVHPQAKPGSVVSGGVTPAPFTPCLGSLLGFPGTASPGHVGRPPLN
FT                   LEGSYAAAAEPTMDQDNSAHLAREPNNGQHLQHHLQQHQHPPPIAQQHHQQQLRNPQQL
FT                   QQQQQQQHLKRSPPQPDSPQAQQQPLSTGRKRNTSNASKSSKAAKKSQSSTPNLAETRR
FT                   LSKNEDIRPTMDESGDMNEEDQERKRKEFLERNRVAASKFRKRKKEYIKRVEMDLQFYQ
FT                   NEYEDMGRALDKLCGIIPGSPTPAASSSLISLLENSISHNDVPSSLSLLAHMKQVVYET
FT                   RYFQRNGRNPRREMESNHMHDTDDEDRHRTDNDSIGNVRSMNGSTTDPTELNRMKRSSS
FT                   INYPGSVPANFTNTGLQSQHQSQQQLQQPRQEQPPHTAPITTGSLPNFPPESGSFQGMI
FT                   KNETTAPSMLPVSLIDARQSRSEQEVANTIGTIGSLPDVISSRPAAHINDVHAQGPSHA
FT                   DNMSDLKHNSLVDLANQSIRAEPMLPKYPNTE"
FT   gene            complement(<406658..>406870)
FT                   /locus_tag="ZYRO0G05038g"
FT                   /old_locus_tag="ZYRO.mRNA.265CM.m"
FT   CDS_pept        complement(406658..406870)
FT                   /locus_tag="ZYRO0G05038g"
FT                   /old_locus_tag="ZYRO.mRNA.265CM.m"
FT                   /product="ZYRO0G05038p"
FT                   /note="highly similar to uniprot|P40422 Saccharomyces
FT                   cerevisiae YHR143W-A RPC10 RNA polymerase subunit ABC10-
FT                   alpha common to RNA polymerases I II and III"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29282"
FT                   /db_xref="GOA:C5DZJ8"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR039747"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZJ8"
FT                   /protein_id="CAR29282.1"
FT                   /translation="MSREGFQIPSNLDVAAAGTSQARSATLKYICAECSSKLSLSRTDP
FT                   VRCKDCGHRILLKARTKRMVQFEAR"
FT   gene            complement(<407068..>409065)
FT                   /locus_tag="ZYRO0G05060g"
FT                   /old_locus_tag="ZYRO-ORF1510"
FT   CDS_pept        complement(407068..409065)
FT                   /locus_tag="ZYRO0G05060g"
FT                   /old_locus_tag="ZYRO-ORF1510"
FT                   /product="ZYRO0G05060p"
FT                   /note="similar to uniprot|P53890 Saccharomyces cerevisiae
FT                   YNL166C BNI5 Protein involved in organization of septins at
FT                   the mother-bud neck may interact directly with the Cdc11p
FT                   septin localizes to bud neck in a septin-dependent manner"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29283"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZJ9"
FT                   /protein_id="CAR29283.1"
FT                   /translation="MGLDKASIEKRVSRIELDIDHMNQMIDENLKLNEAGDRLEQDSRG
FT                   QHAEDNQHLGSAATHQGELSREDSVQNSATSVYSEADGHGSITREDSLHKPSGASEAVY
FT                   DSQEAPVARSEASNDEYYGWSEDQQEQDEQAYTTGQSEADTEYDNEEEDPEETFQAPEE
FT                   RESQEHVNGGMQLHKRQFSEQYPESNDEWEDEVEEPKPEYENENENENESEKENKVQPE
FT                   ATPKATPRIPQAAALPEQETPRTINYETQTDIKPDIPPESQSETHSETQSDIKQNEQEL
FT                   PTTHPYPQEIHNHQHTHETDAQELDHKEYSHETETQEPEHRDHSYATETQEPEHKDYSY
FT                   ATEQYKEVPNPPRGMEFVETREDESLDYSYEPAHQDSPETHKRTIGATQNHNSNGNSLP
FT                   DTTQSVMGQGTSGEKFSDSLYDKYDDQPGLQYHQELGQEASDLPQARSSVGPYHINEPQ
FT                   NDPYDYSYETFETAEPAEPAPPHTANTSQDSNGSTDNPFTSDKVYERSTSGSTDTDDFI
FT                   HIPKNSAQRPATTSNTPVTSRRPTNPFRVVSVGVVGPDGRTSRKTSAGTFSSYKDSNVD
FT                   GPAILQKKLDHLVKKCTKLQREIDYLTKMNTASSLPIEDSRKLSRAVDKLQEYLDKKNK
FT                   EKYDVGVLLSRQLRREIDRGENGQFWVGTK"
FT   gene            <409501..>410625
FT                   /locus_tag="ZYRO0G05082g"
FT                   /old_locus_tag="ZYRO-ORF1505"
FT   CDS_pept        409501..410625
FT                   /locus_tag="ZYRO0G05082g"
FT                   /old_locus_tag="ZYRO-ORF1505"
FT                   /product="ZYRO0G05082p"
FT                   /note="similar to uniprot|P53891 Saccharomyces cerevisiae
FT                   YNL165W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29284"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZK0"
FT                   /protein_id="CAR29284.1"
FT                   /translation="MNRVRELIGGQHSSRNERTRSQRQDVPQPGMSTREGEDQETLFEN
FT                   DTDDGDGLDDTETLNTVASGGDTIGDFQRQGFVNRCPRFTHHRMIPFILVLLTKGFFCF
FT                   PSEKSFKKYIENKRKFDKLDGIEGLGIPLFHAVPLGVVKTIFSPKSPIMKIYKYVIIDS
FT                   ERDKPPPDAEQISVDGSLTLYKYLFCSILEEINNDAGRVEHKFNFTRLDNDGPLPQVLT
FT                   MANMIHLRNTDTTLNGLNLRWYGTSGFASPFGTGNIKLLVLDDNMASFMDQKTVEEYEH
FT                   HYRNNRTRPLGRLPIWAKYSNEGSTVIPKKRTLRMAKLQMGEYQSIAHSDGIFNVPWET
FT                   QALTCMCMVLHEYESRKDRRRTGGLTLGPDMIFM"
FT   gene            complement(<410797..>412200)
FT                   /locus_tag="ZYRO0G05104g"
FT                   /old_locus_tag="ZYRO-ORF1504"
FT   CDS_pept        complement(410797..412200)
FT                   /locus_tag="ZYRO0G05104g"
FT                   /old_locus_tag="ZYRO-ORF1504"
FT                   /product="ZYRO0G05104p"
FT                   /note="some similarities with uniprot|P38844 Saccharomyces
FT                   cerevisiae YHR143W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29285"
FT                   /db_xref="InterPro:IPR026225"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZK1"
FT                   /protein_id="CAR29285.1"
FT                   /translation="MFIQLSTILSIFYISSLPFVGADQEYITSDGVVYGDALVTSTIKP
FT                   PKVYVTTSYFTATQVRPVTLDNLSVTATTEAVVEGTTMSKSDPGSLSTAGSDSSGSQSF
FT                   GGNPSTSSPSVTTPSVSSSCSSTTPSTTPSSSTPSSSTPSSSTPSSSTPSSSTPSSSTP
FT                   SSSTPSSSTPSSSTPSSSTPSSNSPSSSSPSTSAPSSSSPSSSSQVYSTSSSDSQSSNS
FT                   RFTLQPSSTYSITSNTAVSASNSDSTSGSTNSGSSLSSSSSVPSGSANSDNSLSSSPSV
FT                   PSGSANSGSSLSSSSSAPSGSANSDNSLSSSSSVSSSGSASPISVSSSGSSSVTAISST
FT                   SPSSLASGSGSSVYSSPSASASSIPSTSFSSSSITASPSSSGSFSTSSSSSTISGSSSS
FT                   SSLPSSSFSLASGMTPYSTVKGSDSTCTVYYDDADYYSTVYLTSPGQSVDAATTLTSTK
FT                   TVYKTVTRV"
FT   gene            complement(<412920..>413660)
FT                   /locus_tag="ZYRO0G05126g"
FT                   /old_locus_tag="ZYRO-ORF1500"
FT   CDS_pept        complement(412920..413660)
FT                   /locus_tag="ZYRO0G05126g"
FT                   /old_locus_tag="ZYRO-ORF1500"
FT                   /product="ZYRO0G05126p"
FT                   /note="some similarities with uniprot|P53892 Saccharomyces
FT                   cerevisiae YNL164C IBD2 Component of the BUB2-dependent
FT                   spindle checkpoint pathway interacts with Bfa1p and
FT                   functions upstream of Bub2p and Bfa1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29286"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZK2"
FT                   /protein_id="CAR29286.1"
FT                   /translation="MTSSTNVSIELTNEEALMMQPDVSKFLQNLDFSSNGAISQNDGHG
FT                   HGEDQLVIGQTATPVDDSELHFDVDKGDVIFDYGTQEITGTPDKIGEHISQILESVLPN
FT                   GLQKEAQGRLQAVVNQNHTNNDQSAQPTKSESLLELQDAMGNLQRIQKVKQLRQQIPES
FT                   KTNEREICETAGTFKDYGDPPSRPPNFSVLISEKRPVCLFCEYCMVFGEPPRNMIKWYN
FT                   RVNRYDNLPREGERKNKHSRKRNR"
FT   gene            complement(<413934..>417206)
FT                   /locus_tag="ZYRO0G05148g"
FT                   /old_locus_tag="ZYRO-ORF1499"
FT   CDS_pept        complement(413934..417206)
FT                   /locus_tag="ZYRO0G05148g"
FT                   /old_locus_tag="ZYRO-ORF1499"
FT                   /product="ZYRO0G05148p"
FT                   /note="similar to uniprot|P53893 Saccharomyces cerevisiae
FT                   YNL163C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29287"
FT                   /db_xref="GOA:C5DZK3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZK3"
FT                   /protein_id="CAR29287.1"
FT                   /translation="MPRVDSNTFVRLQNDPSSVRNICIMAHVDHGKTSLSDSLLASNGI
FT                   ISQRMAGKIRYLDARQDEQIRGITMESSAVSLYFRVLRKQEGSSDPLVNEHLINLIDSP
FT                   GHIDFSSEVSAASRLCDGAVVLVDVVEGVCSQTVTVLRQCWTEKLKPILVLNKIDRLIV
FT                   ELQFTPQEAYVHLSKLIEQVNSVIGSFFAGERQLDDYSYREQLEQNSDAQYVEKDDSDI
FT                   YFDPANNNIIFASATDGWGFSISQMAKFYEQKLGAKRDNLQKVLWGDFYMDPKTKKITN
FT                   NKGLKGRSLKPLFVSLILDNIWKIYENVTVSKNLEVIEKITKTLGINVLPRDLSSKDDK
FT                   QLLRKIMSQWLPVSTAILLTVIEKLPSPLQSQADRLDTILPNTQDTKKVDPRLLSAMEQ
FT                   CDRNGPASAYVSKILSIPRDELPIQSAGDPVQDEIARRTKEAREAAMKVARQAELEAKL
FT                   SKVNVNGDDGKKEEEELYQRAKDTVITPEINFSGEKKSEVKAPLEAEFEYEEDDADFQN
FT                   DHSLAAEFTPSVDPNDPLASMFEYEEEDPFATNEPNAANGQEVTEDPIEDIFDERDEVL
FT                   IAFARIYSGTLRVGQEIAILGPKYDPSNPDEHIQTVTITSLYLFMGKELIPLESCPSGN
FT                   IVGIGGLAGKILKNGTLIEKGVRGINLAGVNFQTFPIVRVAVEPQNPMEMNKLVRGLKL
FT                   LEQADPCVQTYVEDNGEQILCTAGELHLERCLKDLRERFSGIELTSSEPVIPYRETFLN
FT                   TSEMNPPKDAQLGRGVEQLLQGPYKLKLKTLPLLESTTKFLADHQSIIQNFHNIQLSDQ
FT                   ESFFNKLKDVTKEDKSLAEVLGDNVTKIASFGPKRVGPNIIISEKELLGNFANSSSPKF
FT                   EFADSVINGFQLAVNEGPLAREPVQGMCVVVEDIVEMSPEEINSIEDPQYQKDKVNISG
FT                   RLITSVRDVIHAGFLDWSPRMMWAVYTCDVQTSVEVLGKVYSVVQQRRGRIESEEMKEG
FT                   TPFFQIQAILPVVEAFGFSEDIRKKTSGAAQPQLAFAGFECIDLDPFWVPTTEEELEEL
FT                   GDTADKENIARRHMNNVRRRKGLFVDEKVIQNAEKQRTLKKN"
FT   gene            complement(<417702..>418646)
FT                   /locus_tag="ZYRO0G05170g"
FT                   /old_locus_tag="ZYRO-ORF1497"
FT   CDS_pept        complement(417702..418646)
FT                   /locus_tag="ZYRO0G05170g"
FT                   /old_locus_tag="ZYRO-ORF1497"
FT                   /product="ZYRO0G05170p"
FT                   /note="highly similar to uniprot|P38843 Saccharomyces
FT                   cerevisiae YHR142W CHS7"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29288"
FT                   /db_xref="GOA:C5DZK4"
FT                   /db_xref="InterPro:IPR022057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZK4"
FT                   /protein_id="CAR29288.1"
FT                   /translation="MFDFETICSKTPLPLCSVIKSGSHLILSNSTTIHDFNPQNLHTGI
FT                   LPRCYARSIDVANTMIFNVGNAFVNIGALGVLLVILYNIRQKFTAIGRAEYLHFFQLAL
FT                   LMIIFTLIVNTGASPPGSGSYPYFVAIQIGLAGACCWNLLVNAFLGFNLWEDGTKKSML
FT                   LTRGAAFLGFVANFLVAILTFKTATTTGKIDKTHTLALFIITYVVSGTMLVVYTICQLL
FT                   VSVFVVQNLWVAGAVMLGVFFFVAGQVLVYGVSDKVCMGANHYIDGLFCGSLCNLFTLM
FT                   MVYKIWDMTTDDDLEFSVTIHNEDGVVYNNALK"
FT   gene            <419543..>419932
FT                   /locus_tag="ZYRO0G05192g"
FT                   /old_locus_tag="Zyro0G.mRNA.1036.p"
FT   CDS_pept        join(419543..419546,419616..419932)
FT                   /locus_tag="ZYRO0G05192g"
FT                   /old_locus_tag="Zyro0G.mRNA.1036.p"
FT                   /product="ZYRO0G05192p"
FT                   /note="highly similar to uniprot|P02405 Saccharomyces
FT                   cerevisiae YHR141C RPL42B Proteins component of the large
FT                   (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29289"
FT                   /db_xref="GOA:C5DZK5"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZK5"
FT                   /protein_id="CAR29289.1"
FT                   /translation="MVNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDR
FT                   KQRGFGGQTKPIFRRKAKTTKKVVLRLECVQCKTRAQLSLKRCKHFELGGEKKQKGQAL
FT                   QF"
FT   gene            <420482..>422980
FT                   /locus_tag="ZYRO0G05214g"
FT                   /old_locus_tag="ZYRO-ORF1492"
FT   CDS_pept        420482..422980
FT                   /locus_tag="ZYRO0G05214g"
FT                   /old_locus_tag="ZYRO-ORF1492"
FT                   /product="ZYRO0G05214p"
FT                   /note="some similarities with uniprot|P53894 Saccharomyces
FT                   cerevisiae YNL161W CBK1 Protein kinase involved in cell
FT                   wall biosynthesis required for efficient apical growth
FT                   proper mating projection morphology bipolar bud site
FT                   selection in diploid cells and cell separation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05214g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29290"
FT                   /db_xref="GOA:C5DZK6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZK6"
FT                   /protein_id="CAR29290.1"
FT                   /translation="MFGENPYAQAYQKQSQQQHQMPHQFSPQQHQQQQQHQQRYPDDMA
FT                   SISRPPAATFSSNYMRLQGSHPSLQEQLQRDQQQQQQQQQGMMPNGFTDVPSLGYPATP
FT                   PTQHSYMQNSPLIHSPPPTASGLYMHKNNSRNQVANSGNITPQHSIHGGPQYSPSQFSQ
FT                   DSEHFINSRSSSPLRYHSQQPQQHAFGSYGSQVPPPMGYNSGQASPVKSIRSLHRVQAQ
FT                   AQAQQQAQAQQQAQAQAIAQAQAAQAQAQAQAQAQAQAQAQAAQAQAAQAQAIAQAQAA
FT                   QAQAQAQAQAQAQAQAQAYRQGIPQQQPHAFQEATQGSSTSSSAGSPVPNYMYFERRPD
FT                   LLSKTTQDKAAAAKLKIENFYQSSVKYAIERNQRRVELESQLSMQDWSDERRNRELSSL
FT                   GRKESQFLRLRRTRLSLDDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKK
FT                   DQLAHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQLFTED
FT                   VTRFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYY
FT                   KKLLQQDEQQSQNGGLPKPGQLGGSGDNTGNQNNRQTMLVDAIHLTMSNRQQIQTWRKS
FT                   RRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRK
FT                   IMNFEHTLQFPDDIHISYEAEDLIRTLLSHADQRLGRHGGADEIKRHAFFRGVDWDTIR
FT                   HVEAPYIPKLNSITDTRFFPTDELENVPDSPAMAQANRQREQMMKQGNGNGNKPPVKED
FT                   LPFIGYTYSRFDYLTRKNAL"
FT   gene            complement(<423639..>424457)
FT                   /locus_tag="ZYRO0G05236g"
FT                   /old_locus_tag="ZYRO-ORF1490"
FT   CDS_pept        complement(423639..424457)
FT                   /locus_tag="ZYRO0G05236g"
FT                   /old_locus_tag="ZYRO-ORF1490"
FT                   /product="ZYRO0G05236p"
FT                   /note="similar to uniprot|P38842 Saccharomyces cerevisiae
FT                   YHR140W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29291"
FT                   /db_xref="GOA:C5DZK7"
FT                   /db_xref="InterPro:IPR006838"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZK7"
FT                   /protein_id="CAR29291.1"
FT                   /translation="MDRSLLINVASLITSSYGLIRCTHIKLPPSLAQAGQKQFLTNISL
FT                   AATISHNVVTIVSHVAKRIKKHRSQKKRQEKAYARAIASAEELRDLKLEPNEKRLQQQD
FT                   DSPDSDGCALSLLTLINRHVTLPLALVLESVVATVYWPLRLFAIGLILQGAKRKSPVPL
FT                   HIDVSIHLLPILYMLSDYYFTDASERFKIGLAQSWGIISAVGLAYKSYLSALIDTSTGQ
FT                   KYPYPFLDVPEPYKSVIFVVVTSFGWLFYVAYRALPPRDKVSKKERSKMD"
FT   gene            <425580..>426989
FT                   /locus_tag="ZYRO0G05258g"
FT                   /old_locus_tag="ZYRO-ORF1487"
FT   CDS_pept        425580..426989
FT                   /locus_tag="ZYRO0G05258g"
FT                   /old_locus_tag="ZYRO-ORF1487"
FT                   /product="ZYRO0G05258p"
FT                   /note="weakly similar to uniprot|P38616 Saccharomyces
FT                   cerevisiae YNL160W YGP1 may be involved in cellular
FT                   adaptations prior to stationary phase YGP1 encodes gp37 a
FT                   glycoprotein synthesized in response to nutrient limitation
FT                   which is homologous to the sporulation-specific SPS100
FT                   gene"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29292"
FT                   /db_xref="GOA:C5DZK8"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZK8"
FT                   /protein_id="CAR29292.1"
FT                   /translation="MKLSVLATALAVCSAVLANPVNPAQDLLHKRVDSASAVGGSAATT
FT                   ADAAAGSASPVSGSMPATATTPAVVSGSGIASSISPSSTGGVGSNTTAPAAAAGSSNTT
FT                   APAAAAGSSNTTAPAAAAGSSNTTAPAAAAGSSNTTAPAAGGYSNTTAAAGSSNTTAPA
FT                   AAAGSSNTTVPAAGYSNTTAAAGSSNTSSVPGKVVVFVTGGTVGLKNSSDVSIITLFNS
FT                   SQALNITQLYSLAARVNATLGLATTQSVVIVSNEESLEPLGIFTSLLFNTDKPLVIAQN
FT                   GAVGVPIAKQSSSSARGPLVIGDNKLIYPGVFAPSGDDSSSCAAVGIASDFTNATWFFE
FT                   YSVPALVSPSSVVKQNYSNFTNYNITNTPVVPIIYDGDYSSQLISSLPSASGFVVVSSG
FT                   SNSTLSTVRNSSSPIVFAEAGSSLRYVGKEDVPSGTIPAGYLSPIKAQILLSVAAANGV
FT                   RDQQALSSLFP"
FT   gene            <427759..>429255
FT                   /locus_tag="ZYRO0G05280g"
FT                   /old_locus_tag="ZYRO-ORF1485"
FT   CDS_pept        427759..429255
FT                   /locus_tag="ZYRO0G05280g"
FT                   /old_locus_tag="ZYRO-ORF1485"
FT                   /product="ZYRO0G05280p"
FT                   /note="similar to uniprot|P41948 Saccharomyces cerevisiae
FT                   YNL142W MEP2 Ammonium permease involved in regulation of
FT                   pseudohyphal growth belongs to a ubiquitous family of
FT                   cytoplasmic membrane proteins that transport only ammonium
FT                   (NH4 ) expression is under the nitrogen catabolite
FT                   repression regulation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29293"
FT                   /db_xref="GOA:C5DZK9"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZK9"
FT                   /protein_id="CAR29293.1"
FT                   /translation="MSMNFTGTPTGTGTGGNSLTTDLNQQFDLANMAWVGVAAAGVWIM
FT                   VPGVGLLYSGMSRKKHALSLLWASMMTVSLVIFYWFFWGYSLAFSHTTRGNGFLGTLKF
FT                   FGFKNVLGAPASVDSLPDILFAVYQGMFAAVTGALMLGGACERARLLPMMIFLFLWMTI
FT                   VYSPLACWTWNAEGWLATLGSLDYAGGGPVHISSGHGALIYALILGKRNDPVAKPGMPK
FT                   YKPHSVTSIVLGTVFLWFGWQFFNPGSAGNATIRAWYSAMNTNLAAAAGGLTWMFIDFF
FT                   RFGGKWTTVGLCSGIISGLVGITPAAGFVPIWSSFIIGVVSGAGCNLATDLKNFLHIDD
FT                   GLDVWALHGVGGSIGCVFTGIFAADYVNSTAGSYTAPIAGGWINHHWKQVGYQLAAMCS
FT                   VIAWTVTCTAILLFSMNLVPFLRLRLKPEEEELGTDEAQIGEFTYHEDTLYIPEPVRSK
FT                   NSVAPPMENIDDKIAQTVEEGGNSSTAESGVESGQPQNEK"
FT   gene            <429444..>429749
FT                   /locus_tag="ZYRO0G05302g"
FT                   /old_locus_tag="ZYRO-ORF1482"
FT   CDS_pept        429444..429749
FT                   /locus_tag="ZYRO0G05302g"
FT                   /old_locus_tag="ZYRO-ORF1482"
FT                   /product="ZYRO0G05302p"
FT                   /note="similar to uniprot|P38841 Saccharomyces cerevisiae
FT                   YHR138C Homologous to PBI2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29294"
FT                   /db_xref="GOA:C5DZL0"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZL0"
FT                   /protein_id="CAR29294.1"
FT                   /translation="MKLSAIIGFISAVHAATTSYIITIEQTDVPSSFLDSLKEKVHDVG
FT                   GYVTHEFSLIKGFTAELDDTEVSKLQGQIKQAELKSGYSVHIEKDSEVHTFARHEH"
FT   gene            complement(<429815..>430204)
FT                   /locus_tag="ZYRO0G05324g"
FT                   /old_locus_tag="ZYRO-ORF1481"
FT   CDS_pept        complement(429815..430204)
FT                   /locus_tag="ZYRO0G05324g"
FT                   /old_locus_tag="ZYRO-ORF1481"
FT                   /product="ZYRO0G05324p"
FT                   /note="highly similar to uniprot|P53900 Saccharomyces
FT                   cerevisiae YNL153C GIM3 Subunit of the heterohexameric
FT                   cochaperone prefoldin complex which binds specifically to
FT                   cytosolic chaperonin and transfers target proteins to it"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29295"
FT                   /db_xref="GOA:C5DZL1"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016661"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZL1"
FT                   /protein_id="CAR29295.1"
FT                   /translation="MELLPEGQKNNTNVTFEDQQKINQFSKLIMRKDAIEQELNIQRQE
FT                   KEYSDDVSLELELIDEDEPVQYKVGVIFLHLKQKEAVEQLEKDMESTQGRIDELESEQD
FT                   GLDAQLKELKSILYAKFGDNINLER"
FT   gene            complement(<430373..>431887)
FT                   /locus_tag="ZYRO0G05346g"
FT                   /old_locus_tag="ZYRO-ORF1480"
FT   CDS_pept        complement(430373..431887)
FT                   /locus_tag="ZYRO0G05346g"
FT                   /old_locus_tag="ZYRO-ORF1480"
FT                   /product="ZYRO0G05346p"
FT                   /note="similar to uniprot|P38840 Saccharomyces cerevisiae
FT                   YHR137W ARO9 Aromatic aminotransferase catalyzes the first
FT                   step of tryptophan phenylalanine and tyrosine catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29296"
FT                   /db_xref="GOA:C5DZL2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZL2"
FT                   /protein_id="CAR29296.1"
FT                   /translation="MTQFDFGTLKSRYTSFLSRRDAAKELVKFWDNPPGPGVIELAGGM
FT                   PNAGFFPIDSIDLHVVSHPFEKNHGKNGLKVHMDKQEPKDMPLSMSLQYTNTEGMGPLV
FT                   SFAKKMIERINPPAYGGWNVCMANGSSDAMYKVFEVLCDEDSTVMLEEFTFSPVISNIK
FT                   LQGASVVPVKMQLSADPEQQGIDVDRLADLLDNWSVGPYKHLNKPKALYTVATGQNPTG
FT                   MTLSPTKRRRIYEIAQKHDFLIVEDDPYGYLFFPPYNPKEPMNNAYWDDKSLTVQKYVD
FT                   DYLVKSFLTIDTDARVIRLETFSKLYAPGLRLSFVVANEFLIERIFNMSEVTTRAPSGV
FT                   SQALVYGVVKEMGKKYSSESEPSLDSMVTGWMEWPMKVAGYYTHRRNVAFKALYETEGY
FT                   SKGLYQVMEPSAGMFIDLKPCWPQNELSRPDHYDLIIEKMDKLNQTLLKTGVQVVLGYR
FT                   MAVDVKASKDTCDFVRITIAYANDDQQIVEACHRIGKGFEAYFSHI"
FT   gene            <432802..>433110
FT                   /locus_tag="ZYRO0G05368g"
FT                   /old_locus_tag="ZYRO-ORF1477"
FT   CDS_pept        432802..433110
FT                   /locus_tag="ZYRO0G05368g"
FT                   /old_locus_tag="ZYRO-ORF1477"
FT                   /product="ZYRO0G05368p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29297"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZL3"
FT                   /protein_id="CAR29297.1"
FT                   /translation="MSALEDDLLFQFSPQVPGISYREASSGSQCMPYTVPTMTADALKV
FT                   PPPRIPQPSEVRDQRQFKLHELIEQRKKLEEMTNKYWLRDGEISESMFESSSDEEDA"
FT   gene            complement(<433107..>434156)
FT                   /locus_tag="ZYRO0G05390g"
FT                   /old_locus_tag="ZYRO-ORF1476"
FT   CDS_pept        complement(433107..434156)
FT                   /locus_tag="ZYRO0G05390g"
FT                   /old_locus_tag="ZYRO-ORF1476"
FT                   /product="ZYRO0G05390p"
FT                   /note="highly similar to uniprot|P53909 Saccharomyces
FT                   cerevisiae YNL141W AAH1 Adenine deaminase (adenine
FT                   aminohydrolase) involved in purine salvage and nitrogen
FT                   catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29298"
FT                   /db_xref="GOA:C5DZL4"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZL4"
FT                   /protein_id="CAR29298.1"
FT                   /translation="MVSQDFLKELPKCEHHLHLEGTLEPDLLFPLAKRNGITLPQEFPQ
FT                   TVAELETRYGQFKDLQDFLDYYYIGTSVLIDEQDFHDLAWAYFQKVHSQGLVHAEVFYD
FT                   PQSHTTRGIPIEVVTRGFETACQRAERELGITSKLIMCLLRHMDPQECLQTIEDANKLI
FT                   SNGTIHGIGLDSAERPFPPELFVECYEKARSINPEIQLTAHAGEEGPAKYVSNSLDLLQ
FT                   VSRIDHGVNSVHDEELMQRLAQEKIMLTVCPLSNVKLQVVSRVSQIPLQKLLDANVPFS
FT                   LNSDDPAYFGGYILDNYYKVAEEFPHWDHKVWSTICRNSIEGSWCDAKRKNELLSRLDQ
FT                   VVAKYYPLN"
FT   gene            <435657..>437408
FT                   /locus_tag="ZYRO0G05412g"
FT                   /old_locus_tag="ZYRO-ORF1474"
FT   CDS_pept        435657..437408
FT                   /locus_tag="ZYRO0G05412g"
FT                   /old_locus_tag="ZYRO-ORF1474"
FT                   /product="ZYRO0G05412p"
FT                   /note="similar to uniprot|P23292 Saccharomyces cerevisiae
FT                   YNL154C YCK2 membrane-bound casein kinase I homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29299"
FT                   /db_xref="GOA:C5DZL5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZL5"
FT                   /protein_id="CAR29299.1"
FT                   /translation="MTTAANTAMAVNHLTNTGNLNRMSNVNSAANINMVNGIGGSNSNH
FT                   AAGLNATGAAGGGTGGLATNGTTAVAGGGTNSSARDDSTIVGLHYKIGKKIGEGSFGVL
FT                   FEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTLGIPQAYYFGQEGLHNILVI
FT                   DLLGPSLEDLFDWCGRRFSVKTVVQVAVQMVTLIEDLHARDLIYRDIKPDNFLVGRPQQ
FT                   PDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEA
FT                   MGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLSQGLPIQFGRYLELVRN
FT                   LSFEETPDYEGYRRLLLSVLDDLGQTADGEYDWMRLNGGRGWDLAINKKPNLHGYGHPN
FT                   PPNEKARRHRSKMAGAGVHHQMMQSPHNQQQVLQQAPIPTAQAAPLPQVNMANLNANDD
FT                   PLARNSAAMNNQFAQAKLDPTSYEAYQQQTQKKYAQQLQYQQQQQQTAAVPAQSNNQAR
FT                   FQPSKGANGFGSSGGVPPQATNKYNYQKQPKAIPQQHSGASGRQQKNLDNASFDTGKGF
FT                   FSKFGCC"
FT   gene            complement(<437660..>438445)
FT                   /locus_tag="ZYRO0G05434g"
FT                   /old_locus_tag="ZYRO-ORF1470"
FT   CDS_pept        complement(437660..438445)
FT                   /locus_tag="ZYRO0G05434g"
FT                   /old_locus_tag="ZYRO-ORF1470"
FT                   /product="ZYRO0G05434p"
FT                   /note="similar to uniprot|P53899 Saccharomyces cerevisiae
FT                   YNL155W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29300"
FT                   /db_xref="GOA:C5DZL6"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZL6"
FT                   /protein_id="CAR29300.1"
FT                   /translation="MQVEMTRETGMLDVGTHCSFCRQLDFLPFHCKLCNLDFCENHRTK
FT                   ESHHCQWLLDQEKNNHKVPSPPSRNNDEKFFKSLLPEKGYIRVQQQQQRSPHNPQSEPI
FT                   KSRISQGTLDKLARFFKRSTVHKSTAKKSSSNKLVLLTQLKKTAVGDQRIPVSNRIYIW
FT                   CYVVHDEERDKDAKRESFYVNKIWPIGRVLDAIAQQFGVPNRNDNFKTKQEDKLSLYKI
FT                   DQGTGEMIQLDTSGRVANQISDLDTLYLIRGTEAPALRV"
FT   gene            complement(<438570..>439280)
FT                   /locus_tag="ZYRO0G05456g"
FT                   /old_locus_tag="ZYRO-ORF1469"
FT   CDS_pept        complement(438570..439280)
FT                   /locus_tag="ZYRO0G05456g"
FT                   /old_locus_tag="ZYRO-ORF1469"
FT                   /product="ZYRO0G05456p"
FT                   /note="similar to uniprot|P38838 Saccharomyces cerevisiae
FT                   YHR134W WSS1 weak suppressor of smt3"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29301"
FT                   /db_xref="GOA:C5DZL7"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZL7"
FT                   /protein_id="CAR29301.1"
FT                   /translation="MTGDLENHANPHIQRVAVLQRKPSRDDALSLLKEIAKRVSYLMKE
FT                   NKFRVGMLVEFCPRDKRLLGMNVNRGTKILLRLRNPNDEFRFLPMESIMGTMLHELTHN
FT                   LHGPHDNRFYAKLDDLLARQWVIEQQGLFDTFLGQGSRLGGSTRLPPLQQQLQKRPTRS
FT                   RGRKLGGSRAPRGTPREMAALAAQRRAQDSRSCGDASSYQHEQEDVIIIDEGRNGENKL
FT                   ELEPKPKLEVIDLT"
FT   gene            <439541..>440347
FT                   /locus_tag="ZYRO0G05478g"
FT                   /old_locus_tag="ZYRO-ORF1468"
FT   CDS_pept        439541..440347
FT                   /locus_tag="ZYRO0G05478g"
FT                   /old_locus_tag="ZYRO-ORF1468"
FT                   /product="ZYRO0G05478p"
FT                   /note="similar to uniprot|P53898 Saccharomyces cerevisiae
FT                   YNL156C NSG2 Protein of unknown function potential homolog
FT                   of mammalian Insig 1"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29302"
FT                   /db_xref="GOA:C5DZL8"
FT                   /db_xref="InterPro:IPR025929"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZL8"
FT                   /protein_id="CAR29302.1"
FT                   /translation="MASEKSNNPLTGKEKSTESISNLTRPQLFSLYDEDITKSADSEDY
FT                   ERIRSRGSAGSFSRPASSNSQMEPGPTPAKKRWAPFFRFVFAMVVLSLAGIAYHELSRH
FT                   LHDNHKLHPELASRPLLVGVQLSQFFTGNMAPDWAVYAFEGIFFGSCIPLIDYIFSIKT
FT                   RHASWLSILKTVNAMLGVTFGIRKVQWSSSLQAAIAWGLLNIILWLFFDGTISMFITCS
FT                   TLGLLSCATCYSDITDKSQLLYFVDFYFLGLLLFGELGRYLFSTSF"
FT   gene            complement(<440471..>440842)
FT                   /locus_tag="ZYRO0G05500g"
FT                   /old_locus_tag="ZYRO-ORF1467"
FT   CDS_pept        complement(440471..440842)
FT                   /locus_tag="ZYRO0G05500g"
FT                   /old_locus_tag="ZYRO-ORF1467"
FT                   /product="ZYRO0G05500p"
FT                   /note="highly similar to uniprot|Q9P305 Saccharomyces
FT                   cerevisiae YHR132W-A Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29303"
FT                   /db_xref="InterPro:IPR006760"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZL9"
FT                   /protein_id="CAR29303.1"
FT                   /translation="MSDISPTSSNVDLTSLDSKGVDISQLTPQELKLYKMYGRLPSKKD
FT                   LFKHKMQERKYFDSGDYALNKAGKGETDAVTSNNNLPVTNPSGLRESIIRRRMSNSAGD
FT                   SISRQGSISSGPPSKSPTK"
FT   gene            <441250..>442554
FT                   /locus_tag="ZYRO0G05522g"
FT                   /old_locus_tag="ZYRO-ORF1466"
FT   CDS_pept        441250..442554
FT                   /locus_tag="ZYRO0G05522g"
FT                   /old_locus_tag="ZYRO-ORF1466"
FT                   /product="ZYRO0G05522p"
FT                   /note="similar to uniprot|P38836 Saccharomyces cerevisiae
FT                   YHR132C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29304"
FT                   /db_xref="GOA:C5DZM0"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZM0"
FT                   /protein_id="CAR29304.1"
FT                   /translation="MVAKFNWGRMVLTVATILIPLAAGWQRGYQDYRVCRFHEQDYETV
FT                   MSRIKSGTPMDYDVWARNSEFVDVRLPKWLGQVEGCEVIIEDLDDAIEATMSQEVEGNG
FT                   DSLSDQTAFKFDNGDFFFQGFRDLETIYTWYDLLERAFPNLVKVEVVGETWEGRALKAL
FT                   HISTNNPETNPEKKTIVITGGVHAREWISVSSACWTVHQLLTRYGQSKRETKYLDYLDF
FT                   LIIPVFNPDGYAYTWQHDRLWRKNRQETYWPNCPGIDIDHSFDFQWNSTEEFPCSEDYS
FT                   GERAFEAIEADSWNNFLNGTKGQYKIHGYLDFHSYSQEVLYPYAYSCDALPRDYENLLE
FT                   LSFGLAKAIRNKSGKHYKVISACEDRGSDLSPGLGSGSALDFMYHHRAHWAFQLKLRDT
FT                   GNLGFLLPSKYIEPVGKEIYAAVSYFCSFILNPEL"
FT   gene            complement(<442549..>443103)
FT                   /locus_tag="ZYRO0G05544g"
FT                   /old_locus_tag="ZYRO-ORF1464"
FT   CDS_pept        complement(442549..443103)
FT                   /locus_tag="ZYRO0G05544g"
FT                   /old_locus_tag="ZYRO-ORF1464"
FT                   /product="ZYRO0G05544p"
FT                   /note="similar to uniprot|P53896 Saccharomyces cerevisiae
FT                   YNL158W Essential protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   nuclear periphery"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29305"
FT                   /db_xref="GOA:C5DZM1"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZM1"
FT                   /protein_id="CAR29305.1"
FT                   /translation="MNLILWLQILFVATVSANTESFLLHVPSDFPLRKNSDEPSSYPRY
FT                   ISLHNSNLAKTTFFSGIEGPTYIELKSLQVDETYQIKICWTALDPVSITDIDWIVIPHS
FT                   TEFQNTKSDEARIFIKFNVVADSWPPLNQLTKIPINVSVINTKLGIPVDLYKIIIYIGL
FT                   VMTITFWINGRTNLYELLKNL"
FT   gene            <443318..>444118
FT                   /locus_tag="ZYRO0G05566g"
FT                   /old_locus_tag="ZYRO-ORF1463"
FT   CDS_pept        443318..444118
FT                   /locus_tag="ZYRO0G05566g"
FT                   /old_locus_tag="ZYRO-ORF1463"
FT                   /product="ZYRO0G05566p"
FT                   /note="similar to uniprot|P53895 Saccharomyces cerevisiae
FT                   YNL159C ASI2 Predicted membrane protein genetic
FT                   interactions suggest a role in negative regulation of amino
FT                   acid uptake"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29306"
FT                   /db_xref="GOA:C5DZM2"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZM2"
FT                   /protein_id="CAR29306.1"
FT                   /translation="MSEELGDDDDYLFEKFVAETNARSAREQAHETQQSDEELQQELRV
FT                   AIDNIIHTLEREMQREPHPMRDVQPRTRDENGNNNQESLFVQRRPYLRLLITNLLLFDY
FT                   FVVVLLFPFSLYNILRCGFSIMTLSENDFFSEVVTYCRHVKIFGDDGKSLLVYGESNLG
FT                   LLGKFHNIVVFYTSPLARYLAKWVPVASDHLIRQIYVKFYQYLVKSSTVFVYLTYGVGG
FT                   TVYLAMAGFFFAVCIAITLIRRYKNVHRMVAGSLETATRIPGVW"
FT   gene            <444420..>444521
FT                   /locus_tag="ZYRO0G05588r"
FT                   /old_locus_tag="Zyro0G.tLeu.TAG.13"
FT   tRNA            join(444420..444456,444478..444521)
FT                   /locus_tag="ZYRO0G05588r"
FT                   /old_locus_tag="Zyro0G.tLeu.TAG.13"
FT                   /note="tRNA-Leu (TAG) cove"
FT   gene            <444743..>445837
FT                   /locus_tag="ZYRO0G05610g"
FT                   /old_locus_tag="ZYRO-ORF1461"
FT   CDS_pept        444743..445837
FT                   /locus_tag="ZYRO0G05610g"
FT                   /old_locus_tag="ZYRO-ORF1461"
FT                   /product="ZYRO0G05610p"
FT                   /note="some similarities with uniprot|P00812 Saccharomyces
FT                   cerevisiae YPL111W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29307"
FT                   /db_xref="GOA:C5DZM3"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZM3"
FT                   /protein_id="CAR29307.1"
FT                   /translation="MRFSTLASLAALFEFTTAGRWTEDWPFAGFPSFAKLPFHTCLVDN
FT                   PEFDIALIGVPFDTAVSFRPGARFGPQAIRRASQRQNGLRGFNARAGINPYDNWAHIID
FT                   CGDIPVTPMDNQLALEQMNAAYDELVNGTTTSGNTAGALPRLVSLGGDHSVILPALRAL
FT                   HKHYGPISVIHLDSHLDTWSPDSYPSYWHSNTSEFTHGSMLWLAAQEGLINKGHCVHGG
FT                   LRTRLSGDDWSDYEEDDRVGFHRIHADEMMEIGPRGIAERIKQIVPKNVPVYLSVDIDV
FT                   LDPSAAPGTGTVEPGGWLTRELISLIRQLQDLPLVGADVVEVSPPFDHADVTAMAAAQV
FT                   AYEIITNMVKTPLELETRKFFSNM"
FT   gene            <446414..>448534
FT                   /locus_tag="ZYRO0G05632g"
FT                   /old_locus_tag="ZYRO-ORF1460"
FT   CDS_pept        446414..448534
FT                   /locus_tag="ZYRO0G05632g"
FT                   /old_locus_tag="ZYRO-ORF1460"
FT                   /product="ZYRO0G05632p"
FT                   /note="similar to uniprot|P38835 Saccharomyces cerevisiae
FT                   YHR131C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29308"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZM4"
FT                   /protein_id="CAR29308.1"
FT                   /translation="MPSLARSIQSETSRSIKSDEMPHLADEGNEFLQVIDGEPAKPPPY
FT                   QAVNPNRRVCFPVYEYEETRSLPPSYKPTVEECTVVSVKWEWSTPYELSPVKHWHNYLL
FT                   EINSTQLNFYDIDPELTQGIKNYSNGSDEAQHSHYRFSLSKGGAYQFNRSDQENITARL
FT                   QRNKPKFLHPSKLCKSFSLQCAKVGVPTDYTKKTFLLRLRCEQEQFMVNFAHVDDMIMW
FT                   SVYLQTGIHVSLDLDLREYPSYRVVPRRRRTRASNGGRSSSGSGGGSRSSTRFPRPEGP
FT                   QRSQSMGKLLLSASPSSTRGSGSGSPTPTSGSRIKPQRSTSSGLLPTLHKRHTSSGSFP
FT                   QVPSNASHSRKVSPGASNITGEESPHSIKSKFKHLFKNEDPPKLVSSRSSGNLSTLHKE
FT                   PRIKSSPPKRPPLNSNDTKTKFHVGDLNSVQEDVETENQNMSESKTSPMHHSVLQRPTA
FT                   RRMVSSPLLSVPGQSLDMRSPASSARASPTSTPTPPNESISPLPRTPTQREAEEVQQVR
FT                   REHNDPVSADFHAGIRASLADDDDEEGELEDTELISSRNSRGSRNSGGSIYLEEGIFPE
FT                   NDDDYVYTRRPQQSPRGKCGSSGKWNPPIKEPSRGRYIRDSLRCIKSLNDDDKWMGKVV
FT                   FRPYRPPDFPTNNLPLPYGLTPNIPNRHTKINPWETVDYKRTRNHYLRPYIVGPTGLVK
FT                   ASTKPHNMYEEV"
FT   gene            <450272..>452092
FT                   /locus_tag="ZYRO0G05654g"
FT                   /old_locus_tag="ZYRO-ORF1456"
FT   CDS_pept        450272..452092
FT                   /locus_tag="ZYRO0G05654g"
FT                   /old_locus_tag="ZYRO-ORF1456"
FT                   /product="ZYRO0G05654p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29309"
FT                   /db_xref="GOA:C5DZM5"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZM5"
FT                   /protein_id="CAR29309.1"
FT                   /translation="MSNSKRSLKEILDFEYVEDSEEGEDSNLNDDLSGDDDEESQHDVN
FT                   MCNECKDMQAEIICNDCEEHFCVVCFEMLHRGGKRRKHEYVKTTEDKGESPQQQHPQQP
FT                   QQQPAEENKVESAPSPENDSNQEDSIDVKLLSHLKDSATYIPMRLTFEERHLLRLLEAA
FT                   LQVSEYTDRVDILSYKSKPKRIVEQLKEICSVLSGLVVASNMKIGQKLLEMKNFSDNAK
FT                   WFQAVFEIGRRYKIMNPERMRDTYGKLCYMVMDSRLPQIEEHMEFHLYKPIKTVKSFLV
FT                   SKQEDNGRVLQMFDDKLILYATSSVSPVGKSRPQINKLIKQKEYAIETLASKYSSKYYS
FT                   KEDIRQALYSIGDYNAYINMNRKPIIRMLARLDLFRQPEIAKKYSIGIQFGRQGARLTH
FT                   DHERQWHYVQQSLMLWSIIQREMMRLWYLADIDQFDGSQYRLASTGHGLNRIKPCPSIY
FT                   KEMHKIINECRSKTHTWVGSSVVHLGDDAVPNALFFLDKYTQVPTILIPFDQTLLKIND
FT                   LVGNDEYLLEYVNKEYGSVDGLKLTILQDAFAHMFDGSGADNFFMSGSCIDGRLTSAWN
FT                   HCNEISKKKYYNIFLLTGFTGFNGSEGFSA"
FT   gene            <452257..>453402
FT                   /locus_tag="ZYRO0G05676g"
FT                   /old_locus_tag="ZYRO-ORF1454"
FT   CDS_pept        452257..453402
FT                   /locus_tag="ZYRO0G05676g"
FT                   /old_locus_tag="ZYRO-ORF1454"
FT                   /product="ZYRO0G05676p"
FT                   /note="similar to uniprot|P38696 Saccharomyces cerevisiae
FT                   YHR129C ARP1 Actin-related protein of the dynactin complex
FT                   required for spindle orientation and nuclear migration
FT                   putative ortholog of mammalian centractin"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29310"
FT                   /db_xref="GOA:C5DZM6"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZM6"
FT                   /protein_id="CAR29310.1"
FT                   /translation="MLDPNAVLYSQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRH
FT                   GYVNDSSKDDTFVGNLAQERRSILQLRHPVDHGVVKNWNDMELIWDYMFKDKLKLKDVD
FT                   EHPVLITEAPLNPVSNRDEMCDLLFESFGVQALYVANPAVLSLYASGKISGCVLDCGDG
FT                   YSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIKEKS
FT                   CYVAVDLDIEEEKCNYEGDQVGLKFKLPDGKFITLSKDRFQVPEILFQPSVISSEVSSI
FT                   PEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFGNRLVQELDKLNQAQSRVKIWAPP
FT                   ERKYTSWIGGSILAELSTFQKIIVTKSQWQEDPSIIHTKCG"
FT   gene            complement(<453459..>454109)
FT                   /locus_tag="ZYRO0G05698g"
FT                   /old_locus_tag="ZYRO-ORF1453"
FT   CDS_pept        complement(453459..454109)
FT                   /locus_tag="ZYRO0G05698g"
FT                   /old_locus_tag="ZYRO-ORF1453"
FT                   /product="ZYRO0G05698p"
FT                   /note="highly similar to uniprot|P18562 Saccharomyces
FT                   cerevisiae YHR128W FUR1 Uracil phosphoribosyltransferase
FT                   synthesizes UMP from uracil involved in the pyrimidine
FT                   salvage pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29311"
FT                   /db_xref="GOA:C5DZM7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZM7"
FT                   /protein_id="CAR29311.1"
FT                   /translation="MSTEPYKNVHLLNQSNQLVGLYTIIRDKNTARPDFIFYSDRIIRL
FT                   LVEEGLNHLPVEPLTVRTHTDKPFDGVSFIGKICGVSIVRAGESMEEGLRDCCRSVRIG
FT                   KILIQRDEETAKPKLFFEKLPEDIAQRYVFLLDPMLATGGSAIMATDVLIKRGVKPERI
FT                   YFLNLICSKEGIDKYHAAFPDVKIVTGAIDQGLDENRYLIPGLGDFGDRYYCL"
FT   gene            complement(<454504..>454918)
FT                   /locus_tag="ZYRO0G05720g"
FT                   /old_locus_tag="ZYRO.mRNA.173CM.m"
FT   CDS_pept        complement(join(454504..454842,454907..454918))
FT                   /locus_tag="ZYRO0G05720g"
FT                   /old_locus_tag="ZYRO.mRNA.173CM.m"
FT                   /product="ZYRO0G05720p"
FT                   /note="highly similar to uniprot|P53905 Saccharomyces
FT                   cerevisiae YNL147W LSM7 Component of small nuclear
FT                   ribonucleoprotein complexes involved in RNA processing
FT                   splicing and decay"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29312"
FT                   /db_xref="GOA:C5DZM8"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017132"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZM8"
FT                   /protein_id="CAR29312.1"
FT                   /translation="MSESTEPRQDPPPQQQRKKFEGPKREAILNLAKYKDTKVRVKLMG
FT                   GRLVVGVLKGYDQLMNLVLDETIEYMRDPEDSSFILKDKTRELGLIVIRGTVLLSLSPQ
FT                   DGSEIVSIQDTD"
FT   gene            <455073..>455786
FT                   /locus_tag="ZYRO0G05742g"
FT                   /old_locus_tag="ZYRO-ORF1451"
FT   CDS_pept        455073..455786
FT                   /locus_tag="ZYRO0G05742g"
FT                   /old_locus_tag="ZYRO-ORF1451"
FT                   /product="ZYRO0G05742p"
FT                   /note="similar to uniprot|Q754L8 Ashbya gossypii AFR054W
FT                   AFR054Wp and weakly similar to YNL148C uniprot|P53904
FT                   Saccharomyces cerevisiae YNL148C ALF1 alpha-tubulin foldin
FT                   protein implicated in folding of alpha tubulin cofactor B"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05742g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29313"
FT                   /db_xref="GOA:C5DZM9"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZM9"
FT                   /protein_id="CAR29313.1"
FT                   /translation="MVRTSVVSSLCSVTKEWDENISYLQLCQRIESFTGIEPCYMRLSF
FT                   EFDDGKKLEILESSNPYPFKTYPHVSMILVEDLNENSVVNQLQNSNGTESNFHLSDEEY
FT                   AKRTDSVLQWKMKNNYGRFNSDSKRSQESNKQLQQQRIAELQIDQRCSVESEGQLERRG
FT                   WLRFIGRIGEINDQDIWCGVEFDDPVGKNDGSFKGHIYFGPVKTNHGGFVKPLAVKTGP
FT                   EFLPMTKNDQSDDEI"
FT   gene            <456033..>456449
FT                   /locus_tag="ZYRO0G05764g"
FT                   /old_locus_tag="ZYRO-ORF1450"
FT   CDS_pept        456033..456449
FT                   /locus_tag="ZYRO0G05764g"
FT                   /old_locus_tag="ZYRO-ORF1450"
FT                   /product="ZYRO0G05764p"
FT                   /note="similar to gnl|GLV|KLLA0A11506g Kluyveromyces lactis
FT                   KLLA0A11506g and weakly similar to YNL149C uniprot|P53903
FT                   Saccharomyces cerevisiae YNL149C Protein required for cell
FT                   viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29314"
FT                   /db_xref="GOA:C5DZN0"
FT                   /db_xref="InterPro:IPR011431"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZN0"
FT                   /protein_id="CAR29314.1"
FT                   /translation="MSDAAMNVTSSPSIWNTLYERTKTNLAETIGDLDVKKGLRLVIIV
FT                   GGYILIRGIAQRELAKRKLDNDVRRSEQENAAKMQEKLVDQPGSTAAMPFGWGNKTRRR
FT                   RKQQEEAFADIVERVNQKKNSGDDVEDIEDLLED"
FT   gene            <456751..>457497
FT                   /locus_tag="ZYRO0G05786g"
FT                   /old_locus_tag="ZYRO-ORF1449"
FT   CDS_pept        456751..457497
FT                   /locus_tag="ZYRO0G05786g"
FT                   /old_locus_tag="ZYRO-ORF1449"
FT                   /product="ZYRO0G05786p"
FT                   /note="similar to uniprot|P17890 Saccharomyces cerevisiae
FT                   YNL151C RPC31 RNA polymerase III subunit C31 contains HMG-
FT                   like C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29315"
FT                   /db_xref="GOA:C5DZN1"
FT                   /db_xref="InterPro:IPR024661"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZN1"
FT                   /protein_id="CAR29315.1"
FT                   /translation="MSFGRGRGGGGNNPTRNLPFGLGFNDVGVNETTEFPSIPLPVNNP
FT                   VNSRERSLAITYIKFGQTVKDGPFYTGSLSLAVDDSAEGNNKNSNGKKKKQSLIEEEGH
FT                   MDGIERYSDRYLKKRKIGTSIDEHPYHLEVFPRELYNVMGIDKKKLLVISEFNNKDDIF
FT                   TGGKQDENAGLSMIEKWKQLAEDEDDDNDEENEKNKENAGGDEDVDEDFEEEEDDDDDY
FT                   NAEKYFNDGDDDEYGDEEDMGDEPAF"
FT   gene            complement(<457574..>458794)
FT                   /locus_tag="ZYRO0G05808g"
FT                   /old_locus_tag="ZYRO-ORF1447"
FT   CDS_pept        complement(457574..458794)
FT                   /locus_tag="ZYRO0G05808g"
FT                   /old_locus_tag="ZYRO-ORF1447"
FT                   /product="ZYRO0G05808p"
FT                   /note="similar to uniprot|P53901 Saccharomyces cerevisiae
FT                   YNL152W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29316"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZN2"
FT                   /protein_id="CAR29316.1"
FT                   /translation="MATEVWSGNQGTLCVFVSKARDLPNLTKLDKQNVMLRLRIAHMTR
FT                   ESNTLFRAGQNPVFNYLEKYSITPDVKPIMQVEAYCDRKKKPPILIGRCEVDLLNGMRA
FT                   DPKEGYCCWYELKRDRNEFAGTIFIELSFNPGLPNLRKEERSKDTEAMDATVRSRPVPP
FT                   LPGDSTSIISTEQDDDYYHRSYMEPYTHGSAMREITPAAGGAWDNRPDFSRSSLPGSIG
FT                   VGAPPVFNSSVGTSTTISSEETNATEATSTSDTKFHFANLKKLKERLNVFKNPNNSTNN
FT                   QQSETPVDIEALQKAIGVTSLDDEEGYVSRSHSSHALAANLNDADDRHPSLPPLPPSIS
FT                   HGSRSHSKSPRRPPLPRPFESNDNESVEFDLPSHRNGTPKLPPLPTAASPRNKSRSPRR
FT                   RPPPVSN"
FT   gene            complement(<458995..>463731)
FT                   /locus_tag="ZYRO0G05830g"
FT                   /old_locus_tag="ZYRO-ORF1445"
FT   CDS_pept        complement(458995..463731)
FT                   /locus_tag="ZYRO0G05830g"
FT                   /old_locus_tag="ZYRO-ORF1445"
FT                   /product="ZYRO0G05830p"
FT                   /note="similar to uniprot|P53552 Saccharomyces cerevisiae
FT                   YNL139C RLR1 Required for LacZ RNA expression from certain
FT                   plasmids suppressor of the Transcriptional (T) defect of
FT                   Hpr1 (H) by Overexpression (O) plays a role in
FT                   transcription elongation by RNA polymerase II Involved in
FT                   transcription"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29317"
FT                   /db_xref="GOA:C5DZN3"
FT                   /db_xref="InterPro:IPR021418"
FT                   /db_xref="InterPro:IPR021726"
FT                   /db_xref="InterPro:IPR032302"
FT                   /db_xref="InterPro:IPR040007"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZN3"
FT                   /protein_id="CAR29317.1"
FT                   /translation="MSESVSASIDKLAATHITFPQGHKIFNQEFADNWNTKSQELCAQF
FT                   KELEGTDQRQSWLKDVFREIFELIYDQNTKGSPTMPQISRLLEDIVSSGTQDIKDSELL
FT                   SMVGKVFVSVSQEYSDEDDNVVLALARITKSLHKEMFKFSRLSTKLMNQGQTVLLKHLL
FT                   KKSKYELKKFNLLMECSTGYIQLVTLLWAAYYDPDRMNKVPYFIQEFQQLAGKYSLDPM
FT                   RCLDVILDVSSEFITEGYEFMIRFLKISDYWPKTSPANNFDYQSLNQGGNAIASHLISL
FT                   HLNQEDVGKDTAYLDMVCILIREGFVSFLPIWDNIKPNDETLSAFFENFDNELEAESMK
FT                   GVTNPLAMADALTAADDNDGDEKMEDVNTDGKDSSAKAEEKKALEQKQEALEKENIKNS
FT                   VLNGSKLEFLKRLLVHGVLMPAFYIFKTHPQCVYINDMLPRLIGRLFENMLDPLYQSLV
FT                   FSGSQNLQSASLITTLDNGLLSKKTRLVSERKSHNPFPLLEMRTRFVFYYAEWCKDLGE
FT                   LHTVEELFTKSNEFFTILGPSLGKVPQLISKLCRIGVADIETAAADKKEETINKWIDYV
FT                   RKFIFPAIPVLEVNPVITSEIYQLMKFFPFKRRYFLYNELITRTSQDLLLPKVGFNKAE
FT                   RSAKSILKSLSMDTIETESRKLANLVSTNPLATLVPVIKQIENYDKVSELVVITTKYFN
FT                   SFACDVLQFIILLRLTHNRPAIQTDGVNQNTWVQRLSVYISGLAKDCPKMDITNILVFI
FT                   VKTLHEGNMVAVSILRELITTVGGIRDLNEVNTTRLIMLNSGEPLKYEARKLIFDTRDD
FT                   NRELALKLVNQLAKQKTISELILLLYNLNREANTQTLHYKILSTRCDEMNTLLWSFIEL
FT                   VKYCFTLEEFGDNVLPLEVLTNDFHLSTSWVFHIWRNYIDQKFREADPSSDVMLQNAVF
FT                   EGVDYSYITKELFLTFWKLSLYDVQFDKALYDKKKAGLEEELSKSSSTKKKNEYSKQIK
FT                   DILVSCISHQKTFNNTKRLISEQSQSWAKDLSNERIMSFFQYCIVPRVLFSPPDALFSS
FT                   HFLLKSFDLKDLMKILGVFMSSRILSALLFCCTRSEAGNMGIFFSQLLGSLEEMRVSED
FT                   QEFLYQRELYECNSLLTEQIVELLFNRNYMSIRNGIEFMKHVSHVFPIIDTQILVACKA
FT                   LERILESEEREDIKLPSNALFGHLKARLKNSCKPEEFCEMTEDEKREKGKYVSELEEIN
FT                   HYESLLANEKKEIELRKQLEFNKKQRAEAEKAKELEEAKKAEKEAEKKEDARDKFKGIP
FT                   SGPSGGKQAARPQSSTWPFGKVIRFMDEVCFHLGRNNLNRAADCISDPTENQTLKRLSK
FT                   ESMPIRDLRTGVFEVFERFFRSLVYNPNNADFARKLDEIKAAVKYVSNDTPRARGDMYS
FT                   EATPTEPAKKPSRYNNEPPSGPSNDRDTKTDSHEGTPSGWNRPYDSRNRQALPPGPQRM
FT                   DNKRSNTTPRPMNFPDRPSQPRSETPRNGNKVYSARDQGSSGNNNNNRMRPKHEAPPAS
FT                   DERLTKRYRADDGRNKMRSPQNDSRSKYNNNNNGKRGNTQGLPQGPKGSGEYVSRYQR"
FT   gene            <463906..>464243
FT                   /locus_tag="ZYRO0G05852g"
FT                   /old_locus_tag="ZYRO.mRNA.188CM.p"
FT   CDS_pept        join(463906..463908,463998..464243)
FT                   /locus_tag="ZYRO0G05852g"
FT                   /old_locus_tag="ZYRO.mRNA.188CM.p"
FT                   /product="ZYRO0G05852p"
FT                   /note="similar to uniprot|P0C074 Saccharomyces cerevisiae
FT                   YNL138W-A RCP10 Component of the U2 snRNP associated with
FT                   the SF3b complex conserved in Ashbya gossypii"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29318"
FT                   /db_xref="GOA:C5DZN4"
FT                   /db_xref="InterPro:IPR009846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZN4"
FT                   /protein_id="CAR29318.1"
FT                   /translation="MSEVQGQQRYQVLKHKYVGLGREHTTQEEWLSNVHRDTYHSLQAH
FT                   SGLLEYLALAQGSSSKRQTKIQLIKKMDQNKSRPNES"
FT   gene            complement(<464306..>464881)
FT                   /locus_tag="ZYRO0G05874g"
FT                   /old_locus_tag="ZYRO-ORF1442"
FT   CDS_pept        complement(464306..464881)
FT                   /locus_tag="ZYRO0G05874g"
FT                   /old_locus_tag="ZYRO-ORF1442"
FT                   /product="ZYRO0G05874p"
FT                   /note="similar to gnl|GLV|CAGL0H09086g Candida glabrata
FT                   CAGL0H09086g and some similarites with YHR127W
FT                   uniprot|P38833 Saccharomyces cerevisiae YHR127W (H)igh copy
FT                   (S)uppressor of (N)34 dominant negative allele of SEC4.
FT                   Suppression is very specific to this allele. It has no
FT                   affect on the analogous YPT1 allele. No homology or known
FT                   function."
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29319"
FT                   /db_xref="GOA:C5DZN5"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZN5"
FT                   /protein_id="CAR29319.1"
FT                   /translation="MAPNNKSHRRHNSGKKLVDRITPVGESKPERPLPKEGFKTVNGRL
FT                   VSANDVGVLLREASSKLEAKKKRKSPKGKPHKTGPAPSRPKGKPSKGNPLVIHTNSDAS
FT                   DKLLVFYNLALGVNQDSLKTVLQKLSHTRIGKVRVRDLPSGSATANVWLVKRTTEELER
FT                   VRKLFDGALVDGRTIRVTTVSDTQTMSY"
FT   gene            <465145..>466791
FT                   /locus_tag="ZYRO0G05896g"
FT                   /old_locus_tag="ZYRO-ORF1441"
FT   CDS_pept        465145..466791
FT                   /locus_tag="ZYRO0G05896g"
FT                   /old_locus_tag="ZYRO-ORF1441"
FT                   /product="ZYRO0G05896p"
FT                   /note="similar to uniprot|P17555 Saccharomyces cerevisiae
FT                   YNL138W SRV2 Adenylyl cyclase-associated protein N-
FT                   terminal domain appears to be involved in cellular
FT                   responsiveness to RAS"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05896g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29320"
FT                   /db_xref="GOA:C5DZN6"
FT                   /db_xref="InterPro:IPR001837"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR013912"
FT                   /db_xref="InterPro:IPR013992"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="InterPro:IPR018106"
FT                   /db_xref="InterPro:IPR028419"
FT                   /db_xref="InterPro:IPR036222"
FT                   /db_xref="InterPro:IPR036223"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZN6"
FT                   /protein_id="CAR29320.1"
FT                   /translation="MSDSGKFNVQSYTLVKLLKRLEAATTRLEDVTIYQEGYIESRIAE
FT                   NAAAGGISSNEMSAMSSAGPSAAIPANQANKSPEAIESEPVPAGAAGVEQPSEAITQFD
FT                   QVIQGKVVPLVQLSTKIDPTVAAVVQVFKETFDRQLDFLEIALKSKKPDYSSKEFAESL
FT                   LPINQAILKIGDLKDQNRQSKFFPYLNSVAEGAALFSWVAVETPVSLVADFKDASQFWT
FT                   NRVLKEFKESDPNAASWVSLFLSIFDQLKSYVKEFHPTGVTWSKDGEDFGTALAQFKGG
FT                   SANTAPPTPAPVAAGGAPPPPPPPAPPASVFESKPDEKPAGGSGGIDAVFAELNQGEDI
FT                   TRSLKKVDKSQQTHKNPELRGSSAVPAEQAGGKTPPPVKPKKPNMFKTKKPPRKELVGN
FT                   KWFVENYENHAEPIVIEGKHDEAIFIGNCSSVLIQVKGKVNAITVNQSDSTNVVLDSCI
FT                   SGLELIKCNKFGAQVEQSLPQITLDKCDGGNIFLSAESMNASLYTSCTTAINVNLPVGE
FT                   DGDFVEFPVPEQMVHTFGNGKINTTIYEHAG"
FT   gene            complement(<466947..>468386)
FT                   /locus_tag="ZYRO0G05918g"
FT                   /old_locus_tag="ZYRO-ORF1438"
FT   CDS_pept        complement(466947..468386)
FT                   /locus_tag="ZYRO0G05918g"
FT                   /old_locus_tag="ZYRO-ORF1438"
FT                   /product="ZYRO0G05918p"
FT                   /note="similar to uniprot|P27929 Saccharomyces cerevisiae
FT                   YNL137C NAM9 Mitochondrial ribosomal component of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29321"
FT                   /db_xref="GOA:C5DZN7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZN7"
FT                   /protein_id="CAR29321.1"
FT                   /translation="MPRRATLLKSLSRGRVRTSFNKYNLFNLYKKGQVDFRSKTLYQQK
FT                   WTAKQETRAYHGEHLTEKRWQFFFNPKLDSVAQLDASLKGGKEEETPFLLQTFAVLEKR
FT                   LDFAVFRAMFASSVRQARQFILQGNVFVNGIKIAHPNYTLKPGDVFRVRPSKVLEALGA
FT                   KKPSVQESLKVDKVQVTLWNKYVKEAKSNPRAVWNKKLNKYREMDNSNPQKQQFLEQVK
FT                   DYNKDLEQQELKALNSCTPTNMLTQILTVYSKSEKEPESLTVDDFASVVNGDLKLANLA
FT                   LECFQEVNKSKEFTKESLQNGKIDELSHRLLAPTEEMKNKMSDGSKVSIRSAKKHLSEL
FT                   TKLFSSALRESFDKRKGDQNAVDVPYDENWSSKLHYHPRIDPKELVEDEKKAQEFISLP
FT                   WQQHLYGRANPKRPYFTPWKPRPFLAPFAILPHHLEISFKTCHAVYLRDPVARPGHSEV
FT                   ISPFDLPVHERAYMYYVRRGK"
FT   gene            <468594..>469469
FT                   /locus_tag="ZYRO0G05940g"
FT                   /old_locus_tag="ZYRO-ORF1436"
FT   CDS_pept        468594..469469
FT                   /locus_tag="ZYRO0G05940g"
FT                   /old_locus_tag="ZYRO-ORF1436"
FT                   /product="ZYRO0G05940p"
FT                   /note="some similarities with uniprot|P53911 Saccharomyces
FT                   cerevisiae YNL136W EAF7 Subunit of the NuA4 histone
FT                   acetyltransferase complex which acetylates the N-terminal
FT                   tails of histones H4 and H2A"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05940g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29322"
FT                   /db_xref="GOA:C5DZN8"
FT                   /db_xref="InterPro:IPR012423"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZN8"
FT                   /protein_id="CAR29322.1"
FT                   /translation="MAVDWTKVDEIRLLRWVAEFKPAGLHKHFHMYCIVERMNHPDKYP
FT                   VVLLQKESVKSGKIFTASEIWEKLNQYYNFEMMDKIEDHEQFNEHRDFELPWDEYGDLI
FT                   LDHAKGEEESEEEKEENGGVKREEQPKVAEATYLHDSEKEDSANTSSGNINNMKRRSTR
FT                   LRKSSRLHHSRSGSDEEDASNAVSGDSESDGEDEEALNDNNENENENKGKKNDQPLAKR
FT                   TRHSSSATTNVTNNDISPKRKKRKLEETTPPLPQPVQQQQQQETSPESAQAMPPVRTSS
FT                   RVSSRLRNKK"
FT   gene            complement(<469535..>469879)
FT                   /locus_tag="ZYRO0G05962g"
FT                   /old_locus_tag="ZYRO-ORF1434"
FT   CDS_pept        complement(469535..469879)
FT                   /locus_tag="ZYRO0G05962g"
FT                   /old_locus_tag="ZYRO-ORF1434"
FT                   /product="ZYRO0G05962p"
FT                   /note="highly similar to uniprot|P20081 Saccharomyces
FT                   cerevisiae YNL135C FPR1 Peptidyl-prolyl cis-trans isomerase
FT                   (PPIase) binds to the drugs FK506 and rapamycin also binds
FT                   to the nonhistone chromatin binding protein Hmo1p and may
FT                   regulate its assembly or function"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29323"
FT                   /db_xref="GOA:C5DZN9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZN9"
FT                   /protein_id="CAR29323.1"
FT                   /translation="MSEVVDGNVRIDRVSPGDGATFPKAGDLVTIHYTGTLENGQKFDS
FT                   SVDRGSPFQCNIGVGQVIKGWDVGIPRLSVGEKARLTIPGSYAYGPRGFPGLIPPNATL
FT                   VFDVELLKVN"
FT   gene            <470636..>471751
FT                   /locus_tag="ZYRO0G05984g"
FT                   /old_locus_tag="ZYRO-ORF1432"
FT   CDS_pept        470636..471751
FT                   /locus_tag="ZYRO0G05984g"
FT                   /old_locus_tag="ZYRO-ORF1432"
FT                   /product="ZYRO0G05984p"
FT                   /note="similar to uniprot|P53912 Saccharomyces cerevisiae
FT                   YNL134C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29324"
FT                   /db_xref="GOA:C5DZP0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZP0"
FT                   /protein_id="CAR29324.1"
FT                   /translation="MSIPTSMKAVVIEGVNAVVKENVPLPPLKEGQVLVKTLAAAVNPT
FT                   DWKHIEYKLGPQSSISGCDAAGQVVKLGANVKNVAEGDVVAGFAHGASVKHPENGAFAE
FT                   YVAIDSELLWKLQSSSDSRVLSGKQELPSGPVSNIEGLVTFPISLNTAGVVLVNNLKID
FT                   LSWKSSKPQRDEPVIVWGGATAFGQCFIQLAKQLNAFSKIITVASRKHEPSLKKYGADQ
FT                   LFDYHDSDVVEQIKKEYPEAPVVVDGVSSPETYPQIYKVTADTKPSVIINLIYLDDKNV
FT                   EKPKSNVRHESTMLYLMTGFDIPYGSLHLPKDLEYRKKAIEFIKWVQPKIDAGDIYHLP
FT                   VKISNGLESIPKLLDDVRTGKNSGVKLVAVL"
FT   gene            complement(<472026..>472352)
FT                   /locus_tag="ZYRO0G06006g"
FT                   /old_locus_tag="ZYRO-ORF1430"
FT   CDS_pept        complement(472026..472352)
FT                   /locus_tag="ZYRO0G06006g"
FT                   /old_locus_tag="ZYRO-ORF1430"
FT                   /product="ZYRO0G06006p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29325"
FT                   /db_xref="GOA:C5DZP1"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZP1"
FT                   /protein_id="CAR29325.1"
FT                   /translation="MQFSVVALSMLSAVAVKAADNISQIGDGQIQATAPASSAASASSA
FT                   APTSSAAPASSAAPASSVSSEAPRSTAGASNSTAVLPQSVNGGNQLAGGAYIAGLVAAG
FT                   ALLI"
FT   gene            complement(<473650..>475506)
FT                   /locus_tag="ZYRO0G06028g"
FT                   /old_locus_tag="ZYRO-ORF1427"
FT   CDS_pept        complement(473650..475506)
FT                   /locus_tag="ZYRO0G06028g"
FT                   /old_locus_tag="ZYRO-ORF1427"
FT                   /product="ZYRO0G06028p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29326"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZP2"
FT                   /protein_id="CAR29326.1"
FT                   /translation="MMLYVIGFALYGVIRNGTSRDNDLNSIRFIEYIRRQDFDGIRFLF
FT                   SYSPSSYQTNITSKAFFTGRKFAMLASLPLLLSCVSASVIPLFERNDNSLTNVGADTVV
FT                   SHLTDPFDIRSSKRDTPPYIGSDVVNAISGSIDNTISIPYFNNTQILNEIENSINSQLD
FT                   ALNQGLEALDPLHIFQVVEQSVQNLPSDIDQFKNGLIQNIQGTVGNLFGIHLGKRDGIP
FT                   SIGSDVINAISGAIERVIPLPSGNRTQILQDIEHGINSQLGDLQQGLEFLDPLHIFQVI
FT                   ENAVKSLPSDIDQFKNGLVQAIQGTVGNLFGIHLGKRDGTPSIGSDVINAISGAIERII
FT                   PLPSGNRTQILQDIEHSINSQLGDLQQGLEFLDPLHIFQVIENAVKSLPSDIDQFKNGL
FT                   VQAIQGTVGNLFGIHLGKRDGTPSIGSDVINAISGAIERIIPLPSGNRTQILQDIEHSI
FT                   NSQLGDLQQGLEFLDPLHIFQVIENAVKSLPSDIDQFKNGLVQAIQGTVGNLFGIHLGK
FT                   RDGIFSIGSDVVNAISGAIERVIPLPSGNRTQILQDIEHGINSQLGDLQQGLEFLDPLH
FT                   IFQVIENAVKSLPSDIDQFKNGLVQAIQGTVGNLFGIHPSKK"
FT   gene            <476554..>477045
FT                   /pseudo
FT                   /locus_tag="ZYRO0G06050g"
FT                   /old_locus_tag="pseudo-Zyro0G-476554-477045"
FT   gene            complement(<478718..>480589)
FT                   /locus_tag="ZYRO0G06072g"
FT                   /old_locus_tag="ZYRO-ORF1422"
FT   CDS_pept        complement(478718..480589)
FT                   /locus_tag="ZYRO0G06072g"
FT                   /old_locus_tag="ZYRO-ORF1422"
FT                   /product="ZYRO0G06072p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06072g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29327"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZP3"
FT                   /protein_id="CAR29327.1"
FT                   /translation="MLFSLLSLCSLAFALPATITPTVEEKLYKPTSLGSVDLGNLQRRN
FT                   AFGGVEDTVGDLERREILINGIPANQTNGTFDLSTTNITIGSGTPANLTGNSNGSITIF
FT                   KHKREILINGIPVNQTNGTFDLSKTNITIGSGTPANLTGNSNGSITFFKREEGIRVGGN
FT                   ATGNKTVYFNNGNLTIPTGSTINITGNGNGSITISKRAANLLLSGKPGNETTGPISPDR
FT                   ANITLGGYGPLNITGHANGSVTFFKREDTSGNTSNSSVYLYKGNVTADKGNRFNLTGHS
FT                   NGSITIGRGPGITVGGNATGNKTVYFNNGNLTIPEGSSINITGNSNGSITISKRAANLL
FT                   LSGKPGNETTGPISPDRANITLGGYGPLNITGHANGSVTFFKREDTSGNTSNSSVYLYK
FT                   GNVTADKGNRFNLTGHSNGSITIGRGPGITVGGNATGNKTVYFNNGNLTIPEGSSINIT
FT                   GNSNGSITISKRAANLLLSGKPGNETTGPISPDRANITLGGYGPLNITGHANGSVTFFK
FT                   RANTSGNTSNSSVYLHKGNVTVDQGTPFNLTGHANGSITISRAFRREILINGIPANQTN
FT                   GTIDLTKANITIGSGSLANLTGNANGSITISKRDLENRPRTVLQPVH"
FT   gene            <482377..>482448
FT                   /locus_tag="ZYRO0G06094r"
FT                   /old_locus_tag="Zyro0G.tPro.AGG.14"
FT   tRNA            482377..482448
FT                   /locus_tag="ZYRO0G06094r"
FT                   /old_locus_tag="Zyro0G.tPro.AGG.14"
FT                   /note="tRNA-Pro (AGG) cove score=64.64"
FT   gene            complement(<482666..>483184)
FT                   /locus_tag="ZYRO0G06116g"
FT                   /old_locus_tag="ZYRO-ORF1417"
FT   CDS_pept        complement(482666..483184)
FT                   /locus_tag="ZYRO0G06116g"
FT                   /old_locus_tag="ZYRO-ORF1417"
FT                   /product="ZYRO0G06116p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29328"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZP4"
FT                   /protein_id="CAR29328.1"
FT                   /translation="MRFSTALTSALALLPFGATALQNKNGPFVLELEKDSISDLKNNFL
FT                   TQVDADVFNGLARPLKGVFDGVGDILVSVIGLLGEVVGTVFYLSGDGVLFTQGSDPSNG
FT                   VPGFSLNDQDQLLYEGRQLLGGFEGLNFKLSKDSDAAKRDLIDDINLNLFLPVSINAFD
FT                   TNPSAPSLL"
FT   gene            <484601..>484691
FT                   /locus_tag="ZYRO0G06138r"
FT                   /old_locus_tag="Zyro0G.tPhe.GAA.15"
FT   tRNA            join(484601..484637,484656..484691)
FT                   /locus_tag="ZYRO0G06138r"
FT                   /old_locus_tag="Zyro0G.tPhe.GAA.15"
FT                   /note="tRNA-Phe (GAA) cove"
FT   gene            complement(<485315..>487417)
FT                   /locus_tag="ZYRO0G06160g"
FT                   /old_locus_tag="ZYRO-ORF1414"
FT   CDS_pept        complement(485315..487417)
FT                   /locus_tag="ZYRO0G06160g"
FT                   /old_locus_tag="ZYRO-ORF1414"
FT                   /product="ZYRO0G06160p"
FT                   /note="some similarities with uniprot|P38830 Saccharomyces
FT                   cerevisiae YHR124W NDT80 Meiosis-specific transcription
FT                   factor required for exit from pachytene and for full
FT                   meiotic recombination activates middle sporulation genes
FT                   competes with Sum1p for binding to promoters containing
FT                   middle sporulation elements (MSE)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06160g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29329"
FT                   /db_xref="GOA:C5DZP5"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR024061"
FT                   /db_xref="InterPro:IPR037141"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZP5"
FT                   /protein_id="CAR29329.1"
FT                   /translation="MSSNYGLVEEQFRNISQHDDIFGEEELGEDGEPVIQTHVNEDGTT
FT                   SSYFDKRKLKIAPRSTLQFKVGPTFEFVGNYYKVTERYTGRVLDLSIIPRIDRGFDFID
FT                   GEWVGYKRNYFTLVSSFEALGWDLDEFLNSCFELHGDTGQRCHIKYFAINIKAKSDDDH
FT                   TEISLVQHTAKRDKGPQFPPAMAPLIPSALPNHQIIREASNVRNTTKMKKYDATFYFHR
FT                   DDPVNSTAYSEKSVINSYPGDCIQRVARYERVQFASSINLKKPAQQNRHFRLHVVLGAI
FT                   IPKGFNHYHHGSDGIHGDIVETGIDAQRDLFIPLQEVRTPPLIIRGRSPSNYTSSQRIS
FT                   VRTSSYNCSYKPEPSVSIGPPNPMLASQNSAPSQTPMTISPNKPRPGRPSKRKSRVLYV
FT                   PPPLGSPPQPLPQLLEPPLAELLHEEPPSAAVLSIAKKVETLENIENFFHTQGPLALKT
FT                   LDHQNFNPDMEDKTYKPTLLSRQNSVDPRDIELKCDKEFQENLRTVGPLQILATLKSQN
FT                   SNTGKPDDNNKNNYADAGVSRKKRKLNGTSTTTALELSLEDTKELFDDDALKTNVNYAQ
FT                   SDSPVSPLSSRNIEPNPMEELSFGEGLNSISFSLLADSSSNYCHVPNTTLSEMENVPRI
FT                   FDSRVIGAQDTSNRNDHNDYNKDSSREQTTAGMLVSKEARDAMNGLPSQMADMGELYEE
FT                   LSFYRH"
FT   gene            <488273..>491440
FT                   /locus_tag="ZYRO0G06182g"
FT                   /old_locus_tag="ZYRO-ORF1413"
FT   CDS_pept        488273..491440
FT                   /locus_tag="ZYRO0G06182g"
FT                   /old_locus_tag="ZYRO-ORF1413"
FT                   /product="ZYRO0G06182p"
FT                   /note="highly similar to uniprot|P53914 Saccharomyces
FT                   cerevisiae YNL132W KRE33 Essential protein of unknown
FT                   function heterozygous mutant shows haploinsufficiency in K1
FT                   killer toxin resistance"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06182g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29330"
FT                   /db_xref="GOA:C5DZP6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR027992"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="InterPro:IPR033688"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZP6"
FT                   /protein_id="CAR29330.1"
FT                   /translation="MVKKAIDSRIPTLIRNDVQTKQRSFFVIVGDRARNQLPNLHYLMM
FT                   SADLKMNKSVLWAYKNKLLGFTSHRKKRENKIKKEIKRGTREANDQDPFEAFISNQNIR
FT                   YVYYKDTEKILGNTYGMCVLQDFEALTPNLLARTVETVEGGGIVVILLKSMASLKQLYT
FT                   MTMDVHSRYRTEAHTDVVARFNERFILSLGSNENCLVVDDELNVLPISGGRNVKPLPPK
FT                   DDDERTPSEIELAELKESLQDVQPAGSLVGLSRTVNQAHAILSFIDVISEKTLDTTAAL
FT                   TAGRGRGKSAALGVAIAAAVSHGYSNIFVTSPSPENLKTLFEFIFKGFDALGYQEHIDY
FT                   DIIQSTNPDFNRAIVRVDIRRDHRQTIQYILPQDSHVLGQAELVVIDEAAAIPLQIVKN
FT                   LLGPYLVFMASTINGYEGTGRSLSLKLIQQLRQQANLNDTGNSQTVVTSRDSKASGSIR
FT                   TGNRQLREILLDEPIRYTRGDPVEKWLNKLLCLDVTLMKNARFAAKGTPHPSQCNLFVV
FT                   NRDTLFSYHPVSESFLEKMMALYVASHYKNSPNDLQLMSDAPAHQLFVLLPPIDPKEGG
FT                   RIPDPLCVVQVALEGEISKEHVRSSFARGHRAGGDLIPWLVSQQFQDEEFAGLSGARVV
FT                   RIATNQEYASMGYGSRAIELLRDYFEGKFTDLSEDTTPKDFSIKRVSDKELQNANLLTD
FT                   EVKLRDAKKLPPLLMKLSEQPPHFLHYLGVSYGLTPSLLKFWKRNQFVPVYLRQTANDL
FT                   TGEHSCVMLSVLEGREHRWLSEFARDFHKRFLSLLSYDFRKFTAVHALSLIESSQKAEK
FT                   ESADEKPVKRLNKEQLDDLFSPFDLKRLDSYSNNLLDYHVIVDMLPTLAILYFGGRMEG
FT                   SVNLSGVQSAIFLAIGLQRKNIDDISKELNLPSNQAIAMFAKIMRKISVYFRQLQAESI
FT                   GKSLPNAAQDEQIAEMNGEEIKGYDAAEALDQMDEDLEEAGSEAVQAMRERQREFINSL
FT                   DLNKYAIAENEEEWNQNQKSLEKAAQSKGTASIKTGTKRSTENAENIYKQEMGAVKRGK
FT                   KTKKRSG"
FT   gene            <491950..>492393
FT                   /locus_tag="ZYRO0G06204g"
FT                   /old_locus_tag="ZYRO-ORF1411"
FT   CDS_pept        491950..492393
FT                   /locus_tag="ZYRO0G06204g"
FT                   /old_locus_tag="ZYRO-ORF1411"
FT                   /product="ZYRO0G06204p"
FT                   /note="similar to uniprot|P49334 Saccharomyces cerevisiae
FT                   YNL131W TOM22 Translocase of Outer Mitochondrial membrane
FT                   Mitochondrial import receptor complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29331"
FT                   /db_xref="GOA:C5DZP7"
FT                   /db_xref="InterPro:IPR005683"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZP7"
FT                   /protein_id="CAR29331.1"
FT                   /translation="MVELTDITDESKNFKTPKEQQPAANDDKAGDLSDDEYGSDFEDDY
FT                   DENETIADRLVALKDIIPPKQRQNISSLFNTASSLVKSFFSKSGNVAWTVTTSALLLGV
FT                   PLSLSILGEQQLIEMEKSFDLQKDANDLLAQGDNNGQSAPATA"
FT   gene            complement(<492639..>493915)
FT                   /locus_tag="ZYRO0G06226g"
FT                   /old_locus_tag="Zyro0G.mRNA.2958.m"
FT   CDS_pept        complement(join(492639..493614,493866..493915))
FT                   /locus_tag="ZYRO0G06226g"
FT                   /old_locus_tag="Zyro0G.mRNA.2958.m"
FT                   /product="ZYRO0G06226p"
FT                   /note="similar to uniprot|P17898 Saccharomyces cerevisiae
FT                   YNL130C CPT1 and similar to uniprot|P22140 Saccharomyces
FT                   cerevisiae YHR123w Cholinephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29332"
FT                   /db_xref="GOA:C5DZP8"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZP8"
FT                   /protein_id="CAR29332.1"
FT                   /translation="MGFYVPHENLESLKAYHLNQESPRWTYISYAVGLFLYQLFDACDG
FT                   MHARRTGQSGPLGELFDHCIDSLNTTLSLFPFCSAVGISYNYMMVITQLACLCNFYLST
FT                   WEEYHTHKLFLSEFSGPVEGILMICIGYILTGIYGPQKIWHTELTTFDFNGYHFKVESL
FT                   DIMLVFSGIGLMFNVLSARQNVIDYYNEQPKAQEIVGKKVKGHSPQCEAMKGLLPFFSY
FT                   YISVFSLVIIEPDFISFPFVLSTGFAMAFVVGRIITAHLTKQPFPMVNAPMLVPSAQLV
FT                   LYVLVVNLLGYEKSTVINALLWTGCGLTLGIHGTFINDIIYDFTSYLDIYALSIKHHKV
FT                   A"
FT   gene            complement(<494072..>494749)
FT                   /locus_tag="ZYRO0G06248g"
FT                   /old_locus_tag="ZYRO-ORF1409"
FT   CDS_pept        complement(494072..494749)
FT                   /locus_tag="ZYRO0G06248g"
FT                   /old_locus_tag="ZYRO-ORF1409"
FT                   /product="ZYRO0G06248p"
FT                   /note="similar to uniprot|P38829 Saccharomyces cerevisiae
FT                   YHR122W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29333"
FT                   /db_xref="GOA:C5DZP9"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR039796"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZP9"
FT                   /protein_id="CAR29333.1"
FT                   /translation="MSEFINETPTVLEDNQLPTRGEDTDGNLLLGTDVTKESLHRTKLL
FT                   LKIDNSLQSPVLQNVELLTKLLQLNQAPELTTDESDEDTDDMADELGVPADPIDPQEIY
FT                   DLIAHISDPEHPLTLGQLAVVNLKDIEVHDEGYKDRMAEVIVKITPTITHCSLATLIGL
FT                   GIRVRLERALPARFRITIFVKEGSHQSENQVNKQLNDKERVAAACENDQLLGVISKMLS
FT                   TCK"
FT   gene            <494886..>495665
FT                   /locus_tag="ZYRO0G06270g"
FT                   /old_locus_tag="Zyro0G.mRNA.vl.391.p"
FT   CDS_pept        join(494886..494939,495003..495665)
FT                   /locus_tag="ZYRO0G06270g"
FT                   /old_locus_tag="Zyro0G.mRNA.vl.391.p"
FT                   /product="ZYRO0G06270p"
FT                   /note="similar to uniprot|P53915 Saccharomyces cerevisiae
FT                   YNL129W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29334"
FT                   /db_xref="GOA:C5DZQ0"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026681"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZQ0"
FT                   /protein_id="CAR29334.1"
FT                   /translation="MANIFLVALSGCSSSGKSTIAKVIAQICPDITLIHEDDFYKHDDE
FT                   IPFNEKRGISNWDSPEALDLAHFEAELDSIKETGQISSQLVHNNNVDDISKFQLDPNFL
FT                   QTLRHKLEPISRSTRIVLVDGFMIYNSPKLASKFDLKLFVRAPYEVLKARRNARPGYQT
FT                   LDSYWVDPPYYFDEFVYDSYRSSHAHLFIDGDVEGSLNPQTAAGIKEFTNGSGTPLTEA
FT                   LTWTTNEICEAVSAAH"
FT   gene            <495765..>496991
FT                   /locus_tag="ZYRO0G06292g"
FT                   /old_locus_tag="ZYRO-ORF1407"
FT   CDS_pept        495765..496991
FT                   /locus_tag="ZYRO0G06292g"
FT                   /old_locus_tag="ZYRO-ORF1407"
FT                   /product="ZYRO0G06292p"
FT                   /note="uniprot|Q6RI82 Zygosaccharomyces rouxii TEP1 TEP1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06292g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29335"
FT                   /db_xref="GOA:C5DZQ1"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029023"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZQ1"
FT                   /protein_id="CAR29335.1"
FT                   /translation="MTIRIHHQAKPTNLLKSIYATPLNVHKNNSGLTLDLSYITNQVIV
FT                   CSYPVTRYPKLMYRNSLEDLVTFLNIQHGPESWKLYNFKIEGGRSDYRDEELMELVGAQ
FT                   KTKCIPPNCDGSTLAADLDQFLNRVGWMDHSPPPFLLLQNIIDDIQDQLIKSGSSVAVL
FT                   HCKMGKGRSGTICIAYLMKYLESPLSESRDIFMNGRFKPGVSRGVTILSQLRWLRYHEM
FT                   FLYYEPGLRPDILDQLSQSKFKLHTIQLNEPSSILFARPCSACIKIQTFNESRDSVTDL
FT                   ATLETDEELLCRSDEDKTITICFPLELHISDIRLEFGISARSPTVMNNFTALASYAHCW
FT                   LNLYWETLKCSRIGSKDHYMLSKLLHEQDSGQNFDFVIKWRELDGTGGTSNRGLKLFES
FT                   LTMKWSLIL"
FT   gene            complement(<497083..>497649)
FT                   /locus_tag="ZYRO0G06314g"
FT                   /old_locus_tag="ZYRO-ORF1406"
FT   CDS_pept        complement(497083..497649)
FT                   /locus_tag="ZYRO0G06314g"
FT                   /old_locus_tag="ZYRO-ORF1406"
FT                   /product="ZYRO0G06314p"
FT                   /note="uniprot|Q6RI83 Zygosaccharomyces rouxii similar to
FT                   YHR121W uniprot|P38828 Saccharomyces cerevisiae YHR121W
FT                   LSM12 Protein containing an Lsm domain and an AD domain may
FT                   bind RNA and have a role in RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06314g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29336"
FT                   /db_xref="GOA:C5DZQ2"
FT                   /db_xref="InterPro:IPR016521"
FT                   /db_xref="InterPro:IPR019181"
FT                   /db_xref="InterPro:IPR039683"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZQ2"
FT                   /protein_id="CAR29336.1"
FT                   /translation="MSISLENILGFKVKVVNVLDVVTEGKVYSFNSSNNTLTLQTSKKV
FT                   QQPQSFKVIKCSFIKNLEVIGERPSTNLFKKQPIKPAYVHVDRVNQLLQEKMKESAKKN
FT                   ELSGKGVSSEGQFLFDMAYKTVSDTRWVDKNIVVLDSVEIFPPYKPENIKLINGSKAEA
FT                   VTMVQRILQRGWQKLNESEETKKGG"
FT   gene            <497875..>500748
FT                   /locus_tag="ZYRO0G06336g"
FT                   /old_locus_tag="ZYRO-ORF1404"
FT   CDS_pept        497875..500748
FT                   /locus_tag="ZYRO0G06336g"
FT                   /old_locus_tag="ZYRO-ORF1404"
FT                   /product="ZYRO0G06336p"
FT                   /note="similar to uniprot|P53917 Saccharomyces cerevisiae
FT                   YNL127W FAR11 Protein involved in G1 cell cycle arrest in
FT                   response to pheromone in a pathway different from the
FT                   Far1p-dependent pathway interacts with Far3p Far7p Far8p
FT                   Far9p and Far10p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06336g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29337"
FT                   /db_xref="GOA:C5DZQ3"
FT                   /db_xref="InterPro:IPR012486"
FT                   /db_xref="InterPro:IPR021819"
FT                   /db_xref="InterPro:IPR040185"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZQ3"
FT                   /protein_id="CAR29337.1"
FT                   /translation="MNGNGRPDLPIRSVSLDNLRPKSSLRKRLKFIDDTPTRMSSSASG
FT                   SPERSRESGNELLLDLNNILRAKLTIDDPRNRNNGSNSGSDHRTSHNNKDEEFKKKLGL
FT                   ESDVITRVYGNGNEGTNECEENDEEADDNDDVPEVNSRATKEHRLSDEQDSDEMGDEED
FT                   EEEDEFANVDEIDGPISGKQKDNKSEAKGLDIDYNMPIDEEYKKSLDERAAEFDKVSRF
FT                   QPISQPRIEWSLQDFCSLQDELAEWFCTSDFSQLAQTKSQFDKKVDEPQRFLKDDDYAL
FT                   KIMDQLCQDTNKNLLALTYISMGTFALVTSLDEQLQNIRRNNLMLCSHLNSIVDVFKKV
FT                   AIACRDNVTNLKRETTLFFYSCTILFFMTNVCIEQRDNDSNTVKNAIKILHDAQLLPFL
FT                   THYIEHWRWNSRLSMRIRNVINLLFRLLVLQFGDKTVWKRSKAFLYNLHNLKQPHRSEK
FT                   GQILTISPLHYQAFREDITARFPDHRTPLAGLPPEVDNSNSLSQFLEIPRSKAKNPVNL
FT                   TLATPQQHIATPAPSPPGSPNLLQMDAIRHRKSFQTNMAYPCLYPSDDEEGEDELSKKM
FT                   SLDDYDRRTEVFVPYSIQEATNILSNSVHIKLSVQQLWYERDLFISTERGWKVDQGEDK
FT                   YNYSSMENTSQEESIDIMKRVDSFYDECFSSLNSLVFVLLQTVESNLSNVDFRNSDIPA
FT                   DTKIDPLIPRLEITRAKELAMKSSFGILYLLLRWFKLNHVLKQEHLCVLLHDSRYIQVC
FT                   CSLLSKYSENYPDKAFNRMLSSPGSIWRECSNYNSTYQQSLLDQQDTEKSQNYDTVTLS
FT                   SLAYMLKVLRRIVGNKTERLKELPLNIGLLFKRYYRIFNIDIYHPILRIIKELTPFKNK
FT                   RWKAEHMELISGVFLYEELELIDNWVTGKDVSGELGDACGQEIAMRALLQFYNFLHYEK
FT                   SMEDLGYSQRSTTNLSLLNKESEYLGM"
FT   gene            <501008..>503569
FT                   /locus_tag="ZYRO0G06358g"
FT                   /old_locus_tag="ZYRO-ORF1403"
FT   CDS_pept        501008..503569
FT                   /locus_tag="ZYRO0G06358g"
FT                   /old_locus_tag="ZYRO-ORF1403"
FT                   /product="ZYRO0G06358p"
FT                   /note="similar to uniprot|P53540 Saccharomyces cerevisiae
FT                   YNL126W SPC98 Component of the microtubule-nucleating Tub4p
FT                   (gamma-tubulin) complex interacts with Spc110p at the
FT                   spindle pole body (SPB) inner plaque and with Spc72p at the
FT                   SPB outer plaque"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06358g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29338"
FT                   /db_xref="GOA:C5DZQ4"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZQ4"
FT                   /protein_id="CAR29338.1"
FT                   /translation="MDLEVALYPVVEALAPHTLSDGLTNSLTHELAQLLQSPSRSLGQL
FT                   QNTIDSFKLKVPYSPDGVIRWQKLINVIQLLFGIDRKENVIKYLSTFQSMLMENSTIPS
FT                   PDMDRNHVMSLNMNGLDTHDKLLSPLRPQSLQAESFENLDKFSDRRSLLSSQKGYALSR
FT                   EYNSVSLHMLSNQYYYKMISEEEILKVISYTLLATMTELFPLEFNKINIPKEVTNSESG
FT                   LLHLIFEAVLLYQNLKLKVDEQKHKNVSPMKKALLVQVESALQNYVKVVNSLSAFARVD
FT                   SLKQLYYEFYDHIIALRFHYRYMENFEETSGDSFLTRFNDLQSHGDVLVRRLCTEIFKN
FT                   LLSLYYEYLIDWLTMGKLEATYREFFIVAHESEDPLPLKLVKNKVPKFIPMSVANEIFI
FT                   IGKTFLLLSKYCKELHWTNEISKKYSFKYQQLVHHVQLTDFYSLVHSHYEEMVKFANNT
FT                   LLHKFYYKQVLYTLKDILLMGKSDLIDILIQKAQDILAMPSASLSGYRLTRFLQEAVQQ
FT                   SSMRNLLNKSDKNFVINGLDARILDLGHGSLGWDVFTLDYLIDVPLSTVLNVNRNGGKK
FT                   EYLRIFNFLWRFKKNNFFYNQEWLKSNQLIRNFRKMDRHGPLIRDLTSKLSKVNILRNQ
FT                   IQHFSQKLEAFCFRSIIDKNFQEFERKVVITSDKNDNTDDDEQGMNDLQAVRLRNGVLM
FT                   LNGILRPRSSRSPLLSSILQATATTETFCKEPNIDELDSLHDGYLQKILLHKLLNSSNG
FT                   QKTVGGLSGQPYSSSSIILLNIAFEFITFQSALNDVAHELLIQLNLDTQPQLGVLLSRF
FT                   NSVLRDLVPRYKLFKENLRIFIKDLKMDGDDELCSLSRFLR"
FT   gene            complement(<503630..>505399)
FT                   /locus_tag="ZYRO0G06380g"
FT                   /old_locus_tag="ZYRO-ORF1401"
FT   CDS_pept        complement(503630..505399)
FT                   /locus_tag="ZYRO0G06380g"
FT                   /old_locus_tag="ZYRO-ORF1401"
FT                   /product="ZYRO0G06380p"
FT                   /note="some similarities with uniprot|P53918 Saccharomyces
FT                   cerevisiae YNL125C ESBP6 Protein with similarity to
FT                   monocarboxylate permeases appears not to be involved in
FT                   transport of monocarboxylates such as lactate pyruvate or
FT                   acetate across the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06380g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29339"
FT                   /db_xref="GOA:C5DZQ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZQ5"
FT                   /protein_id="CAR29339.1"
FT                   /translation="MSKTQSIGHLPPSTGSDVSRSEPQWSWKEDNDEDTGIAEKPHTVT
FT                   SADTYSSGSVGSGEDEVELDRALTSYFDVADAMRIQTNEGSRGQIKLEDSESGNEEGAK
FT                   EYDGNDLDDDDNLKKVFTNHSTGEIDLPPDGGYGWVVTLCVFLVMFSTWGCNSGFGIFL
FT                   AFYLKSGAFAGANKFDYATIAGITVACGQGFAPFVVVCYRVIGCKPTMLIGTVFMFAGF
FT                   LMASFAKSLWELYLTQGLLVGLSISFSYVPATVVLPGWFLKKRAYAIGISYMGTGCGGV
FT                   TYGLAVNKMINNSHSTRWALRVLCISCTCSMLVAIALLKQRNPLPITGIKRWGPIWEQF
FT                   KIVFNIKVAKNPISLTIAIWFGFSLFGYNLMMYTLSSYAQARGLSAHDGSTLTAITNAA
FT                   QVVGRPIMGLLGDRFGRTNTTIVLSALLTIFLFAFWIPSHTFVQLIFFCICMGSCVGVA
FT                   QVMVTVLIADLVGPEAFLASWAFANAGPAPYLLCCEIIAQALVTNSKSSPYLHTQCYGG
FT                   ACFAISLILIFILRERAVRLKLGKMAEQEGVGFNGKNDIEVHSDVNFTHDYSSLLGKSP
FT                   TKYLRRLTYPMRI"
FT   gene            <505987..>507273
FT                   /locus_tag="ZYRO0G06402g"
FT                   /old_locus_tag="ZYRO-ORF1400"
FT   CDS_pept        505987..507273
FT                   /locus_tag="ZYRO0G06402g"
FT                   /old_locus_tag="ZYRO-ORF1400"
FT                   /product="ZYRO0G06402p"
FT                   /note="some similarities with uniprot|P53919 Saccharomyces
FT                   cerevisiae YNL124W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06402g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29340"
FT                   /db_xref="GOA:C5DZQ6"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="InterPro:IPR040309"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZQ6"
FT                   /protein_id="CAR29340.1"
FT                   /translation="MTDAFDQALENPETASQIHLPTNDVDLGDLGSDESSSSSYESEDS
FT                   DEEEEEVAEYGDAEEEEEGGGGDVIKSKHEVTEEQVPDLPDDYEIPESATISPIGKIKS
FT                   AFDNNIIIEAVVSGEKRVLKEGSILCLEDKSLIGILCEVFGPLQKPFYRVALPVSKKER
FT                   FDQLKEQLGSNVCIVVPEAHWVDTFELKKLKGTDASNGYDEELPEEEQEFSDDEKEAIS
FT                   KKMKKEQNKKKKENGKPKQPRSGGVDKIPNNLQSMKVPQAMTSVSYRSRNSRQAPQQSP
FT                   PAAYEQPHHQYQPPRPRPQAIPQPQLPPQTQQPIYQPPPTPYNYGVPYVQQSPSFQQPP
FT                   SFQQPPSFQPFVSPYPQPQPLYQAPMYYPPQPQPQFPMPGPAPGPGPAPAPVQQNMQQV
FT                   LQLHQLLVQQQQQQQQQQQGQNQHFNYDD"
FT   gene            complement(<507306..>510170)
FT                   /locus_tag="ZYRO0G06424g"
FT                   /old_locus_tag="ZYRO-ORF1395"
FT   CDS_pept        complement(507306..510170)
FT                   /locus_tag="ZYRO0G06424g"
FT                   /old_locus_tag="ZYRO-ORF1395"
FT                   /product="ZYRO0G06424p"
FT                   /note="similar to uniprot|P25846 Saccharomyces cerevisiae
FT                   YHR120W MSH1 DNA-binding protein of the mitochondria
FT                   involved in repair of mitochondrial DNA has ATPase activity
FT                   and binds to DNA mismatches has homology to E. coli MutS
FT                   transcription is induced during meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06424g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29341"
FT                   /db_xref="GOA:C5DZQ7"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZQ7"
FT                   /protein_id="CAR29341.1"
FT                   /translation="MLWSGRINPLCFQVRYTLRTYISKPKVTKLSLTLDNKESNYPTEE
FT                   NAIDTSSPPIAFKRSKSSNLSEQSTDLRKKSQTQLPPSLQYARDLMDRYKSHVVLTQMG
FT                   SFYELYFEHATMYAPQLNISLTSKNYTFGKVPFAGFPVPQLNRHLKVLVNNYGYSVTIA
FT                   DQFKRDTPADNDVNKFYRRVTRIVTPGTFIDEAFENLQENTHLLNIEFPENCMKNLADP
FT                   DMKIGLCWCDVSTGEISVQQILLKDLASAITRIQPREILLDEELAQFNLESGYWYSELV
FT                   ELKKYFMKYQKLPQRHRTMDTFYGLFTAGNSKEGINQLKITFQQFTQKEIAALRNILIY
FT                   VSEHLPDFHMNFQVPQRKITASIMQIDSRTSAALELHTSVRDNRKRGTLLSTVRRTVTP
FT                   VGARLLVQWLSGPSMDLKEIKNRQRIVKFFKASNDCTDTLIFLLKKTHDLARILQKFSF
FT                   GRGEALEIIQLARSIQVALDIGYHLQKESQNSDSSSKRIIETLVLQLKFDRQIISDVLT
FT                   GLNEEELVKSENLTQDGEAAEESAELEETGATELQQEGNLKESWVVNVDYSQRLKDLHK
FT                   RYAELRDQKCSLQRTYQSYFIDEWGCKSVLLRRKQNGDYALRVTGGINHLKRVVELAKQ
FT                   NSFHVLQKSSQTVWFTHESWTKLGTELEMAVFKIRKEEINIMNEFKKRFIEKSNEVRAI
FT                   SDILGYLDILSSFAVLARERNLVCPIVDQSDRLEIVGGRHLVVEDAISNRSLEKFTEND
FT                   CQLNAGELWVVSGPNMGGKSTFLRQNAVIVLLAQMGCFVPCKSARIGLVDKIFSRVGSA
FT                   DDLYNEMSTFMVEMVETSFILKGATNRSLAILDEIGRGTSGKEGISIAYATLRHLIKNN
FT                   VCRSLFATHFGQELNDILQRRSEGDLTEKIQFYKSGVVETLEGDFYYDHKLKPGICETS
FT                   DALRVAETAGFPGDALEIAKEVLS"
FT   gene            complement(<510394..>513441)
FT                   /locus_tag="ZYRO0G06446g"
FT                   /old_locus_tag="ZYRO-ORF1394"
FT   CDS_pept        complement(510394..513441)
FT                   /locus_tag="ZYRO0G06446g"
FT                   /old_locus_tag="ZYRO-ORF1394"
FT                   /product="ZYRO0G06446p"
FT                   /note="similar to uniprot|P38827 Saccharomyces cerevisiae
FT                   YHR119W SET1 Histone methyltransferase subunit of the
FT                   COMPASS complex which methylates histone H3 on lysine 4 and
FT                   is required in transcriptional silencing near telomeres
FT                   contains a SET domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29342"
FT                   /db_xref="GOA:C5DZQ8"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017111"
FT                   /db_xref="InterPro:IPR024636"
FT                   /db_xref="InterPro:IPR024657"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZQ8"
FT                   /protein_id="CAR29342.1"
FT                   /translation="MSGYYRRSYPIPPTGPQRSNFWHESSGSDYNHKPYFNGGYKRYGR
FT                   YGNFVDNDVSSRNHRNRREEVNDGSSSSYESPLLNHEEDTKRPIPRVKWDTEELKAKYH
FT                   YFDVREKKLIHMEEMTNWNKDSKYPPNGYVLVQENNMGQPRPVFKQRVPQEKAVDPRVE
FT                   QRQQQQQQQVIPPTYRKLRSKLALLPHIVYDKFSVGPPPPNEIVLSLLSNVATVQDISI
FT                   KNYFKRYGEISHFEAFSDPNSALPLHIYLIRYGSYSGKLDDAARAAYMAFKDHEGRGCS
FT                   ILGTKFNCTLNKNNILEKTISRTVTDNLNRVRKITNDMKKMEKRQKEEEKKESQAYSER
FT                   KIPLDLAKQINGRPVLVVSKSFALHHGLRVEDFKVKLRRYRWSRILDHSSGLYVVFNDL
FT                   EHARNCQKVESGKMLITSRAKRAPVDVRFQLIAPTVDKQPTNDINGNHAALPKSSNQLP
FT                   TYKTKEELISAATSYILKDLENALHVDIRKRIIGPAVFDTLNPASFPDLIAKKEVKEKE
FT                   RKEVVAKKAEELKKKQSTNNDFDIFSLYSGGVTQSNRNRLKRRGSEVIDILPSGRRKLF
FT                   KGVKPMAHMLNDDSLSKEQTPVAPSTSSPFDESEDEEMTSSDATEYESGEDDNVEQKKM
FT                   IKVETESTTPEIDHAEKPLFVSKKAEEIMRIPEPYRPSVGGLPKPIQPDDTIRPNLFID
FT                   DLQKTVTDMEDLFILKKVLGLDEPNQNDEKSEHDGTLEYRIWKLRSQAQNFRVDQENQL
FT                   RLLGAPLDSLLLTGNGSFKAQGYRKIPEKLKSCYLPHRRKPHQPLNTVSYHSETKDGTP
FT                   EVEREESENLEEPESVPQEISSSRDNRASNRRFQQDIEAQRAAIGTESELLSLNQLNKR
FT                   KKPVTFARSTIHNWGLYALEPIAAKEMIIEYVGERIRQPVAEMREIRYLKSGIGSSYLF
FT                   RIDENTVIDATKKGGIARFINHCCEPSCTAKIIKVGGMKRIVIYALRDIGANEELTYDY
FT                   KFEREIDAEERLPCLCGAPSCKGFLN"
FT   gene            <513793..>515067
FT                   /locus_tag="ZYRO0G06468g"
FT                   /old_locus_tag="ZYRO-ORF1390"
FT   CDS_pept        513793..515067
FT                   /locus_tag="ZYRO0G06468g"
FT                   /old_locus_tag="ZYRO-ORF1390"
FT                   /product="ZYRO0G06468p"
FT                   /note="similar to uniprot|P38826 Saccharomyces cerevisiae
FT                   YHR118C ORC6 Subunit of the origin recognition complex
FT                   which directs DNA replication by binding to replication
FT                   origins and is also involved in transcriptional silencing
FT                   may be phosphorylated by Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06468g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29343"
FT                   /db_xref="GOA:C5DZQ9"
FT                   /db_xref="InterPro:IPR008721"
FT                   /db_xref="InterPro:IPR016811"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZQ9"
FT                   /protein_id="CAR29343.1"
FT                   /translation="MSNHQIQRCIRDILGINQEEKLDWSQSHFKKLLSATSTLHTASLN
FT                   KVMLKQDEETARLHLCAYIASERLADKHMPELSYYMDRVPLEPRKARKLMELIKQNVFQ
FT                   LSPVKNIQWTPSPKKRNGTSPLKNGDRFTAQDPQILRKQLFDTPTKGNSPVGDPVKNAQ
FT                   VVNPPSATASPSKARRKLAFEEEDEMENPVPASNQSLDTLAQLSLVANERLNNEEEEEE
FT                   LKKKPRSNKRSQQQQEQEQEQPAPKRRKETGRSRSEMCLLQKRYYKVTPAEIINLCNQF
FT                   EIPKDVAYSILDQFMSYASYLVCPWKLACGLVLNATFVVFTERRRKDPRVDHLILEKMC
FT                   GITKAPQLEDITECINLVKELIEGEKWYRDLQIKHNYYNGACFDEAISTKLGSMLQPNN
FT                   ILVSNEQFTSWKRKIEQDLSLKDMH"
FT   gene            complement(<515132..>515410)
FT                   /locus_tag="ZYRO0G06490g"
FT                   /old_locus_tag="ZYRO-ORF1388"
FT   CDS_pept        complement(515132..515410)
FT                   /locus_tag="ZYRO0G06490g"
FT                   /old_locus_tag="ZYRO-ORF1388"
FT                   /product="ZYRO0G06490p"
FT                   /note="similar to uniprot|Q75D91 Ashbya gossypii ABR133W
FT                   50S ribosomal protein L35 and some similarites with YNL122C
FT                   uniprot|P53921 Saccharomyces cerevisiae YNL122C
FT                   Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06490g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29344"
FT                   /db_xref="GOA:C5DZR0"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZR0"
FT                   /protein_id="CAR29344.1"
FT                   /translation="MFFNSIVGLGSRSAFASFGGFNSSSLVFTRNLMKTHKGTAKRWKK
FT                   TADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQRLRRLLPY"
FT   gene            complement(<515759..>517573)
FT                   /locus_tag="ZYRO0G06512g"
FT                   /old_locus_tag="ZYRO-ORF1387"
FT   CDS_pept        complement(515759..517573)
FT                   /locus_tag="ZYRO0G06512g"
FT                   /old_locus_tag="ZYRO-ORF1387"
FT                   /product="ZYRO0G06512p"
FT                   /note="similar to uniprot|P07213 Saccharomyces cerevisiae
FT                   YNL121C TOM70 Translocase of Outer Mitochondrial membrane
FT                   70 kDa mitochondrial specialized import receptor of the
FT                   outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29345"
FT                   /db_xref="GOA:C5DZR1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZR1"
FT                   /protein_id="CAR29345.1"
FT                   /translation="MSSDNSVAGFISRNKTAIITTAAAGTAAVGAYLYYRQLQDAAGSD
FT                   DKKGESPDGTAASKKKRKNKKKKQGSSPSPSAAVSYPVDEKGEPKLDNVAEMSEEQKES
FT                   WSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENST
FT                   KALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQA
FT                   MTVLKDKLGQQKNQLLPSDTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRS
FT                   SEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDV
FT                   QKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQ
FT                   YEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFF
FT                   AEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKL
FT                   LEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAK
FT                   VQKRIRADPLVSAKIEETLAAYKAQGVI"
FT   gene            complement(<518228..>518566)
FT                   /locus_tag="ZYRO0G06534g"
FT                   /old_locus_tag="ZYRO-ORF1386"
FT   CDS_pept        complement(518228..518566)
FT                   /locus_tag="ZYRO0G06534g"
FT                   /old_locus_tag="ZYRO-ORF1386"
FT                   /product="ZYRO0G06534p"
FT                   /note="similar to uniprot|P38824 Saccharomyces cerevisiae
FT                   YHR116W COX23 Mitochondrial intermembrane space protein
FT                   that functions in mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29346"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZR2"
FT                   /protein_id="CAR29346.1"
FT                   /translation="MADGDKDNLREGNLDPQLVVEPKKVDYAPQGDSPDKFQYYPDKPE
FT                   SSLSRYRFAVKDASQYFDPCQESSRMSFNCLDRNNYDREMCKEYFDAYRECKKQWLRAR
FT                   RENRSLWE"
FT   gene            <518731..>519870
FT                   /locus_tag="ZYRO0G06556g"
FT                   /old_locus_tag="ZYRO-ORF1385"
FT   CDS_pept        518731..519870
FT                   /locus_tag="ZYRO0G06556g"
FT                   /old_locus_tag="ZYRO-ORF1385"
FT                   /product="ZYRO0G06556p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29347"
FT                   /db_xref="GOA:C5DZR3"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZR3"
FT                   /protein_id="CAR29347.1"
FT                   /translation="MASKESLGIFGEFEYYVTFAKDGSKYTSFQLEKSHAKQSSRASTR
FT                   SDDSTLIVLDSLKSGIGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLD
FT                   PLQDYEIWIISGDTTISEFCNNLPNKKITRNPLRILPLPMGTGNAWANSLGFDSPITAF
FT                   RNYLNHNLKPRDIPLYRAALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQI
FT                   AAQSILESYSLDLDISLDGLRRSYAYFALINTPNLEATYKPSPRSNPLERELRLLGYSS
FT                   SLGRQELVEKIMQGYQNKPNGDLPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCD
FT                   GILLNLLDYQSPDKHKPSNEIRFQFLNDYSGFQLQVYSL"
FT   gene            complement(<519877..>521586)
FT                   /locus_tag="ZYRO0G06578g"
FT                   /old_locus_tag="ZYRO-ORF1384"
FT   CDS_pept        complement(519877..521586)
FT                   /locus_tag="ZYRO0G06578g"
FT                   /old_locus_tag="ZYRO-ORF1384"
FT                   /product="ZYRO0G06578p"
FT                   /note="similar to uniprot|P32354 Saccharomyces cerevisiae
FT                   YIL150C MCM10 Essential chromatin-associated protein
FT                   involved in the initiation of DNA replication required for
FT                   the association of the MCM2-7 complex with replication
FT                   origins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29348"
FT                   /db_xref="GOA:C5DZR4"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015408"
FT                   /db_xref="InterPro:IPR040184"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZR4"
FT                   /protein_id="CAR29348.1"
FT                   /translation="MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLN
FT                   VKKTNPKPLDPNLSHIQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQI
FT                   PANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSN
FT                   LWISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKF
FT                   TSAASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTK
FT                   AHIKSFNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELK
FT                   FRSTNAKRVELSGTYALGAPTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPL
FT                   DINARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRDNRKSNILNRELKKNSELDIK
FT                   HKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTEKDSSVA
FT                   SLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHFGSGGDEKDDSDSDLEIVS"
FT   gene            complement(<521893..>527355)
FT                   /locus_tag="ZYRO0G06600g"
FT                   /old_locus_tag="ZYRO-ORF1381"
FT   CDS_pept        complement(521893..527355)
FT                   /locus_tag="ZYRO0G06600g"
FT                   /old_locus_tag="ZYRO-ORF1381"
FT                   /product="ZYRO0G06600p"
FT                   /note="some similarities with uniprot|Q02455 Saccharomyces
FT                   cerevisiae YKR095W MLP1 Myosin-like protein associated with
FT                   the nuclear envelope, connects the nuclear pore complex
FT                   with the nuclear interior; involved in the Tel1p pathway
FT                   that controls telomere length; involved in the retention of
FT                   unspliced mRNAs in the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29349"
FT                   /db_xref="GOA:C5DZR5"
FT                   /db_xref="InterPro:IPR012929"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZR5"
FT                   /protein_id="CAR29349.1"
FT                   /translation="MSEGETGVANIVTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGIL
FT                   TILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQA
FT                   QEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTE
FT                   SRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEVTS
FT                   KTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMK
FT                   DLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDKDNVELLASGERNTEN
FT                   EKLIQELITLKENFEESERERLRLEALVQELIPGDDSQDDINNTSSFISLRNKDSSLRD
FT                   MGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDH
FT                   TSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSA
FT                   EEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESE
FT                   EKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQN
FT                   GSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIE
FT                   LEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIA
FT                   CNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQLQTLQSEREK
FT                   FLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKLDSVVAES
FT                   QHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVETSPESSLRKELE
FT                   KTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGKQELQLQVETLQNEKSQLQDVV
FT                   AKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQILKLQRD
FT                   LEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQ
FT                   NEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKDNSDGVNGETAEVREIL
FT                   TNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQH
FT                   EKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQLRERILPLESELNTLHTSV
FT                   LEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKE
FT                   LDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLN
FT                   AHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLK
FT                   EQSAATAKGEISEDLSNVVESMRRSFEEEKINFLKEKTEELKKLEEEKHTLQVNGNEPQ
FT                   QQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELY
FT                   KKKLEESKSSLESSDGNNSDLKKQLEKDLQEKFEAEVQAVKKKAFEEGKQQAAMKSTLL
FT                   ERKISKLESQLHGKVDSPDKSSSETSSVPKPNLPSKIDEKSVTTNQSVPNPLVSGEKVL
FT                   KLDPSKPTFNFSSFSGGNPFTSSPQNNDTMGTSAFGFKPTFTLSNNSNKSSGTKIDSSS
FT                   TENKPANPFSSFTETGASSPERESSNTAMTPTPGEGASTPSKRAAEDDDNEVGSESKKP
FT                   REENA"
FT   gene            <527968..>528421
FT                   /locus_tag="ZYRO0G06622g"
FT                   /old_locus_tag="Zyro0G.mRNA.1232.p"
FT   CDS_pept        join(527968..527975,528043..528421)
FT                   /locus_tag="ZYRO0G06622g"
FT                   /old_locus_tag="Zyro0G.mRNA.1232.p"
FT                   /product="ZYRO0G06622p"
FT                   /note="highly similar to uniprot|P14796 Saccharomyces
FT                   cerevisiae YKR094C RPL40B"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29350"
FT                   /db_xref="GOA:C5DZR6"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZR6"
FT                   /protein_id="CAR29350.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRQCYARLP
FT                   PRATNCRKRKCGHTNQLRPKKKLK"
FT   gene            complement(<528671..>532171)
FT                   /locus_tag="ZYRO0G06644g"
FT                   /old_locus_tag="ZYRO-ORF1378"
FT   CDS_pept        complement(528671..532171)
FT                   /locus_tag="ZYRO0G06644g"
FT                   /old_locus_tag="ZYRO-ORF1378"
FT                   /product="ZYRO0G06644p"
FT                   /note="similar to uniprot|P39928 Saccharomyces cerevisiae
FT                   YIL147C SLN1 Histidine kinase osmosensor that regulates a
FT                   MAP kinase cascade; transmembrane protein with an
FT                   intracellular kinase domain that signals to Ypd1p and
FT                   Ssk1p, thereby forming a phosphorelay system similar to
FT                   bacterial two-component regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06644g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29351"
FT                   /db_xref="GOA:C5DZR7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZR7"
FT                   /protein_id="CAR29351.1"
FT                   /translation="MWMRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVY
FT                   FTDNYKNLRSERLYMAAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYA
FT                   NWVDSGNVIQKFLTSSGLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNK
FT                   PLPSSLQSEGILTNPVLNGTSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNV
FT                   FDDTTALEKSNVAILSAVYDQNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALR
FT                   QGKGGALERTKFLYTKKVAVGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVV
FT                   GIGVFVCLVTFPLAHWAVKPIVRLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRP
FT                   SNCGSSIRSRVTDNHNEKGHDLHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSK
FT                   GLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAA
FT                   KIDAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELL
FT                   LHILTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIR
FT                   TMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIP
FT                   GTEPKGNDEKDKGGIEEKERFSIENTPNDTSSNSSNKHSDTETTPGLNDTDEKQASDDM
FT                   DGGEEDVEDADEVSSFSTSTSSYNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVIS
FT                   IVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSK
FT                   LGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFKIAKSLKSKRSKSSL
FT                   MTVGPKSSSSDKSLSQLKLTDSDRSVRLDRPFLQSTGTASSNTNLGTTSTINKILVAED
FT                   NDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLL
FT                   STKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDK
FT                   QPQEQDKEPKSSENDNSQLLQQDPQQSKEQKQQQQLLPIITTTTSSSSSGRETKNKDPQ
FT                   "
FT   gene            complement(<532862..>534373)
FT                   /locus_tag="ZYRO0G06666g"
FT                   /old_locus_tag="ZYRO-ORF1375"
FT   CDS_pept        complement(532862..534373)
FT                   /locus_tag="ZYRO0G06666g"
FT                   /old_locus_tag="ZYRO-ORF1375"
FT                   /product="ZYRO0G06666p"
FT                   /note="similar to uniprot|P40458 Saccharomyces cerevisiae
FT                   YIL146C ECM37 Non-essential protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29352"
FT                   /db_xref="GOA:C5DZR8"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DZR8"
FT                   /protein_id="CAR29352.1"
FT                   /translation="MTSTEGTGGGDGKGISGFSDIERRSILDPHLSVLELLRRPSDTRP
FT                   HEALKGEVSDIVGNCAGTTGTGNGSISQSWQTIHRNDSCLSVVPERCPSQATAAGILSS
FT                   SDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLEDYRSLNVGIPLVLPEDSNNINNNNK
FT                   NGSTTGSNGEEDDNDTITKSLNSSSNSFIMPKLSLSQKTQKFRILVLGRPGLKFYHSIP
FT                   KKYQHMFELPRSHDPAEFKQYTGILVVFQELKEMVSLLNRVCQCNPNRPVIPVCQSGQR
FT                   QQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMFRFLQELSKTVSDNSDMDAEEPNNG
FT                   SKRLKRSLQRKKKKFIETSAERNGRPHKKRHNNEKVNRWVLWGVSLTLGVGVGYCISHL
FT                   VSSTWISLTTNPLGPVDPESVSKDLFVFDRQELKLGEMDMDSDHPFGHALFLFKQALKQ
FT                   WNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTNRVLALGYVML"
FT   gene            complement(<535282..>537123)
FT                   /locus_tag="ZYRO0G06688g"
FT                   /old_locus_tag="ZYRO-ORF1372"
FT   CDS_pept        complement(535282..537123)
FT                   /locus_tag="ZYRO0G06688g"
FT                   /old_locus_tag="ZYRO-ORF1372"
FT                   /product="ZYRO0G06688p"
FT                   /note="similar to uniprot|P32901 Saccharomyces cerevisiae
FT                   YKR093W PTR2 Functions in transport of small peptides into
FT                   the cell Peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29353"
FT                   /db_xref="GOA:C5DZR9"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZR9"
FT                   /protein_id="CAR29353.1"
FT                   /translation="MNSASPSITGPEKNKVIIEDKSLEVSGSHERGELDFDEYEVPNDD
FT                   EPTEEELRSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLD
FT                   LKSQGATGLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPS
FT                   VDSKNTALGGFITAIVLIGIATGMIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNI
FT                   TIQNVFMFFYLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVR
FT                   PPVGDKVIAKSFRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFM
FT                   FYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRY
FT                   TPFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAY
FT                   VLIAFSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLW
FT                   MFTGLAVASFISGCLFWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSDLEFEPAG
FT                   ADDKLDHIGSHGATGFRHDGELGEEGELSPYMSPKSL"
FT   gene            complement(<537970..>539724)
FT                   /locus_tag="ZYRO0G06710g"
FT                   /old_locus_tag="ZYRO-ORF1369"
FT   CDS_pept        complement(537970..539724)
FT                   /locus_tag="ZYRO0G06710g"
FT                   /old_locus_tag="ZYRO-ORF1369"
FT                   /product="ZYRO0G06710p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29354"
FT                   /db_xref="GOA:C5DZS0"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZS0"
FT                   /protein_id="CAR29354.1"
FT                   /translation="MSKLVPIASHSLSPDTSGPYEEGEKGNAYQKTSDNEKGEYVDVSG
FT                   REIISDEHRKQPRQLPLQAYSHYADIQREYERSKDYDGLYAVQREQMYTDANSNLSPTK
FT                   LDSQRMMRIAKAYSVFFLITTDILGPSNAPNAISQMGYVPGVILYVVFGIAAACGGWLL
FT                   NHCFCKVDSNNYPIRTFSDLASRVVAPWFRYPFGLLQFIQMILNCGLLLLSTAQAVSQM
FT                   LIVNRGKDNFCFTVDILVWALLCMIAGQISSLGKFAHIANSAVWMNIAICICTMVGVAV
FT                   GGPYYGIFQQYGKGPPYYYPDTFNPLPIVKHAIAPGSLGDRIAGMNNMVFAWGGATIFC
FT                   EVMAEMKRPMDFWKGMLCAQSLILVVYLFYGLFVYTYNGQFCYVTANQAIASVGLQNAG
FT                   NVLTIVSGLIAMVLYGNVAIKVIYQGFLVADLGFPHLTTRKGTIAWGLFVIAYWAVAYI
FT                   LGTAIPSISALVQIVGAFCILNFSYTFPFLFGFCLLCRQDASLADKFDLKTLTVEKADS
FT                   YLRNLSRWKRAIAHGGTRRILIKCSLFLLFLASLATCGLCSYSAITGAIQAYQTNTAHA
FT                   FTCTSPVG"
FT   gene            complement(<540069..>540923)
FT                   /locus_tag="ZYRO0G06732g"
FT                   /old_locus_tag="ZYRO-ORF1366"
FT   CDS_pept        complement(540069..540923)
FT                   /locus_tag="ZYRO0G06732g"
FT                   /old_locus_tag="ZYRO-ORF1366"
FT                   /product="ZYRO0G06732p"
FT                   /note="similar to uniprot|P40459 Saccharomyces cerevisiae
FT                   YIL145C PAN6 Pantothenate synthase also known as pantoate-
FT                   beta-alanine ligase required for pantothenic acid
FT                   biosynthesis deletion causes pantothenic acid auxotrophy
FT                   homologous to E. coli panC"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29355"
FT                   /db_xref="GOA:C5DZS1"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZS1"
FT                   /protein_id="CAR29355.1"
FT                   /translation="MITITTVSQLEQYRDSLDGTIGFVPTMGALHEGHFSLVRRSIANN
FT                   DHTVVSIFVNPTQFGPTEDLETYPRDIARDAAQLEKLGVECLFAPISPSEIYPLGRERG
FT                   PFVDVKLGWATEGLEARTRPGFFKGVATVVTKLLLLVRPGTAYFGQKDWQQLAVVRALC
FT                   EGLFLRVKIESVETAREPNGLALSSRNSYLEPSARSAASDIYKGLLKAAKCATLGMKKE
FT                   YLFEQIEQSWQQRLTSGQFQIDYLELCTPELKPIDTVHSNCVVLCAVYVNGVRLIDNIL
FT                   ITA"
FT   gene            <542611..>543186
FT                   /locus_tag="ZYRO0G06754g"
FT                   /old_locus_tag="ZYRO-ORF1362"
FT   CDS_pept        542611..543186
FT                   /locus_tag="ZYRO0G06754g"
FT                   /old_locus_tag="ZYRO-ORF1362"
FT                   /product="ZYRO0G06754p"
FT                   /note="highly similar to gnl|GLV|CAGL0G05291g Candida
FT                   glabrata CAGL0G05291g and similar to YDR071C uniprot|Q12447
FT                   Saccharomyces cerevisiae YDR071C PAA1 Polyamine
FT                   acetyltransferase acetylates polyamines such as putrescine
FT                   spermidine and spermine may be involved in transcription
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29356"
FT                   /db_xref="GOA:C5DZS2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZS2"
FT                   /protein_id="CAR29356.1"
FT                   /translation="MTSTLPLHMYIRPIILEDAQQVIDLEARGFPPSERASPQNVEFRL
FT                   NTCPELCSGLFIREFNSDTKEVQSETLIGHIMGTKISRNGFIRLEDMKLTHNESSDTIA
FT                   IHSLVIDKNYQKKNLATLLLTDYIQKLSNQEIGERIVIIAHEPLIPFYERVGFKVHGEN
FT                   RDVIKDPEFASSKWIDMVRELVKEEYEN"
FT   gene            <543464..>543757
FT                   /locus_tag="ZYRO0G06776g"
FT                   /old_locus_tag="ZYRO-ORF1361"
FT   CDS_pept        543464..543757
FT                   /locus_tag="ZYRO0G06776g"
FT                   /old_locus_tag="ZYRO-ORF1361"
FT                   /product="ZYRO0G06776p"
FT                   /note="similar to uniprot|Q12497 Saccharomyces cerevisiae
FT                   YDR070C FMP16 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29357"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZS3"
FT                   /protein_id="CAR29357.1"
FT                   /translation="MLSMFCRTPVVSRTLQQQGSRAFTNTAYRALPHRKDNLTADEQTE
FT                   QKNFDDNQARLEEMEHSRTKDVDYTHQRSEAELRKIGEDAQVEQNRPDDGVY"
FT   gene            <544095..>546728
FT                   /locus_tag="ZYRO0G06798g"
FT                   /old_locus_tag="ZYRO-ORF1360"
FT   CDS_pept        544095..546728
FT                   /locus_tag="ZYRO0G06798g"
FT                   /old_locus_tag="ZYRO-ORF1360"
FT                   /product="ZYRO0G06798p"
FT                   /note="some similarities with uniprot|P32571 Saccharomyces
FT                   cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
FT                   recycling ubiquitin from proteasome-bound ubiquitinated
FT                   intermediates acts at the late endosome/prevacuolar
FT                   compartment to recover ubiquitin from ubiquitinated
FT                   membrane proteins en route to the vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29358"
FT                   /db_xref="GOA:C5DZS4"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZS4"
FT                   /protein_id="CAR29358.1"
FT                   /translation="MSSSKLRCKSISKLSNVAEQFMIQDSRCGPGARVMTLLQVCLDTL
FT                   EAYKDEYKKLKRNDEVSQEQIYHIYESAYVYYKIVHSLVLNRIPNLNEFHQVKRRSNTS
FT                   DKKLMEIYNMLVKSLLYDEKISGVKTFIKEHSSDIDEISSDKELKTGGFISAKELEFLL
FT                   KSDDRNILLVDVRQRSEFEETHIKASNVICIEPISFKSSYTDLELEKKSMITSPNVEID
FT                   IFKRRNEFTFVILYTDGNKENGHHNFYIQQEMVLLDLLINRSFAKPLHKDVKILVLEAG
FT                   ISSWKFHGGSCSSSENFQGNQDSGAIYINGNTSGLKLQQLPKLTPNISSSMDSSMKDMM
FT                   RSTSQDPSNAGFNLPIQQRPPGSANLINPSPSVSPSQLPLGSPPLSHHPDMKFAKYPTT
FT                   PQLADKDNANDSNGTANGTANGGSSAGNGLPTFTNVSPINSRAVAPARRTIASPNPPSI
FT                   LVGSSATNGTSANTSTNQPLSKPPTQPLPTLPQLPTRSSNSQSSLTQTKQYDLDFTVGL
FT                   ENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQMH
FT                   QSAAFKKSDKNKAVRPYEFKMACGSINSLFRESGQQDSQEFCQFLLDGLHEDLNQCGGN
FT                   PPLKELSEEAEKMRERLSMRIASSIEWERYLTRDFSVIVDLFQGQYASQLRCKVCNHTS
FT                   TTYQPFSILAAPVPHAKSCYLLDCFKEFTKLEQLEKDEEWLCPYCKKKQPSTKKLTITR
FT                   LPRNLIIHLKRFDNLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPGVTDELPSRGQVAP
FT                   FKYKLYAVASHSGSLYGGHYTAYVDKGLNKGWYYFDDTGYRPMRTPTECITSNAYVLFY
FT                   HRVYGV"
FT   gene            complement(<546927..>547832)
FT                   /locus_tag="ZYRO0G06820g"
FT                   /old_locus_tag="ZYRO-ORF1358"
FT   CDS_pept        complement(546927..547832)
FT                   /locus_tag="ZYRO0G06820g"
FT                   /old_locus_tag="ZYRO-ORF1358"
FT                   /product="ZYRO0G06820p"
FT                   /note="similar to uniprot|P54858 Saccharomyces cerevisiae
FT                   YDR068W DOS2 Protein of unknown function green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29359"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="InterPro:IPR035925"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZS5"
FT                   /protein_id="CAR29359.1"
FT                   /translation="MEFFYEEQALANDPHKTEDHDEKTEKVFNKLEDEVSKRYDETAKA
FT                   FKGFVAEAEDGVKLNLPLDPAVSEKTQRYLGQLDSNLQNVEKFAQGYWTKVSNPGFWSN
FT                   VTNNLGNKFEQIVQLGEERGEDMDKGTDKESSKTVVGGNRTETELKTLSTDESLYLNNK
FT                   LSLPEDFDADSKTQEISQILEKDMDLANLMNGIVPQEISYKDFWNIYFTQKQRILEMET
FT                   TRRKILESKETNKEEEIAWDEEEDDNDKQDEEPVIIKKEDTADNDNIKKEKQTSNEESK
FT                   TGKVGANANENDDDDDDDWE"
FT   gene            <548056..>548727
FT                   /locus_tag="ZYRO0G06842g"
FT                   /old_locus_tag="ZYRO-ORF1357"
FT   CDS_pept        548056..548727
FT                   /locus_tag="ZYRO0G06842g"
FT                   /old_locus_tag="ZYRO-ORF1357"
FT                   /product="ZYRO0G06842p"
FT                   /note="similar to uniprot|Q6Q559 Saccharomyces cerevisiae
FT                   YDR067C which is a model system for studying replication of
FT                   positive-strand RNA viruses in their natural hosts"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29360"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZS6"
FT                   /protein_id="CAR29360.1"
FT                   /translation="MTSLVAPLQFNIVQFDFYRGSYPREINLPFLKNLRLKYILSLTPE
FT                   PLTNDPVMAKFCDENGIENIHIQCCKKKENKDKDKDKDKSTPKVKKKKKPVPIEYSVVI
FT                   ECVKFLIDRRHYPCYMHCTNGELVTSLVVACLRKFSYWSTVSILNEFLAYNSSINIHER
FT                   NFIEQFHSEIEIDNLNLKDKVPWISLQHVGWNKEDKVQNAEITRINSVPGMLPKLKFHS
FT                   L"
FT   gene            complement(<548758..>550014)
FT                   /locus_tag="ZYRO0G06864g"
FT                   /old_locus_tag="ZYRO-ORF1356"
FT   CDS_pept        complement(548758..550014)
FT                   /locus_tag="ZYRO0G06864g"
FT                   /old_locus_tag="ZYRO-ORF1356"
FT                   /product="ZYRO0G06864p"
FT                   /note="similar to uniprot|P40087 Saccharomyces cerevisiae
FT                   YER143W DDI1 DNA damage-inducible v-SNARE binding protein
FT                   contains a ubiquitin-associated (UBA) domain may act as a
FT                   negative regulator of constitutive exocytosis may play a
FT                   role in S-phase checkpoint control"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29361"
FT                   /db_xref="GOA:C5DZS7"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019103"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZS7"
FT                   /protein_id="CAR29361.1"
FT                   /translation="MNLTISNETNEEVYGPLEVSDDMTLPDLVALIELECGFDRSKHDL
FT                   YHSVTLLDPNDTKSLTAIGMGDNELLLIRNKVTASAAGAGATNADSMSDDAFVEQFRQE
FT                   LLRNQPLRQQLSWQIPEIDRMIEDEQLFRQRLGPLILQRRYGFGADSGPQNPFGIPQEE
FT                   YARLMNDPDDPSNQQKIAELINQQEIDEQMRNALEYTPEMFTTVHMLFIHLEINGHPVK
FT                   AFVDTGAQATIMSTKLAERTGLARLIDRRFVGEARGVGTGKIIGRIHQAQVRIETQFIP
FT                   CSFTVLDTEVDLLLGLDMLKRHQALIDLGKDSLKIAGVETRFLGESEIPKAFTAQAPEA
FT                   HQQKTEQGPGQTLGATPGGSAPTPAAPRPSAARANRPKSHDESNIKQLTDLGFSRSEAI
FT                   NALDQTDGNAELAASLLFG"
FT   gene            <550132..>551004
FT                   /locus_tag="ZYRO0G06886g"
FT                   /old_locus_tag="ZYRO-ORF1354"
FT   CDS_pept        550132..551004
FT                   /locus_tag="ZYRO0G06886g"
FT                   /old_locus_tag="ZYRO-ORF1354"
FT                   /product="ZYRO0G06886p"
FT                   /note="similar to uniprot|P22134 Saccharomyces cerevisiae
FT                   YER142C MAG1 3-methyl-adenine DNA glycosylase involved in
FT                   protecting DNA against alkylating agents initiates base
FT                   excision repair by removing damaged bases to create abasic
FT                   sites that are subsequently repaired"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29362"
FT                   /db_xref="GOA:C5DZS8"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZS8"
FT                   /protein_id="CAR29362.1"
FT                   /translation="MKRPLETDGYDENDDEKEISGGIVASVIPDEFLEKHSSEFHKACR
FT                   HIMRIDKSLVEIILKGDFPLFLKDKREVDFQFYYDKLASAIISQQISGIAAKSIKKRLI
FT                   DYFGGKFPAFGELHDELVDPIKRQKVQACGFSARKMEYLESLTNYFCEKENSIKDLFAN
FT                   GTDDEIVEQLTKNIKGIGPWSSKMFLLTGLSRMDVFAPDDLGIARGFSKYLSDKPLLVE
FT                   ELKRNRVAAKRSKIKHKKLNWVIYDDDLMEKFAAQFSPYRSVLMFILWRMAATNVEAMA
FT                   NNEKEFVSN"
FT   gene            complement(<551125..>552594)
FT                   /locus_tag="ZYRO0G06908g"
FT                   /old_locus_tag="ZYRO-ORF1353"
FT   CDS_pept        complement(551125..552594)
FT                   /locus_tag="ZYRO0G06908g"
FT                   /old_locus_tag="ZYRO-ORF1353"
FT                   /product="ZYRO0G06908p"
FT                   /note="similar to uniprot|P40086 Saccharomyces cerevisiae
FT                   YER141W COX15 Protein required for the hydroxylation of
FT                   heme O to form heme A which is an essential prosthetic
FT                   group for cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06908g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29363"
FT                   /db_xref="GOA:C5DZS9"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZS9"
FT                   /protein_id="CAR29363.1"
FT                   /translation="MLLRSVLGRIGPKFPSCRPLLANSRFNFSRNWSSLRSYSNFNAIK
FT                   LDSNGFSRGFFSSTRPLNSSTASQEAIPSSIQPPKRLINSSKWVGYWLIGTSGLVFGIV
FT                   VLGGLTRLTESGLSITEWRPVTGTLPPMSQEEWEEEFAKYKESPEFKQINSSIDLDEFK
FT                   FIFFMEWIHRLWGRAIGAVFVLPAAYFALARKTSARVNRRLFGLAFLLGFQGFIGWWMV
FT                   KSGLDQDDLDERKSKPTVSPYRLATHLGCAFLLYLGMIWTGLEVLREKNFVKDPAKALE
FT                   TFKTLDNPLLRPLRRMSLGILALTFCTTMSGALVAGLDAGWIYNTFPKMGENWIPPKRE
FT                   LMDANFAHKEDKSDLWWRNLLENPTTVQLNHRLFGIATFGAVFALHMYGVKKKHIVPKA
FT                   ADRTLKAMMGLVTLQVGLGITTLLWLVPIPLASAHQAGALAVFTSAILLAAQLRKPRIP
FT                   MKLLINGLHMQELRKGGSKILAEAAKQPKLK"
FT   gene            complement(<552837..>554471)
FT                   /locus_tag="ZYRO0G06930g"
FT                   /old_locus_tag="ZYRO-ORF1351"
FT   CDS_pept        complement(552837..554471)
FT                   /locus_tag="ZYRO0G06930g"
FT                   /old_locus_tag="ZYRO-ORF1351"
FT                   /product="ZYRO0G06930p"
FT                   /note="similar to uniprot|P40085 Saccharomyces cerevisiae
FT                   YER140W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29364"
FT                   /db_xref="GOA:C5DZT0"
FT                   /db_xref="InterPro:IPR008010"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZT0"
FT                   /protein_id="CAR29364.1"
FT                   /translation="MDSRHGRQDSGTNKRSEAANKPPPIITTRSRALDRYLSLQTHIYR
FT                   EVVHAVEENGGDDDQRAGDLEDDYELEQLLNMVRIPPSLEKFMIWTLLACSDCFLHYFT
FT                   ITPLRVATGFIAKYWRGKNRRSSEMYNDRCMVCLILIAAFVLNSLDTSKAYHRIKRQSS
FT                   VKLYMLFSVLEMANKMLASMGQSLFSVLFSRKNSQRVLSKRLLMQVLCLVYLISHGYVM
FT                   VYQIVALNVAVNSYSNALLTLLLSMQFAEIKASLFKRIDKEGLFQISIADVVERYQLVL
FT                   LLLVIAIRNMIAKSKSQSSIIPNSWTLHSTSSVITGILCGPMVNVIGSELVVDWVKHAY
FT                   ITKFNRIRPKIYDKFLLIVCKDHSTSLLKFRDRLGLPIPALVVSFVVMIRPSFTQALNF
FT                   SSPLRCIMATSTLAIGFAILVVFKIGLHMLLIKWGQFILDGRQLNTAVTENEYVPGFLS
FT                   DGLGRVDNKSRSIIHIRDFNVEPDSPSADENICNGKNVELSGASSQNDFSNDIPPGPND
FT                   LRQHKNSKNPRSLENVARYKMVSKQIW"
FT   gene            <554642..>555331
FT                   /locus_tag="ZYRO0G06952g"
FT                   /old_locus_tag="ZYRO-ORF1349"
FT   CDS_pept        554642..555331
FT                   /locus_tag="ZYRO0G06952g"
FT                   /old_locus_tag="ZYRO-ORF1349"
FT                   /product="ZYRO0G06952p"
FT                   /note="similar to uniprot|P40084 Saccharomyces cerevisiae
FT                   YER139C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29365"
FT                   /db_xref="GOA:C5DZT1"
FT                   /db_xref="InterPro:IPR007308"
FT                   /db_xref="InterPro:IPR038534"
FT                   /db_xref="InterPro:IPR039693"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZT1"
FT                   /protein_id="CAR29365.1"
FT                   /translation="MTTVKSVQEEILKPLQRHKQLTVKEAEEISLGLIDTLCDSYCQDE
FT                   ATLQYLSMFFTPQLYQDLLDERNLNKWCGYPMCSRSPERIRDPFEVDDNTKRFLWENNP
FT                   YAYLSIYCSKFHFRCSQFYQVQLSDESLFARTGIHLINQSSSELERLNEKYGVTLFEQL
FT                   LREKASEDDMKSLVAGLRRLGIKNDNDNGTEKGDDQFETDLSKWLSDIKIVEHEEPELL
FT                   GDLEKDG"
FT   gene            complement(<555376..>556491)
FT                   /locus_tag="ZYRO0G06974g"
FT                   /old_locus_tag="ZYRO-ORF1348"
FT   CDS_pept        complement(555376..556491)
FT                   /locus_tag="ZYRO0G06974g"
FT                   /old_locus_tag="ZYRO-ORF1348"
FT                   /product="ZYRO0G06974p"
FT                   /note="similar to uniprot|Q6Q5U4 Saccharomyces cerevisiae
FT                   YDR065W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29366"
FT                   /db_xref="GOA:C5DZT2"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DZT2"
FT                   /protein_id="CAR29366.1"
FT                   /translation="MVQNFIHLPEHRQCVLHLYRHTLRNSKQCCHSQHLINRIKKITRQ
FT                   TIVKHRYDKSSWSVHFYLQKLYELNHLLIQRDVKTVWNLLTDVSKSKSKSKSKKSSTRS
FT                   SRILKALQDIHQLKQDKGLQDPQIVREKLILNNYIKREQARNHLPRFIPEEYKTKLLLP
FT                   LALHTVAMARLNSIHGKLVEGPPKVFLTHTTPMGHRIWFVRSAFNKKKRQSKTLGILIR
FT                   REKNEGHKRWDYLRQCKSNAYWAQQEANWEQLIENKIVPQFDLNRYLDSQSIGKKKIEC
FT                   PPQLAHWLEPIGYSIQKLNQINADKAAYFRNYKNRVLLNGGQALYFENKSITMYQRRVK
FT                   RFQQMVQNDLPYVVPFFPGRDLLSTLTKYRF"
FT   gene            <558826..>558898
FT                   /locus_tag="ZYRO0G06996r"
FT                   /old_locus_tag="Zyro0G.tAla.TGC.16"
FT   tRNA            558826..558898
FT                   /locus_tag="ZYRO0G06996r"
FT                   /old_locus_tag="Zyro0G.tAla.TGC.16"
FT                   /note="tRNA-Ala (TGC) cove score=80.16"
FT   gene            complement(<559273..>560025)
FT                   /locus_tag="ZYRO0G07018g"
FT                   /old_locus_tag="ZYRO-ORF1343"
FT   CDS_pept        complement(559273..560025)
FT                   /locus_tag="ZYRO0G07018g"
FT                   /old_locus_tag="ZYRO-ORF1343"
FT                   /product="ZYRO0G07018p"
FT                   /note="similar to uniprot|P13856 Saccharomyces cerevisiae
FT                   YGR152C RSR1 GTP-binding protein of the ras superfamily
FT                   required for bud site selection, morphological changes in
FT                   response to mating pheromone, and efficient cell fusion;
FT                   localized to the plasma membrane; significantly similar to
FT                   mammalian Rap GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29367"
FT                   /db_xref="GOA:C5DZT3"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZT3"
FT                   /protein_id="CAR29367.1"
FT                   /translation="MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIE
FT                   IDNKVFDLEILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELLDLREQVLRIK
FT                   DVSRVPMVLVGNKADLGDERVVSVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVR
FT                   QIMRNELEAVNNNPKGTKGRAVTPAAATNVKRGGATPVHQVKAPTSKSRPNAQHRAHQR
FT                   QQSKAAANGSTGKDQSSKKKQKDKCVIS"
FT   gene            <560215..>560796
FT                   /locus_tag="ZYRO0G07040g"
FT                   /old_locus_tag="ZYRO-ORF1342"
FT   CDS_pept        560215..560796
FT                   /locus_tag="ZYRO0G07040g"
FT                   /old_locus_tag="ZYRO-ORF1342"
FT                   /product="ZYRO0G07040p"
FT                   /note="similar to gnl|GLV|KLLA0C12023g Kluyveromyces lactis
FT                   KLLA0C12023g and some similarites with YGL105W
FT                   uniprot|P46672 Saccharomyces cerevisiae YGL105W ARC1
FT                   Protein that binds tRNA and methionyl- and glutamyl-tRNA
FT                   synthetases (Mes1p and Gus1p) delivering tRNA to them
FT                   stimulating catalysis and ensuring their localization to
FT                   the cytoplasm also binds quadruplex nucleic acids"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29368"
FT                   /db_xref="GOA:C5DZT4"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZT4"
FT                   /protein_id="CAR29368.1"
FT                   /translation="MARRFLNVRSNLLTGLTIARRYHFNLVNLKVGITREVALHPHSDK
FT                   LYVSQIQLACNETKQVCSGLRGIIPKESFENKLVVVVDNMKKCKLRREVSEAMVLCGQG
FT                   SEGDVQLCRPANDSETLLGRNILLEGPGESELPPTRKIKPKEWESISSRLYVGDQNVVV
FT                   YRQEDGVEKRLLVDGVPIVVDDLPRGSAVR"
FT   gene            complement(<560961..>561080)
FT                   /locus_tag="ZYRO0G07062r"
FT                   /old_locus_tag="Zyro0G.tLeu.CAA.55"
FT   tRNA            complement(join(560961..561004,561043..561080))
FT                   /locus_tag="ZYRO0G07062r"
FT                   /old_locus_tag="Zyro0G.tLeu.CAA.55"
FT                   /note="tRNA-Leu (CAA) cove"
FT   gene            complement(<561185..>561910)
FT                   /locus_tag="ZYRO0G07084g"
FT                   /old_locus_tag="ZYRO-ORF1338"
FT   CDS_pept        complement(561185..561910)
FT                   /locus_tag="ZYRO0G07084g"
FT                   /old_locus_tag="ZYRO-ORF1338"
FT                   /product="ZYRO0G07084p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29369"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR037047"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZT5"
FT                   /protein_id="CAR29369.1"
FT                   /translation="MSHHCEDEHFDHGHGHGHDHTAPIPTNPNQSLFTKIDTSKVRCLN
FT                   AVARGVPAHTELFRVFLKDQDEKFNCSRYLESDADCQLVVHIPFVGNCKLFSVILRTSD
FT                   SDDGLSSPKTIKLFKNYNRSIDFDTLGSSKADLAIQHPNNVGVTDSGVNEDENTFVEHY
FT                   LPRRLFQNCSSLTLFLEDNWTGDEDDLCRLYYLEIRGEFTGKIAPHGGAPMTTVYESAP
FT                   NPVDHQKLESEMDEVEMGL"
FT   gene            <562168..>563190
FT                   /locus_tag="ZYRO0G07106g"
FT                   /old_locus_tag="ZYRO-ORF1337"
FT   CDS_pept        562168..563190
FT                   /locus_tag="ZYRO0G07106g"
FT                   /old_locus_tag="ZYRO-ORF1337"
FT                   /product="ZYRO0G07106p"
FT                   /note="highly similar to uniprot|P05373 Saccharomyces
FT                   cerevisiae YGL040C HEM2 Delta-aminolevulinate dehydratase a
FT                   homo-octameric enzyme catalyzes the conversion of delta-
FT                   aminolevulinic acid to porphobilinogen the second step in
FT                   the heme biosynthetic pathway localizes to both the
FT                   cytoplasm and nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29370"
FT                   /db_xref="GOA:C5DZT6"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZT6"
FT                   /protein_id="CAR29370.1"
FT                   /translation="MHQAEFLDVEPSSISSILQGGYNHPLLREWQSERQLTKNMFIFPL
FT                   FISDDPNDDSEIDSLPNIRRFGVKKLVPYLKPLVAKGLRSVIIFGVPLKKENKDPVGTA
FT                   ADDPEGPVIQGIKTLKREFPDLYIMCDVCLCEYTSHGHCGVLYEDGTINRERSVARLAA
FT                   VAVNYAKAGAHSVAPSDMIDGRIRDIKRGLINAGLAHKTFVMSYSAKFSGNLYGPFRDA
FT                   ACSAPSSGDRKCYQLPPGGKGLARRALKRDQEEGADGIIVKPSTFYLDIMRDASEICND
FT                   LPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIISYLTPEFLDWLNN
FT                   "
FT   gene            <563726..>565228
FT                   /locus_tag="ZYRO0G07128g"
FT                   /old_locus_tag="ZYRO-ORF1334"
FT   CDS_pept        563726..565228
FT                   /locus_tag="ZYRO0G07128g"
FT                   /old_locus_tag="ZYRO-ORF1334"
FT                   /product="ZYRO0G07128p"
FT                   /note="highly similar to uniprot|P32582 Saccharomyces
FT                   cerevisiae YGR155W CYS4 Cystathionine beta-synthase
FT                   catalyzes the synthesis of cystathionine from serine and
FT                   homocysteine the first committed step in cysteine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29371"
FT                   /db_xref="GOA:C5DZT7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005857"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZT7"
FT                   /protein_id="CAR29371.1"
FT                   /translation="MPVDTRTDVIDLVGNTPLIELKTLPKALGIKPKVYAKLELYNPGG
FT                   SIKDRIAKSMIEYAESTGEIHPDRTTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMS
FT                   NEKVSVLKALGAEIVRTPTEAAWDSPESHIGVAQRLEKEIPGAVILDQYSNPRNPEAHY
FT                   YGTAKEIQEQLQHLKEFKNLRAVIAGAGTGGTITGISRYLKEQDEKIDIVGADPFGSIL
FT                   AQPESLNKTDVSGYKVEGIGYDFVPQVLNRKEVDTWYKTDDKASFIYARQLISNEGVLV
FT                   GGSSGSAFSALVKYNNDHPELTEDDVLVAVFPDSIRSYLTKFVDDEWLKRNDLWSDDVI
FT                   ARVGGKGSSKYDRKDPFHGATVQDLKLKPVVSVKESAVVADVIQILRENAFDQLPVLTE
FT                   DGRLTGMVTLSQLLKKLSNGSATKEDKMKSLYIDFRRLKNFDDVSSYNENKTGKKKFVQ
FT                   FTKASKLADLNGFFERNSSAVITEGSKPIHIVTKIDLLDYLI"
FT   gene            complement(<565293..>565727)
FT                   /locus_tag="ZYRO0G07150g"
FT                   /old_locus_tag="ZYRO-ORF1332"
FT   CDS_pept        complement(565293..565727)
FT                   /locus_tag="ZYRO0G07150g"
FT                   /old_locus_tag="ZYRO-ORF1332"
FT                   /product="ZYRO0G07150p"
FT                   /note="similar to uniprot|P0C5N3 Saccharomyces cerevisiae
FT                   YGL041W-A Identified by expression profiling and mass
FT                   spectrometry"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29372"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZT8"
FT                   /protein_id="CAR29372.1"
FT                   /translation="MFRGLVFARSIAPVSLRTFQRPLVGLRPTTVSQRWYAQSWDGKQP
FT                   NDQIEAHLKVQKLMDDIHKHPRVAEKLENVSKIMLDKGLANGDESKPPGPWQMVKILMD
FT                   KDLKNAMAEFKQELQDSGIELGPDQLGPLMTVLGIEKKTK"
FT   gene            complement(<565863..>567566)
FT                   /locus_tag="ZYRO0G07172g"
FT                   /old_locus_tag="ZYRO-ORF1331"
FT   CDS_pept        complement(565863..567566)
FT                   /locus_tag="ZYRO0G07172g"
FT                   /old_locus_tag="ZYRO-ORF1331"
FT                   /product="ZYRO0G07172p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29373"
FT                   /db_xref="GOA:C5DZT9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZT9"
FT                   /protein_id="CAR29373.1"
FT                   /translation="MTFEIDSTEGSTKNRIGYTVNGPRNSKDDWKDGTDHKIVVVDTNN
FT                   SVSDDPESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINY
FT                   VIMGGVIYLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDL
FT                   TALQLVLDYWKTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIF
FT                   FIMAIIANCGHNQQHEYIGFKNWSHGDAPFVQGFKGFVTIFVTSSFSYGGTETVTLTGG
FT                   EAKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNLKTKSVLTSPFTIVFQMA
FT                   GTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNKAPYVA
FT                   VITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQGKVH
FT                   ELKFRNWTYPYGPWFCIIFISLIILVQGWSAFDPWSTSSFFSFYLELIVFPACWIFWWV
FT                   IKRDRFKKAKDMDFITDKYVQSEEESLLNERLDNLKGLPRVRQAISDYFL"
FT   gene            complement(<567844..>568740)
FT                   /locus_tag="ZYRO0G07194g"
FT                   /old_locus_tag="ZYRO-ORF1329"
FT   CDS_pept        complement(567844..568740)
FT                   /locus_tag="ZYRO0G07194g"
FT                   /old_locus_tag="ZYRO-ORF1329"
FT                   /product="ZYRO0G07194p"
FT                   /note="highly similar to gnl|GLV|CAGL0D06160g Candida
FT                   glabrata CAGL0D06160g and similar to uniprot|P07273 YGL043W
FT                   Saccharomyces cerevisiae DST1 General transcription
FT                   elongation factor TFIIS"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29374"
FT                   /db_xref="GOA:C5DZU0"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003617"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR006289"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="InterPro:IPR035100"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="InterPro:IPR036575"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZU0"
FT                   /protein_id="CAR29374.1"
FT                   /translation="MDSREVSTHVKNLEKFKTNDETVLDILKALEKEVVPTEKLLRETK
FT                   VGVEVNKFKKSQNAEIVKLVKRMISSWKETINKSKKAKIQPQSQQQQPSTSQNPSTQQL
FT                   SPTEPRKQDKFVSSKPRNSKNDGVDTNIYNHKLRDMVIRALYDALAKESEHPPSSVLDS
FT                   AKSIEEEMNKLNNCDENEKAYKDKYRIIYSNIISKNNPDLKHKITNGDVTSQYLVSCDP
FT                   KELAPEHLKKKLEEIAKQNLHNAQGATIQRSITDRFTCGKCKEKKVSYYQLQTRSADEP
FT                   LTTFCTCEACGNRWKFS"
FT   gene            <568877..>569692
FT                   /locus_tag="ZYRO0G07216g"
FT                   /old_locus_tag="ZYRO-ORF1327"
FT   CDS_pept        568877..569692
FT                   /locus_tag="ZYRO0G07216g"
FT                   /old_locus_tag="ZYRO-ORF1327"
FT                   /product="ZYRO0G07216p"
FT                   /note="similar to uniprot|P25299 Saccharomyces cerevisiae
FT                   YGL044C RNA15 Cleavage and polyadenylation factor I (CF I)
FT                   component involved in cleavage and polyadenylation of mRNA
FT                   3' ends interacts with the A-rich polyadenylation signal in
FT                   complex with Rna14p and Hrp1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07216g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29375"
FT                   /db_xref="GOA:C5DZU1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR025742"
FT                   /db_xref="InterPro:IPR026896"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR038192"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZU1"
FT                   /protein_id="CAR29375.1"
FT                   /translation="MNRTSGGQHLPSRVVYLGSIPYDQTEEQILDLCSNVGPVNNLKMM
FT                   FDPQTGKSKGYAFVEYKDLESSASAVRNLNGYQFGSRLLKCGYATGTDMENNDNNNNSN
FT                   NNNNNSNNMEDGTSLKFARLPAGIDVNINMTTPAMMISSELAKRNAEEQLGLLRNFQDW
FT                   TRRNPEDAVELLRECPQLSFVIAEILLTNGISNVDDLTQLAVQRNDTPETGANGTDAPQ
FT                   DPNIQSRQRELLRQVLQLSDSEIAVLPDDEKMSLWDLKQRATRGEFGLI"
FT   gene            <569912..>571189
FT                   /locus_tag="ZYRO0G07238g"
FT                   /old_locus_tag="ZYRO-ORF1325"
FT   CDS_pept        569912..571189
FT                   /locus_tag="ZYRO0G07238g"
FT                   /old_locus_tag="ZYRO-ORF1325"
FT                   /product="ZYRO0G07238p"
FT                   /note="some similarities with uniprot|P39927 Saccharomyces
FT                   cerevisiae YGR156W PTI1 Pta1p Interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29376"
FT                   /db_xref="GOA:C5DZU2"
FT                   /db_xref="InterPro:IPR025742"
FT                   /db_xref="InterPro:IPR026896"
FT                   /db_xref="InterPro:IPR038192"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZU2"
FT                   /protein_id="CAR29376.1"
FT                   /translation="MSDPRRRTSRHVLTPDSLSSAIQLTNMPADWSQDTASSVVAGSGP
FT                   IVDITTKTDPRTGRLSAAIFDYKTSKDCRRAFEILSRIDSLPCNLERIIPQNYKNHASM
FT                   ASKDELQLNRDSFPWNCGLDLPFEMISEVPLPRKPSQTPAPPVANNNSNTNGNSSNNKS
FT                   PTNNNIAFPDILRKASQHLPQLQPNILSTPDPVSSNLSKIPPLQLIEIISNLKILANQD
FT                   SMKRSQLEAFLKTNLNISISVTQALLEMGFINYNAVTQVLKRQQGGNGFSSSVNSSSNT
FT                   PLNTNIPMPMPMPMPPFVPPQQPLPPPPQQQQQQPGQGPPPPFGFMPPPIPFMPPTPVM
FT                   GTTPPPMMPMQQMPPAPAPAPPAPVPIPPVPTPSQRRINMAKLQALPQNQRDMIKQVLS
FT                   FTDEQIRVLPQDQKSLVENLKKEYIL"
FT   gene            <571506..>574019
FT                   /locus_tag="ZYRO0G07260g"
FT                   /old_locus_tag="ZYRO-ORF1323"
FT   CDS_pept        571506..574019
FT                   /locus_tag="ZYRO0G07260g"
FT                   /old_locus_tag="ZYRO-ORF1323"
FT                   /product="ZYRO0G07260p"
FT                   /note="similar to uniprot|P05374 Saccharomyces cerevisiae
FT                   YGR157W CHO2 First step in the methylation pathway for
FT                   phosphatidylcholine biosynthesis Phosphatidyl-ethanolamine
FT                   N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29377"
FT                   /db_xref="GOA:C5DZU3"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="InterPro:IPR016219"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DZU3"
FT                   /protein_id="CAR29377.1"
FT                   /translation="MASDVVARTRSSGVTFTPPTTHDMVRSLFDPTVRKSFLEICITLA
FT                   LLSDFVFCYWGLQRFGLTSMKKAFLAQYLFWRLCYNLGIGVALHLQSRYETWTNYAKRN
FT                   HVFTKGNHTPLARFCQFELKTKMSEGYDMYSQPEELNVWLLFRQFVDLILMQDFCTYMI
FT                   YVYLSLPAQWSAMLNWRTGLGVSMILFNIWVKVDAHRVVKDYAWYWGDFFFLQESELVF
FT                   DGVFNISPHPMYSIGYMGYYGLSLICGNYHVLLVSISGHLLQFLFLKYVESPHMEITYG
FT                   SESSDDNSQINSCIDDLIATKNYDYSRPLINSGFWVNNFDKLRFTDYFTVGTSLALICW
FT                   LFLERPSVKLLFNLTFFTKFVTSIVVCSILYLQSSQKWFTKLYLKNGYTQVYSYQQWQF
FT                   IYNFSSCLTYTLLFIQTLAKLFDDNTYIEYTQFIFGLLLCAVQTWCNAEIRSAISDFGW
FT                   FYGDFFLSNYIPTKSLTSHGIYRYLNNPETILGVAGVWGTVLMTDFSWENIALACLWSG
FT                   CNFIIVKFIEQPHMAKLYGDNTRVGGIEKTLQGLGPWRRMSELMDRVENVITKSLTNQQ
FT                   EPFDKGLEKPRKDIKSVNNHLRVRTNSQEWEEAVEDAIGNVTSKLYPDCKFEIEDLGEK
FT                   SFILPRPITIRWQVPIELFDEDAWIGLYNIIQTRSNSKTTKVSSSGHWSAVSPNAYKGY
FT                   ESNNLAVTEFEKNDTVACGKVTFDSSLLHFKPGIYEFRYHAGNSHNVLCTSKPFELLLP
FT                   NLDMETPEILNKQLLQLLTSVSAVKNGKFDSHGNRYFTTRIFQRLVKDSLGVELSTDYI
FT                   NRVNGDIGAISQRICHIKKVLDDLE"
FT   gene            complement(<574134..>574862)
FT                   /locus_tag="ZYRO0G07282g"
FT                   /old_locus_tag="ZYRO-ORF1322"
FT   CDS_pept        complement(574134..574862)
FT                   /locus_tag="ZYRO0G07282g"
FT                   /old_locus_tag="ZYRO-ORF1322"
FT                   /product="ZYRO0G07282p"
FT                   /note="similar to uniprot|P48240 Saccharomyces cerevisiae
FT                   YGR158C MTR3 3'5' exoribonuclease exosome subunit nucleolar
FT                   protein involved in export of mRNA and ribosomal subunits
FT                   homologous to the E. coli exonuclease RNase PH"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07282g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29378"
FT                   /db_xref="GOA:C5DZU4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZU4"
FT                   /protein_id="CAR29378.1"
FT                   /translation="MNVQDRRRLLGPANAKPIAFSVPPKDVEESSKEIGNEHLISMHTG
FT                   LIENCNGSSLVEVKDTSVLLHQSSLITSVYGPRALRGSFTSNASLSIQLENGSLEKYSN
FT                   SQLKEVSNFLTGIFNSVVNRSRYPKSGIDIFLYLTYDKDLNSDESKMGHLSSIIPYCIT
FT                   GITLALVDAGIEVLDMASAGVHDGNVFAFLKNGQEVAGFWKDDGKCENIMESLEPCRKE
FT                   YFSYRELMVRHLMEKQASKV"
FT   gene            complement(<575051..>576700)
FT                   /locus_tag="ZYRO0G07304g"
FT                   /old_locus_tag="ZYRO-ORF1321"
FT   CDS_pept        complement(575051..576700)
FT                   /locus_tag="ZYRO0G07304g"
FT                   /old_locus_tag="ZYRO-ORF1321"
FT                   /product="ZYRO0G07304p"
FT                   /note="similar to uniprot|P53180 Saccharomyces cerevisiae
FT                   YGL045W RIM8"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07304g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29379"
FT                   /db_xref="GOA:C5DZU5"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZU5"
FT                   /protein_id="CAR29379.1"
FT                   /translation="MSFLGLFKKDVHHSSSYGKKSSHIVPGGILQKNLVREFYIRLDDP
FT                   HRIWKPDEYISGETVLNIKKDVTNVAVRLKLVSQVKVKSSVGGTTLRTKVTDKLLEKTT
FT                   FLYGNESDCQLGAQKDATNGLTQGEHIFPFKLKIPNGKKVFSSIKFERGSITYYLQCSL
FT                   EAMGRGQVERPVSRCMHPFLVMVPLDVSNLPEPKTKTVVLQSTSPVRPSNNIGFDNGSS
FT                   NTKNTGNSNTSNNTNNSASSVSDKTVRISVDLSKAGYCIGEVIPVRVSLQHYKNFCHPA
FT                   GLIVTLARICRVGSGGNDEPMETFRKDICQTIRPIYVDPETHACSVTAYLKVPVDTFST
FT                   FTSLQKFFTFQYYVEVMINLSQKNIILTESNRVVAGLHDGVKPGSSESLSGLEESLVGG
FT                   MPRRLMSMVSKSGSLNEENFDESNIIYKDMVNVERLKRMNNVTGMSIETVIGMTRSEQS
FT                   SPVLAEQSLQPVQIQPVQQPLPIAQSDLSPPFSDSQFLYSKPLIDEWLAPLDAYPPVPE
FT                   YTPNNDIKIIEDKRELEQEKLKQLESDPPDIY"
FT   gene            complement(<577044..>578450)
FT                   /locus_tag="ZYRO0G07326g"
FT                   /old_locus_tag="ZYRO-ORF1319"
FT   CDS_pept        complement(577044..578450)
FT                   /locus_tag="ZYRO0G07326g"
FT                   /old_locus_tag="ZYRO-ORF1319"
FT                   /product="ZYRO0G07326p"
FT                   /note="some similarities with uniprot|P27476 Saccharomyces
FT                   cerevisiae YGR159C NSR1 Nucleolar protein that binds
FT                   nuclear localization sequences required for pre-rRNA
FT                   processing and ribosome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29380"
FT                   /db_xref="GOA:C5DZU6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034272"
FT                   /db_xref="InterPro:IPR034276"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZU6"
FT                   /protein_id="CAR29380.1"
FT                   /translation="MASTSKASKKELKQKELKQKEEAKAAKAAKASKPSKSAKAAKTSK
FT                   STKSAKAAKVESESSDSSSGSDSDSESSSDDEDDKKSSSSSSSDESSSDDESEEEKSKK
FT                   KTSKKEESSSESDSDSDSESSSDESEEDKKESKKESSSDESSSDESEEDKKESKKESSS
FT                   DESSSDEEEDKKDSKKDSSSDESSSESSSDEEDSKSSSSSSSEEASKPSKRKAEVDEEQ
FT                   EESSKKAKLSGEPATIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGY
FT                   VDFTDKSYAEKAVKEMHGKELDGRPINCDMSTSKPTVNPREDRAKRFGDMPSEPSDTLF
FT                   LGNLSFNADRDQIYELFSPHGEVISVRIPTHPETEQPKGFGYVQYASVDSAQKALETLQ
FT                   GEYIDNRPVRLDFSTPKTGNGGGNRGAPRGGARGGGNRGGFRTGSGANSAPLGKGKNSA
FT                   PFKGSKKTFD"
FT   gene            complement(<578705..>579880)
FT                   /locus_tag="ZYRO0G07348g"
FT                   /old_locus_tag="ZYRO-ORF1315"
FT   CDS_pept        complement(578705..579880)
FT                   /locus_tag="ZYRO0G07348g"
FT                   /old_locus_tag="ZYRO-ORF1315"
FT                   /product="ZYRO0G07348p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07348g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29381"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZU7"
FT                   /protein_id="CAR29381.1"
FT                   /translation="MFKIAILLLLLNQVWATKTLSTTDISTSTVCPCSAARCTECEQNT
FT                   SGGTVTQSASTVTITTNDIESASTITKDITTTTNITASGSTITEVSTVTVTASDTVSAL
FT                   TVTANGTTQDASTVTITASGTAPAVPASTITKEASTVTVTANSTVPAFHQEASTVTITA
FT                   NETAHPSTVTVTTNCTASTISQDASTVTLTANSTAPASTLDASTVTVTTNVTGPPSTIT
FT                   VTASGSLTIHVSEAPSTVVVTANGTASAFTVTETSTVTGTHTVPSSNATSTIAAAFQGP
FT                   TPSTVFQTSTMTVDGTFARSTPTAATPAPYTVTKTITAPCTASAGSVISELATTTTTEV
FT                   SKDSSLAATSHMTPSSGSTAPSAPPIASYSAAAQINRFPMLLGILPMIAVL"
FT   gene            complement(<580202..>580774)
FT                   /locus_tag="ZYRO0G07370g"
FT                   /old_locus_tag="ZYRO-ORF1314"
FT   CDS_pept        complement(580202..580774)
FT                   /locus_tag="ZYRO0G07370g"
FT                   /old_locus_tag="ZYRO-ORF1314"
FT                   /product="ZYRO0G07370p"
FT                   /note="some similarities with uniprot|P53289 Saccharomyces
FT                   cerevisiae YGR161C RTS3 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29382"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZU8"
FT                   /protein_id="CAR29382.1"
FT                   /translation="MSLSMEKKHLQPVLRSPHNNRKLSCEEIIDEMEKEQDAAVVRLLR
FT                   EVDRLKAENLQLRKQIHSNSFASSNGSGSGSSRQSSQFSNESPLGVDSEYHYMLPSHRS
FT                   SLARGTSLQGASTFHPIDTSIPTQTVQRKRGASITSPRTSMLSVDSSPVCNGEVVDPLH
FT                   DVPRPWSGAGGGSPAEAARRWQEYRIR"
FT   gene            complement(<581554..>583671)
FT                   /locus_tag="ZYRO0G07392g"
FT                   /old_locus_tag="ZYRO-ORF1311"
FT   CDS_pept        complement(581554..583671)
FT                   /locus_tag="ZYRO0G07392g"
FT                   /old_locus_tag="ZYRO-ORF1311"
FT                   /product="ZYRO0G07392p"
FT                   /note="similar to uniprot|P53746 Saccharomyces cerevisiae
FT                   YNR060W FRE4 Ferric reductase reduces a specific subset of
FT                   siderophore-bound iron prior to uptake by transporters
FT                   expression induced by low iron levels"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29383"
FT                   /db_xref="GOA:C5DZU9"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZU9"
FT                   /protein_id="CAR29383.1"
FT                   /translation="MMVLLSAMVFMWSISAALSLQHSAWERVSVLSCAINLTQIPWNFE
FT                   SEPGFYNKLCDYEPAFGSWSHCIHEQLLDVANESTFVKSLDYINQLCSLVDGDDRHGVT
FT                   LEKYYSSLHNASHYMRPVPSDPKFKAWYPVEIDSATRRQLNSAYYSFLINLDNSDKYAL
FT                   WLIWYFIIIMGVAALLMIPGVKPWLFKFTTVNKIRGDFILPTLTQTHAAYLPYKWATGL
FT                   VPTKFESLLVLGFFLLHGFLLFYNYKIDPYNMIFKSHQLQWLRQVADRSGILSFAHFPL
FT                   IVVFSTRNSILEHLTGFKYTTSIVLHKWVGRSMVIDAFIHGIAYILYAQETESIESLSQ
FT                   QDFWKIGVLAAYVAIFLCIFSMGFLRRSYYETFLYLHIVLALFFFYCCWAHVKRFGWEK
FT                   WIHVSIAFWILERLLRLKSILRFGIASAKLELVGPDLFKVLVPRPANWSCQPAQYVFLY
FT                   FLQPACICWQSHPFTFIDLGQEVLIVIRAKQGATQRVLTDLIHKGGRSQLKVLIEGPYG
FT                   ASSPLPRFQDTLLLCGGSGVPGPLAYALNMAQPLASAPQRQNLHIVIVNRGVDILEAYM
FT                   DPILRLKHLNVDLQIHITGSQTKQLTSGTPQQYGSTAVANPGWGSASKIQNLQEVISSA
FT                   RIHYGRPNVSEVIANIAGESRSLAICCCGPPAFVDLTRNYVAETIGTSVRNNRRNNNSS
FT                   MIEYFEEYQTW"
FT   gene            complement(<583978..>586101)
FT                   /locus_tag="ZYRO0G07414g"
FT                   /old_locus_tag="ZYRO-ORF1309"
FT   CDS_pept        complement(583978..586101)
FT                   /locus_tag="ZYRO0G07414g"
FT                   /old_locus_tag="ZYRO-ORF1309"
FT                   /product="ZYRO0G07414p"
FT                   /note="similar to uniprot|P38731 Saccharomyces cerevisiae
FT                   YHL040C ARN1 Transporter member of the ARN family of
FT                   transporters that specifically recognize siderophore-iron
FT                   chelates responsible for uptake of iron bound to ferrirubin
FT                   ferrirhodin and related siderophores"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07414g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29384"
FT                   /db_xref="GOA:C5DZV0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZV0"
FT                   /protein_id="CAR29384.1"
FT                   /translation="MENRSNSKISEPRFERQEVHVTDKEYNDVPPEFENVKYGQNAHQE
FT                   VMPVDSDGEKQKLRPSLNMHGLPDKLHVSKWLVIRQSELLAAEYDWWPFRILLLFCAFI
FT                   CGYGYGLDSNIRFIYTSYVTNSFSEHSLLSTVNVINAVISAASQIVYARLADVFGRLTL
FT                   FITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGYVGVVLVLLLILSDFSSLKWRLFYQ
FT                   FAPTWPFIINTWISGNITSRANPQENWSWDIGMWAFIFPLSCVPLICCMLHMWWKARRT
FT                   EEWKILNEEKTYFKTHGLVSFIKELFWKLDTIGTFIMTVSLGCILVPLTLAGGTSSKWD
FT                   DSQIIGPLVLGVVLLPMLIVYELKWAREPILPWKLIKDRAVWASMSISFLYDFIFYMAY
FT                   DYLYTVMIVAVDESVKSATRISSLSAFVSTVFSPFFALYITRVTRLKPYIIAGCGLWMV
FT                   AMGLLYHFRGGKSSHSGIIGGLCVWGVGTTMFTYPVNVSVQSATSHENMATVTSLNYTL
FT                   YRIGSAVGIAVSGCIWTQNLYHEIFKRVKDAKIASYAYEQPYNFIAEYTWGTPIRQQVV
FT                   EAYMHVQKLETLVGLVFCAPLLLFSLCLRDPELTDEIAHNDLGEGEYIARDKDYIFDWI
FT                   EDKCRKFVPGLHPKGRHPSFASQEAQEETRSIEEGQVPDDSSDVVMESGESNFKKLQGE
FT                   FHSRRVSSHEQNI"
FT   gene            <587527..>589464
FT                   /locus_tag="ZYRO0G07436g"
FT                   /old_locus_tag="ZYRO-ORF1305"
FT   CDS_pept        587527..589464
FT                   /locus_tag="ZYRO0G07436g"
FT                   /old_locus_tag="ZYRO-ORF1305"
FT                   /product="ZYRO0G07436p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29385"
FT                   /db_xref="GOA:C5DZV1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041805"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZV1"
FT                   /protein_id="CAR29385.1"
FT                   /translation="MILSRVITLGAIAATGAAFSQDYKADANEAFNELVPSNNQTAIDQ
FT                   LIHELREVSINDSRCQACLNRLEVGKKWAQENPGVIPVAWPQWCVRYKAGSPDSCTRNF
FT                   ARTTVERNAEGSNFVDMLTLIDPHGYDGQLYCQYLEEDSCPKPPTPNSSLSHLWPPKQP
FT                   KHHVAPEPGNETFNVLHISDFHVELDYTVGAESNCSATMCCTPHSQGKGGGGYLYKGHW
FT                   NSFYKDAHYENEFTYVKGAYYNVFQNSSISAPAPTFGHYHCDAPEILVNSSINSVVDYG
FT                   KKHNLSFEFAMFTGDLIDHDEQAWMNFDKSLASEEAGFRDLKSRLGDMPVYSTLGNHDS
FT                   YPYGEIAQEGHGFSNKYTWNNDLMAEMWKDYGWINETTSQFVRTHYTGFAVDTKVGLRI
FT                   VSLNSNCYYRKNHYAFWNATDPDGFGMWSFLISELVDAESKGQRVWIMTHIPPIVDGLP
FT                   LPSKIFYEIIERFSPYTIAGVFFGHTHLDQFNILYAGNNTKTIENVINHAWISQAVTPW
FT                   FNNNPSWRWYEIDKETFSVMNAYNYYAKLNETFDNEGKEPEWLFEYSCRDGYGIDWPKT
FT                   SPLNGTYWHLVSEKIRDSVEYRQIYENYATRFSPYVPDCSQNGKCLSDYCTLSSFQVDD
FT                   YDNCVSQLHT"
FT   gene            complement(<589686..>591635)
FT                   /locus_tag="ZYRO0G07458g"
FT                   /old_locus_tag="ZYRO-ORF1302"
FT   CDS_pept        complement(589686..591635)
FT                   /locus_tag="ZYRO0G07458g"
FT                   /old_locus_tag="ZYRO-ORF1302"
FT                   /product="ZYRO0G07458p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07458g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29386"
FT                   /db_xref="GOA:C5DZV2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZV2"
FT                   /protein_id="CAR29386.1"
FT                   /translation="MDESMGGTLEYRRDNKRHAKAWSLVIALMMVCSTLILYKFFSIQC
FT                   DDYMSSIRMSFSDKSAQKHDGDEIDTGNAWRLDTASNYSIDLDYWLKQEEPMERHYYFN
FT                   VSTVQEVHPDGVSRTLTVINGQYPGPLVEASSGDTVVIHVENHMDGDPLTIHCHGLLMK
FT                   DQAFNDGSSWINQCPIPAAGSYEYRIKLDDDQYGTYWYHSHYSTQYADGVFGPLVIHSK
FT                   KEYEDLDFSYDKELVVMVNDYYHDTSYSYMSTYMGSGNENTEPVPDNGLIQGQNHFEYV
FT                   DSQYLVPHGAEKKRFAHEVPHTVLDLDPNSIYRVRVINAGFFLPFEFGLEGHMLKVIEA
FT                   DGTLVEPIQVESLTLSVAQRYSFVLLPQDPDFNKKNYWMHAHFNQFCTKEENPNFNMDV
FT                   KAIVNYNDNSNSVEKTSWTYNGGDVLCRDFDQSKLKTLNKKVPSAHSDSNLPDVRVDID
FT                   ILWMIGAYQMARGYLNDKTYLPLQNGSTMYQLGFAPGANTVKDWNDNQLLTFSDNQYMI
FT                   NLNQRGQVVDLVINNYDDGAHPFHLHGHKFWVLAIGDSGYFQDEYYDTNDDEQAMNFDN
FT                   PIFRDTVNIPGFGWAVIRFVVDNPGVWPFHCHIGWHMEAGLLLQINALQEEYASWNHYP
FT                   QNWYSQCQYWQDKL"
FT   gene            <592050..>593285
FT                   /locus_tag="ZYRO0G07480g"
FT                   /old_locus_tag="ZYRO-ORF1301"
FT   CDS_pept        592050..593285
FT                   /locus_tag="ZYRO0G07480g"
FT                   /old_locus_tag="ZYRO-ORF1301"
FT                   /product="ZYRO0G07480p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29387"
FT                   /db_xref="GOA:C5DZV3"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZV3"
FT                   /protein_id="CAR29387.1"
FT                   /translation="MQFQFSALAFVALFLFPLGHCATRSFSSYNPDPTDVAKNAATANT
FT                   TQLTWNVRGRAIDRFVVIWLENTDYNKAAGHPDMKWLAKRGITLDNYWALTHPSQPNYV
FT                   ASVGGDYFALDHDEYVTVPKNVSTIADLLDSKGISWGEYLEDMPYSGYQGFEYLNQKTQ
FT                   ANDYVRKHNPLISYESVFLNETRLSLIKNFSQFERDLKDHKLPQYFHITPNMTNDGHDS
FT                   SIKTAAHWARSWLTPLLKNKHFMKNTLVLLTFDENEIYSTQNQVFTILLGGAVPDHLKG
FT                   TKDHTFYDHYSLLSSVEANWDLDNLGRNDVNANVFSTIANKTNITNRFVNTTYMVNNHT
FT                   YNGYFLNSSISLPAPNITAINRNGKPVLQKIKDTWKDVYSSQLSHSYFTPTTTTVSARL
FT                   TNLATVSASVSS"
FT   gene            <593385..>595073
FT                   /locus_tag="ZYRO0G07502g"
FT                   /old_locus_tag="ZYRO-ORF1300"
FT   CDS_pept        593385..595073
FT                   /locus_tag="ZYRO0G07502g"
FT                   /old_locus_tag="ZYRO-ORF1300"
FT                   /product="ZYRO0G07502p"
FT                   /note="similar to uniprot|P38732 Saccharomyces cerevisiae
FT                   YHL039W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29388"
FT                   /db_xref="GOA:C5DZV4"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZV4"
FT                   /protein_id="CAR29388.1"
FT                   /translation="MGKLEDCIQWAVKNGSIVDERIHFKQSSISGISAVVEGILATEEP
FT                   LIQIPSKLLITNEKAQESFQVDSDVIDKNAPNALVQLYVAKLKFAKGMPSIYQPYIDLL
FT                   PLKLEQPYFWDWKELQVIKGTDLYLVMKQRLPKLLEEWTTLLKKLSLEPSDDLGQLETP
FT                   GLDLVDYVARYRETNEQLPWNSFAAYVWSAGIFASRAFPKIALNDQCLSINEAFLYPIV
FT                   DFLNHKNDTKVKWCFQDGKMCFVSKESLKSGEELFNNYGDKSNEELLLNYGFVQDNNQY
FT                   DDARLTLRLDSQLLDGAEQLGIPLSQERVTDNSVQFKLNKKELLPHNLVKLFALVHKLK
FT                   SEDGINLRNSLEGIDSLQSILMQKVEFFRQKTRIDASASRKLQILRKYFDQQRRLFQLS
FT                   IENGQKLQKELIKSNSEFLISFKTIFKNDKQFANSLLLTFGVAKFEDLITKDCMNQILL
FT                   LWIVRVANKNEYAKKLPFEIPQFIYDTFQEVSSTIVIEKEDVLQMMGFYQAMFPAMSEK
FT                   IPEIYGQGNWRIRQFIVADTVMDRLVWTRKLTQEPFFVKKQRIAF"
FT   gene            complement(<595175..>595690)
FT                   /locus_tag="ZYRO0G07524g"
FT                   /old_locus_tag="Zyro0G.mRNA.2733.m"
FT   CDS_pept        complement(join(595175..595592,595677..595690))
FT                   /locus_tag="ZYRO0G07524g"
FT                   /old_locus_tag="Zyro0G.mRNA.2733.m"
FT                   /product="ZYRO0G07524p"
FT                   /note="uniprot|Q9HF97 Zygosaccharomyces rouxii cof1
FT                   Cofilin"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29389"
FT                   /db_xref="GOA:C5DZV5"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZV5"
FT                   /protein_id="CAR29389.1"
FT                   /translation="MSRSGVSVADESLQAFNDLKLGKKYKFVLYGISEDKTTIVVKETS
FT                   TSQSYDEFLGKLSENDCLYAIYDFEYEIGGNEGKRSKIVFFTWSPDTAPVRSKMVYASS
FT                   KDALRRALTGVSADIQGTDFSEVSYETVLERVSKGAGSH"
FT   gene            <595928..>596425
FT                   /locus_tag="ZYRO0G07546g"
FT                   /old_locus_tag="ZYRO-ORF1295"
FT   CDS_pept        595928..596425
FT                   /locus_tag="ZYRO0G07546g"
FT                   /old_locus_tag="ZYRO-ORF1295"
FT                   /product="ZYRO0G07546p"
FT                   /note="weakly similar to uniprot|Q07887 Saccharomyces
FT                   cerevisiae YLL049W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZV6"
FT                   /protein_id="CAR29390.1"
FT                   /translation="MSSVQDTIESFESRLQRLEDALGDAGGVDLYGLVSLLSFEVRSMF
FT                   YQGQDYSEQLMGLLDGFSGNETVDEFEKKSRVLMSCYDGLTKSLRWLDQLESFMSKLGT
FT                   KMETGSGAPVELNAVMELPALMNKCHVLLVRSILVAKRFMEMNLRFNEFWLKIDQKLGG
FT                   PS"
FT   gene            complement(<596422..>598317)
FT                   /locus_tag="ZYRO0G07568g"
FT                   /old_locus_tag="ZYRO-ORF1294"
FT   CDS_pept        complement(596422..598317)
FT                   /locus_tag="ZYRO0G07568g"
FT                   /old_locus_tag="ZYRO-ORF1294"
FT                   /product="ZYRO0G07568p"
FT                   /note="weakly similar to uniprot|P03874 Saccharomyces
FT                   cerevisiae YHL038C CBP2 Protein required for splicing of
FT                   COB aI5 intron Cytochrome B pre-mRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29391"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZV7"
FT                   /protein_id="CAR29391.1"
FT                   /translation="MVDTNLKFWSTLVFAAFKRRPENPVFGYKRNVIKMRNAHGKRIES
FT                   LLKKPDLHVVDLELDGTLETAHVSRIRELLLKDARAPTDSTLRIFRNGKVPKQGQKQEI
FT                   SDWKYSSLLFKNALNPKYGLPLSKLNAHEDFLMNKTILLESESGEEKLDRILWPSAVFS
FT                   HSCRGIGIPTETYRQYREKYGTDDKIPKLVNPLPGDPFLKLYPVDFVPSDFQAVGLFPN
FT                   YVETHKNVFKGFDLFGALVKSRLCTESEIKLINQRVITKEKPSSYTPSSDIDLKGVDVQ
FT                   DHRDSNNLQVETNLNNLNKWTKVSKDYQSFWSARGIPNKIIPADILRCLFLTKDITISQ
FT                   MKEEFCKHYILFSIFSQAWRIDRKFNNKDPNFSESSLDVPWRPWDLYILKRSQEISAIP
FT                   IPTTLEEFSDVKLQFDQFLSEFFSYYALIVSEMKAETDSFFQPTESHLPRMVPVKQVLR
FT                   NILLENQWVQTLYPNLHTHMKNRFQWIHSSNYLAVPTTTEMDEKTRQSNEKLLTIVRII
FT                   SELESESRQNQLGERGGIYVDLKTPASNWKIVIVNNSLTDPEVRRLLKFNSDLGLQFTQ
FT                   NLEYSRNEDGWSCQKKKMLDPDTYIYLYHNEKHLESNKDLIDDIIDRFDQQADKN"
FT   gene            <599222..>600853
FT                   /locus_tag="ZYRO0G07590g"
FT                   /old_locus_tag="ZYRO-ORF1293"
FT   CDS_pept        599222..600853
FT                   /locus_tag="ZYRO0G07590g"
FT                   /old_locus_tag="ZYRO-ORF1293"
FT                   /product="ZYRO0G07590p"
FT                   /note="similar to uniprot|P38734 Saccharomyces cerevisiae
FT                   YHL036W MUP3 Low affinity methionine permease, similar to
FT                   Mup1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29392"
FT                   /db_xref="GOA:C5DZV8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZV8"
FT                   /protein_id="CAR29392.1"
FT                   /translation="MSREQETGLLLDDNSIDNVPRKDVDPQQSFLNDLETSLTDIAEDP
FT                   FVEVPQGRHLGVFSTMVLFVARIVGSGIFATPSSIYVNCGGNTGIYFGVWTLAGLVSFA
FT                   GLFVFLEYGSWLPRSGGRKNFLEQTYTRPELMMSVTFVCFTIFTGFAMSNAIVFGKYFL
FT                   YVLGFSDPSTGVQSNASKYVSIIVISVAMLVHGCSVRTGVRIQNFLGGIKFGLIGLMCL
FT                   IGLYSFFYHVPEGKESPSLKSNSVFAFQNKSEVSLASLASAFLNAFFCFSGWDSVHSVA
FT                   SEVKNPTYTLKVGGTASLLICFTCYSMMNLAYVNVLSYEEIKQAGPLVGSVLFTKLFGK
FT                   FLGSKLLSLSVAVSTLSNLLVVIYGLSRMNQESFREGYLPFSKQLASNWPWGSPLPSIL
FT                   VCGGFTIIWLAALPPENSSFDYLVSMEGYGNQFFLLLIAVGLFIHRRRHKGQQPSTRAS
FT                   TLGTILMIIVSGYTLITPFIGDQNRNMIGFLPPYQITSILIIGACFFFWLVTFVILPRT
FT                   FHYELEPNISYLADGLAVTEWKKKII"
FT   gene            complement(<601181..>606268)
FT                   /locus_tag="ZYRO0G07612g"
FT                   /old_locus_tag="ZYRO-ORF1292"
FT   CDS_pept        complement(601181..606268)
FT                   /locus_tag="ZYRO0G07612g"
FT                   /old_locus_tag="ZYRO-ORF1292"
FT                   /product="ZYRO0G07612p"
FT                   /note="similar to uniprot|P32386 Saccharomyces cerevisiae
FT                   YLL048C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29393"
FT                   /db_xref="GOA:C5DZV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZV9"
FT                   /protein_id="CAR29393.1"
FT                   /translation="MLQQWLQWWLQQLEDRTTHFYLPAYIYTSMLSAYFKISGCFDTFF
FT                   KGSKIKVNTLMLLTKDNSCPFWVFDDVTQCGRARYINYYFPLFVLVSGLLYWTYNILTH
FT                   HYKYDKLKLKQRDVNDLMLIDGEDDENKPLLQESPSPSSYNGNEVDGEELKERHFSLQR
FT                   LKLVKPNGEPHGKPELVRRGFIEKSRTIFELLLVLSQFAVHFGIWLNHTEDDSEFTSRS
FT                   SIVQVIVWGFLVTLVTLRLWNINQSARWVNRYCGNIWSISFTSYMFMFFTTVLPFRSIF
FT                   IGHIEEKSVKNYYLSQFYLDLALFALLFLSPSGNKLAVVYKTDEQITPSPEPVSSIASF
FT                   ITWSWLDKFVWQAHKSVIEKKDIWGLRMDDYAIFVIKRFKQYVERKGKEKSFTYNLLTF
FT                   FTKYLLLQGFWALLDSMMSFAPTILLKRILEYVDDRESAPGNLAWFYVCCMFFCRVFCA
FT                   IFSGQALFFGRRVCIKMKAIIISEIYTKALRRQVAVNSNKQSTDEVDPQELNEEEHRDG
FT                   DEESGTSANLGAIINLMAVDAFKVSEICAYLHAFVEAVAMSCVAIVLLYKLLGLSAIIG
FT                   ALLIVVLMPVNFRLVTWLGQLQKKSLSYTDKRIQNLNEAFQAIRIIKFFSWEDNFEKGI
FT                   QAIRDVELKLLLQRSLIWALCSFVWYATPTIVTTSAFAFYIYVQKQTLTTPVAFTALSL
FT                   FSLLRTPLDQLSDMLSFVIQSKVSLDRIQEFLEEPDTDKYNQLSVAPGGQKLGFENATI
FT                   SWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIVVPSLDP
FT                   RALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFNSPYSEARYNDVIEACGLKRDFEI
FT                   LSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSHTASWIYDNCI
FT                   TGPLMQGRTCILISHNIALTLRNAELVVLLENGQVKEQGDPLTLLHKGHLGEDELVKSS
FT                   IMSRNNSSVNVKTKSSTSVQNLAKTSKESTKPQQTDEERKKAGKLVKDETKAEGVVGLE
FT                   VYKWYLKIFGGWKTLSFLVSAFVFAQGMYIGQSWWVRDWASHNMNSTIFAFRENLVSAG
FT                   FHTFGRVDAFVHYVAELPNRVAVATGAEPVGPHSMFYYLAIYFLIGFAQSVLSAFKTIL
FT                   SFVAGLNASKKIFNLLLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAF
FT                   YSLVTCLSTVVLITFITPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQH
FT                   FSETLVGVTTIRAFGDESRFIQENLHKIDENNRPFFYLWVANRWLAMRIDLIGSLVVFG
FT                   AGVFILLNIDHIDAGMAGISLTYAITFTEGALWLVRLYSNVEMNMNSVERLKEYMVVEQ
FT                   EPYNQPIMTPPSDWPQHGRVEMSDVSLRYAPGLPRVIKNVSFTVEPKSKVGVVGRTGAG
FT                   KSTIITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPY
FT                   DEYSDEDIFAALKRVNLVSQEELDRSNIDAASVGSENVNKFLDLNSEINEGGGNLSQGQ
FT                   RQLVCLARSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGNTILTIAHRLRSVID
FT                   YDKILVMDQGEVKEYDHPYSLLLNKNSQFYSMCESSGELEVLIELAKEAFVEKLNSK"
FT   gene            complement(<606630..>607460)
FT                   /locus_tag="ZYRO0G07634g"
FT                   /old_locus_tag="ZYRO-ORF1288"
FT   CDS_pept        complement(606630..607460)
FT                   /locus_tag="ZYRO0G07634g"
FT                   /old_locus_tag="ZYRO-ORF1288"
FT                   /product="ZYRO0G07634p"
FT                   /note="similar to uniprot|P10080 Saccharomyces cerevisiae
FT                   YHL034C SBP1 Single-strand nucleic acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29394"
FT                   /db_xref="GOA:C5DZW0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZW0"
FT                   /protein_id="CAR29394.1"
FT                   /translation="MSSEEVTNNNNVAAATTAPKAPVDPETTIFVGNVASGVTEDDLKK
FT                   VFQEEFGDKVEVEIPAPAKTTKGKVLPRRYAFVKFPQKIDVEAIKSKYDKTVVNEKGIF
FT                   IRKALTEEERDTQRKTKKQQRRNTKNGAKFPKFRTAVSAPPNKEKPPLEEMERSNDTLY
FT                   VNNIPYSATKEQLAEFFGTTPELIVLPMRRMRNTKTNKVFYSKKMNRGIAFVTFENLQV
FT                   DIKTKVEEFQSKTLQDRPIVVDVAALRQQTNDEQKPSDEQEKKDEDKEEKSESN"
FT   gene            complement(<608384..>609154)
FT                   /locus_tag="ZYRO0G07656g"
FT                   /old_locus_tag="ZYRO-ORF1286"
FT   CDS_pept        complement(608384..609154)
FT                   /locus_tag="ZYRO0G07656g"
FT                   /old_locus_tag="ZYRO-ORF1286"
FT                   /product="ZYRO0G07656p"
FT                   /note="highly similar to uniprot|P29453 Saccharomyces
FT                   cerevisiae RPL8B and to YHL033C uniprot|P17076
FT                   Saccharomyces cerevisiae RPL8A Ribosomal protein L4 of the
FT                   large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29395"
FT                   /db_xref="GOA:C5DZW1"
FT                   /db_xref="InterPro:IPR001921"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038524"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZW1"
FT                   /protein_id="CAR29395.1"
FT                   /translation="MAPGKKVAPAPLASKSAKTSGPKNPLIRSTPRSFGIGQNVQPKRN
FT                   LSRYVKWPVYVRLQRQKKILSMRLKVPPSIAQFQHTLDRNSAAEAFKLFNKYRPETAAE
FT                   KKERLTKEAAAVAEGKTRQEASPKPYNVKFGLNHVVSLVENKKAKLVLIANDVDPIELV
FT                   IFLPALCKKMGIPYAIVKGKARLGTLVNQKTSAVAALTEVKKEDEAALAKLVSTVNVNF
FT                   GDKYDEVKKHWGGGVLGEKSQKKLEKRIQAVNSN"
FT   gene            complement(<609429..>609499)
FT                   /locus_tag="ZYRO0G07678r"
FT                   /old_locus_tag="Zyro0G.tGly.GCC.54"
FT   tRNA            complement(609429..609499)
FT                   /locus_tag="ZYRO0G07678r"
FT                   /old_locus_tag="Zyro0G.tGly.GCC.54"
FT                   /note="tRNA-Gly (GCC) cove score=66.96"
FT   gene            complement(<609766..>611880)
FT                   /locus_tag="ZYRO0G07700g"
FT                   /old_locus_tag="ZYRO-ORF1284"
FT   CDS_pept        complement(609766..611880)
FT                   /locus_tag="ZYRO0G07700g"
FT                   /old_locus_tag="ZYRO-ORF1284"
FT                   /product="ZYRO0G07700p"
FT                   /note="similar to uniprot|P32190 Saccharomyces cerevisiae
FT                   YHL032C GUT1 Glycerol kinase converts glycerol to glycerol-
FT                   3-phosphate glucose repression of expression is mediated by
FT                   Adr1p and Ino2p-Ino4p derepression of expression on non-
FT                   fermentable carbon sources is mediated by Opi1p and Rsf1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29396"
FT                   /db_xref="GOA:C5DZW2"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZW2"
FT                   /protein_id="CAR29396.1"
FT                   /translation="MSQDINRLTVDGVVPLIATVDVGTTSSRAILFNRLGQEVSKHQIE
FT                   YSTTASKEKYGASGKRRPSFDRNPDDPIFTAEGIAIKETKYVEIEDLKQPDPTLRFPRP
FT                   GWVECKPINILENVEECLAKAFSFVWSVNEQRQQDGLPPYRVHAMGIANMRETTIVWSK
FT                   ETGLPVVDYGIVWNDTRNAGIVAEMKKNTPKEKQERLQEKIGLPLYSTYFSCSKLRWLL
FT                   DNEPAVQKSYGEGDLMFGTVDTWLIYHLTHNHAFISDVTNASRTGFMNLDTLDYDDELL
FT                   SYWGIDKTKINLPRITSSAEYFGDFKVPEVTKSWMDPSDWDILEKLSNRGPPIPVQGCL
FT                   GDQSSSLVGQLAFKPGAAKCTYGTGCFLLFNTGSKKLISKHGALTTFGYWFPHLEGDDK
FT                   NSPHFALEGSVAVAGAVVQWLRDNLRLIPKAEDVGPLACRVPDSGGVVFVPAFSGLFAP
FT                   YWDADARATIMGMSQHTTASHIARAAVEGVCFQARAILSAMSADALGEGKRDKEFLNEM
FT                   EDDSEEKSALSTLAVDGGMSKSDEVMQIQADILGPCTKVRRSPTSECTALGAAIAAEMG
FT                   FKDPKDRIMWKDLKDVKKWVFYNGIPKGEAVPAELMPNLKLFVSDSDDAERRHKRRLWD
FT                   IAVRRTRGWMAAVYPPNSNVNEGFQTDGLAVESPAVQPENSPFIPPKHENLEREMHRKE
FT                   LRKQRNALKV"
FT   gene            <612724..>614802
FT                   /locus_tag="ZYRO0G07722g"
FT                   /old_locus_tag="ZYRO-ORF1280"
FT   CDS_pept        612724..614802
FT                   /locus_tag="ZYRO0G07722g"
FT                   /old_locus_tag="ZYRO-ORF1280"
FT                   /product="ZYRO0G07722p"
FT                   /note="uniprot|Q6RW11 Zygosaccharomyces rouxii FPS1
FT                   Glycerol facilitator"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29397"
FT                   /db_xref="GOA:C5DZW3"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZW3"
FT                   /protein_id="CAR29397.1"
FT                   /translation="MPDTQDGKSNSQKLLNDYLSNPDPGPSPSAPQPTTAGTGDTSTTA
FT                   ADVNLQGNKNFDNSGNSGIESRHKSSSNWNDDGYDYEMQNYYPQPYTQRTSRARSNTNY
FT                   IPHYMTGPDSQYPIQEVVPNTQMAVATGSDPAANRADGFGHSVRSRAPTIRSNVPDFHS
FT                   ILGSTRSKPHSHNGSHIRSNSSGRSSAASAAADSENHGNETGDGVNSGSSNHALSTPLM
FT                   VRPKTLHQNPQTPTVLPSAYHPINNWTSLKHGYLKEFLAEFVGTMVMIIFGNAVNCQVN
FT                   VASKIQQENFDKALQKVSNSPEQLRETAEAFKNLVSSTSGGTFDEVALGWAAATTMGYF
FT                   AAGGSAISGGHLNPSITVVNFIFRGFPFKNVFIYVTGQLLGAFVGALILFIFYKRVIEE
FT                   GFPGEWWKNETVAGIFCVFPKPYLSTSRQFVSEYICTALLQIGTFALTDPYTSLSSDLF
FT                   PLMLFILMYILNASLSYQTGSAMNMARDLGPRLALYAVGFNRHMLWVNHHHFFWVPIVA
FT                   PFLGSITGGLIYDVCIYQGHESPVNWPIATYKDILRRSWLRRRQWKGRSNWPVIGKKLS
FT                   NNPAPSEFSDFSYEDDDEDRGNPFQNPKTDPSKVSLVQEADPGADTRSPDSVHFKSVQG
FT                   DSRRLHGEIPTIMEENPSLETESLGSLTSLSINNNDNNGPTSNDGIPSFPTVQKKQE"
FT   gene            complement(<614897..>615565)
FT                   /locus_tag="ZYRO0G07744g"
FT                   /old_locus_tag="ZYRO-ORF1279"
FT   CDS_pept        complement(614897..615565)
FT                   /locus_tag="ZYRO0G07744g"
FT                   /old_locus_tag="ZYRO-ORF1279"
FT                   /product="ZYRO0G07744p"
FT                   /note="highly similar to uniprot|P38736 Saccharomyces
FT                   cerevisiae YHL031C GOS1 v-SNARE protein involved in Golgi
FT                   transport homolog of the mammalian protein GOS-28/GS28"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29398"
FT                   /db_xref="GOA:C5DZW4"
FT                   /db_xref="InterPro:IPR023601"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZW4"
FT                   /protein_id="CAR29398.1"
FT                   /translation="MSQSFVTVRSQAISLESQVESLLSKYSTFAQTTSSEQTSQEKRLD
FT                   TQLEELLNQRQDVVERLGTICDENPTISASKLSQLQRHREMLKEHWQNLRNIRSSIQQE
FT                   RNRLNLLFSVKSDIAQQRTEDSTVPFEDDEDYYRGESRRVDQSHNLVDRLISQAWETRD
FT                   QFSAQSNLLQSGSNRVLQTLHRVPGINQLIARIGTRRRKNVLVMASVIVICILLLFFTW
FT                   "
FT   gene            complement(<615624..>616097)
FT                   /locus_tag="ZYRO0G07766g"
FT                   /old_locus_tag="ZYRO-ORF1278"
FT   CDS_pept        complement(615624..616097)
FT                   /locus_tag="ZYRO0G07766g"
FT                   /old_locus_tag="ZYRO-ORF1278"
FT                   /product="ZYRO0G07766p"
FT                   /note="similar to uniprot|Q07879 Saccharomyces cerevisiae
FT                   YLL042C ATG10 Enzyme that mediates formation of the Atg12p-
FT                   Atg5p conjugate which is a critical step in autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29399"
FT                   /db_xref="GOA:C5DZW5"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZW5"
FT                   /protein_id="CAR29399.1"
FT                   /translation="MRFEEYRAQLPSLKHSLQDCDKVKNLHYNPLKSTIHIHIQWDVTE
FT                   FNISHLECKITYSQTYHEPQLLLRIWKFSQIEGIDCIEPWFPKQIDRILPLPNWFQFGL
FT                   DTISTSSSDNPAAWYSIHACDTADIVGDRSIFQSTYLSRWASVFLFDWIQNVD"
FT   gene            complement(<616337..>617128)
FT                   /locus_tag="ZYRO0G07788g"
FT   CDS_pept        complement(616337..617128)
FT                   /locus_tag="ZYRO0G07788g"
FT                   /product="ZYRO0G07788p"
FT                   /note="highly similar to uniprot|P21801 Saccharomyces
FT                   cerevisiae YLL041C SDH2 Iron-sulfur protein subunit of
FT                   succinate dehydrogenase (Sdh1p Sdh2p Sdh3p Sdh4p) which
FT                   couples the oxidation of succinate to the transfer of
FT                   electrons to ubiquinone"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29400"
FT                   /db_xref="GOA:C5DZW6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZW6"
FT                   /protein_id="CAR29400.1"
FT                   /translation="MMNSVLKRSVVNGLNLQRGLATATAVAPRLKNFKVYRWSPDEPSK
FT                   KPYLQTFQVDLNECGPMVLDALLKIKNEQDATLTLRRSCREGICGSCAMNIGGRNTLAC
FT                   LCKIDQNESKDLKVYPLPHMYIVKDLVPDLTNFYQQYKSIQPYLQRKSYPEDGKEILQS
FT                   VEDRKKLDGLYECILCACCSTSCPSYWWNQEQYLGPAVLLQAYRWLIDSRDQAAQTRKA
FT                   MLQNTMSLYRCHTIMNCTRTCPKGLNPGLAIAEIKKELATD"
FT   gene            complement(<619006..>628332)
FT                   /locus_tag="ZYRO0G07810g"
FT                   /old_locus_tag="ZYRO-ORF1275"
FT   CDS_pept        complement(619006..628332)
FT                   /locus_tag="ZYRO0G07810g"
FT                   /old_locus_tag="ZYRO-ORF1275"
FT                   /product="ZYRO0G07810p"
FT                   /note="similar to uniprot|Q07878 Saccharomyces cerevisiae
FT                   YLL040C VPS13 homologous to human COH1 component of
FT                   peripheral vacuolar membrane protein complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29401"
FT                   /db_xref="GOA:C5DZW7"
FT                   /db_xref="InterPro:IPR009543"
FT                   /db_xref="InterPro:IPR017148"
FT                   /db_xref="InterPro:IPR026847"
FT                   /db_xref="InterPro:IPR026854"
FT                   /db_xref="InterPro:IPR031642"
FT                   /db_xref="InterPro:IPR031645"
FT                   /db_xref="InterPro:IPR031646"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZW7"
FT                   /protein_id="CAR29401.1"
FT                   /translation="MLESLAATLLNRLLGSYIENFDPTQLNVGIWGGNVKLKNLKLRKD
FT                   CFDGLHLPIDVKFGILGDLVLNVPWSSLKNKPVKVNIEDCYLLCTPRDFDSLHSAEQVE
FT                   RELRVKLQSLARWEVASQARAAADDSNSHKDQNESFMQSLITKVVDNVQVSIKNIHIRY
FT                   EDMSSNLSKEPCSVGITLNELSAVSSDSDWNPSFISITQDITHKLLTLDSFCLYWNTNT
FT                   NSIQEHGEIYDPNAMISKFKNCVATNGVSKPDFQYMLRPVTGSGRLTVSKLGSTEDRPH
FT                   IDLQMLYDEFGLEIDDSQYADILHTLSSIHLSQKTQKFRKMRPTYPVSQNPKGWFRYLG
FT                   DCVIEEIHEKNDMWTWDHISKRCQQRRLYVKLWSKKLSVSNWEQPLPDRDEEKQLEQLH
FT                   RELGFEDIVLFRSLGRKEFAKQKLKSRDASPAKTQQPSSQGGWFSSWWGGGNSSQDSDL
FT                   TITDEQRQELYDAIEFEENDGSLTDAQLPRDRITMKVTGLLRKGTFSMRKKDHEFCLGE
FT                   VIFENCEVDFLQRPDSFLTSFKLQQFKVEDGSPNTLYKHIISVKNTESDSPSKSVTKSL
FT                   PLFHLDFESNPVDESADSKLNVVLRGMTVFYHVHFITEILRFFSPPKQHKDTVGAIINA
FT                   AEATVEGWTTQTRMGLESLLEEHKTANITLDLQAPLIILPLNPHSWETPCAVIDVGHIF
FT                   LKSDLVPKERINKLKQLTPEEYAKIDESELNKLMFDRYQLYLQDTQMLIGSDVRSTITS
FT                   LNGASEGCQYSILNKLRLEVTLDLSILPKAFNLPKVRAFGRLPQLKLSLNDNQYKILMQ
FT                   LLEKSIPSLLDVDADNEFRETADTLDDTRRKVQIQLSRTLKDLEKMLPMELAQKLFELH
FT                   FDVDDIQISIYKCLESNSMQCKKLVDVLGGKVKFNFVRKAKEMNIKLNVHSLEVEDHIE
FT                   ESNNEEFRHLISSGNVDQNGSKDLFNLEYKRMQRIVSHDNTLIEVFDQDVSMNLAKLKL
FT                   VLSPKSLLTLINYALTTFTDPNAPVAPADALRHNEENREDAPQKINVNIKVAGVVVVFN
FT                   DESLKLATLVVSAGDFSLLYMPEKMKVKLSLGGLELTDETTETLPRDSMFRKLISMSDQ
FT                   ELAEVSYETFDAADRPGDYDSFFKYNTGSMHVNFVEHSINKVLTFFCKFQRMKALFDKA
FT                   REVAYNQAPSIEAVNKMKMDVKIKAPIIQFPRLVSAEDEIYDSINFYLGEFFVENKFDK
FT                   NEAGAEINNINLGIREAQVSSILNLDQGLTQHLHMVDNLCLTFNIDHNPFADVSTPKFL
FT                   VRGYFDPLMSSLTELQLKYLLEVSEKVSAAFDITDTSAVELSEEVIYANAFLDSPDTEN
FT                   SPSSVVTSETPRTENGEPLEGIKMDFSFKAPEISLTLYHDTTSSKDLENNGLTKLTFQD
FT                   IALSAQYNDDGTGEGESHIATFTVEDIRDIKDNKHTELIPKVVNDNYQFMAAVTCTKLH
FT                   HGKLVNASVTIDSPQVILAMDYLFALKSFFDASFEKKQANVTEDETTSREQNPSLPATE
FT                   NNSSNTKLQYSLNVVNAAVIMLADPSDLYSEAVMFNIGQFLLSDQNITSLCANNVGMSL
FT                   SKMNTEDKNQVRLLEEFSSSLVIDRRESTPEKLLTNVQISVEPMVMGISLRDIRLAMLV
FT                   FNRVVSQMNGTPEEHDSGDNASSMTPGGFSKEFEKKLSKYAPSFVSSVEAMSRRGSVSH
FT                   DVIMRGENLEADFGGIRLFLIGDVHEMPILDMNVSPFQASVKDWSTEIDALAALEVYMN
FT                   VFNYSRSSWEPLVEPFPISFHLSKSAANKDAKVMFDVISKKTAEVSLSARTISMLSQIP
FT                   GTLTTNYSLEPRGASKPYKIKNDTELDLDVWIVTDTLQERKSLTTLAAGSAIPWEFEDW
FT                   RSVRENLEAEHLGLNLGAAIAGGRYKTTMKVDVTYEGEMLFVLQPAVEHVHNRIVCELE
FT                   LGEDNIKTITFRSPLLLENTTSTDMEIMVEPEQASRRFSFELKALSSRSVPVEYAFNSS
FT                   LRIKPITEAEYDWSQQPIIWRSLLKKPISLQCNSYDGRNENFHIEVNGKYDEKEPLAQI
FT                   FPHMKLVISSPIAIENLLPCDLKFSLFDKREEEKNMCLLKKGERVPVHDVSLDNFLLLR
FT                   VQPLIEDASMSKPSIVNTATKSALKPELSLVMKLSGGQKFNAMLHYQSVEGTRAKIIRI
FT                   TSPYIIFNETDRDLYVQGNSSNIAQCKLQAEDDVRFSIPKMFSFDVNSYKKNRARIRFK
FT                   ESDWSMPISFEALGQSFDTVVNIPNKEQECNFGITVSEGEGDYLLSKIISIAPRYIIHN
FT                   FLDVPIELCEHGSTNVLDVEPGKSIPLYKMRNVVHKQLMVKFLGSTSEWSSPFFIKDIG
FT                   FTYLKVLKQNSHVLLKVEIILERATVFIRIKDAQNHWPYSIRNFSDQEFIFYQRDPRVV
FT                   DDYYDYDTYDELDETEYKPYYYRVPPKSVMPYAWDYPAARQKKLILTARGRRREVQLAE
FT                   IGNLKPMRLPSRSPSEEPLSMDLNVIADGPTQALVITNYNPDFSLYKLRNKNNTSSSVS
FT                   VSSSSGDGFEAEAEDKNVYAKIVLSFKGVGISLINASLQEILYLHANGLEMRYNESDLY
FT                   QTFSWKVKWLQVDNQLFGSPFQNILYPYAVPHTTHEIENHPVISGSVSKVKDDSHGLMY
FT                   FKHATLLLQELTIQLDEDLLIALLDFAKSPGAAWNLSSKDARYPTKITLPQCADLKFAD
FT                   DMYFEIFHIQPIMLHVSFVRSDQHQLLKDEQEKLGVEYQGTMLVFLDMLTMTMANVNDA
FT                   PITLNSLYMANLRVPINTLYKAVETHYGQQFFYQIHKILGSADFLGNPVGLFNTISSGV
FT                   WDIFYEPYQGYMMNDRPQELGLHLAKGGLSFAKKTVFGLSDSMAKFTGSMAKGLSITQD
FT                   LEFQERRRLQQRMNANKRNRFTSTAQSFANTVGSGFTGMAFDPVTGAQKEGASGFFKGL
FT                   GRGLIGLPTKTAIGILDLTSNLSQGVRSTTTALDVPAAARVRLPRYIDYHEKIIRPFDL
FT                   KEAQGQYWLKVVNGGLYMNDNYLAHVVLPGKELAVLVSMEHIIELNIGNLESMWTTDYF
FT                   GIQGIVLQRGGIHIKLKTQSEYFIPIANPQERKCLYKHIAIAVTEYNKYCEAAL"
FT   gene            <628580..>634129
FT                   /locus_tag="ZYRO0G07832g"
FT                   /old_locus_tag="ZYRO-ORF1271"
FT   CDS_pept        628580..634129
FT                   /locus_tag="ZYRO0G07832g"
FT                   /old_locus_tag="ZYRO-ORF1271"
FT                   /product="ZYRO0G07832p"
FT                   /note="similar to uniprot|P38737 Saccharomyces cerevisiae
FT                   YHL030W ECM29 Major component of the proteasome tethers the
FT                   proteasome core particle to the regulatory particle and
FT                   enhances the stability of the proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29402"
FT                   /db_xref="GOA:C5DZW8"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024372"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZW8"
FT                   /protein_id="CAR29402.1"
FT                   /translation="MSSVTSEVKEKELVEKVELRLALSDTPDKFEQNLDTFLPPLLLKL
FT                   GSPHASVRQAVFNSLRDVLARLNSLTNVRLPVEKLLLQSQKPPFTQESNNVRLYSLLLA
FT                   SKGIDRLEVGEKRQLIPVAMREISKLPDAAAARVFHIVCKLITSWVPPQRSSKEEDEAF
FT                   ESLKLEDRGDLEFLAQKFTQFFFLIPAKADPQTKIIPRGYTCPGLCADEVSFFTYTAGV
FT                   TFTKEQMVHFKSSIFKFFNSGFTQDTKLLAKFLIVASTDSSDISDTAAFYLKKLNISSE
FT                   DPDFVDFLISLYTGDKSVGKPPVRPELQDKILSFLNKSVYATSNAKKVSQICHIGLHSS
FT                   LYRLRSSCLTFVRHVAQHNYKNLIEQPGENEGIGFNVNIASLIRNNLHSEGWPRLQLSS
FT                   STPNFANTILQRRLQYETLGDILSRDFDLLKDLSFIEFLFDSLRGDFSEFLPSIQEALT
FT                   SLTGSLSQLPAASKEKLREIIRKHLSDDFELESSENKETKDSLMACRFILIKYANATFE
FT                   FDDSEARLFNIWGTSRANRFDIIEESNKGLDPYWFRMNRASDTKEFKSTSELLSSRISE
FT                   TMLPSFPEFVATLLKENDLKSLTVTSVIRGTLGTAVRFAKQCLISQAVRGKSTCVVQDE
FT                   DWSLRIEKALDVDDKVSSLALNLISGFDGEWFTGFLRLLCGEIIQKNESGRHISTAKYP
FT                   DAIYGELLLILLRNCSDKTLGALEDLIPAFYNFLGTIQTANDLDIVSGANLLGIISASV
FT                   PNSPHLKTIVDQRIETSPGGEIGASLIADSYIFPRLYLRGHFKLVGNERLGALVSNLLS
FT                   LISNPKLKLLSGKLLCEVSKFGLLRELDSQARHDTLNRLIDLLGSKLLKDEAYVEIWGT
FT                   FSLYSREFGLFEEFFNKLYDTHVSKQIELIFAVGESLSILAGGWKSSFLLKQLDVSRTA
FT                   LVPLQNSFGDENVGIVLDKVLNACDSTKPSLRKSACIWLLSLLQYLKSTTEISSRCNEI
FT                   HLRFMKFLVDKDEFVQDSASRGLSLVYEIGNGDLQESMIKSLLKSFTDSANAMNMSSGT
FT                   VSADTQLFDEGMLNTGDGSVSTYKDILNLASEVGDPALVYKFMSLAKSSSLWASRKGIA
FT                   FGLGAIMSKSSLENLLLEDRGTAEKLIPKLYRYRFDPYQSVSRSMNDIWNTLISNSNSV
FT                   ISEYFDEILKELLAGMGNKEWRVREASTLALLQLVQGQGREQLDDKLLDIWFMAFRSMD
FT                   DIKESVREAGIRLTTVLAKILARAVDVNKGVKPEKSRHILESILPFLLGTRGLNSDAED
FT                   VRNFSLKTIVDLIKNSGSAMKPFAVELVHEFILLFSSIEPQIVNFLSLNASNYKVDANT
FT                   IDMHRKTTVTNSPLLEAIDKLITNSDDSLIDSHVNSVTKAIKKSVGLPSKVAASTVVNI
FT                   LVRRYSFSLTPYSGRLLKVCVNQFDDRNESVRLTFALSFGHVYHVASLEKCVKYAEQLS
FT                   ERYFTSNESISRKVVGSAVEAVSKYANKQFEDVSGIYVPLLFIASNDADEVVGTFFSKV
FT                   WTETSTSGTGAMKLYLKETVDLLQKYIGSKDFAMRRTCAKSVSLLCEKVDLTVKEETVQ
FT                   QLFEITIESLKGRTWEGKEVIVEALVSLAVKFHVYVNSHSELSESLQDVLTAELGRQNK
FT                   RYTKQIIFSYCRFMEVFPQPSMVDKLIQVAQTFFEDGAEDGDSSNKRSKPYSEISLKSS
FT                   PKNVELEDYSIKLLKSCAKICRPVNDVYPYSLFHFIVSKILFLLQEDFVIYTWRTQVGA
FT                   CEIGSEIMETYNEKFVAVEFEESLRKLWNELFIRNSTRETVDNAKIQLVRFGSKISTKD
FT                   AYLRNEIQRDLINLSETDVSAKVSNELKILGIND"
FT   gene            complement(<634289..>635671)
FT                   /locus_tag="ZYRO0G07854g"
FT   CDS_pept        complement(634289..635671)
FT                   /locus_tag="ZYRO0G07854g"
FT                   /product="ZYRO0G07854p"
FT                   /note="highly similar to uniprot|P04838 Saccharomyces
FT                   cerevisiae YLL039c UBI4 ubiquitin"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29403"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZW9"
FT                   /protein_id="CAR29403.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
FT                   SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAM
FT                   LV"
FT   gene            complement(<636468..>637247)
FT                   /locus_tag="ZYRO0G07876g"
FT                   /old_locus_tag="ZYRO-ORF1266"
FT   CDS_pept        complement(636468..637247)
FT                   /locus_tag="ZYRO0G07876g"
FT                   /old_locus_tag="ZYRO-ORF1266"
FT                   /product="ZYRO0G07876p"
FT                   /note="similar to uniprot|Q07872 Saccharomyces cerevisiae
FT                   YLL038C ENT4 Protein of unknown function contains an N-
FT                   terminal epsin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29404"
FT                   /db_xref="GOA:C5DZX0"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZX0"
FT                   /protein_id="CAR29404.1"
FT                   /translation="MSLFDSMRVFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYS
FT                   PKTVREITQVLKRRLSSYGRRTSHKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYF
FT                   ECLKSCEVSQKRDEPLAKQIRSMSNQICDCVKDDELLENKKKEIIEFRSSISSPGRKST
FT                   DNSHLKLIGVAKGSLERTPISLTNQKNENVTLLSEYQYAPNPDIYYRRGTTSLDLRRRN
FT                   KGSANEISVIRLDPLEEENEARSIQAKGWKAIGGYIK"
FT   gene            complement(<637442..>638938)
FT                   /locus_tag="ZYRO0G07898g"
FT                   /old_locus_tag="ZYRO-ORF1265"
FT   CDS_pept        complement(637442..638938)
FT                   /locus_tag="ZYRO0G07898g"
FT                   /old_locus_tag="ZYRO-ORF1265"
FT                   /product="ZYRO0G07898p"
FT                   /note="similar to uniprot|P32523 Saccharomyces cerevisiae
FT                   YLL036C PRP19 Splicing factor associated with the
FT                   spliceosome contains a U-box a motif found in a class of
FT                   ubiquitin ligases"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29405"
FT                   /db_xref="GOA:C5DZX1"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR038959"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZX1"
FT                   /protein_id="CAR29405.1"
FT                   /translation="MFCAISGKPPRTPVVSLVSKCVFEKDLIEQYIQETGNDPISNAPL
FT                   SVDQLLIISQTPQQSAFTNAVNSSTLNSNYSIPNLLSSLQNEWDAIMLENFRLRKQLDA
FT                   FTKQLSTALYERDAAKIVASNALREREQLVQELNQLSLHLGVDEAEESEEQVTGLPQDL
FT                   IEQLLNASKEYVNITKKNKDLFVDEVSELVCRNNYNASDSPVLQSGSKLRSGLSKSVVF
FT                   TIDDGNTVYYTQGDKNSQFEINVEEKLEYLTMTPNEEYLIFSTTDGKIGTYNIKESQKH
FT                   VLEIRTDEIILIQSHEYILNDQFLWVDKKGKVGYSSLDGSKTTLVSQGGAGDFSRAALH
FT                   KDGLLLALVQDDNIQIRNVTQFEEPPTVWNLGKEINQEGSITGVKFSSNGYWMIVSTTH
FT                   AIMSFDLRKSVGTLAVQPITIESQIWDTDLSGKHLVIWQSGRLQFYSFVKSSKTWELNK
FT                   DLPLKPLEEQDLKSLKLSYGESGAVTVLQSLNKIQVFSLE"
FT   gene            complement(<639096..>640781)
FT                   /locus_tag="ZYRO0G07920g"
FT                   /old_locus_tag="ZYRO-ORF1263"
FT   CDS_pept        complement(639096..640781)
FT                   /locus_tag="ZYRO0G07920g"
FT                   /old_locus_tag="ZYRO-ORF1263"
FT                   /product="ZYRO0G07920p"
FT                   /note="similar to uniprot|P38738 Saccharomyces cerevisiae
FT                   YHL029C Cytoplasmic protein required for replication of
FT                   Brome mosaic virus in S. cerevisiae which is a model system
FT                   for studying replication of positive-strand RNA viruses in
FT                   their natural hosts"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29406"
FT                   /db_xref="GOA:C5DZX2"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DZX2"
FT                   /protein_id="CAR29406.1"
FT                   /translation="MVENIPPVLSSHHYKHLKHLDRCKQLVETCVELLSKGDHDALAYL
FT                   ARTLGIPPQLRHKVWPLLLKYHPMCISPNILSNTVVWDSEHNFYKLVSGTSSSNDINKE
FT                   PREGLENLILHDLKKYFRNVSKSEEDHELQVLKEAVLKFLSKWSRIFQYESGLAWIAVG
FT                   LAEWIPIIENSEGPIVLNERKNHTSGTTTPNQPNPTCLSPLFKEYPLPSYLKSKLPKDS
FT                   IFDFNEIYERIVLVILHCPDTITAQKLVEAESLKNSAPRRGSYAIKEGKLNYSPFLSGG
FT                   DLGYQTQVFFKVFSTVLPELYQPFTEENAVQPSSKRTGWLYWWMKCSGARAFQKQDRGR
FT                   LWDILLGWRPEPNRHTIDFFLNYNSKKFDHLYHSRFRNNLDFFNSTSKNDPFWFPDLDT
FT                   IPLGTSKFKYDFNVFEELLDRNSYGHDAPPDPVPGNNDDDKIPFSLIDSHIQLVFIYIA
FT                   ILQHNEFKLLEFEETETSEFLNNVPMLSRADDICFKRLCDDDQSTYQNGFTSQEDLPKR
FT                   PGSSKLRIGSDAKTSRSFNDILTMAGDIWRKWLWQELEECFVSE"
FT   gene            <642460..>644787
FT                   /locus_tag="ZYRO0G07942g"
FT                   /old_locus_tag="ZYRO-ORF1257"
FT   CDS_pept        642460..644787
FT                   /locus_tag="ZYRO0G07942g"
FT                   /old_locus_tag="ZYRO-ORF1257"
FT                   /product="ZYRO0G07942p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29407"
FT                   /db_xref="GOA:C5DZX3"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZX3"
FT                   /protein_id="CAR29407.1"
FT                   /translation="MLYRLSGCWTITLTLALLLAQRVASASNNGYTLDGDSTPWDSNSG
FT                   ANESSDSIKVAGSSTPSVTGTTGSIPSYSSQPQPSSRDNDPFSSAPSPSGYGSGGSSSN
FT                   TESYSSSVNAATSSSSDFSPSSSETPTASSSSQTGGTSGSYSSSSAPGPTDSSSSVSNF
FT                   ESSSPSPSSSSPASLFSSSSASPTASDSSSTYPGLSSSSEVASSGSAVPSSTSSYSSPS
FT                   SSSANTASGSSYSSVSSDIYPSSTPSSSSSSSSYSPSSSFSSFSSSSSAVPSSSSYSSL
FT                   PSSSHSYSSSTPSSSSISSSSSFVSSSSSSSSAPSSSSSLPSSSSSIPSSSSSAPSSSS
FT                   YQSSSSSSSSIFSSSSSIPSSSYSSSSTSRSYSPSSSGSSSSFSYSSSWSPTSTASSGS
FT                   SGAFGYLSSSSSYSPSSSSSFSYSSKASSSSSDFILDATSSSSDSSSAYSSIGSSSDSL
FT                   PKSTTTSYSPSSSSSSSVWSPTSSPSSSYSSSSSSYSWPISPTTSSYPSSTSSESSSDP
FT                   SSTITSNTWSSISSASSYPSSGSSTPVATSSGSSSQSSSDTLKSAFVTSFSVRSTTSSS
FT                   PIKTLTRSAGGGEITSIRYSMVILTSQGSRYTQTRVVTNSPTAGSQKSIQNGNGGYWAS
FT                   TGKVVGTFVPVGIVCLGIILFLIWAMFIHPRKKQKQFDTFYNNNIYSPSLKSDTPSLHQ
FT                   SRPSSVSGFVYADEKGIITPKPAPNQSLTTDDESFELPKPVVVDQRLDFHQMLNNIDNS
FT                   SSKVSLADDVDYSRKFLHLGDK"
FT   gene            <645949..>647400
FT                   /locus_tag="ZYRO0G07964g"
FT                   /old_locus_tag="ZYRO-ORF1254"
FT   CDS_pept        645949..647400
FT                   /locus_tag="ZYRO0G07964g"
FT                   /old_locus_tag="ZYRO-ORF1254"
FT                   /product="ZYRO0G07964p"
FT                   /note="weakly similar to uniprot|P33400 Saccharomyces
FT                   cerevisiae YHL027W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29408"
FT                   /db_xref="GOA:C5DZX4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZX4"
FT                   /protein_id="CAR29408.1"
FT                   /translation="MVLLRDILNQDTSENNISKTPPPAVGAGDFKKRSASLPSPNFSGT
FT                   SSSNGNSDSEDDGSKCRLSVPSSSSRVETPQSSTPSSTEEEQFFCKWDQCGKMFNQPEL
FT                   LYHHLCQDHVGRKSQRNLQLACKWEECNVKTEKRDHITSHLRVHVPLKPFDCYRCGKKF
FT                   KRPQDLKKHLKVHAESHLVVKKRRGPKLGSKRVQKKQKEEPEVARSKFSSASSSISSPS
FT                   PTPDKSYSLPTLPRVSFQQLISNEIPSYEPVYTQQLGAKLRTVLPSLGEEESLPRSPPV
FT                   ATQNAAGFFTTLSKNMSSSLPNQYSTVKQPVITTPIAPAVQPGYKPSSYPKVYQLPPIG
FT                   PPPIDAPSERVSPAASLPSLSSAPILNSRYNSFGRLPHFNALGQHFSSNQKNNGSESTE
FT                   EDDLLEQISSLRVGDDDYEDDGDDDESQDIFESLEIVNIIRDYLLCSLLEQEFEDGNVE
FT                   QELDQKDFSKVSDTHNLSRYPQVVI"
FT   gene            <647633..>649507
FT                   /locus_tag="ZYRO0G07986g"
FT                   /old_locus_tag="ZYRO-ORF1252"
FT   CDS_pept        647633..649507
FT                   /locus_tag="ZYRO0G07986g"
FT                   /old_locus_tag="ZYRO-ORF1252"
FT                   /product="ZYRO0G07986p"
FT                   /note="similar to uniprot|Q9P4W6 Saccharomyces cerevisiae
FT                   YLL035W GRC3 Protein of unknown function required for cell
FT                   growth and possibly involved in rRNA processing mRNA is
FT                   cell cycle regulated"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29409"
FT                   /db_xref="GOA:C5DZX5"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZX5"
FT                   /protein_id="CAR29409.1"
FT                   /translation="MAQLENANALQYQEVSDSDESNSSTESTVTPGPKDEDLAEYDEED
FT                   EEEPNNDSKGQFQPLLDENVFIIDETKDTLLVGLTEKQRIFVSGVFCLQVVKGGILYGH
FT                   THYSASKDTYTVWHPLCDSIPSIQSSFYAGWEEGVHISSEHEELVECDLKDFPCIIKLH
FT                   NPKVDNLLEASELYSEVGNLWRKQGDFTQNFTSPQCGFAILHESLNQFSPLHITGEWLN
FT                   VIERLGLAHKNSSHDMRVIVLGGKNTGKSTLLRLLAQNFLYGGSSQEEILYFDLDPGQP
FT                   EFSPPDCISINQLSRFTKVLGKHMGQPFFSPIRQHYLGSNSPQDIPHLYLRCIDELVDY
FT                   LDEQTYMGTSLMNLPGWIKGFGLNILNHVIRRYKPTHIVMLESKSSRQYFEELDTGTLF
FT                   TSSLRDDYRAQILKVHTNFNSFEDSKFSAATLRTQNMLAYFHTQTKTKSLIKYNFTPLI
FT                   MQPPLQISFGNRGVQGIRFFEEFEDIHKDDIKNALQGTVVGLYSCDDDEDNALRENITF
FT                   QGAFPILKNLPSKIVFFSLALIHSIDVENRLMNVYIPGFRTNQLGSNSERKWIMIRGKS
FT                   ETPFCELYPSKTLFNGDKIPYISNERRKKYEYIWKVRRNVMRRGHHLK"
FT   gene            complement(<649595..>652075)
FT                   /locus_tag="ZYRO0G08008g"
FT                   /old_locus_tag="ZYRO-ORF1251"
FT   CDS_pept        complement(649595..652075)
FT                   /locus_tag="ZYRO0G08008g"
FT                   /old_locus_tag="ZYRO-ORF1251"
FT                   /product="ZYRO0G08008p"
FT                   /note="highly similar to uniprot|Q07844 Saccharomyces
FT                   cerevisiae YLL034C RIX7 Putative ATPase of the AAA family
FT                   required for export of pre-ribosomal large subunits from
FT                   the nucleus distributed between the nucleolus nucleoplasm
FT                   and nuclear periphery depending on growth conditions"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29410"
FT                   /db_xref="GOA:C5DZX6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZX6"
FT                   /protein_id="CAR29410.1"
FT                   /translation="MAKGPAKKSSLRGSLDGKIENLIYRLLEEKALERKRSNTAENDDD
FT                   ESMETVYFAKDLKGGEIFTYCQSKDVTMLRVKKVVLQKSIERVLKQIIEEEAQEFESFP
FT                   GYKDEEPTAQDVEAQLKEQNLMVMPEVNDMNKSITEQWNVKAETPAEDTPDDKVNGSAS
FT                   KKRTKDSAPSKPKKQKTKEDRTPPQSRLESIGGMEDVVAQLMELIGLPILHPEIYISTG
FT                   VEPPRGVLLHGPPGCGKTSIANALAGELQVPFLSISAPSVVSGMSGESEKKIRDLFDEA
FT                   RSLAPCLMFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDELNMEKTGGKPVIVIGAT
FT                   NRPDSLDAALRRAGRFDREICLNVPNELSRVHILKKLAQNLKIDGEIDFIKLAKLTPGF
FT                   VGADLKALITAAGTCAIKRIFHAYAYSSIATDNKMDIDQDTENKDEDEKSLKNTANMID
FT                   PLPLTIIQKFIQNFPEPLNDEQLSNLSIQYEDFLKALPTIQPTAKREGFATVPDVTWAS
FT                   VGALTKVRVELNMAIVQPIKKPELYEKVGISAPAGVLLWGPPGCGKTLLAKAVANESRA
FT                   NFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDSTLSESSSR
FT                   VVNTLLTELDGLNDRRGIFVVGATNRPDMIDPAMLRPGRLDKTLFIELPNAEEKLDILK
FT                   TLVRTNGTPMSSDVDLETVIADDRCKNFSGADIASLVRESSVLALKRSFFKNDQVQSVV
FT                   ENNLDKEFEDLSVAYPSEEILVTMSDFVNALRKVRPSVSDKDRLKYEKLSNKLGWNDDV
FT                   ELTTEETKTPNTNA"
FT   gene            complement(<652418..>653236)
FT                   /locus_tag="ZYRO0G08030g"
FT                   /old_locus_tag="ZYRO-ORF1248"
FT   CDS_pept        complement(652418..653236)
FT                   /locus_tag="ZYRO0G08030g"
FT                   /old_locus_tag="ZYRO-ORF1248"
FT                   /product="ZYRO0G08030p"
FT                   /note="similar to uniprot|P38740 Saccharomyces cerevisiae
FT                   YHL026C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29411"
FT                   /db_xref="GOA:C5DZX7"
FT                   /db_xref="InterPro:IPR018852"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZX7"
FT                   /protein_id="CAR29411.1"
FT                   /translation="MKETTRSSKWFIFYYLFENGLISAMVAGGSEFGIAYAMYWNHKSP
FT                   LTLWAFPHTLSGDCALSHFIQVGLTWYAEELTIGWDALNGKTPIIPFANKYLPKSKFVR
FT                   WYFEVDNGIIPDEDEPENNTFKKYMKRQLIRYPQKNWFFNLCEWLIRKSIRALIVGAII
FT                   WAVEWPITMGIMAGTGTRVGSHDYKFHGYYPEVMKLIYGFVLGLISTPTAILIVVLRDQ
FT                   WYRLYLQTEESSGGLLSPAGLEDKSSKLQESSKQNSTILKNPVTDDSFTS"
FT   gene            <653827..>656157
FT                   /locus_tag="ZYRO0G08052g"
FT                   /old_locus_tag="ZYRO-ORF1246"
FT   CDS_pept        653827..656157
FT                   /locus_tag="ZYRO0G08052g"
FT                   /old_locus_tag="ZYRO-ORF1246"
FT                   /product="ZYRO0G08052p"
FT                   /note="weakly similar to uniprot|P53148 Saccharomyces
FT                   cerevisiae YGL093W SPC105 Protein required for accurate
FT                   chromosome segregation localizes to the nuclear side of the
FT                   spindle pole body forms a complex with Ydr532cp"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29412"
FT                   /db_xref="InterPro:IPR013253"
FT                   /db_xref="InterPro:IPR033338"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZX8"
FT                   /protein_id="CAR29412.1"
FT                   /translation="MAKGILKSSQNEEPQFASGLQLPTSSLSRHEVLENGNNTTSRINT
FT                   LQLENKINRRVSFAPDVTLHSFDFVPQVKDVKLPRRKEKREEDDEKNPEGEESTELSQA
FT                   EPGQDSEMTMTQVFKPSKEMEMTDIFRPPHDEPMELTQVRRAPENVDDGFEKMESSQIE
FT                   HATGNLDDGSQTMELSQIQHATENVDGASEQMELTQVQHATGNLDDASEHMELTQVPRA
FT                   TRNVDGASEQMELTQVPRATGNIADESEKMDLTQVHRIIENVDDESEKMELTQVPSRVH
FT                   TPPAKRRKTMSSEIEEDDDMELSLMRMSPIALRGTDTKPPLSYSLKKFLDAVGVSFLID
FT                   TNFIKSQEAVEFPLTKLPVSLHSHQILSKLYVDMPVLEMNEFVCRELWRRVDQSSVQFQ
FT                   DLENQISSSVPPLLFREYFQSSEDMRRLMNQQLQLVKSFAKLESRKAWYDWRIQHFKGL
FT                   QDVLLENLGLLQEEKTKLDKDLQRAQKNKEETFSLLQVLRKEVELVRDLPSQVYKKESK
FT                   LADKLQLEKFRQELKAHKIAFNDSQNLRLQRRSLVAEIESKCKELGELKGKLHQLQQKN
FT                   KTQVTDYDMTKLRRKLEFLSVLSGIQFKGINNSQLLVKCFDLIELSIDLSLSQSAPQKA
FT                   CSLLNNTEPFYNELLEYVISQLQTSTNFLTDLFLQLRKLIPLIKTYFFLKHLFPLTIST
FT                   ANRTTTIQLMDYDIRTDVKYVYKLSMQELITAVLDENSTVSLSVELAQKNKEIPLDVIS
FT                   ARFVSKTGRILSWANLKRIHMTT"
FT   gene            <656384..>660292
FT                   /locus_tag="ZYRO0G08074g"
FT                   /old_locus_tag="ZYRO-ORF1244"
FT   CDS_pept        656384..660292
FT                   /locus_tag="ZYRO0G08074g"
FT                   /old_locus_tag="ZYRO-ORF1244"
FT                   /product="ZYRO0G08074p"
FT                   /note="similar to uniprot|P49687 Saccharomyces cerevisiae
FT                   YGL092W NUP145 Essential nucleoporin catalyzes its own
FT                   cleavage in vivo to generate a C-terminal fragment that
FT                   assembles into the Nup84p subcomplex of the nuclear pore
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29413"
FT                   /db_xref="GOA:C5DZX9"
FT                   /db_xref="InterPro:IPR007230"
FT                   /db_xref="InterPro:IPR021967"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="InterPro:IPR036903"
FT                   /db_xref="InterPro:IPR037665"
FT                   /db_xref="InterPro:IPR037672"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZX9"
FT                   /protein_id="CAR29413.1"
FT                   /translation="MFNRNTNGGFLFGNANTSTPTSTPTPAPNSLQVPQKSGNLFGNAN
FT                   ANLGVSTPSPSGGLFGNSNTQAGAGGGGGLFGNQSTTNKPLFSNGASTTNNTGGSSLFG
FT                   NTNTNTNTNTNANTSNNTTAPSTFSFGNNASKTNNNSSGGLFSNSGNQPTGGLFGNKPT
FT                   ASGGLFGGSSAPQPQQQQPPNGNITASNPYGLNINNIPIPSVSDMPAPITSSKGNKQGS
FT                   ESSSSGTSGLISSGSVMDGKRNFSLSSSSPSNLPTTTSLPSFSHSSLVNKLSARLKTVN
FT                   QASAVQGLFSPSRNKLWDNHETGGVLTSNSSEYKPTHSNNTVLPSKGLSPFPLQKGEVS
FT                   DLRKLKIDPNRSAAKKVKLLSGMAATTKSFELDDGTTRNWDIKKSESRNSSVSNLNNTD
FT                   TDEFSSAETKVDGEEKPGNTKEEPKTDYWCSPSLEKLSHLPMNQLSIVPDFVIGRKGYG
FT                   CITFNREVDLTAFAPNLEEELFGRIVVFHPTKTVEVYPEESKKAPIGHGLNVPATITLE
FT                   NIYPVDRKTKKPLKDGSRSDEVQLLIKRLKNMRDMEFISYNPFGGIWTFKVNHFSIWGV
FT                   VNEEDVEVDTAEVEKLKNENMSNRTLAFPKNKRKLVQSNAQGFTHSPKENGDRTQNDLL
FT                   ALQDQSGAEATDELVEDENGDDLFLEEKPYEPDVSEQDFAGMEVEPSLNVSTDWVTQLK
FT                   LAGSSLQSIFAAPKDLLAPGNDEIDMLFNEFNQSVELKKKIKKERKLTSPLNFAKFCCD
FT                   SKFLVKDSHGPVGAKLHNLLLPYQRDVAIVNSLFRKQLKGSVIMERQSNAYPVVTQNSL
FT                   QFKDVMELHGPSDPDYQVWKLCSLLFDAVDLPDSLDNEEVKANLLKKERHRLLCSWIVD
FT                   QVQEEIDAKLKKTTNALDQIFLYLAKNDIVGASQLAIKSQNGHIAILISLLGSNDPGVC
FT                   QLASLQLDKWNSAGNKVDSSVARIYRLLTGDLVNGSFLTAEMMSEFNWLALLGVVLYYG
FT                   KIDEFSLEDLINHFFRYFKKPENDIFLIILSLFSTPSSSEALLKKLKLNTTALESLFPW
FT                   YFAQILRFGTAYKFSNVILDQLTLTSIEELKFANLHEEALLATCFLSNDFVAQQQIDSL
FT                   VFHNIKRLSKSSNGYILDRLKISTKLIYQAKALNDKYNSNYLSEAKHLLKAKSFEDAEK
FT                   VIVTLVGPRLVIQGASTRLEELEILRTLLSSFPQNEMENWESGLGVFDNFLKLILDKDY
FT                   REELFSSLISGLSLLHQANRFHKEVPVCCNIMAQELVTTFINEHGGKLDDNTKGKLLRL
FT                   PLGQPEKVYLECMLAKTV"
FT   gene            complement(<660451..>661428)
FT                   /locus_tag="ZYRO0G08096g"
FT                   /old_locus_tag="ZYRO-ORF1241"
FT   CDS_pept        complement(660451..661428)
FT                   /locus_tag="ZYRO0G08096g"
FT                   /old_locus_tag="ZYRO-ORF1241"
FT                   /product="ZYRO0G08096p"
FT                   /note="highly similar to uniprot|P52920 Saccharomyces
FT                   cerevisiae YGL091C NBP35 Essential nuclear protein
FT                   evolutionarily conserved putative ATPase exhibits genetic
FT                   interaction with CDC2 encoding the catalytic subunit of DNA
FT                   polymerase delta"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29414"
FT                   /db_xref="GOA:C5DZY0"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028601"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZY0"
FT                   /protein_id="CAR29414.1"
FT                   /translation="MTGTDIEQVLPPAYELKEPEPEHCPGPESENAGKGNACTGCANQS
FT                   VCESLPKGPDPDIPAIVENLSNIKHKILVLSGKGGVGKSTFTTLLSWALSTDEDLQVGA
FT                   MDLDICGPSLPHMLGCSDETVHESSTGWTPVYVADNLATISIQFMLPEDDSAIIWRGSK
FT                   KNSLIKKFLKDVDWDQLDYLIVDTPPGTSDEHISISKYMKESGIDGALVVTTPQEVALL
FT                   DVRKEIDFCRKAGIRVLGLVENMSGFVCPNCKGESQIFKPTTGGGKALCEELGIRFLGS
FT                   VPLDPRIGRSSDQGESFLDTHPDSPASTAVLEVVEALRDEVGDF"
FT   gene            <662157..>663224
FT                   /locus_tag="ZYRO0G08118g"
FT                   /old_locus_tag="ZYRO-ORF1239"
FT   CDS_pept        662157..663224
FT                   /locus_tag="ZYRO0G08118g"
FT                   /old_locus_tag="ZYRO-ORF1239"
FT                   /product="ZYRO0G08118p"
FT                   /note="some similarities with uniprot|P53150 Saccharomyces
FT                   cerevisiae YGL090W LIF1 Protein involved in DNA double-
FT                   strand break repair physically interacts with DNA ligase 4
FT                   (Lig4p) homologous to mammalian XRCC4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29415"
FT                   /db_xref="GOA:C5DZY1"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZY1"
FT                   /protein_id="CAR29415.1"
FT                   /translation="MKFVSCLPVSDAAVEHEEVDEVVLCESHFSQDNFPSSADAIENLT
FT                   IEWLVLSEGSEIHQRHNCRLYDLQVFTDASETKYIWYELLRQLTSHKVYNPDMEQKVRY
FT                   TRWICNAPEGGEWSLCMELKSGGIVRKIAQLQLTPASHCELNLFQMANTLFQECCACND
FT                   KMAQIKSQTDTIERHLNDLQEERKLLDQLLEKRDTKTRSVVVGLLNEKKRKIAELQRQL
FT                   KDQGPQDAELINRYVTDPVRGHISPGRRRKRLDNHNSDTRRNPRLAPPPKKLRVKKEES
FT                   GSEPEPEPEGKQEFKFLGIKKQDNPVKQEDEELPDPSTSSTNESTSHTENSTDEGENGD
FT                   EDEDQDEDEEETDVE"
FT   gene            <663951..>665849
FT                   /locus_tag="ZYRO0G08140g"
FT                   /old_locus_tag="ZYRO-ORF1237"
FT   CDS_pept        663951..665849
FT                   /locus_tag="ZYRO0G08140g"
FT                   /old_locus_tag="ZYRO-ORF1237"
FT                   /product="ZYRO0G08140p"
FT                   /note="similar to uniprot|Q08925 Saccharomyces cerevisiae
FT                   YPL184C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29416"
FT                   /db_xref="GOA:C5DZY2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZY2"
FT                   /protein_id="CAR29416.1"
FT                   /translation="MHLYNTSDMNQLFNTSDIQFPNSDLSRSVTPEQAAWTGAPSNQIL
FT                   PPRYGLTELEARSSGYPVYPYQQDNNKSQLGQLQPQRPQPVVPPMSFSTPSGPSGIGGI
FT                   SNGPGGPGASLIAGASAGGPVGASTGSGICDAFQEPDEYAMSQVSAFSSPYSSQSTQRL
FT                   TQQQPPGPQNDYALATAAAAAVANANSYMPSIPQLGSNRNFNNAPSKTVYLGNTPITLT
FT                   VKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKRLHIDGRDIKIGWG
FT                   KPTPIDPVVATAVANDNATRNVYIGQLNTGPKLSSQVSPVDVTEPVITEDKLRLDLQEF
FT                   GEIDCIKIVEEKGIAFVHFASILNAIKAVANLANINPYYRNKKIFYGKDRCAFITKTQQ
FT                   HNAAQFLGVQPGMERLVQFSDSELISNALLQQSAAAAAIATSAGGPNNLGNRTVYLGNL
FT                   PKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSLHGITIQKRRC
FT                   RVGWGKHPGSLENALALAVSNGASRNVYVGNINFDEDSKREDPIFTESSLRSIFQQWGE
FT                   VEQINYLPERNCCFVNYTNISNAILAIDKIKGHPVFKDLKINFGKDRCGNVPHQVR"
FT   gene            <666343..>666936
FT                   /locus_tag="ZYRO0G08162g"
FT                   /old_locus_tag="ZYRO-ORF1236"
FT   CDS_pept        666343..666936
FT                   /locus_tag="ZYRO0G08162g"
FT                   /old_locus_tag="ZYRO-ORF1236"
FT                   /product="ZYRO0G08162p"
FT                   /note="some similarities with uniprot|Q08926 Saccharomyces
FT                   cerevisiae YPL186C UIP4 Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29417"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZY3"
FT                   /protein_id="CAR29417.1"
FT                   /translation="MVKVIYGHSADHFKELKVAGDFSQWEIKPMLKNSEFWEYNFYKGS
FT                   LPPEAKALHFKFIDDNGIWFTDNDYAKETDANNNENNVRILTAEEIGELGGDDDEMEEA
FT                   GESSYDINDEGPVRPAPTPTARELKEPNESGELDESTVIVNHADVQEVNRDGERPETSG
FT                   TVYSQGREVTDQYKTILARIIAFFTNLFRSWFSH"
FT   gene            complement(<667300..>667863)
FT                   /locus_tag="ZYRO0G08184g"
FT                   /old_locus_tag="ZYRO-ORF1234"
FT   CDS_pept        complement(667300..667863)
FT                   /locus_tag="ZYRO0G08184g"
FT                   /old_locus_tag="ZYRO-ORF1234"
FT                   /product="ZYRO0G08184p"
FT                   /note="similar to uniprot|P01149 Saccharomyces cerevisiae
FT                   YPL187W MF(ALPHA)1 Mating pheromone alpha-factor made by
FT                   alpha cells interacts with mating type a cells to induce
FT                   cell cycle arrest and other responses leading to mating
FT                   also encoded by MF(ALPHA)2 although MF(ALPHA)1 produces
FT                   most alpha-factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29418"
FT                   /db_xref="GOA:C5DZY4"
FT                   /db_xref="InterPro:IPR016326"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZY4"
FT                   /protein_id="CAR29418.1"
FT                   /translation="MRLSIALGVTFGAVAGLTAPVEEVKRDADAHFIELDPGQPMFKRE
FT                   AEAHFIELDPGQPMFKREAEAEAHFIELDPGQPMFKREAEAEAHFIELDPGQPMFKREA
FT                   EADAHFIELDPGQPMFKRDADAHFIELDPGQPMFKREAEAEAHFVELDPGQPMFKREAE
FT                   ADAHFIELDPGQPMFKRGEIESAA"
FT   gene            complement(<669189..>670454)
FT                   /locus_tag="ZYRO0G08206g"
FT                   /old_locus_tag="ZYRO-ORF1233"
FT   CDS_pept        complement(669189..670454)
FT                   /locus_tag="ZYRO0G08206g"
FT                   /old_locus_tag="ZYRO-ORF1233"
FT                   /product="ZYRO0G08206p"
FT                   /note="highly similar to uniprot|Q06892 Saccharomyces
FT                   cerevisiae YPL188W POS5 Mitochondrial NADH kinase
FT                   phosphorylates NADH also phosphorylates NAD( ) with lower
FT                   specificity required for the response to oxidative stress"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29419"
FT                   /db_xref="GOA:C5DZY5"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZY5"
FT                   /protein_id="CAR29419.1"
FT                   /translation="MLLRVPLRLGRFYTSLEYPAIRIRDYSKYVSLKSVQDLRLATSPD
FT                   FVTSANSKLQSLIWQKPMQNVFITKKPWTETTRSSMVHFISYLHDSFPEINVIVQPDVA
FT                   DEIAQDFRSTPRQDPHQPHILYTGTDEEIVSRTDLLVTLGGDGTILRAVSIFGNRQVPP
FT                   VLAFSLGTLGFLLPFDYQEHRRVFEKVISSRAKCLHRTRLECHIIRNGQSEDCSLATSL
FT                   HAMNDLFLHRGNSPHLANLDIFIDGDFLTRTSADGVAFSTPTGSTAYSLSAGGSIVSPL
FT                   VPSILLTPICPRSLSFRPLILPHSSHIRVRVGSKATQGPANAMVKLSVDGIPQEDLRIG
FT                   DEIHVVNEVGTIYLNGSQLPSTSNKRQVSERRKSIKNSGIYCIAKTENDWTRGLNELLG
FT                   FNSSFRLTKPQKEEELERDLTD"
FT   gene            complement(<670807..>671281)
FT                   /locus_tag="ZYRO0G08228g"
FT                   /old_locus_tag="Zyro0G.mRNA.2605.m"
FT   CDS_pept        complement(join(670807..671212,671271..671281))
FT                   /locus_tag="ZYRO0G08228g"
FT                   /old_locus_tag="Zyro0G.mRNA.2605.m"
FT                   /product="ZYRO0G08228p"
FT                   /note="similar to uniprot|P28263 Saccharomyces cerevisiae
FT                   YEL012W UBC8 Ubiquitin-conjugating enzyme that negatively
FT                   regulates gluconeogenesis by mediating the glucose-induced
FT                   ubiquitination of fructose-1 6-bisphosphatase (FBPase)
FT                   cytoplasmic enzyme that catalyzes the ubiquitination of
FT                   histones in vitro"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29420"
FT                   /db_xref="GOA:C5DZY6"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZY6"
FT                   /protein_id="CAR29420.1"
FT                   /translation="MSKVPRSFRLLEELEKGEKGLGPESCSYGLADSDDISMTTWNGTI
FT                   LGPPHSNHENRIYSLSIECGPNYPDHPPTIKFISKINLPCVDSKTGQVTPSTFHTLRDW
FT                   KRAYNMETILLELRKEMATPANKKLPQPKEGSTF"
FT   gene            <671493..>673457
FT                   /locus_tag="ZYRO0G08250g"
FT                   /old_locus_tag="ZYRO-ORF1231"
FT   CDS_pept        671493..673457
FT                   /locus_tag="ZYRO0G08250g"
FT                   /old_locus_tag="ZYRO-ORF1231"
FT                   /product="ZYRO0G08250p"
FT                   /note="similar to uniprot|P40957 Saccharomyces cerevisiae
FT                   YGL086W MAD1 Coiled-coil protein involved in the spindle-
FT                   assembly checkpoint phosphorylated by Mps1p upon checkpoint
FT                   activation which leads to inhibition of the activity of the
FT                   anaphase promoting complex forms a complex with Mad2p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29421"
FT                   /db_xref="GOA:C5DZY7"
FT                   /db_xref="InterPro:IPR008672"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZY7"
FT                   /protein_id="CAR29421.1"
FT                   /translation="MVSSNGGSSPFLESPVHASPKMSPQTDRQVMSLQYKLNTVQNEFE
FT                   IEKLRLQQQSNLLDKKYRNVVEELEKALDDTKYLYETNGRLEQELSDLKNSSNQNDDTR
FT                   DEELRRLRSELRAKDYRIDELESNYQSKLSKLERKLENNQVESQSSQTLLKRYEEEISK
FT                   QSGQIKMLQRANSEKDDELATLKASNVVTQHHNYSTEDLQELTVTNKMLQDQLQYSKEL
FT                   EEANMQQAGELKRLRMTSESQNFWKSENEKLQNKVEQLNLLEKQFQDSQLENVQLKSQI
FT                   ASWGLYTDGKQSPEDIVRDWTLTKKECIVLNDENKKIRFDLMNLKNLNDELAHERNQLL
FT                   ELNKNYEANIINLKKLNHEVEQQKQLSFEECRLLRIEMEELSKFSKDSNRDADAGYGSL
FT                   VDSYKNQTEDLTGELKKLNDQLLAREPATKKRKASDQLGLNYSQRLNELQLENVSLSRE
FT                   LKKCQDTITILEDKIKNLTELKEKKIRILQLRDNPLLKDQFVKRKQLELLKKENADLLQ
FT                   FAQANNNGDKELESVPISVYESINFEIKQREEGLFRANKKFVRLKEVFNKKSLEFIDVV
FT                   NSLLGFRLEFQQDGKVKIISCFKPERSLVVDLNQNTLKSNLDRDIEDWESLLQLWVDQR
FT                   GQIPCFLATITLKLWEESA"
FT   gene            <673661..>674491
FT                   /locus_tag="ZYRO0G08272g"
FT                   /old_locus_tag="ZYRO-ORF1229"
FT   CDS_pept        673661..674491
FT                   /locus_tag="ZYRO0G08272g"
FT                   /old_locus_tag="ZYRO-ORF1229"
FT                   /product="ZYRO0G08272p"
FT                   /note="similar to uniprot|P53153 Saccharomyces cerevisiae
FT                   YGL085W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08272g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29422"
FT                   /db_xref="GOA:C5DZY8"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DZY8"
FT                   /protein_id="CAR29422.1"
FT                   /translation="MGDNRNLPVTQPNSINFNVVILSIFFSGSFIGAWAFFNRFLKQYT
FT                   KATEIPQNVFRKRWLFGKVTAVGDGDNFHFFHAPGGLIAGWGWLRPLPELNKSDPPISS
FT                   SKVGSSVPIHRRIFDSIFGRNKTRTAYSNYFLGLPVPYKNKRNLPTISIRICGVDAPER
FT                   AHFGNPAQPFSEEALIWLRHTLIGKCVWIKPLAVDQYNRCVAKVEYWTWTGWKNVSLEM
FT                   VKQGLAVVYESKTSAEFDGEEDKYRFHEMAAKARRRGIWSQKQFETPGEYKRRI"
FT   gene            complement(<674545..>676419)
FT                   /locus_tag="ZYRO0G08294g"
FT                   /old_locus_tag="ZYRO-ORF1227"
FT   CDS_pept        complement(674545..676419)
FT                   /locus_tag="ZYRO0G08294g"
FT                   /old_locus_tag="ZYRO-ORF1227"
FT                   /product="ZYRO0G08294p"
FT                   /note="similar to uniprot|P53154 Saccharomyces cerevisiae
FT                   YGL084C GUP1 Multimembrane-spanning protein and similar to
FT                   uniprot|Q08929 Saccharomyces cerevisiae YPL189W GUP2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29423"
FT                   /db_xref="GOA:C5DZY9"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZY9"
FT                   /protein_id="CAR29423.1"
FT                   /translation="MVLEALTDGLQRFFSFGVLDHRLEPSSRDRRRQMLLSKIYATPRG
FT                   RVSSKVSKQGPFGDLAIQSPLWKTWEFKFYYLAFVIVVPLTIKSVMDASSEENPNYSLY
FT                   EPLLSRGWIFGRKVDNSDLQYSFFRDNLPLLLGVMVLHTSIKRITLKLTKISKVYFDFI
FT                   FGIAFVVAAFGVNCFKYFAEILITFSIGSAFKFNPRLAILLSWTFGISLLFFNQKYSRY
FT                   SYGSISSILSCLDGQFQGLIPRWDVFFNFTLLKILSYNMDFLEKWQEKQSADINNSSIA
FT                   LKSLGKVSPPGSRSESPMSNASGSATGSSLELHKTRSNQHPLEEKERLVAPHPLHDYNL
FT                   LHYIAYVTYTPLFIAGPTITFNDYLYQTRVTLPSISLRNTTVYAIRFAFCFLTMEVIVH
FT                   FAYVVAITQRKAWYGDSPFQIFMIGLFGLTVVWLKLLIPWRLFRLWALMDCTDTPENMI
FT                   RCVYNNYSCLAFWRAWHRSFNKWVVRYIYIPLGGSQNRILTSLAVFSFVAIWHDIKLRL
FT                   LLWGWLIVLLLLPEMFATKYMNRYSDRSWYRHLCAAGGVVNIWVMVIANLFGFCMGTEG
FT                   TKDFLKEIFGTVAGLRFFLLASGFLFIMVQIMFEQREHEKRKGINIRC"
FT   gene            <677123..>679465
FT                   /locus_tag="ZYRO0G08316g"
FT                   /old_locus_tag="ZYRO-ORF1225"
FT   CDS_pept        677123..679465
FT                   /locus_tag="ZYRO0G08316g"
FT                   /old_locus_tag="ZYRO-ORF1225"
FT                   /product="ZYRO0G08316p"
FT                   /note="similar to uniprot|P53009 Saccharomyces cerevisiae
FT                   YGL083W SCY1 Suppressor of GTPase mutant"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29424"
FT                   /db_xref="GOA:C5DZZ0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZZ0"
FT                   /protein_id="CAR29424.1"
FT                   /translation="MFWFSKTGISSKYTFSASPTFITEPWSVYTGRPKDTSTSSSGPSK
FT                   VSIFIFDKKRFETHLLTYGIIKSKNSSHDKALIAEAYEVLRNQVGNLAKLKHPNILHVV
FT                   EPLEEHSKNFMFVTEYVTGSLESVFTNVDEELNFFKGHVREDIVIQRGILEITQALEFI
FT                   HNRASCVHLDIQPRSVFINDNSDWKVSGFGHLWNLPQSTNSAEYFMQQFDPRVPPFMHL
FT                   ALDYTAPEIVLDSTVSFKSDYFSLGSLILKLYTGKSLLNSENSSSQYRDEYAKFERKLV
FT                   NRSWEGVISNIPHNLKICMPKLMNRDIYERYENISDFLKCDFFQDPLMKTLNFLDDLPT
FT                   KDRDDRLLYLEGLVELLPKYPSSLLQRKFLTVLLHLLSQLCGDVKLDAASLSMDVHLII
FT                   RIGSTLSQLTFQERVFPVLADKSNFPHILKHATLPLAENISTLKDKIRQDDFMQVILKP
FT                   LITYVFRDMKDELAVPTQEKLLEKMAVLTDIFDFLTVKSFLLPLLSELFGRTTSLTVKT
FT                   ACVSCFQLLIERKNVDTDLTCQEILPLFQSMKTRDPRILMQSLNLFETVPHVVKSENLL
FT                   VEQLLPLLWRYSLAPTLQTSQYAQYLQTTNKITSDIQQNHMESLSKTNRSQDANGTRDF
FT                   NRLIEPTKINDPPREDTDTKNANSIATPAIQPVRKTSANKASTPLNPLTAKFTEELPSR
FT                   SKLTRPPRRPEVKTTKLDEDDFDEFVSAASPTLSQRNINVSQPNGTDSPSYNSLQTPQT
FT                   SGGSNTQTVNSISLPPGFSVPLQPSKK"
FT   gene            <679961..>680164
FT                   /locus_tag="ZYRO0G08338g"
FT                   /old_locus_tag="Zyro0G.mRNA.vl.392.p"
FT   CDS_pept        679961..680164
FT                   /locus_tag="ZYRO0G08338g"
FT                   /old_locus_tag="Zyro0G.mRNA.vl.392.p"
FT                   /product="ZYRO0G08338p"
FT                   /note="similar to uniprot|Q3E823 Saccharomyces cerevisiae
FT                   YPL189C-A"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29425"
FT                   /db_xref="GOA:C5DZZ1"
FT                   /db_xref="InterPro:IPR031459"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZZ1"
FT                   /protein_id="CAR29425.1"
FT                   /translation="MRAATRINVTNKLYVSTFLVAFSSVALTSIFPCPAHSLDSDSPAD
FT                   ELPQDETKQSQLLKKRELQGKF"
FT   gene            <680710..>682986
FT                   /locus_tag="ZYRO0G08360g"
FT                   /old_locus_tag="ZYRO-ORF1224"
FT   CDS_pept        680710..682986
FT                   /locus_tag="ZYRO0G08360g"
FT                   /old_locus_tag="ZYRO-ORF1224"
FT                   /product="ZYRO0G08360p"
FT                   /note="similar to uniprot|P38996 Saccharomyces cerevisiae
FT                   YPL190C NAB3 Single stranded DNA binding protein acidic
FT                   ribonucleoprotein required for termination of non-poly(A)
FT                   transcripts and efficient splicing interacts with Nrd1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29426"
FT                   /db_xref="GOA:C5DZZ2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZZ2"
FT                   /protein_id="CAR29426.1"
FT                   /translation="MSDNNGAYEPVTDTDNVGSQTEASGSSEAQDAMKSILASVEEAKQ
FT                   NASDSDGNDDEEEGSDDLYEDKSGSENDNKETGSANEEQEDEENTSQGSSNKEELRDEH
FT                   SSEGSDEESSKEKDVKVEEAGEKQTEEKEESYDEDNNDNDNSESSEESNRAQEEQDEEE
FT                   MDEEEKSIENGVDEDTKPASVQSSLRDATIHNELLQKQANYIMASDMLNLAEFQELSSR
FT                   DKVAAIVNMLNSNPDTALPTSGSSVTNNSESDGFPEQTNWPRPSVDEKQRPDLNGPMTA
FT                   VERERYNKYLRGENKITEMHDIPPKSRLFIGNLPLKNVSKEELFRIFSPYGHILQINIK
FT                   NAFGFIQYDNPQSVRNAIAHESQEMNFGKKLILEISSSNARPQFDHGDHGTNSSSTFIS
FT                   SSKRPFQHEDNDAADMYNDNQGYKKSKRCVPACVIYVKRTADRSYANEVFSHFRRGTGL
FT                   ETDMIFLKPRMELRRMINDVAYDGVWGVILVNKTRNVDIQIFYKGPQGETKFDEYISIS
FT                   SDDAIAIFNNLKTSKGSGGMSASRAPPPTTLVGAPNPYAAAAPPPPHQSYYGGYGLTPP
FT                   MAQQPPMAPQQPPYVQAAPSAYAPYGAPAPAPPTATPYGRYQPQLAQPMPAAPPPPPAA
FT                   AAAAGDPGQHQLLAAIQNLPPNVVSNLLAAAQQQQQQQQQPQTNQQLLGLLQSMQPQPQ
FT                   PQQQQQQQFASQPVPQPQFQRLQQQHFPQPPAPLNSPPHQTQQPQQSAGNNVQSLLDSL
FT                   AKLQK"
FT   gene            <683440..>684585
FT                   /locus_tag="ZYRO0G08382g"
FT                   /old_locus_tag="ZYRO-ORF1220"
FT   CDS_pept        683440..684585
FT                   /locus_tag="ZYRO0G08382g"
FT                   /old_locus_tag="ZYRO-ORF1220"
FT                   /product="ZYRO0G08382p"
FT                   /note="similar to uniprot|P53155 Saccharomyces cerevisiae
FT                   YGL082W and similar to uniprot|Q08930 Saccharomyces
FT                   cerevisiae YPL191C Hypothetical ORFs"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29427"
FT                   /db_xref="GOA:C5DZZ3"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="InterPro:IPR033979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZZ3"
FT                   /protein_id="CAR29427.1"
FT                   /translation="MSLSFATKPVQVNGIPHRILLQNDNGPCALLALANTLLLAPRYAA
FT                   EARELATLAQHSSVKLEDLVQVLANIAIMSPNGANTDVNQLFQILPQLHTGLNVNPIFN
FT                   GSFEDGIEMAIFRLYNVGIVHGWIIDGDSDPIAREHVSKYSYESAQKILLQSYDIQNGS
FT                   YSPHNSQEIIEDANYIRSFLARSATQLTDYGLVHLKEILVEKSYAVLFRNDHFSTIYKY
FT                   EGELFTLVTDLGYKNRPDIVWQSLKSVNGSADVFYTGNFIPATQAAQEGPEQPIDSDAA
FT                   VATGATSNPAVNGGGVNNPFLGEGESETSAPYQLQQIEDDEALAKRLQEEEDDRAATNM
FT                   QRSYQRREKKKTVAENGNGNGDGNDTKSRKRDKIKKSCIIM"
FT   gene            <684847..>685782
FT                   /locus_tag="ZYRO0G08404g"
FT                   /old_locus_tag="ZYRO-ORF1219"
FT   CDS_pept        684847..685782
FT                   /locus_tag="ZYRO0G08404g"
FT                   /old_locus_tag="ZYRO-ORF1219"
FT                   /product="ZYRO0G08404p"
FT                   /note="some similarities with uniprot|P53156 Saccharomyces
FT                   cerevisiae YGL081W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08404g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29428"
FT                   /db_xref="GOA:C5DZZ4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZZ4"
FT                   /protein_id="CAR29428.1"
FT                   /translation="MEEVRKFRFSLREAQSDRGVIKVFGRASRKDPNRIAQRDNLFYDE
FT                   RSLSRNHALLGIKLMEPLADGITMDQFRIYVKDLESTYGIVDLNSQESDPFVIDLKNGE
FT                   RFGLIKLNNPISVNQRRGAKLKFQIDVDDVGEDEFECRVSDVSFDDSPLVTRPSTCDNE
FT                   IEFLSMLQGFSPSDSESESESEGTPCAPNDDMDSVSENSFYSETSESYALVNLYTLPKV
FT                   DIWDEDDEESDVRKEDFKVNEERIGNKRPLPDADDEDAQDEGQDIQFRPNKRAKTGIVS
FT                   KRDIITGTIGFLLGSVGTIGFLIGIAGRLE"
FT   gene            <685941..>686255
FT                   /locus_tag="ZYRO0G08426g"
FT                   /old_locus_tag="ZYRO-ORF1218"
FT   CDS_pept        685941..686255
FT                   /locus_tag="ZYRO0G08426g"
FT                   /old_locus_tag="ZYRO-ORF1218"
FT                   /product="ZYRO0G08426p"
FT                   /note="some similarities with uniprot|Q08931 Saccharomyces
FT                   cerevisiae YPL192C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29429"
FT                   /db_xref="GOA:C5DZZ5"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZZ5"
FT                   /protein_id="CAR29429.1"
FT                   /translation="MSDNEKVDKTEPKDSSVEVSPVKRVKRLEKKPLTPTKGRVSKPAR
FT                   QRTVSPRMKAKQVALATTRNPQQQQRQNKDSFYRGALLGSFLGATLSTVITNAIAKLLG
FT                   "
FT   gene            complement(<686252..>687217)
FT                   /locus_tag="ZYRO0G08448g"
FT                   /old_locus_tag="ZYRO-ORF1217"
FT   CDS_pept        complement(686252..687217)
FT                   /locus_tag="ZYRO0G08448g"
FT                   /old_locus_tag="ZYRO-ORF1217"
FT                   /product="ZYRO0G08448p"
FT                   /note="similar to uniprot|Q08932 Saccharomyces cerevisiae
FT                   YPL193W RSA1 RiboSome Assembly"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29430"
FT                   /db_xref="GOA:C5DZZ6"
FT                   /db_xref="InterPro:IPR019496"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZZ6"
FT                   /protein_id="CAR29430.1"
FT                   /translation="MYNPSSYGSPYPDPPPYGRALPRPTSSGTLENDVKRQKLDRPSPY
FT                   YIPQYQYGQPPPMTVPVPAPAPAPAPAPAPAPAPAPYYSPPQPTTYGSYWNQPVYPPPN
FT                   VPYMATPQALAPVKDSPVPTIKESRKEPLKNEPSIEESDAEENDDDGDVDGGNEANGDE
FT                   ATSSTSTIQGTSITLATEEDIAKWKEERKKMWLLKISNKRKEHMERMGVKEEELKGHSI
FT                   LHETKKQKQFIQNIQNQVNRTNPKSNLNVKIVQREMAQENVQLLQFIKELGDSHLLDYE
FT                   LTAEEKSKLFGSPDDKQRNARKPYTRGNHNNTNNARRGKS"
FT   gene            <687952..>688335
FT                   /locus_tag="ZYRO0G08470g"
FT                   /old_locus_tag="ZYRO-ORF1216"
FT   CDS_pept        687952..688335
FT                   /locus_tag="ZYRO0G08470g"
FT                   /old_locus_tag="ZYRO-ORF1216"
FT                   /product="ZYRO0G08470p"
FT                   /note="similar to uniprot|P53157 Saccharomyces cerevisiae
FT                   YGL080W FMP37"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29431"
FT                   /db_xref="GOA:C5DZZ7"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZZ7"
FT                   /protein_id="CAR29431.1"
FT                   /translation="MSQPVQRAAQRSLISRYVNKETLKYIFTTHFWGPVSNFGIPIAAI
FT                   YDLQKDPTLISGTMTSALLVYSAVFMRYAFAVTPKNFLLFGCHVINETAQLGQAYRFLD
FT                   YNYFSSPEKQAAIKAKYATVVPN"
FT   gene            complement(<688463..>690133)
FT                   /locus_tag="ZYRO0G08492g"
FT                   /old_locus_tag="ZYRO-ORF1215"
FT   CDS_pept        complement(688463..690133)
FT                   /locus_tag="ZYRO0G08492g"
FT                   /old_locus_tag="ZYRO-ORF1215"
FT                   /product="ZYRO0G08492p"
FT                   /note="similar to uniprot|Q08949 Saccharomyces cerevisiae
FT                   YPL194W DDC1 DNA damage checkpoint protein part of a PCNA-
FT                   like complex required for DNA damage response required for
FT                   pachytene checkpoint to inhibit cell cycle in response to
FT                   unrepaired recombination intermediates potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29432"
FT                   /db_xref="GOA:C5DZZ8"
FT                   /db_xref="InterPro:IPR007268"
FT                   /db_xref="InterPro:IPR026217"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZZ8"
FT                   /protein_id="CAR29432.1"
FT                   /translation="MSFKATFQDSEKHNIWFRTVSALTTVRKDINFTITSAELIAWAIN
FT                   TTDTTLCQVRFARSFFEDYEFKPYEIVFGEDGVQIVPDSHGTDQKLYSFEVNGRHLTTI
FT                   SKKPDGDSVNEFTIAINNTASCPDVLANRLLIHIEMSSLISKDYTPQFTPIKYDPIVID
FT                   LKYKRKFLDVYGSKSRSVQETLNHRLSEIFVEAERELSTALFNENNEPNPKDMNQLTMA
FT                   DEINLVCCNQALIKNFLDNCNPNITEEMKLEISHQKLCVTAFTKAIYGKNNDVLRNNIS
FT                   LSNTISTSDLECHCLFLKEINNGDKGDDGTKSIVFKLKDFKNFMSIGSSGKSSLSGNLN
FT                   IWFCHRGEPLLVELNRPDVKSELVQITDSSGMANAENENAITKATATVSPNTRASREPF
FT                   KAEPFLPRVSPLKSSSVPSKETRRSPLKNMGGSIPNKSSITRQLFVKEDDEHPLSVWNH
FT                   EEEELKREQPEPNEEILLAAPAERSRTTVGWGQRPLEPDHSLKPMDKQSMLKQEKRKYL
FT                   QELKDEQKRQKREINDRSTQESQEGLGPTQPNRPKGLFD"
FT   gene            complement(<690407..>693211)
FT                   /locus_tag="ZYRO0G08514g"
FT                   /old_locus_tag="ZYRO-ORF1213"
FT   CDS_pept        complement(690407..693211)
FT                   /locus_tag="ZYRO0G08514g"
FT                   /old_locus_tag="ZYRO-ORF1213"
FT                   /product="ZYRO0G08514p"
FT                   /note="similar to uniprot|Q7LIB1 Saccharomyces cerevisiae
FT                   YPL195W APL5 Delta-like subunit of the yeast AP-3 complex
FT                   which functions in transport of alkaline phosphatase to the
FT                   vacuole via the alternate pathway suppressor of loss of
FT                   casein kinase 1 function delta-like subunit of the yeast
FT                   AP-3 adaptin component of the membrane-associated clathrin
FT                   assembly complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29433"
FT                   /db_xref="GOA:C5DZZ9"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017105"
FT                   /db_xref="UniProtKB/TrEMBL:C5DZZ9"
FT                   /protein_id="CAR29433.1"
FT                   /translation="MSSLYAPTNEDVKQRLRPFGIFFEKSLKDLIKGIRANNETPEKLN
FT                   HFLAQALSECREEANSPDFNLKTNAVLKLTYLEMYGFDMSWANFHILEVMSSSKLQQKR
FT                   VGYLAASQSFYKDPDILMLATNLMKKDLKYTGTDDVVKVGIALSGLSTIITPPLAADIC
FT                   DDLFTMLNSSRPYIRKKAITALFKVFLQFPEALRDNFDKFAAKLEDDDTSVVSAAVSVI
FT                   CELSKKNPQPFIQLSPLLYEILVTISNNWIIIRLLKLFTNLSKVEPKLRPRLLPKILEL
FT                   MDSTTATSVLYESINCIVKGHMLEEDDYDVAMQCLDRLHTFCDSSDPNLRYISCVLFYK
FT                   IGKINTAFISQFDKLVMRLLNDVDVSIRSKAIELIEGIVDEDNLQNIVLVLLKQFVDQD
FT                   VVLLQVGGFETTREIPIFIPEQYKIKMVNAVIHICSMDNFANLNDFEWYNAVLWDLAIL
FT                   SQDLSDKSLGYRVGEQLRNIMIKVPSMREITMTTIIKVLYNEEINNHLPSILKDCFWSL
FT                   GEFSSFIENGDDLINLVFQRRKYYPADVEIILIPSLLKIFSNWCNRSTDIDPERVKSVL
FT                   SDLLSHFEPLCYSKAFEVQERAVQCMEFLKLASEAMEQDTEGLPLLLTDILPSFFNSYE
FT                   LKPISQGTQQKLQSCISVDCETPFLTEEELQAVLNQEENENDEGLFSEDLLLIDDSSSA
FT                   SYQNQDYDVPDESKANSEEPNVLDNEELESRKRAERESNPFYLSQNNDRTSKASTQLLD
FT                   FSHREADEPEAHLIRLNKNTNGTEDETERKRKSKKKHKKRVHVLSDEVVVENKPQSPTL
FT                   SIQSLPTNASSSRGKISLRMPTKLEKFDFSKPLVSPSHDGTSDARRQSTSGEQDELERL
FT                   RRKFETQQLEANETLENGENDEETIIIKKKKSSKKKKKHSSSKKSKKKDSVDETPKVSN
FT                   DTVI"
FT   gene            <693417..>694004
FT                   /locus_tag="ZYRO0G08536g"
FT                   /old_locus_tag="ZYRO-ORF1209"
FT   CDS_pept        693417..694004
FT                   /locus_tag="ZYRO0G08536g"
FT                   /old_locus_tag="ZYRO-ORF1209"
FT                   /product="ZYRO0G08536p"
FT                   /note="similar to uniprot|P53158 Saccharomyces cerevisiae
FT                   YGL079W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29434"
FT                   /db_xref="GOA:C5E000"
FT                   /db_xref="InterPro:IPR019371"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E000"
FT                   /protein_id="CAR29434.1"
FT                   /translation="MDDSSSEARAGIENDTTVRSRSPSVDSQSYAIPMPEEIEEQLSEE
FT                   SSSFDDSNSVESNEDQILGRALPESGQHAFSQDSQEFEPMLDVSKHIFDSLMQAIDSAD
FT                   FSEAISLQTKTSAVINSKSTELKQLIDETKVRFSQFKERFEKGSLTAKNIRGNLRYSKD
FT                   KIEKINALVRTSYPIEFNEAREKILERPLDDH"
FT   gene            complement(<694035..>694820)
FT                   /locus_tag="ZYRO0G08558g"
FT                   /old_locus_tag="ZYRO-ORF1208"
FT   CDS_pept        complement(694035..694820)
FT                   /locus_tag="ZYRO0G08558g"
FT                   /old_locus_tag="ZYRO-ORF1208"
FT                   /product="ZYRO0G08558p"
FT                   /note="similar to uniprot|Q08952 Saccharomyces cerevisiae
FT                   YPL196W OXR1 Protein of unknown function required for
FT                   normal levels of resistance to oxidative damage null
FT                   mutants are sensitive to hydrogen peroxide"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08558g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29435"
FT                   /db_xref="GOA:C5E001"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniProtKB/TrEMBL:C5E001"
FT                   /protein_id="CAR29435.1"
FT                   /translation="MGAFSRLKKSWSQSNYDTLKSRNNGGGPSKNINTHATEPNLKNNL
FT                   DNDEDVLPPITLNGYSPGTKRRLLTPEMCDEIRTLMPTRIQLYTDWNLLYSLEQHGSSL
FT                   QSLYHNVTPKSKSPMRVGYVLVIKDSKQGIFGAYSNEPFHPTSDRRYYGNGECFLWKME
FT                   KVPNLTIGCDGKTKTNIENGNEHKWQFRGYPFTGLNEFAIYCQSDFLSMGAGDGHYGLW
FT                   CDDNLFHGVSNPSLTYGNDVLSREGNKFHITALEVWKVG"
FT   gene            complement(<695127..>696746)
FT                   /locus_tag="ZYRO0G08580g"
FT                   /old_locus_tag="ZYRO-ORF1207"
FT   CDS_pept        complement(695127..696746)
FT                   /locus_tag="ZYRO0G08580g"
FT                   /old_locus_tag="ZYRO-ORF1207"
FT                   /product="ZYRO0G08580p"
FT                   /note="similar to uniprot|P20447 Saccharomyces cerevisiae
FT                   YGL078C DBP3 Putative ATP-dependent RNA helicase of the
FT                   DEAD-box family involved in ribosomal biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29436"
FT                   /db_xref="GOA:C5E002"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E002"
FT                   /protein_id="CAR29436.1"
FT                   /translation="MSKKELKDKKRVSEDDSNVDTKKHKSDKKEHKVKKDKKEKKDKKE
FT                   KKEKKEKKEKKEKKKEKESNKDSKIEKEEVKEEKENEEENVVIGGYQQSKDLANVPQSD
FT                   IDSFYKENEVSVEDSQKYNLRPLLSFSHLSLKPEIQSEISKFPKPTPIQSVSWPYLLSG
FT                   RDVIGVAETGSGKTFAFGVPAIDQLVSNGDAKRKSVKVLVISPTRELASQTYDNLIILT
FT                   NKVGLECCCVYGGVPKQEQRNQLRNSQVVVATPGRLLDLINEQSVDLSQVQYLVLDEAD
FT                   RMLEKGFEEDIKNIINQTNSRDRQTLMFTATWPKEVRELASTFMRDPVKVSIGNRDELS
FT                   ANKRITQIVEVIEPRQKDRKLLELLRKYQSGAKKDDKVLIFALYKKEASRVENNLKYNG
FT                   YDVAAIHGDLSQQQRTSALNDFKAGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVED
FT                   YVHRIGRTGRAGQTGTAHTLFTDNEKHLAGALVNVLNGANQPVPEELKKFGTHTKRKEH
FT                   GAYGAFFKDVDMSKKPKKVTFD"
FT   gene            complement(<697178..>698887)
FT                   /locus_tag="ZYRO0G08602g"
FT                   /old_locus_tag="ZYRO-ORF1205"
FT   CDS_pept        complement(697178..698887)
FT                   /locus_tag="ZYRO0G08602g"
FT                   /old_locus_tag="ZYRO-ORF1205"
FT                   /product="ZYRO0G08602p"
FT                   /note="similar to uniprot|P19807 Saccharomyces cerevisiae
FT                   YGL077C HNM1 Choline transporter (permease) that also
FT                   controls the uptake of nitrogen mustard expression is co-
FT                   regulated with phospholipid biosynthetic genes and
FT                   negatively regulated by choline and myo-inositol"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29437"
FT                   /db_xref="GOA:C5E003"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004756"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="UniProtKB/TrEMBL:C5E003"
FT                   /protein_id="CAR29437.1"
FT                   /translation="MSTSGEFQQRSSQSEIHKREFYEAPNEELSMDKNDMDKYDDESGS
FT                   GGSEEVVLRKSFSLWSILGVGFGLTNSWFGISASLVTGLSSGGPLLVIYGIILISLISI
FT                   TIGVSLGELTSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSFAYAGAIFTSASTTLSVA
FT                   SELVAMYQLTHEDFTPKRWQVFVTYLILHFFLMQFNCYGKSLPLIASSSLYISLLSFIV
FT                   ITITVLACSSGHFNSAKFVFSHFYNETGWSSGGIAFIVGLINPAWSFSCLDCATHMAFE
FT                   VEKPETIIPTAILGTIAIGFITSFCYVISLFFSIRDLPSVLNNTGGFPVLVIYEQALNS
FT                   KAGAIVLGCLILFTSFGCVIASHTWQSRLCWSFSRDGGLPFAGLWSKVNSRMGVPLNAH
FT                   LMSCVWVAIIGFLYLASSTAFNSLITACIAFLLLSYSIPVICLLMKKRQIAHGPFWFGK
FT                   FGLFCNIALLLWTVFCLVFFSFPPDYPVNKDNMNYVSVVIVGYFLYSLIYWKFWASKDF
FT                   HTHDDDDDEQTVAQEISNEGFDEYDGTDDSRTHSSVIATTPQHMDFIEKSTK"
FT   gene            complement(<699877..>701213)
FT                   /locus_tag="ZYRO0G08624g"
FT                   /old_locus_tag="ZYRO.mRNA.198AT.m"
FT   CDS_pept        complement(join(699877..700506,700772..700865,
FT                   701203..701213))
FT                   /locus_tag="ZYRO0G08624g"
FT                   /old_locus_tag="ZYRO.mRNA.198AT.m"
FT                   /product="ZYRO0G08624p"
FT                   /note="highly similar to uniprot|P05737 Saccharomyces
FT                   cerevisiae YGL076C RPL7A and to uniprot|Q12213
FT                   Saccharomyces cerevisiae YPL198W RPL7B Proteins component
FT                   of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29438"
FT                   /db_xref="GOA:C5E004"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/TrEMBL:C5E004"
FT                   /protein_id="CAR29438.1"
FT                   /translation="MVAEKVLAPETHLKKTAAQQKSAEQIAAERKAHKAANQEKRQVIL
FT                   QRNTQYQKEYEAAERAVIDAKREAKVNGTFYVEGQPKLVFVVRIKGINHMAPKQRKVLQ
FT                   LMRLNQINNGVFVKVTKATTELLKLIEPYIAYGYPSYSTIRQLVYKRGFGKINKQRIAL
FT                   SDNQIVEEHLGKYGILSIDDLIHEIYTVGPHFKQANNFLWPFKLSNPNGGWGVPRKFKH
FT                   FIQGGALGNREQFINKLVKSMN"
FT   gene            complement(<700595..>700684)
FT                   /gene="SNR39"
FT                   /locus_tag="ZYRO0G08646r"
FT                   /old_locus_tag="Zyro0G_snoRNA_251"
FT   ncRNA           complement(700595..700684)
FT                   /gene="SNR39"
FT                   /locus_tag="ZYRO0G08646r"
FT                   /old_locus_tag="Zyro0G_snoRNA_251"
FT                   /product="snR39"
FT                   /note="C/D snoRNA intronic SNR39/SNR59"
FT                   /ncRNA_class="snoRNA"
FT   gene            complement(<701588..>701682)
FT                   /gene="SNR39b"
FT                   /locus_tag="ZYRO0G08668r"
FT                   /old_locus_tag="Zyro0G_snoRNA_165"
FT   ncRNA           complement(701588..701682)
FT                   /gene="SNR39b"
FT                   /locus_tag="ZYRO0G08668r"
FT                   /old_locus_tag="Zyro0G_snoRNA_165"
FT                   /product="snR39b"
FT                   /note="C/D snoRNA monocistronic SNR39b"
FT                   /ncRNA_class="snoRNA"
FT   gene            <701987..>702745
FT                   /locus_tag="ZYRO0G08690g"
FT                   /old_locus_tag="ZYRO-ORF1198"
FT   CDS_pept        701987..702745
FT                   /locus_tag="ZYRO0G08690g"
FT                   /old_locus_tag="ZYRO-ORF1198"
FT                   /product="ZYRO0G08690p"
FT                   /note="similar to uniprot|Q08954 Saccharomyces cerevisiae
FT                   YPL199C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29439"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR013899"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E005"
FT                   /protein_id="CAR29439.1"
FT                   /translation="MNHSVAVGRGPMLTHSPQDYNHATDSEYQRLRDLAEQAYERKHKL
FT                   SHESQVAYKSGQKAKAHELSEKSKQEVAKAEDYNLQAAEYVFRQNNADSASDEIDLHGL
FT                   YVKEAQWILKKRIYATIQQGDPQIRVIVGKGLHSPHGIAKLKPAVEELCDEARLKNYID
FT                   PHNAGVLIIELKGSQVPQSWNAPDPGLSVSKPQQAHTMGYQPPQGPQYQQQQQPHMAPP
FT                   QQQQQQQQGGDGNLLVQMLSLLCVCISKSL"
FT   gene            complement(<702763..>703794)
FT                   /locus_tag="ZYRO0G08712g"
FT                   /old_locus_tag="ZYRO-ORF1197"
FT   CDS_pept        complement(702763..703794)
FT                   /locus_tag="ZYRO0G08712g"
FT                   /old_locus_tag="ZYRO-ORF1197"
FT                   /product="ZYRO0G08712p"
FT                   /note="weakly similar to uniprot|P53159 Saccharomyces
FT                   cerevisiae YGL075C MPS2 Essential membrane protein
FT                   localized at the nuclear envelope and spindle pole body
FT                   (SPB) required for insertion of the newly duplicated SPB
FT                   into the nuclear envelope potentially phosphorylated by
FT                   Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29440"
FT                   /db_xref="GOA:C5E006"
FT                   /db_xref="InterPro:IPR031433"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E006"
FT                   /protein_id="CAR29440.1"
FT                   /translation="MDFDKSSSSLVLDLAWNQVDKKNQDFIYAKDFPALIMSIEEILSR
FT                   GQQTPLAFLSNTGKSVIDTFAREKEFFKIYRDEFKEIFHGLVGKTFKDTIEGTNVSRSV
FT                   LDEQGQEPDVSTTPTRQQRSSPRKVNRLLKNLETRVASMKDELKFKDEILAEKDRELIQ
FT                   LTRKLSDYKDKYEFVQRQFSFYKDHGESPRRNSSESEQLNLEQNASTKHEFIISELKRK
FT                   LQEQTLAISNLKEQLQRGEGAGVLYTNYSKRYNPLHNDGPMVLVLATLVFLTIILLIGS
FT                   MIWVTGGKDDSNSFSQYSWWENNSLLSRIGWFFRDWSDTGVDYVNFEPSSDAYERIMGI
FT                   RRI"
FT   gene            <704684..>706402
FT                   /locus_tag="ZYRO0G08734g"
FT                   /old_locus_tag="ZYRO-ORF1195"
FT   CDS_pept        704684..706402
FT                   /locus_tag="ZYRO0G08734g"
FT                   /old_locus_tag="ZYRO-ORF1195"
FT                   /product="ZYRO0G08734p"
FT                   /note="similar to uniprot|P10961 Saccharomyces cerevisiae
FT                   YGL073W HSF1 Trimeric heat shock transcription factor
FT                   activates multiple genes in response to hyperthermia
FT                   recognizes variable heat shock elements"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29441"
FT                   /db_xref="GOA:C5E007"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5E007"
FT                   /protein_id="CAR29441.1"
FT                   /translation="MDRGSNKDSDVSPFNDDEIEQILHPNNLFTDDLRQLDKDSNSGAI
FT                   EDIINPSLDQNAANNSHNNNEAIENAIQRVSPVRMNNQLLPTRMFRPPVTAAQASTPKP
FT                   TTHKKRHLFVNKVWSMLNDESNGNLIRWAEDGKSFVVVNREEFVHQVLPKYFKHSNFAS
FT                   FVRQLNMYGWHKVQDVKSGSIQNSSDDKWQFENEFFIRGREDLLQHIVRQRPANQARLS
FT                   GPTDPGSGTANGNGEMHLSEYHLGDNVNFAALLNELEQIKYSQLAISKDLLRINKDNEL
FT                   LWKENMLARERHRTQQQALEKILRFLASLVPHMDQKMIAENIFQDVHNGNGNQTDMPGS
FT                   SASAAAAAGVPSSANLGVPSPGINGPFAPYDNEFQDFPNFNDGILPLDNRYLLRNGSPN
FT                   DSNSNYNSNLNHYDSNDVSTGRISEIPFDEEEEPSRSVGSNRSSFLSHLQSNMEEQDAR
FT                   IQQLEDMVTSQANPNSSPNQNQNSSLPPQASTTSGLTPLLQPEDNLMSLQENSPGVVVQ
FT                   DLSSHTNTNNNSTSSSTTRPQDADPAYSSAGKRVAHDDDHEDSLIEEIDTKKPRH"
FT   gene            <706808..>707824
FT                   /locus_tag="ZYRO0G08756g"
FT                   /old_locus_tag="ZYRO-ORF1193"
FT   CDS_pept        706808..707824
FT                   /locus_tag="ZYRO0G08756g"
FT                   /old_locus_tag="ZYRO-ORF1193"
FT                   /product="ZYRO0G08756p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29442"
FT                   /db_xref="UniProtKB/TrEMBL:C5E008"
FT                   /protein_id="CAR29442.1"
FT                   /translation="MGIPMDLYRQSCKRRYLDCPQIVKDRLWNDMRRSTNTAHSLSSYP
FT                   LGWKMCFRRRIHVNAPQFFYSCNELCWIGVNGTRLTIYHGESRGDLELPDAQVRCVGCH
FT                   QLDDSTIYVYVGTSRGVFRGILNGDSFTCPIWKVIPMGGCLALDASDAPSHLVALMEND
FT                   GVVISCSEGVFRLKEPVINNGNESYPAVDVSRNQLAISTWQERFDTNKNFDATPLLFPD
FT                   ESVLHVKCMNDSGILLHTNQRLVVIQPNQLQPITTNGCTCFHYDGHHIYTVEQHLYGTC
FT                   FTIYEMDGIEDKWCQVGYYDIRATFGISKVLGMNVSGSTVELLSERNQLYRFEIQYT"
FT   gene            <708666..>710342
FT                   /locus_tag="ZYRO0G08778g"
FT                   /old_locus_tag="ZYRO-ORF1192"
FT   CDS_pept        708666..710342
FT                   /locus_tag="ZYRO0G08778g"
FT                   /old_locus_tag="ZYRO-ORF1192"
FT                   /product="ZYRO0G08778p"
FT                   /note="similar to uniprot|P22149 Saccharomyces cerevisiae
FT                   YGL071W RCS1 Transcription factor involved in iron
FT                   utilization and homeostasis binds the consensus site
FT                   PyPuCACCCPu and activates the expression of target genes in
FT                   response to changes in iron availability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29443"
FT                   /db_xref="GOA:C5E009"
FT                   /db_xref="InterPro:IPR014842"
FT                   /db_xref="UniProtKB/TrEMBL:C5E009"
FT                   /protein_id="CAR29443.1"
FT                   /translation="MDSISTSSGLVPDSMTESAESHSRQTNDGSLAIQANELPKALAED
FT                   QNKFIHLDPVPDFRDKAEIKPWLQKIFYPQGIEIVIERSDNIKVIFKCKAAKRGKNTKP
FT                   RRNEVTTTSSMSASSSSVTSPNTGLSSAAGKKKRSVSRFNTCPFRIRATFSLKRRKWNI
FT                   VVVNNSHSHELKFDPDSDEYRKFKEKLREDNDWDAVKQFDELEYKSRSNLPIESSLIPC
FT                   ECGLTSEIESFSIVLPSTKPAQNNNSTDSPSTNITNRNSVSSIGSGIGSNSSGMAPVIS
FT                   KPRSKKWQQQQQQRHREKLMRNPSTEHLFTQSQLQLQLQQLQQGCPVEFLDPSIFTDSF
FT                   ASSPASSTMATQPPQQQQQQQQQQQQQHSLQLTDPLTEFNEIDFTDIFKPHSIHLQDVH
FT                   SNTQQDHGSDLLQPSQSSPPQFLDTNHETASRRDEFPPLLFSPLDAAANELMTPTDDMS
FT                   VSPSHTSNSQNNSSQRWPTGISIHDQHQHQHQHQPILRQYFNDDEILAPARLASLWPQQ
FT                   QETSSSSPLRRVVNAVDSQSPCNENDYAVDDLLWKMNFENA"
FT   gene            complement(<710447..>710815)
FT                   /locus_tag="ZYRO0G08800g"
FT                   /old_locus_tag="ZYRO-ORF1191"
FT   CDS_pept        complement(710447..710815)
FT                   /locus_tag="ZYRO0G08800g"
FT                   /old_locus_tag="ZYRO-ORF1191"
FT                   /product="ZYRO0G08800p"
FT                   /note="highly similar to uniprot|P27999 Saccharomyces
FT                   cerevisiae YGL070C RPB9 RNA polymerase II subunit B12.6
FT                   contacts DNA mutations affect transcription start site"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29444"
FT                   /db_xref="GOA:C5E010"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR034012"
FT                   /db_xref="UniProtKB/TrEMBL:C5E010"
FT                   /protein_id="CAR29444.1"
FT                   /translation="MTTFRFCRDCNNMLYPREDNENQRLLFECRTCSYVEEAGNPLVYR
FT                   HELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCL
FT                   VCSHIFTSDQKNKRREFL"
FT   gene            <710992..>711543
FT                   /locus_tag="ZYRO0G08822g"
FT                   /old_locus_tag="ZYRO-ORF1189"
FT   CDS_pept        710992..711543
FT                   /locus_tag="ZYRO0G08822g"
FT                   /old_locus_tag="ZYRO-ORF1189"
FT                   /product="ZYRO0G08822p"
FT                   /note="similar to uniprot|P53163 Saccharomyces cerevisiae
FT                   YGL068W MNP1 Protein associated with the mitochondrial
FT                   nucleoid"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29445"
FT                   /db_xref="GOA:C5E011"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C5E011"
FT                   /protein_id="CAR29445.1"
FT                   /translation="MLRIITKRSPIVASRCGRLTTTPFLQQLNCRYQSTEASESKPSEP
FT                   VDPKISNIVNEISKLTLLETSVLINELKTQLNIPDIALPAAGAVAAPAGGAASGAAEEE
FT                   AQEEKPEEKTIFALKLESFDAKAKPKIIKEIKTMLGLSLVEAKKFAEAAPKVLKDNVAK
FT                   DDAEKIKSSLEALGAKVSLE"
FT   gene            complement(<711678..>712766)
FT                   /locus_tag="ZYRO0G08844g"
FT                   /old_locus_tag="ZYRO-ORF1187"
FT   CDS_pept        complement(711678..712766)
FT                   /locus_tag="ZYRO0G08844g"
FT                   /old_locus_tag="ZYRO-ORF1187"
FT                   /product="ZYRO0G08844p"
FT                   /note="highly similar to uniprot|P06245 Saccharomyces
FT                   cerevisiae YPL203W TPK2 Involved in nutrient control of
FT                   cell growth and division cAMP-dependent protein kinase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29446"
FT                   /db_xref="GOA:C5E012"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E012"
FT                   /protein_id="CAR29446.1"
FT                   /translation="MEYYEQYPHHHHHHHHFRQPEQAVPASASSHHKSLLPQRSGISKG
FT                   KYSLKDFQIMRTLGTGSFGRVHLVRSVHNGRYYAMKVLKKQQVVKMKQIEHTNDERHML
FT                   KLVEHPFIIRMWGTFQDAKNLFMVIDYIEGGELFSLLRKSHRFPNPVAKFYAAEVTLAL
FT                   DYLHSHNIIYRDLKPENLLLDRNGHIKITDFGFAKEVVTVTWTLCGTPDYIAPEVITTK
FT                   PYNKSVDWWSLGVLIFEMLAGYTPFYDATAMKTYEKILQGKVNYPPFFHPDVVDLLSKL
FT                   IMADLTRRLGNLQSGSQDIKSHPWFGEVIWEKLLAKDIETPYEPPVVPGVGDTSLFEMY
FT                   PEEHLDYGATGDDPYGQYFVGF"
FT   gene            complement(<713156..>714661)
FT                   /locus_tag="ZYRO0G08866g"
FT                   /old_locus_tag="ZYRO-ORF1186"
FT   CDS_pept        complement(713156..714661)
FT                   /locus_tag="ZYRO0G08866g"
FT                   /old_locus_tag="ZYRO-ORF1186"
FT                   /product="ZYRO0G08866p"
FT                   /note="similar to uniprot|P29295 Saccharomyces cerevisiae
FT                   YPL204W HRR25 Protein kinase involved in regulating diverse
FT                   events including vesicular trafficking gene expression DNA
FT                   repair and chromosome segregation binds the CTD of RNA pol
FT                   II homolog of mammalian casein kinase 1delta (CK1delta)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29447"
FT                   /db_xref="GOA:C5E013"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E013"
FT                   /protein_id="CAR29447.1"
FT                   /translation="MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSR
FT                   HPQLDYESRVYKYLSGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFTLKT
FT                   VIMLALQIICRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFNTHR
FT                   HIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKK
FT                   QKYDRILEKKLCTSVETLCAGLPQEFAEYMLYCRNLKFDERPDYLYLARLFKDLSIKLE
FT                   YHNDHLFDWTMLRYTKAMVEKQRDLLMDTPQDNSANAATDNNNMNAASNTPNNNNNNNG
FT                   SSQAAVNPNSKSDSFNKVKLLAMKKFATHFHYCKNEDKHHPTPEEIKQQSIQNSNAAAL
FT                   LPEELLSAIDKGMESLKHQHNQAPAPAPAQAVAAAAVTSQTAAAAGANATVTAPEPLLQ
FT                   QQQKESQYQPQQPLPQRTTHYPPQPSQPLQAKQEKPQGEDIWL"
FT   gene            <715926..>716438
FT                   /locus_tag="ZYRO0G08888g"
FT                   /old_locus_tag="ZYRO-ORF1184"
FT   CDS_pept        715926..716438
FT                   /locus_tag="ZYRO0G08888g"
FT                   /old_locus_tag="ZYRO-ORF1184"
FT                   /product="ZYRO0G08888p"
FT                   /note="highly similar to gnl|GLV|CAGL0J04400g Candida
FT                   glabrata CAGL0J04400g and similar to YBL021C uniprot|P13434
FT                   Saccharomyces cerevisiae YBL021C HAP3 Subunit of the heme-
FT                   activated glucose-repressed Hap2p/3p/4p/5p CCAAT-binding
FT                   complex a transcriptional activator and global regulator of
FT                   respiratory gene expression contains sequences contributing
FT                   to both complex assembly and DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29448"
FT                   /db_xref="GOA:C5E014"
FT                   /db_xref="InterPro:IPR003956"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5E014"
FT                   /protein_id="CAR29448.1"
FT                   /translation="MSLDEKNEDSRLSSPPNDDSNNGGGGSSSAEIDSATRRMQYMAEL
FT                   REQDRWLPINNVSRLMKNTLPTSAKVSKDAKECMQECVSEFISFVTSEASDRCAGDKRK
FT                   TINGEDILISLHALGFENYAEVLKIYLAKYRQQQALKNQLMYEQEDGEEDGERQREMSQ
FT                   EDENSPE"
FT   gene            <716835..>720200
FT                   /locus_tag="ZYRO0G08910g"
FT                   /old_locus_tag="ZYRO-ORF1183"
FT   CDS_pept        716835..720200
FT                   /locus_tag="ZYRO0G08910g"
FT                   /old_locus_tag="ZYRO-ORF1183"
FT                   /product="ZYRO0G08910p"
FT                   /note="similar to uniprot|P36775 Saccharomyces cerevisiae
FT                   YBL022C PIM1 Mitochondrial ATP-dependent protease involved
FT                   in intramitochondrial proteolysis involved in degradation
FT                   of misfolded proteins in mitochondria required for
FT                   bigenesis and maintenance of mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08910g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29449"
FT                   /db_xref="GOA:C5E015"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027503"
FT                   /db_xref="UniProtKB/TrEMBL:C5E015"
FT                   /protein_id="CAR29449.1"
FT                   /translation="MISSKTSRAVSQFLTRRLVRNSRTYLRPVVSNTRNASSLHGRGPS
FT                   LDQIALSSDIHWQRFQSQQKNESLQLNLKDLERQWMNQLMGISAKAEKDHDDGGKQQPM
FT                   KKQEDEEGQVEEKDKQEEGNDKVEEHEKDRKNLEEKSESQGSPTSSSATAGLPAGGNNG
FT                   SDGNDSSGNDGNNRNKSKKHTPPEVYPQMLALPISRRPLFPGFYKAVVISDDRVMKAIR
FT                   EMLDRQQPYIGAFMLKNSESDSDVIHSTDEVYDVGVFAQITSAFPSKDEKTGTETMTAL
FT                   LYPHRRIKIDSLLAPKGDAKGTPAEAPQESKDETAEVTTETQDVNESKTVAETDSNAQA
FT                   VTTLEEEDLNPTEFLKNYDVSLVNVSNLEDDPFERKSPVVNALTSEILKVFKEISQLNS
FT                   MFREQIATFSASIQSATTNIFEEPARLADFAAAVSAGEEDELQEILESLNIEQRLEKSL
FT                   LVLKKELMNAELQNKISKDVETKIQKRQREYYLMEQLKGIKRELGIDDGRAKMIETFKK
FT                   RVENLQLPESVKNVFDEEVQKLSTLETSMSEFGVIRNYLDWITSLPWGITSKEQYSINS
FT                   AKKTLDEDHYGMNDVKDRILEFIAVGKLLGKVDGKILCFVGPPGVGKTSIGKSIARSLN
FT                   RKFFSFSVGGLTDVAEIKGHRRTYIGALPGRVIQALKKCQTQNPLILIDEIDKIGHAGI
FT                   HGDPSAALLEVLDPEQNSNFLDNYLDISIDLSRVLFVCTANTLDTIPRPLLDRMEVIEL
FT                   TGYVAEDKVKIAEQYLSPSAKRAAGLENANVDLAEDAIRSLMRKYCRESGVRNLKKHIE
FT                   KIYRKAALNVVKQLSMDDSPRIDKENVKENDKNPETPASASDGENAKESNGIEIEKTKD
FT                   SSESMKVSDDIKITVDSDNLKDYVGPPIFTSDRLYENTPPGVVMGLAWTSLGGTSLYVE
FT                   SVLEQPLQDCNHPSFERTGQLGDVMKESSRLAYSFTKMFLSSKFPQNRFFEKAAIHLHC
FT                   PEGATPKDGPSAGVTMATSLLSLALNKSIDPTVAMTGELTLTGKVLRIGGLREKAVAAK
FT                   RSGATTIIFPRDNLSDWEELPDNVKEGLEPVAADWYDDVFQRIFSGLTAEEANSTWESQ
FT                   FKLIDAKKDKEKEH"
FT   gene            <720464..>721996
FT                   /locus_tag="ZYRO0G08932g"
FT                   /old_locus_tag="ZYRO-ORF1180"
FT   CDS_pept        720464..721996
FT                   /locus_tag="ZYRO0G08932g"
FT                   /old_locus_tag="ZYRO-ORF1180"
FT                   /product="ZYRO0G08932p"
FT                   /note="similar to uniprot|P38067 Saccharomyces cerevisiae
FT                   YBR006W UGA2 Succinate semialdehyde dehydrogenase involved
FT                   in the utilization of gamma-aminobutyrate (GABA) as a
FT                   nitrogen source part of the 4-aminobutyrate and glutamate
FT                   degradation pathways localized to the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29450"
FT                   /db_xref="GOA:C5E016"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5E016"
FT                   /protein_id="CAR29450.1"
FT                   /translation="MIRYSSLLTRRTTNAIRVSQRYYSQSFDDPDLFRTRALINGKWIK
FT                   KPDSFPVRNPSTQEIVAKVSDCQLSDYEDAIVGAKAAFDEFRHTSPQERSDMLENLGNL
FT                   LIENKQDLARLITLENGKPFADALGEVLYSASYFRWFSQEAVRMYGTVIPGPSGNKQMF
FT                   SIRQPLGVVGIMTPWNFPSAMLARKVAPALATGNTCVVKPASETPLSALVIGWLCQQAG
FT                   FPPSTCSILPTSKTPEVGKLLCGHDLVKKVTFTGSTRVGRLLMAQCAQDSKIIKKVSME
FT                   LGGNAPFIIFNDADLDKALNGIIGCKFRQSGQTCVCANRIFVHKDVYDEFATRLVKRMI
FT                   STFNLGDGFNEKVTHGPLISAAAVEKVSQLVEDAKQKGAEVLAGGKKAEALGPYFYRPT
FT                   VLSGVNESMDIFHTEVFGPVASLVKFEDTEEVIRMANNTDVGLAGYFYTQDINRAQEIA
FT                   LRMETGMVGINTGAISDAALPFGGIKNSGLGREGSLHGLEDYTELKSIVLQA"
FT   gene            complement(<722062..>723105)
FT                   /locus_tag="ZYRO0G08954g"
FT                   /old_locus_tag="ZYRO-ORF1179"
FT   CDS_pept        complement(722062..723105)
FT                   /locus_tag="ZYRO0G08954g"
FT                   /old_locus_tag="ZYRO-ORF1179"
FT                   /product="ZYRO0G08954p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29451"
FT                   /db_xref="GOA:C5E017"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR040204"
FT                   /db_xref="UniProtKB/TrEMBL:C5E017"
FT                   /protein_id="CAR29451.1"
FT                   /translation="MSDISASEYISRQDELEQEARELMPWEPKTCTYEMGPLKQSVFAC
FT                   RSHKNIGLCYSCSIQCHTKCDIVELFTKRHFTCDCGTERDNQEPGEEGFRCQLRKNRES
FT                   DVPSLTNRYGQNFRGLFCECEKEYDPDSNDTMIQCVLGTECNEDWYHDSCMGKKIPPLE
FT                   SFDAYICWKCAKKYDYYLKRIISHPLGEKIVAHTLAHGVEEDKEDSKPTSGMKRSANEV
FT                   DSQHNNDEYSIFLKEGFSEKLGELKDSIEDHNDKLYLFLNDLVPFLIKDEPVYEPADDG
FT                   EDAPDDLVSNVLRNAMHREQAIAGISAFNALKMKLNEFLKPFAETGNVVKEEDIKSFFQ
FT                   RPEETSK"
FT   gene            <723356..>725971
FT                   /locus_tag="ZYRO0G08976g"
FT                   /old_locus_tag="ZYRO-ORF1178"
FT   CDS_pept        723356..725971
FT                   /locus_tag="ZYRO0G08976g"
FT                   /old_locus_tag="ZYRO-ORF1178"
FT                   /product="ZYRO0G08976p"
FT                   /note="highly similar to uniprot|P29469 Saccharomyces
FT                   cerevisiae YBL023C MCM2 Protein involved in DNA replication
FT                   component of the Mcm2-7 hexameric complex that binds
FT                   chromatin as a part of the pre-replicative complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29452"
FT                   /db_xref="GOA:C5E018"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008045"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:C5E018"
FT                   /protein_id="CAR29452.1"
FT                   /translation="MADNRRRRRENDEDSDSDNEIPPSSPQPLGRAAYDTVSSPIGAPD
FT                   SDLLENPEGEDDEIQDDPDLDELEEQMNEVDLMGDDMYGDYEADPERDRYDETHVDDAE
FT                   QQELSLADRRRIDAQLNQRDRLLKDGAYMDDDDAADATQLDEMGLPIQRRRRRRQYEDV
FT                   DADDDLLDDMEIDPLTEELTLESLSNVKANSYAEWITQPNVSRTIARELKSFLLEYTDE
FT                   TGRSVYGARIRTLGETNSESLEVNYRHLAESKAILALFLAKCPSEMLKIFDLVAMEATE
FT                   LHYPDYARIHSEIHVRISDFPTIHSLRELREANLNTLVRVTGVVTRRTGVFPQLKYVKF
FT                   NCLKCGSILGPFFQDSNEEIRISFCTNCRSKGPFTVNGEKTVYRNYQRITLQEAPGTVP
FT                   AGRLPRHREVILLADLVDISKPGEEVEVTGIYKNNYDGNLNAKNGFPVFATILEANSIK
FT                   RREGNALNDDEEGLDVFSWTEEEEREFRKMSRDRGIIDKIISSMAPSIFGHRDIKTAIA
FT                   CSLFGGVPKNVNGKHAIRGDINILLLGDPGTAKSQILKYAEKTAHRAVFTTGQGASAVG
FT                   LTASVRKDPITKEWTLEGGALVLADKGICLIDEFDKMNDQDRTSIHEAMEQQSISISKA
FT                   GIVTSLQARCSILAAANPNGGRYNSTLPLAQNVNLTEPILSRFDVLCVVRDFVDEESDE
FT                   RLAAFVVDSHIRSHPENDPDELDRQRGEDGDAMKDDGNEDEGYEHLTARQRRLQRQRKK
FT                   EEEVSPIPQELLIKYIHYARTKILPKLHQMDMNKVSRVYADLRRESISTGSFPITVRHL
FT                   ESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDSFVDAQKISVRRQLQRSFAIYTLGHH
FT                   "
FT   gene            complement(<726070..>728121)
FT                   /locus_tag="ZYRO0G08998g"
FT                   /old_locus_tag="ZYRO-ORF1175"
FT   CDS_pept        complement(726070..728121)
FT                   /locus_tag="ZYRO0G08998g"
FT                   /old_locus_tag="ZYRO-ORF1175"
FT                   /product="ZYRO0G08998p"
FT                   /note="similar to uniprot|P38205 Saccharomyces cerevisiae
FT                   YBL024W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29453"
FT                   /db_xref="GOA:C5E019"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023270"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E019"
FT                   /protein_id="CAR29453.1"
FT                   /translation="MGRRNFKKGKTFGARNDDDNGRGWSELVKENEKWEQYYKKLGLIS
FT                   EEDWPVFKSTCQAALPLTFRITGSRAHAQEVLDLFQQRHLANLTGIEFEGEPVKPPVEL
FT                   PWYPNHLAWQIDVPKSVIRKNPQFAKMQRFLVVENAVGNISRQEAVSMIPPTLLDVQPH
FT                   HTVLDMCAAPGSKTAQMIEYLHRDNDEPSGFVVANDADAKRSHMLVHQLKRLNSANLIV
FT                   VNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCSGDGTMRKNVNVWRDWTTQNGLAL
FT                   HNVQLNILNRGLHLLKSGGRLVYSTCSMNPIENEAVVAEALRKWGGKVRLVDCSDKLPG
FT                   LVRSNGINQWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGG
FT                   FFITVLEKVEEPESTPQADTKASEEPANKKAKTESTSTSAPASEKKERLPRDANEEPFA
FT                   FVDPNHEALKTCWGFYGIDDIFDRNTCLVRNATGEPTRVVYTVCPALRDLIQANDERLK
FT                   IIYSGVRLFVAQKSALECSWRIQSEALPIMKHHMTSNRIIKTNEELLKLLLEESFPSFE
FT                   IIGEKIGDEFVQQTKDISNGCAFIEVERDGSGKENLFLPVWKGNKCINLMVCKEDTQEL
FT                   LYRLFGVENLPKSNSARNKKVESKEETEEEKKETNGEQKETPKEEATA"
FT   gene            complement(<728273..>728689)
FT                   /locus_tag="ZYRO0G09020g"
FT                   /old_locus_tag="ZYRO-ORF1172"
FT   CDS_pept        complement(728273..728689)
FT                   /locus_tag="ZYRO0G09020g"
FT                   /old_locus_tag="ZYRO-ORF1172"
FT                   /product="ZYRO0G09020p"
FT                   /note="highly similar to gnl|GLV|CAGL0K01969g Candida
FT                   glabrata CAGL0K01969g and similar to YBL025W uniprot|P38204
FT                   Saccharomyces cerevisiae YBL025W RRN10 subunit of UAF
FT                   (upstream activation factor) involved in promoting high
FT                   level transcription of rDNA Upstream activation factor
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29454"
FT                   /db_xref="GOA:C5E020"
FT                   /db_xref="InterPro:IPR022793"
FT                   /db_xref="UniProtKB/TrEMBL:C5E020"
FT                   /protein_id="CAR29454.1"
FT                   /translation="MDRTVYEACSDLIVDYGTHKVSADEVLTQKVGGLVPIPFKTREEL
FT                   EIASDKDRKDGLFTGELVPSIDLRVLHYFATQLCLQKYPHLTEAFDETSLLTLGLLVEQ
FT                   WVKDYLRDSNGELASGSSQSVSKAINYRDSPANI"
FT   gene            complement(<729114..>729648)
FT                   /gene="SCR1"
FT                   /locus_tag="ZYRO0G09042r"
FT                   /old_locus_tag="Zyro0G_ncRNA_153"
FT   ncRNA           complement(729114..729648)
FT                   /gene="SCR1"
FT                   /locus_tag="ZYRO0G09042r"
FT                   /old_locus_tag="Zyro0G_ncRNA_153"
FT                   /product="SRP RNA"
FT                   /note="SCR1 (SRP RNA)"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            <729797..>730165
FT                   /locus_tag="ZYRO0G09064g"
FT                   /old_locus_tag="ZYRO-ORF1171"
FT   CDS_pept        729797..730165
FT                   /locus_tag="ZYRO0G09064g"
FT                   /old_locus_tag="ZYRO-ORF1171"
FT                   /product="ZYRO0G09064p"
FT                   /note="similar to uniprot|P40083 Saccharomyces cerevisiae
FT                   YER137C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09064g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29455"
FT                   /db_xref="GOA:C5E021"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:C5E021"
FT                   /protein_id="CAR29455.1"
FT                   /translation="MSDNQSLRVSQALDNLAKTILEQRDSSSYNEKLRRLEALINMILQ
FT                   TDSNGSKMDTTKLDSILREDDIEIIEKNHQRYALIPVIPLRSTTVSKNKKKNKIRCSYC
FT                   NEMGHTRANCEKKLQPQQ"
FT   gene            complement(<730224..>730571)
FT                   /locus_tag="ZYRO0G09086g"
FT                   /old_locus_tag="Zyro0G.mRNA.2476.m"
FT   CDS_pept        complement(join(730224..730457,730518..730571))
FT                   /locus_tag="ZYRO0G09086g"
FT                   /old_locus_tag="Zyro0G.mRNA.2476.m"
FT                   /product="ZYRO0G09086p"
FT                   /note="highly similar to uniprot|P38203 Saccharomyces
FT                   cerevisiae YBL026W LSM2 Component of small nuclear
FT                   ribonucleoprotein complexes involved in RNA processing
FT                   splicing and decay"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29456"
FT                   /db_xref="GOA:C5E022"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016654"
FT                   /db_xref="UniProtKB/TrEMBL:C5E022"
FT                   /protein_id="CAR29456.1"
FT                   /translation="MLFFSFFKTLVDQEVVVELKNDIELKGTLKSVDQFLNLKLDNISC
FT                   TDQTKYPHLGSVRNIFIRGSTVRYVYLNKNMVDINLLQDAARREAMTEKK"
FT   gene            complement(<730843..>732192)
FT                   /locus_tag="ZYRO0G09108g"
FT                   /old_locus_tag="ZYRO-ORF1169"
FT   CDS_pept        complement(730843..732192)
FT                   /locus_tag="ZYRO0G09108g"
FT                   /old_locus_tag="ZYRO-ORF1169"
FT                   /product="ZYRO0G09108p"
FT                   /note="highly similar to uniprot|P39958 Saccharomyces
FT                   cerevisiae YER136W GDI1 GDP dissociation inhibitor
FT                   regulates vesicle traffic in secretory pathways by
FT                   regulating the dissociation of GDP from the Sec4/Ypt/rab
FT                   family of GTP binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29457"
FT                   /db_xref="GOA:C5E023"
FT                   /db_xref="InterPro:IPR000806"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5E023"
FT                   /protein_id="CAR29457.1"
FT                   /translation="MDPESMDTEYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYG
FT                   GESASVTLSQLYDKFKQNPISKEEREAKFGRDRDWNVDLIPKFLMANGELTNILVHTDV
FT                   TRYVEFKQVSGSYVFKQGKIYKVPATEMEAISSSLMGVFEKRRMKKFLEWIGSYEEDDI
FT                   STHQGLDLDRNTMDEVYTKFGLGNSTKEFIGHAMALWTNDDYLHQPARPSVERVLLYCQ
FT                   SFSRYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLDTPIEKVDYNEQGKFQGVQTKL
FT                   GHFRAPLVIADPTYFPEKCKSTGQRVIRAICILDHPVASTNNADSLQIIIPQSQVDRKN
FT                   DIYIAIVSDSHHVCAKGHYLAIISTIIETDKPHKELEPAFQLLNPIEERFMGIAELFEP
FT                   KEDGSKDNVYLSRSYDSSSHFESMTDDVKDVYFRVTGHPLVLKTRQDGDN"
FT   gene            <732487..>734034
FT                   /locus_tag="ZYRO0G09130g"
FT                   /old_locus_tag="ZYRO-ORF1168"
FT   CDS_pept        732487..734034
FT                   /locus_tag="ZYRO0G09130g"
FT                   /old_locus_tag="ZYRO-ORF1168"
FT                   /product="ZYRO0G09130p"
FT                   /note="similar to uniprot|Q12298 Saccharomyces cerevisiae
FT                   YDR061W Mitochondrial protein member of the ATP-binding
FT                   cassette (ABC) transporter family transcriptionally
FT                   activated by Yrm1p along with genes involved in multidrug
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29458"
FT                   /db_xref="GOA:C5E024"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E024"
FT                   /protein_id="CAR29458.1"
FT                   /translation="MSQKAGFVVRIRDALFKSSLARNAPAVFPHRIRDFEVKPGEKWVI
FT                   WGPGKGQFMNILSNKYLSDPPLSLQFGVGGKYPRVEQVLFKGVMPTAHLSARYEYFKDE
FT                   FDVTCKKFILDNAVGSNNVSYDVAKTDREVDMALYDKLIDSLQLTDLQDRWAMGLSNGQ
FT                   MRRARLAYSLLKKPDLMLVDDPFLGLDPTATKIISEFLANYDLPIIIGLRFQDKIPNWC
FT                   THVCCVENDGQVLFQGPVNQHDVQIKELRDSRVSSRYSENMGSSDLEGLISGHPLFATK
FT                   PNVPHLELRGLDVKYRGQPVLSNLHWKVELGSRWHVQGNNGSGKSTLLSLITAEHPQSW
FT                   NSRVVEHGTPRRTGSSSYFDINKNIGMSAPELHAIFLKNCGDRLNVRESIATGFHEASN
FT                   NNFTPIWSKLNKDQQTMVEKFIKYFDLPSDKLFGELSVSDQKLALFVRSIVKMPKLLVL
FT                   DEAFSGMELEPMLRCHELLNHWPGTTMVVSHVPEETPKCHHYLRLVSPGVYDIGQVR"
FT   gene            <734390..>736096
FT                   /locus_tag="ZYRO0G09152g"
FT                   /old_locus_tag="ZYRO-ORF1167"
FT   CDS_pept        734390..736096
FT                   /locus_tag="ZYRO0G09152g"
FT                   /old_locus_tag="ZYRO-ORF1167"
FT                   /product="ZYRO0G09152p"
FT                   /note="highly similar to uniprot|P40970 Saccharomyces
FT                   cerevisiae YDR062W LCB2 Component of serine
FT                   palmitoyltransferase responsible along with Lcb1p for the
FT                   first committed step in sphingolipid synthesis which is the
FT                   condensation of serine with palmitoyl-CoA to form 3-
FT                   ketosphinganine"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29459"
FT                   /db_xref="GOA:C5E025"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5E025"
FT                   /protein_id="CAR29459.1"
FT                   /translation="MSDAKVEGPTGSTRVPLFVPENLPADVKKENEYGTLTSKEHLHQT
FT                   KSLNGKPMEPPIMDTPPYYISLITYLNYLIVIIFGHMHDFLGMTFQKDSHQDVMEKDGW
FT                   APWYSKFESFFSRRMKKKIDDCFSRPTTGVPGRFIRCIDRISHEENKYFTYPGTTSMCL
FT                   NLSSYNYLGFAQSEGQCTTTALQSVDKYGIHSGGPRTQIGTTDLHLDAERLIASFLGKQ
FT                   DAVIFSMGYGTNANFFNAFLDSKCLVISDELNHASIRTGVRLSGAAVRTFAHNDMVGLE
FT                   KLIREQIVLGQPKTNRPWKKILICVEGLYSMEGTLCSLPEVVELKKKYKCYLFVDEAHS
FT                   VGAMGPTGRGVCDLFGVDPNDVDFLMGTLTKSFGAAGGYIASNKWVIDRLRLDLTTSNY
FT                   AEPTPAPVLAQIIASLKTIKGELAPGEGKERLQRIAFNSRYLRLGLQRLGFIVYGAPDS
FT                   PVIPLLLYCPTKMPAFSRMMLQRKIAVVVVAYPATPLIESRVRFCVSSSLTKDDLDYLL
FT                   RHVSEIGDMLFLKASSGAASVPQDGRPPRWDVEDVIARTAEDCKNDNFFLT"
FT   gene            <736360..>736806
FT                   /locus_tag="ZYRO0G09174g"
FT                   /old_locus_tag="ZYRO-ORF1166"
FT   CDS_pept        736360..736806
FT                   /locus_tag="ZYRO0G09174g"
FT                   /old_locus_tag="ZYRO-ORF1166"
FT                   /product="ZYRO0G09174p"
FT                   /note="similar to uniprot|Q12156 Saccharomyces cerevisiae
FT                   YDR063W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09174g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29460"
FT                   /db_xref="GOA:C5E026"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR011171"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:C5E026"
FT                   /protein_id="CAR29460.1"
FT                   /translation="MASELYYFNTVTKEKIRKFRISTSRSETLQVLPIKIQPKDYEITI
FT                   DEEELEELEDVKELSELAEILPDNSPRYLLTAYPLTTRENIKQVPLVLIYWKPATVVSQ
FT                   EWKMLYAGALEQVRSECGTYKLVEVSSGLEDDADVEELKEQLEK"
FT   gene            <737073..>737895
FT                   /locus_tag="ZYRO0G09196g"
FT                   /old_locus_tag="Zyro0G.mRNA.1853.p"
FT   CDS_pept        join(737073..737093,737461..737895)
FT                   /locus_tag="ZYRO0G09196g"
FT                   /old_locus_tag="Zyro0G.mRNA.1853.p"
FT                   /product="ZYRO0G09196p"
FT                   /note="highly similar to uniprot|P05756 Saccharomyces
FT                   cerevisiae YDR064W RPS13 Protein component of the small
FT                   (40S) ribosomal subunit; has similarity to E. coli S15 and
FT                   rat S13 ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29461"
FT                   /db_xref="GOA:C5E027"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="UniProtKB/TrEMBL:C5E027"
FT                   /protein_id="CAR29461.1"
FT                   /translation="MGRMHSNGKGISSSAIPYSRNAPSWFKLSSESVVEQIIKYARKGL
FT                   TPSQIGVLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHLER
FT                   NRKDKDAKFRLILIESRIHRLARYYRTVAVLPPTWKYESATASALVN"
FT   gene            complement(<738073..>738146)
FT                   /locus_tag="ZYRO0G09218r"
FT                   /old_locus_tag="Zyro0G.tVal.AAC.53"
FT   tRNA            complement(738073..738146)
FT                   /locus_tag="ZYRO0G09218r"
FT                   /old_locus_tag="Zyro0G.tVal.AAC.53"
FT                   /note="tRNA-Val (AAC) cove score=67.58"
FT   gene            complement(<738476..>738549)
FT                   /locus_tag="ZYRO0G09240r"
FT                   /old_locus_tag="Zyro0G.tVal.AAC.52"
FT   tRNA            complement(738476..738549)
FT                   /locus_tag="ZYRO0G09240r"
FT                   /old_locus_tag="Zyro0G.tVal.AAC.52"
FT                   /note="tRNA-Val (AAC) cove score=67.58"
FT   gene            complement(<739471..>739543)
FT                   /locus_tag="ZYRO0G09262r"
FT                   /old_locus_tag="Zyro0G.tAla.TGC.51"
FT   tRNA            complement(739471..739543)
FT                   /locus_tag="ZYRO0G09262r"
FT                   /old_locus_tag="Zyro0G.tAla.TGC.51"
FT                   /note="tRNA-Ala (TGC) cove score=80.16"
FT   gene            complement(<740111..>741514)
FT                   /locus_tag="ZYRO0G09284g"
FT                   /old_locus_tag="ZYRO-ORF1159"
FT   CDS_pept        complement(740111..741514)
FT                   /locus_tag="ZYRO0G09284g"
FT                   /old_locus_tag="ZYRO-ORF1159"
FT                   /product="ZYRO0G09284p"
FT                   /note="similar to uniprot|P31755 Saccharomyces cerevisiae
FT                   YGL038C OCH1 Mannosyltransferase of the cis-Golgi apparatus
FT                   initiates the polymannose outer chain elongation of
FT                   N-linked oligosaccharides of glycoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29462"
FT                   /db_xref="GOA:C5E028"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039367"
FT                   /db_xref="UniProtKB/TrEMBL:C5E028"
FT                   /protein_id="CAR29462.1"
FT                   /translation="MIKPLNKSEFRLDKRTKQIFFGILLLYSLVAFHLSNKKYAKFITA
FT                   PEISNVALPTTSHVEQLNLKELRVKDRKLKDLREQLVMAFPYEPEKPIPRRIWQTWKVK
FT                   EDSLDFPASFRSYQRDWTEAATLQGFEYMLVPDDNIEAFLQNLYGELPLVLKAFKEMPK
FT                   NILKADFLRYLLLYARGGIYSDMDTFPLKPLNKWPSVDREKLKTFKETRKPVPYKGFKS
FT                   EEVVAQNEREPGLVIGIEADPDRTDWSDWFARRIQFCQWTIQSKPGHPVLRELILNITA
FT                   TTLYSVSSVKKTAEELIDKTHKNDYNVNYRDKRARDSHYDHDETKTDKNVDGSDIMNWT
FT                   GPGIFSDMVMQYLNNLIQNNNDVLLLNGNIYTPTTVDPAEAAAQDENGVSTKKFYRKII
FT                   ESLLVNRHIPWEFFTLITEPITVDDLMILPITSFSPDVGQMNAKGMDDEMALVKHQFEG
FT                   SWKGDAGHD"
FT   gene            complement(<742041..>742679)
FT                   /locus_tag="ZYRO0G09306g"
FT                   /old_locus_tag="ZYRO-ORF1157"
FT   CDS_pept        complement(742041..742679)
FT                   /locus_tag="ZYRO0G09306g"
FT                   /old_locus_tag="ZYRO-ORF1157"
FT                   /product="ZYRO0G09306p"
FT                   /note="similar to uniprot|P53184 Saccharomyces cerevisiae
FT                   YGL037C PNC1 NAD( ) salvage pathway gene pyrazinamidase and
FT                   nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29463"
FT                   /db_xref="GOA:C5E029"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C5E029"
FT                   /protein_id="CAR29463.1"
FT                   /translation="MRALIVVDVQNDFLPGGSLAVPHGDEIVKPVIDLIEDPTEKWDQV
FT                   VMTRDWHPHNHISFAKSHNLADFSPITYVSPVEGDDRKIEGTLFPVHCVEGTRGSQLAP
FT                   EMLEEQKKIGCLIVSKGYLQDREYFSAFNDIWDHHKTELNNYLHCHGIDEVYVVGLAFE
FT                   YCVKSTAISASKLGYKTTILQKYSKGFLSDEKSMQELKQELAENNVQLA"
FT   gene            <743013..>743966
FT                   /locus_tag="ZYRO0G09328g"
FT                   /old_locus_tag="ZYRO-ORF1156"
FT   CDS_pept        743013..743966
FT                   /locus_tag="ZYRO0G09328g"
FT                   /old_locus_tag="ZYRO-ORF1156"
FT                   /product="ZYRO0G09328p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29464"
FT                   /db_xref="GOA:C5E030"
FT                   /db_xref="UniProtKB/TrEMBL:C5E030"
FT                   /protein_id="CAR29464.1"
FT                   /translation="MARRQIFDIEGEKKGIKKKKSKKRMRLWNILFIALLILCIHCHRI
FT                   IPASNPSVVEPAAPINYGDISLLMINDFVLIIQVFMTCIPSGVLAPMLVDFVRISCLFN
FT                   MLSTFSLLSLSLLNGWDRLDESRTFKMEMRKTFNSWAENNEKRNWLNESVNWRELKNWV
FT                   NVFDIHFDMYVSNYTDVERNGKINRVICASFNMGQKSLFDMPFEQEICVTKEGIKKLGK
FT                   NRFSSLSVDTTKNLVKFLAKGGYVKAASNPPFYLFKLMETYGDMTIDFLETLQEMTSSL
FT                   QVETKSSLEKACSFHEGEKLLMLMRLKRPQAVASLM"
FT   gene            <744354..>746777
FT                   /locus_tag="ZYRO0G09350g"
FT                   /old_locus_tag="ZYRO-ORF1155"
FT   CDS_pept        744354..746777
FT                   /locus_tag="ZYRO0G09350g"
FT                   /old_locus_tag="ZYRO-ORF1155"
FT                   /product="ZYRO0G09350p"
FT                   /note="similar to uniprot|P53185 Saccharomyces cerevisiae
FT                   YGL036W Mtf1 Two Hybrid Clone 2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29465"
FT                   /db_xref="UniProtKB/TrEMBL:C5E031"
FT                   /protein_id="CAR29465.1"
FT                   /translation="MSRLNESYPHVSDGTAKALVSSTVKVMRYLSNTGDYKVVFKLINA
FT                   LGFFNQKVVEGRLNGSDLEGIDVFTPILQSEEVMKHKLDLVAIFLAYLSIHREFHPLIL
FT                   NSIKDWCKLLPEKKLITCTDTKYMPGFYTVVSLLDQYEEVTPQILQYLELDLAHVLVHV
FT                   WVPQWLQIAQTPLENDSLADLLLNEAKLDFVVATSNDLGQFIANKHLQKEPPTSYFIYK
FT                   ICKRISLFADWMPSSLYKPAAQLAISHGSSASGLHFDLQVLMEVVDHPELNFFQEPRLV
FT                   SLLHQATNNLRKVPFHKLHAALGTLGSIQSLPAIINMVQLLLCKFLINAGNVSELIQKA
FT                   DYRLQLHPNEKKWFNNRTNNKYQIPSWFETSLLPPLPPIAKSMFVFDNNEHESEQEAKS
FT                   FTIITNLLFESLNMVILMNTEMLKQYQWLNIDPLMIDVSDETFNIRHLVAGQFLLLYLI
FT                   PIIMAAMLSQQLLESQVGILSEKRKSIMRKIIFSNTTRLCETLIHAHGNIALYHLLKLC
FT                   TKASAEDMVLQGICLELLHHIFFGPNGTYNKQLCLENKLTTQALENYITVWNDGSHRYQ
FT                   PFFEKILNVEQPSVEVRTIPVSELYELLPDHEEILRTLQERSSSTPKSSAPSSVTKENS
FT                   QQKVGLTSRSGNVGTTTPLTYKYNPYSTPSFEPSKPVTLTPPVSFSSGTYTADTMGSTP
FT                   DTYTFNPRNNEMMMGRTTTPSDTNNYSTVFNGSFSGEPLSNLSRTIESLNGTPQTPSKG
FT                   FFSSPWDGSPGISVTPNNSKIVSTGKNYILGGHNRIKNNSRAQSIHIDNFKTGP"
FT   gene            <747001..>749052
FT                   /locus_tag="ZYRO0G09372g"
FT                   /old_locus_tag="ZYRO-ORF1154"
FT   CDS_pept        747001..749052
FT                   /locus_tag="ZYRO0G09372g"
FT                   /old_locus_tag="ZYRO-ORF1154"
FT                   /product="ZYRO0G09372p"
FT                   /note="similar to uniprot|P48234 Saccharomyces cerevisiae
FT                   YGR145W ENP2 Essential nucleolar protein of unknown
FT                   function contains WD repeats interacts with Mpp10p and
FT                   Bfr2p and has homology to Spb1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29466"
FT                   /db_xref="GOA:C5E032"
FT                   /db_xref="InterPro:IPR012580"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040382"
FT                   /db_xref="UniProtKB/TrEMBL:C5E032"
FT                   /protein_id="CAR29466.1"
FT                   /translation="MVLKSTSASDISVYQVSGTNVSRSLPDWIAKRRKRTLKNDLEYQN
FT                   RVELVQDFEFSEASNRIKVTKDGQSAMATGTYKPQIHLYDFANLSLKFERHTDAENVDF
FT                   LFLSDDWTKSVHLQNDRSIQFQNKGGLHYTTRIPKFGRSLAYNPLNCDLYVGSSSDELY
FT                   RLNLEQGRFLNPFKLETEGVNHVSTCETNGLLAVGMENNVVEFWDPRSRSRICNLVLGN
FT                   QLDNSPFEVTTTSFRQDGLNFACGTSNGYTYLYDLRSSEPYAVKDQGYGFPLKKIIWLD
FT                   NVDTENKIMTSDKRIAKIWDRVTGKPYASMEPNVDINDVEHVPGTGMFFTANEGIPMHT
FT                   YYIPHLGPSPRWCSFLDSITEELEEKPSETVYSNYRFITRDDMKKLNLSHLIGSNVLRA
FT                   YMHGYFINNELYDKVALLANPNAYRDEREREIRRRIEKERESRIRTTGAVKKPKVKVNK
FT                   ELVDKLSQKRGDTATEKVLADDRFKEMFADDDFQLDEDDYDYKQLNPVKSARETEEGSA
FT                   KRIRALTAAEESDEERIANRSAEDDEESESSESESEPEPELNEQETKRLQKQLKNQERK
FT                   RREKADEDKFMSEFNVGAAQNDSRQVTFDEKVKEQREQEQDKKDGGALLHRNHRGEAEI
FT                   TFIPQKNKPSQSKKTSNNKKTERNPSESGRSRPRYEGRRASKNVFRGM"
FT   gene            <750044..>751789
FT                   /locus_tag="ZYRO0G09394g"
FT                   /old_locus_tag="ZYRO-ORF1151"
FT   CDS_pept        750044..751789
FT                   /locus_tag="ZYRO0G09394g"
FT                   /old_locus_tag="ZYRO-ORF1151"
FT                   /product="ZYRO0G09394p"
FT                   /note="similar to uniprot|Q752V4 Ashbya gossypii AFR469W
FT                   SEC9 Protein transport protein SEC9 and weakly similar to
FT                   YGR009C uniprot|P40357 Saccharomyces cerevisiae YGR009C
FT                   SEC9 t- SNARE protein important for fusion of secretory
FT                   vesicles with the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09394g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29467"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:C5E033"
FT                   /protein_id="CAR29467.1"
FT                   /translation="MGIKKLLKIKPPEEQTHDKNREELMELGITTKNPNKKKRDKFAAY
FT                   GQYARDKSKNKVYAPPGYEPYATGESEDLNKSELDSSVQNSGSDGSSSNPYQVAGNEAD
FT                   PYAVKAGDGLSSDPFANVGAGALGIGSRNFASAYDGLTSHSPRPSAGTSRAGAGTGTSN
FT                   NPYNDVPATTNVGNRRAGGSPGVEAARSNPYGRRAAAGAYPSAAMGGEGPPASTGGNPY
FT                   SSMGIDEYSDGMKQPNLDFDLDLNEGPREGEYDPNQVAVDEDLNETIQDQSDNLNNAPT
FT                   SQEQELLPKPAPQRQQQQPAPQMYNPQPQWQFEEEEVEQRVQGQEMGASNRGYKTFEEL
FT                   QKEEEARQQQEEDEAVDEVKQEIRFTKQGSVQSTRNTLRMAQEAEMSGMNTIGMLGHQN
FT                   NQFGDIENNLDLMYAHNRVADDKIGELKKLNRSMFAVHVGNPFTSRRRAREKAETMKNR
FT                   KIEEKMLQQEKLQGVQSSTKRVEGALSPGNEPLSTSDRYKREEILNRAKRYQFEADEED
FT                   DMMEVEIDKNLDQIGQISGRLKKLALATGDEIDAQRKRLGKMEDNADDMDIRLHMNTQR
FT                   MAGIR"
FT   gene            complement(<751903..>752322)
FT                   /locus_tag="ZYRO0G09416g"
FT                   /old_locus_tag="ZYRO-ORF1148"
FT   CDS_pept        complement(751903..752322)
FT                   /locus_tag="ZYRO0G09416g"
FT                   /old_locus_tag="ZYRO-ORF1148"
FT                   /product="ZYRO0G09416p"
FT                   /note="weakly similar to uniprot|P48235 Saccharomyces
FT                   cerevisiae YGR146C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09416g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29468"
FT                   /db_xref="InterPro:IPR024368"
FT                   /db_xref="UniProtKB/TrEMBL:C5E034"
FT                   /protein_id="CAR29468.1"
FT                   /translation="MSAFNDFCIVCDQLIPQDSLPPRVDELLYCSEECMVKDTSRVPPA
FT                   AAPAELSESASSLGDVDSLIASPLLLPMDGMVPPPASGIEDSDYMLMELESASQAVPRT
FT                   QAVKEPCSPGAGNAVQVLDRVAEDNYKLWLSQCHW"
FT   gene            complement(<752797..>753786)
FT                   /locus_tag="ZYRO0G09438g"
FT                   /old_locus_tag="ZYRO-ORF1146"
FT   CDS_pept        complement(752797..753786)
FT                   /locus_tag="ZYRO0G09438g"
FT                   /old_locus_tag="ZYRO-ORF1146"
FT                   /product="ZYRO0G09438p"
FT                   /note="some similarities with uniprot|P27705 Saccharomyces
FT                   cerevisiae YGL035C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09438g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29469"
FT                   /db_xref="GOA:C5E035"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5E035"
FT                   /protein_id="CAR29469.1"
FT                   /translation="MTETPRKNNGEHAPRPHVCPICHRAFHRLEHQTRHMRTHTGEKPH
FT                   VCDFKNCGKRFSRSDELTRHRRIHTNPQPRAKRGRKKKSEILQETKPQDSPAPPSDEPP
FT                   SHSSSSTSLSLLRGTSESQEPELAISPSSTPFATPGTTPTVSRSSSRQRLTALSSLQRM
FT                   TPLTTTAPTYVDSTAPLRRRPGSALSLNDMLRESDSDSDDSDRGRKRSRTATPASSRSE
FT                   SVARANVNTTSATNTVAPILPTPTLGPAELSNRLLEIQRQQQQQHDPSTALPSTAGAST
FT                   AFSGSASAAGISNSTHHTDANSHPAQNPDQDPAPLPPLRSLPLQFPTG"
FT   gene            <755241..>755858
FT                   /locus_tag="ZYRO0G09460g"
FT                   /old_locus_tag="ZYRO-ORF1137"
FT   CDS_pept        755241..755858
FT                   /locus_tag="ZYRO0G09460g"
FT                   /old_locus_tag="ZYRO-ORF1137"
FT                   /product="ZYRO0G09460p"
FT                   /note="similar to uniprot|P53187 Saccharomyces cerevisiae
FT                   YGL033W HOP2 Meiosis-specific protein that localizes to
FT                   chromosomes preventing synapsis between nonhomologous
FT                   chromosomes and ensuring synapsis between homologs
FT                   complexes with Mnd1p to promote homolog pairing and meiotic
FT                   double-strand break repair"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09460g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29470"
FT                   /db_xref="GOA:C5E036"
FT                   /db_xref="InterPro:IPR010776"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040461"
FT                   /db_xref="UniProtKB/TrEMBL:C5E036"
FT                   /protein_id="CAR29470.1"
FT                   /translation="MVKLTSEDAQTLIESYLISQYRPFAINDIVLNLHGQITKAAATKA
FT                   LDSLVQEHRVTAKTFGKVIIYSCNEKELELPAGVESDNFTFAHLAELRKELKELDSDKS
FT                   AVTEALNKVLKEPSNAQLLHLQVAREQEIAHLQQVLTRLQEDWDPKMEPLINDLVKTDK
FT                   TLDKELKTRFKIMKNLLAIVKDTVRPTDMGEFLEEIGFEQMG"
FT   gene            <756123..>757040
FT                   /locus_tag="ZYRO0G09482g"
FT                   /old_locus_tag="ZYRO-ORF1136"
FT   CDS_pept        756123..757040
FT                   /locus_tag="ZYRO0G09482g"
FT                   /old_locus_tag="ZYRO-ORF1136"
FT                   /product="ZYRO0G09482p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29471"
FT                   /db_xref="GOA:C5E037"
FT                   /db_xref="InterPro:IPR002042"
FT                   /db_xref="InterPro:IPR019842"
FT                   /db_xref="UniProtKB/TrEMBL:C5E037"
FT                   /protein_id="CAR29471.1"
FT                   /translation="MSFLADSIYGKDNVKFLKVKKDASNPKLQQIMEATVKVLLKGNFD
FT                   VSYTEADNSPIVPTDTVKNTILILAKTNDTWPSEKFASTLALHFTTKYAHVSGVSIQIY
FT                   QERWVKFNVDGAPSQHSFVHQGPEKKIVELDYDKVPGPAQYKLSTSIKDLTVLKSTNSM
FT                   FYGYNVCDYTTLKPTEDRVLSTDIYSKWDWSPSRLGSLHTLSSGSCDGIFDQVYDEARA
FT                   ITLDIFAKENSASVQATMYNMATEILKKAPQVEYVSYELPNKHYFLFDFKWFKGLENDN
FT                   ELFYPSPHPNGLIKCKVGRKASKL"
FT   gene            complement(<757119..>757769)
FT                   /locus_tag="ZYRO0G09504g"
FT                   /old_locus_tag="ZYRO-ORF1135"
FT   CDS_pept        complement(757119..757769)
FT                   /locus_tag="ZYRO0G09504g"
FT                   /old_locus_tag="ZYRO-ORF1135"
FT                   /product="ZYRO0G09504p"
FT                   /note="similar to gnl|GLV|KLLA0E10879g Kluyveromyces lactis
FT                   KLLA0E10879g and some similarites with YGR147C
FT                   uniprot|P37293 Saccharomyces cerevisiae YGR147C NAT2 N
FT                   alpha- acetyl-transferase transfers acetyl group from
FT                   acetyl coenzyme A to the N-terminal methionine residues of
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29472"
FT                   /db_xref="GOA:C5E038"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniProtKB/TrEMBL:C5E038"
FT                   /protein_id="CAR29472.1"
FT                   /translation="MFRSLPGLRQSILRASKARPMGFIRCQSQQVKKPKSIKELMSTYG
FT                   YSALGVYLGLSLIDLPLCFLMVHSLGEETISVYLNKFKQAFGFGKSEDEVIREVRDKMA
FT                   RKQDEDNSQVQRSWWQEFKQSTLLAEFLIAYGIHKSLVIIRLPITAAITPPTVSLLQKW
FT                   GFNIGPQMFKTMSKDASIRYKGGNPKDFIKPTSNTQPPRNPHTKGQKWFNGMM"
FT   gene            complement(<758586..>759056)
FT                   /locus_tag="ZYRO0G09526g"
FT                   /old_locus_tag="ZYRO-ORF1132"
FT   CDS_pept        complement(758586..759056)
FT                   /locus_tag="ZYRO0G09526g"
FT                   /old_locus_tag="ZYRO-ORF1132"
FT                   /product="ZYRO0G09526p"
FT                   /note="similar to uniprot|P04449 Saccharomyces cerevisiae
FT                   YGL031C RPL24A and to uniprot|P24000 Saccharomyces
FT                   cerevisiae YGR148C RPL24B"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09526g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29473"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:C5E039"
FT                   /protein_id="CAR29473.1"
FT                   /translation="MKLEIDSFSGGKIYPGRGTLFVRGDSKIFRFQNAKSAALFKQRKN
FT                   PRRIAWTVLYRRHHKKGITEEVAKKRSRRAVKAQRPVVGASMELIKERRAVKPDVRKAQ
FT                   REEKKKADKEKRKSERSARRANKAKTAAAGGGEKVSKQQAKGAFQKVAATSH"
FT   gene            <759657..>760106
FT                   /locus_tag="ZYRO0G09548g"
FT                   /old_locus_tag="Zyro0G.mRNA.1910.p"
FT   CDS_pept        join(759657..759659,759792..760106)
FT                   /locus_tag="ZYRO0G09548g"
FT                   /old_locus_tag="Zyro0G.mRNA.1910.p"
FT                   /product="ZYRO0G09548p"
FT                   /note="highly similar to uniprot|P14120 Saccharomyces
FT                   cerevisiae YGL030W RPL30 Protein component of the large
FT                   (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29474"
FT                   /db_xref="GOA:C5E040"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:C5E040"
FT                   /protein_id="CAR29474.1"
FT                   /translation="MAPVKSQESINQKLALVIKSGKYTLGYKSTVKALRQGKSKLVIVA
FT                   ANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVTILDAGDSDILTAL
FT                   A"
FT   gene            <760320..>761591
FT                   /locus_tag="ZYRO0G09570g"
FT                   /old_locus_tag="ZYRO-ORF1129"
FT   CDS_pept        760320..761591
FT                   /locus_tag="ZYRO0G09570g"
FT                   /old_locus_tag="ZYRO-ORF1129"
FT                   /product="ZYRO0G09570p"
FT                   /note="similar to uniprot|P48236 Saccharomyces cerevisiae
FT                   YGR149W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29475"
FT                   /db_xref="GOA:C5E041"
FT                   /db_xref="InterPro:IPR021261"
FT                   /db_xref="UniProtKB/TrEMBL:C5E041"
FT                   /protein_id="CAR29475.1"
FT                   /translation="MVETVNQHHRSPSEGEPVRGFSKASLSSLLELLDPLASNVSLTYS
FT                   PNNYLVKAKKHLKNLDPSKLTDSSQERRQQLGEWKNKVQHRVRALDPPLQNIFFNNGST
FT                   LDKMFYPFTLVNIFLIGLLMGKFPEWFHVYYTVMFNILMPIRFYTYYKTNNHYFLADLC
FT                   YFTNMLCLLFIWAFPESVNLYQTCFALTFGTLSFAVITWRNSLVIHSLDKCTSCFIHII
FT                   PVCTMYVIHHGVVPEFQENRFPAASKKLAPFWNLKKNIVWTSFYYLIWQSLYHYFITIR
FT                   QSYKIKSGQRMTSFEYLTTHTYKDFWMVKLPAPWPMLIYIVTQYLYQLCTMCLCGIWYN
FT                   YRPAAAGFLILIFLCASHNGATYYVDFYGKRYEKEVGRLRDETESLQQQLKYTGTNSDS
FT                   SMDSVSVISAESLSKENEDPKKEQ"
FT   gene            complement(<761703..>764222)
FT                   /locus_tag="ZYRO0G09592g"
FT                   /old_locus_tag="ZYRO-ORF1128"
FT   CDS_pept        complement(761703..764222)
FT                   /locus_tag="ZYRO0G09592g"
FT                   /old_locus_tag="ZYRO-ORF1128"
FT                   /product="ZYRO0G09592p"
FT                   /note="similar to uniprot|P48237 Saccharomyces cerevisiae
FT                   YGR150C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29476"
FT                   /db_xref="GOA:C5E042"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E042"
FT                   /protein_id="CAR29476.1"
FT                   /translation="MLSLKSRGSWNVLRWIQVPRRTAVIPAKPSPMRRKRRRIKNVSSK
FT                   DLDLRGIDPQDSRALEFKVKQLQEFTRNLKEQFKLADSNTKKLEAEEELAKSIPEDDDK
FT                   RADELFGKLEAPAFEKPLPQPNLSTLILSAENQQLKKLIPVEIKERINDDGFLLARLID
FT                   KDNQNWNDIISKLYTTEKRLSDISMPIISSGILRKVKNLSYENIEKLDIMLLETKNGDI
FT                   TCFNRLMYETLLLNLSNLRPPTSGEEDKVTMKMRQLLERYDKSKEISPDVPSKMTQFSL
FT                   NCCLKYSTKSVSFENMEYFLSKFKNDYGITPNRENYTTVIQFYVKFGVSKQAWDVFDTM
FT                   KFLSSSHAPDVTTYNSVLHLCNRERDYAKAIDLYEEMLDRQLQPSIQTLNIMAKTMARA
FT                   SADNVISEGKADSLRLLGWKYIHTLESTFDHTKHETHFYHTLEAMMALAAYDGDVGFAR
FT                   ALYYKYTTRKYKEVVKYWKGKFDSQKIWQTALDPQLFNLLLLAYANFRPNKLPILLGYE
FT                   KGIKLRRNILNSVDYAGRYDLDDEIKVQLPMLPISDMNQAWQILAESRALWQFNLEFGG
FT                   YYDLRDTPEGFDTTRLQEMVSKSATQDELQFNILHQVSQWKFQLVNHSILNPKSLTTFL
FT                   TIPIKNGDRIEFMLRLKEFTFQQNDLESRIEKLYKGLKLVESRVEPNSHERDLAINQIE
FT                   MDENVKWFASMKHKIVAKNYIYELMMKAASAFKDSAISKDAWQSRGEYRKTKLFQQMDS
FT                   KRRIESDTQFAALMVQFFARQNMLTDALAIVMSTRKFIDWKYHMVKGLHEGLVKLEDEK
FT                   SISILLDIVNKKSSIELLDEKIRDFQL"
FT   gene            <764438..>764812
FT                   /locus_tag="ZYRO0G09614g"
FT                   /old_locus_tag="ZYRO-ORF1126"
FT   CDS_pept        764438..764812
FT                   /locus_tag="ZYRO0G09614g"
FT                   /old_locus_tag="ZYRO-ORF1126"
FT                   /product="ZYRO0G09614p"
FT                   /note="similar to uniprot|P53188 Saccharomyces cerevisiae
FT                   YGL029W CGR1 Coiled-coil protein that may contribute to
FT                   compartmentalization of nucleolar constituents expression
FT                   is growth-regulated"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29477"
FT                   /db_xref="GOA:C5E043"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniProtKB/TrEMBL:C5E043"
FT                   /protein_id="CAR29477.1"
FT                   /translation="MSSSEVGNKELDNSKVKGVPVSGRTWKVDKEQLRVGSRQVRNKKL
FT                   RSWELKQQKRLEDKQFKERMRQLKEDKEQEHQKWIQSLRERREKRAEKERYEMLATKMH
FT                   AKKVDRMRRREKRNKALKER"
FT   gene            complement(<765217..>765307)
FT                   /locus_tag="ZYRO0G09636r"
FT                   /old_locus_tag="Zyro0G.tPhe.GAA.50"
FT   tRNA            complement(join(765217..765252,765271..765307))
FT                   /locus_tag="ZYRO0G09636r"
FT                   /old_locus_tag="Zyro0G.tPhe.GAA.50"
FT                   /note="tRNA-Phe (GAA) cove"
FT   gene            <765491..>766492
FT                   /locus_tag="ZYRO0G09658g"
FT                   /old_locus_tag="ZYRO-ORF1125"
FT   CDS_pept        765491..766492
FT                   /locus_tag="ZYRO0G09658g"
FT                   /old_locus_tag="ZYRO-ORF1125"
FT                   /product="ZYRO0G09658p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29478"
FT                   /db_xref="GOA:C5E044"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniProtKB/TrEMBL:C5E044"
FT                   /protein_id="CAR29478.1"
FT                   /translation="MGPKKQGHLLEIIDEDVQSVNAFQGRLRKISSNSNGHQNDEDSNH
FT                   DSKRRKVHKDGSSKSSGKDNDHHDIMEGISQEDFRQYHKAKDRVRNFYKEQHEMQTMAY
FT                   NLQARVNYKTKTRAKMTIWDALCKLSELIDDSDPDTELSQIDHAIQTAESIRKDGKPRW
FT                   MQLVGLIHDLGKILYFFDSEAQWDVVGDTFPIGCRFAEENIFYEFFEGNPDNSHPIYST
FT                   KYGVYEPNCGLNSILISWGHDEYMYYIAKSQSILNEKALAMIRYHSFYPWHREGAYRYL
FT                   MNEKDCELLEVVQDFNKYDLYSKCSQKYDLKELEKYYRDLIDEYFPQKYVEF"
FT   gene            complement(<766783..>768306)
FT                   /locus_tag="ZYRO0G09680g"
FT                   /old_locus_tag="ZYRO-ORF1124"
FT   CDS_pept        complement(766783..768306)
FT                   /locus_tag="ZYRO0G09680g"
FT                   /old_locus_tag="ZYRO-ORF1124"
FT                   /product="ZYRO0G09680p"
FT                   /note="similar to uniprot|Q5AKC7 Candida albicans SCW11
FT                   Potential cell wall glucanase and some similarites with
FT                   YGL028C uniprot|P53189 Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29479"
FT                   /db_xref="GOA:C5E045"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5E045"
FT                   /protein_id="CAR29479.1"
FT                   /translation="MINAIQLLASLAFLHSLAAALPVKREIVTRMHTAPTHTNTDMYST
FT                   TTRIHVAPTVAYVVNGDVTYTTTLVPPNVDPTAEPVTSVIYGTSSAASQQPSQTPESSS
FT                   DSWSSPAPSSSPQAASSTTQLSSVSSQSPSPAPVSSSESSFPAPATSSESSSAAPATSS
FT                   ESSSPAPATSSQSSSPAPVTSSQSSSPAPAGSTQWTTLYPSSSSSSSSSPATPSSSWTP
FT                   ASSSSAPSSSSSSASSSGGLVSVPTAISYTPYNDDSTCKSSDQVNADLQEIQSKGIHRI
FT                   RVYGADCGAFENILPAATRLGMKVNQGLWIDQSGVNSIDDAVQSLIQYGTQNGWDIFDF
FT                   ITVGNEAINSGFCSVSDLISKIQSVKSQLRNAGYQGAVITSEPPVTFETNPQLCTDSGI
FT                   DFVGVNPHSFFDFGIDANDAGSFVKGQVQLAQNACGNMDIFVTETGYPSNGYIIGQEEP
FT                   TQENQRIAINSILEEMNNNVTILSFFNDKWKNPGPYGIEQWFGIESQFN"
FT   gene            complement(<769394..>771838)
FT                   /locus_tag="ZYRO0G09702g"
FT                   /old_locus_tag="ZYRO-ORF1120"
FT   CDS_pept        complement(769394..771838)
FT                   /locus_tag="ZYRO0G09702g"
FT                   /old_locus_tag="ZYRO-ORF1120"
FT                   /product="ZYRO0G09702p"
FT                   /note="similar to uniprot|P53008 Saccharomyces cerevisiae
FT                   YGL027C CWH41 Processing alpha glucosidase I involved in
FT                   assembly of cell wall beta 1 6 glucan and asparagine-
FT                   linked protein glycosylation ER type II integral membrane
FT                   N-glycoprotein disruption leads to a K1 killer toxin-
FT                   resistant phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09702g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29480"
FT                   /db_xref="GOA:C5E046"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR031335"
FT                   /db_xref="InterPro:IPR031631"
FT                   /db_xref="InterPro:IPR038518"
FT                   /db_xref="UniProtKB/TrEMBL:C5E046"
FT                   /protein_id="CAR29480.1"
FT                   /translation="MLIMLVTELLLNIFCLSIGALASQKAFSNDLSFEEYTEQSLLWAP
FT                   YRPNCYFGLRPRNVDETPFQLGIMWFDNSRTDGVTRLRHFVDQGDHLNKYGWDVYDPRL
FT                   GGRETIIDDDNNLNLTIYFTKSHNGQNWAVRLHGEPIDANRDTTASIILYMNQNGENSN
FT                   SRLVNMGSKSSKSMKFHGVSTELGEYEISVKRNSGKLFKDRALSSMEIVPGCDASKTSH
FT                   LSMNVPDDSVWKAKDVFQTLLADSVKSILETQPEDVHTSLIPSVFTVRNIYGLPPGNFH
FT                   FLQNTFDNSDPKGFELDVVYNKVKASERISSSEDVSNLISYTLAEVTARFNRNFQFSFQ
FT                   DEEHRKFAMETLSNLLGGIGYFHGKQLVDRTTELDEDTFREVPFTHPQEEGPLSLFTSV
FT                   PSRAAFPRGFYWDEGFHLLQIMDYDFDLAVEICLSWFELIEDGGWVAREVILGEEARSR
FT                   VPGRFAVQNPHIANPPTLLLAFSEMLGRAIEQANQGSMNRFGEEDATAGNNQLENNSEL
FT                   LITYAQKIYPKLLKHYNWFKTSQQSSLDDYLDILEEDGILDKVYVNETYRWRGRTVTHC
FT                   LPSGMDDYPRAQPPDDSELDVDALAWVGIMTRSMRQIAHILGLEKDEQMYSDIESRIVE
FT                   NLDVIHWSEEDGYYCDVTVGGEWDDQRSFSCHAGYVSILPFALKLMPKDSPKLDQIVSL
FT                   LSDSNKLFSDYGILSLSRDDEYFGKDENYWRGPVWMNINYLVLDALKFYYPEVVSKDKK
FT                   VPSDAKKLYQALKQNLIDTVFDNWEKTGYCYEQFNPKTGKGQGIEHFTGWTALIVNVMG
FT                   HA"
FT   gene            complement(<772244..>774973)
FT                   /locus_tag="ZYRO0G09724g"
FT                   /old_locus_tag="ZYRO-ORF1119"
FT   CDS_pept        complement(772244..774973)
FT                   /locus_tag="ZYRO0G09724g"
FT                   /old_locus_tag="ZYRO-ORF1119"
FT                   /product="ZYRO0G09724p"
FT                   /note="similar to uniprot|P32786 Saccharomyces cerevisiae
FT                   YBL014C RRN6 involved in the transcription of 35S rRNA
FT                   genes by RNA polymerase I member of yeast Pol I core factor
FT                   (CF) also composed of Rrn11p Rrn7p and TATA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29481"
FT                   /db_xref="GOA:C5E047"
FT                   /db_xref="InterPro:IPR019350"
FT                   /db_xref="UniProtKB/TrEMBL:C5E047"
FT                   /protein_id="CAR29481.1"
FT                   /translation="MDDGLLPQHFPTGAQLAVGVRGSSMYVPSQEETGKNGGWVRHFED
FT                   DMPFNLNELQIGKDAIVLDDPSTFIVEDDDEDGMESLRNLQDDSPVDDEVLDDDNEFNE
FT                   QWKETIIKDLRWERLSPSIPSNFSVFQGIDFHKDPMFDTRYGSPISPQDYVPGTLINDI
FT                   TQSDYLAAVRRKSKRETEKLLMFDPVVNDLFVAGNIQTARDLRSNSDQQTVIAFCSGET
FT                   NSILKLAVLPENKLHLANGAQWLQELFAKNVDDELGTFASIDLKASIKSIKIADVSSLL
FT                   GRCSDTVGVLTENALHFIKIDNIDPQTSHISYSMHEPLKSTSFGDFPFADFVFNPWELQ
FT                   QFAVVDIKGNWGVARLPKAIKPGSRIRFLPNLKGSIFDPEELSNWKRIEWSSSYSKLLI
FT                   IDASKMVELDIENDWQLEVVQAKTWSYLRDYRRIDDEFGALLTSKEIIIVSTKSGNEQV
FT                   SRVISWKHCLDPTDQTLRLSIQKMPLGFKMLILTCIFSKGHDKVYVHGFCHDQDRHLVQ
FT                   AVNGPILICMPHVFKGISSMHFLPYNEEERWIASDTQGQKLWLNFLFKDNSTNRLMHCF
FT                   LTNDELSDPQDQLFVTPERMDAVPSLLPPIARHIDQVRFFIGQTKVTMFEEPETPIAPD
FT                   SEIFQNFGYQLSEAINGIVESWENQQMDIEQVQPLLSDLTNVPTKYESMEELESLLHQL
FT                   SEYYRDLGIVLTDFKTISKLLIKEETMNFDLFFSKLLQCWDIVTPNSLSVTRKVFDSIL
FT                   WSILRFYKSANYDKIETELRESLTEPYSEMISHWDEDESQLMGDQTSDDRLIQESSRPQ
FT                   FLFGSQSQIPTIKSSQSKSTRRRRHPHSVQTESSFNVPFTPTEQDLSSSRISGSQWGLL
FT                   PNTMTPAFSLMSSPTPMLSQSQNSQRPRRKKKRIGGFG"
FT   gene            complement(<775201..>777327)
FT                   /locus_tag="ZYRO0G09746g"
FT                   /old_locus_tag="ZYRO-ORF1116"
FT   CDS_pept        complement(775201..777327)
FT                   /locus_tag="ZYRO0G09746g"
FT                   /old_locus_tag="ZYRO-ORF1116"
FT                   /product="ZYRO0G09746p"
FT                   /note="highly similar to uniprot|P00931 Saccharomyces
FT                   cerevisiae YGL026C TRP5 tryptophan synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09746g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29482"
FT                   /db_xref="GOA:C5E048"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C5E048"
FT                   /protein_id="CAR29482.1"
FT                   /translation="MSELLRQTFANAKKEGRNALITFMTAGYPRVEDTIPILKGFQEGG
FT                   VDVIELGMPFSDPIADGPTIQVSNTVALQNNVTLKQTLELVAKARAEGITVPILLMGYY
FT                   NPILTYGEERFIKDAAEVGVNGFIIVDLPPEEALKVRNYVRDNGLSLIPLVAPSTTNER
FT                   LELLSKVADSFVYVVSRMGTTGAQSSMANDLDELVNRVKQYTKEIPIAVGFGVSHRQHF
FT                   LDVGQHSDGVVIGSKIITLVGEAPEGKRGEVAKNYVSEILNGVTHSTLSKEEFKEIQKK
FT                   SIEIAKQQQELVNTFQEVHKFPIRFGDFGGQYVPEALHACLRELEQGFDEAVVDPKFWE
FT                   DFRSLYSYIGRPSSLHKAARLSEYIGGAQIWLKREDLNHTGSHKINNALAQVLLAKRLK
FT                   KTEVIAETGAGQHGVATATACAKFGLGCTVFMGAEDVRRQALNVFRMRILGAKVVAVTN
FT                   GTKTLRDATSEAFRFWVSNLKTTYYVVGSAIGPHPYPTLVRTFQSVIGQETKEQFAALN
FT                   DGKLPDAVVACVGGGSNSSGMFSPFEKDLSVKLLGVEAGGDGIDTDYHSATLTAGRPGV
FT                   FHGVRTFVLQDKEGQVHDTHSVSAGLDYPGVGPELAFWKASGRADFVAATDAQALQGFK
FT                   LLSQLEGVIPALETSHAVYGACELAKTLKPDQHIIINVSGRGDKDVQSVAEVLPKLGPK
FT                   IGWNLRFEEDPSSG"
FT   gene            complement(<777685..>779112)
FT                   /locus_tag="ZYRO0G09768g"
FT                   /old_locus_tag="ZYRO-ORF1114"
FT   CDS_pept        complement(777685..779112)
FT                   /locus_tag="ZYRO0G09768g"
FT                   /old_locus_tag="ZYRO-ORF1114"
FT                   /product="ZYRO0G09768p"
FT                   /note="some similarities with uniprot|P40356 Saccharomyces
FT                   cerevisiae YGL025C PGD1 Subunit of the Mediator global
FT                   transcriptional cofactor complex which is part of the RNA
FT                   polymerase II holoenzyme and plays an essential role in
FT                   basal and activated transcription direct target of the
FT                   Cyc8p-Tup1p transcriptional corepressor"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29483"
FT                   /db_xref="GOA:C5E049"
FT                   /db_xref="InterPro:IPR020998"
FT                   /db_xref="UniProtKB/TrEMBL:C5E049"
FT                   /protein_id="CAR29483.1"
FT                   /translation="MSGGEELSEILSINMKLDELESKLSSGDSSKESVMGAINETKGSI
FT                   LPMRLKFNDFLQTMSSIDKMQEVSPDEKFLLIKSKLLELTNSMQQVSEEFTKLQPLFDT
FT                   VPEYAERYGNKRYLPLETLRSATNGNGNDFSAQQLNQPNQQIPQSQQSVMESQQAQPLQ
FT                   QQQLQQQLQQQQQLQLQQQQLQQFQLQQQQQQQQINGNSAPSVNSVQSRKKSKSNAGTP
FT                   GSNVNTPSGGVTINNVTPSSKKPRKPRQPKRTPSGLNMGMGIGSVPTPIMSSSNFTPQN
FT                   VQSPAIGGGNVMSASNGNINGNGGNSVQSVNGVPPTSTMNTPMNNVMSPLGNTPSGFGL
FT                   SQSHPPQPLPQQLTQQLSQQLTQQRQQQVQQQRHQQAQAQAQAQAQAQAQAQAQQQQQQ
FT                   QQQAQQNPSQPQYGMAPHSGQLPQAQINMNTITPANILSMNMAADNQQNWGSRGGKDFD
FT                   PLDINNLDFGNLNMDFI"
FT   gene            complement(<779383..>780183)
FT                   /locus_tag="ZYRO0G09790g"
FT                   /old_locus_tag="ZYRO-ORF1111"
FT   CDS_pept        complement(779383..780183)
FT                   /locus_tag="ZYRO0G09790g"
FT                   /old_locus_tag="ZYRO-ORF1111"
FT                   /product="ZYRO0G09790p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29484"
FT                   /db_xref="UniProtKB/TrEMBL:C5E050"
FT                   /protein_id="CAR29484.1"
FT                   /translation="MDPSTRLEQRRLKFSKDASKKILDDPLSDKSLISRGSDLSILQKD
FT                   QTAREQLLSRIKKSQDKHTVDHGLRKLREAIVSVFNDSRDDPTLIAFVYEVYQLSYDYF
FT                   FREQDFTKLGNLVLNFMFQKFPADSHFQQLYALYSSHVESNLSKCISILANNRRPSITV
FT                   QERQLIRLSSIYLINLESPSQWFFILSHLPRRQIQFLTSIAAFQHMKERCYKYIKTCYN
FT                   QVTLDYVLDSWFYNMVGNSDIPNDWPLESIGGVQTLVLKRGTKT"
FT   gene            <780268..>781356
FT                   /locus_tag="ZYRO0G09812g"
FT                   /old_locus_tag="ZYRO-ORF1110"
FT   CDS_pept        780268..781356
FT                   /locus_tag="ZYRO0G09812g"
FT                   /old_locus_tag="ZYRO-ORF1110"
FT                   /product="ZYRO0G09812p"
FT                   /note="similar to uniprot|P32785 Saccharomyces cerevisiae
FT                   YBL013W FMT1 Methionyl-tRNA formyltransferase catalyzes the
FT                   formylation of initiator Met-tRNA in mitochondria potential
FT                   Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09812g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29485"
FT                   /db_xref="GOA:C5E051"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C5E051"
FT                   /protein_id="CAR29485.1"
FT                   /translation="MNLIWRSIGRRWYSLNVLYFGSDEFSIHSLRALNELKGRSVDKLQ
FT                   LVTRPPKWCGRSKSIKKNVPIVNVADQLGLPPARHCDSREDMLQLIDLVKSHEFNMIIA
FT                   VSFGRLIPAQLLEQVPYSLNVHPSLLPRYKGASPIQYTLLNQDRYTGVTIQTLHPHKFD
FT                   HGSIVAQTIPLKVQNLVQNRTVSEFEPGFPKRTAALMDQLGLQGGSLLKHVINDKLYAS
FT                   PPALNPPYNSCYASKITSEMRRLHWPQDTAETAITKLETLGPPYVFKQVDENKSKTMVD
FT                   ETPVKRIIFHNFERADFLPFSKAGEFIYNDKDQHIYVQCHSDALKIKELQFEGFKMEKP
FT                   EQFMKSLRKRCGTGTYQAHTFL"
FT   gene            <781689..>783968
FT                   /locus_tag="ZYRO0G09834g"
FT                   /old_locus_tag="ZYRO-ORF1109"
FT   CDS_pept        781689..783968
FT                   /locus_tag="ZYRO0G09834g"
FT                   /old_locus_tag="ZYRO-ORF1109"
FT                   /product="ZYRO0G09834p"
FT                   /note="similar to uniprot|P32784 Saccharomyces cerevisiae
FT                   YBL011W SCT1 High copy suppressor of choline-transport
FT                   mutants"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29486"
FT                   /db_xref="GOA:C5E052"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C5E052"
FT                   /protein_id="CAR29486.1"
FT                   /translation="MMPVDEKTTGGSSTTGFSTTSGDTELIARDLEPATSPSSKSSTNE
FT                   EKEDKDKGNEAHPHKQPFYRILIYNIILGMLLNIFDCFFREIRTRGGYKVPRQGPVIFV
FT                   AAPHANQFVDPVILMGQVKKVVNRRISFLVAEKSLKRRAIGFFSRCVMSIGVVRAQDNL
FT                   KPAKGKITIDPENPRKLIGHGTSFLTDFKPKGLIGLPKSLGNVEIDSIESETELTLRKE
FT                   FKMNKPEVKSILTKGTSFKYADKVNQSLVYHKVFEHLASNQCIGIFPEGGSHDRTDLLP
FT                   LKAGVAIMALGCMDKHPESNVKIVPCGMNYFHPHKFRSRAVVEFGNPISIPHELVEKYR
FT                   SPETNREAVKEMLDTISEGLKAVTVTCSDYETLIVVQAMRRLYAGHLSSRLPLSMVVEM
FT                   NRRLVKGYQTYREDPRIISLKKEIMTYNAHLSHYNIPDHLVMRDRMSFAKNLWLLCFRS
FT                   LRLLVMLAFALPGIIMFLPIFIVAKRISKQKAREALAASTVKIKANDVIATWKILIGMG
FT                   LAPLLYTLWSIMISYLLRHRFPGNKILTFVISYFACSAVTYSALLVGDIGMDIFKSLRP
FT                   LYLSITTPQGLRDLQKERHALAEKITELINTIGPELFPDFDADTLRHKYELDDEEEDRR
FT                   TAELKRRRLLKKQKIKHEVKRAERAKTAEREENENDGHSTDSDAVSLVNSENSLSNIPI
FT                   FSNPANLISEGSTSSADMSSGSEFAVEEKIGAKDGVSSKIVQAIWEKRSVEDHEGNNHD
FT                   DADDSE"
FT   gene            complement(<784236..>786206)
FT                   /locus_tag="ZYRO0G09856g"
FT                   /old_locus_tag="ZYRO-ORF1108"
FT   CDS_pept        complement(784236..786206)
FT                   /locus_tag="ZYRO0G09856g"
FT                   /old_locus_tag="ZYRO-ORF1108"
FT                   /product="ZYRO0G09856p"
FT                   /note="weakly similar to uniprot|P53191 Saccharomyces
FT                   cerevisiae YGL023C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29487"
FT                   /db_xref="GOA:C5E053"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniProtKB/TrEMBL:C5E053"
FT                   /protein_id="CAR29487.1"
FT                   /translation="MSSIHSQASDTLPQETQAATPPAQQQQYNRGKTPAIREENEEEED
FT                   GDASNDAINRDDKPSPKANSTRSSSSSNAVSSSNGGKSMSTITFEKQKVVPPRARTHSA
FT                   QSVLSTISLQPMFHQHAHQNQQQSQQPQQTNEDQRNLSCTNLARINQQIQSPAMSSIRK
FT                   KGVTNSVTSGRISDEDLEIGLRLPFTDDKRLYLDANSVKQRQQQKQKQLQKKDNASVKT
FT                   NGSTVVENEEVEEDDVVMQKRLTAQALRKLSNLRGSSTMGVGINQALINNDNNNNSNNG
FT                   NNNSLSYGDGDGRTIDEGSQDLEAMTHLKFGNKKVFLDSFPQGSNNNNNYYSSNNNNNN
FT                   NNNVAASLVTQQPSLQSIRKASLEVIQQPGQQLNTQQKVGVPPTSGTTPTNASSRRCVK
FT                   QINNPKKPLYLPAVLRDVSETNLTNEDFVRPPSPPQSLVSNNQTITSRNLHQQAQHSSQ
FT                   NTSASSTASIHSSSSSVMESCRRQIALWFFPNGEYSSMENRWSQLLDPPAPPTKRHWLH
FT                   DNKRGSCHYCHKLFTFWERKHHCRHCGDIFCQQHLGHWLYLNSDASFIIGGGGLGTLSK
FT                   ICDGCLEEYENVVKNPKWKSQKLGNFNQHGGLVEPTRAAAAAATPPKNVEGINVQNDDS
FT                   KGDFIGSVAGSVPADWNWSSF"
FT   gene            <787219..>789423
FT                   /locus_tag="ZYRO0G09878g"
FT   CDS_pept        787219..789423
FT                   /locus_tag="ZYRO0G09878g"
FT                   /product="ZYRO0G09878p"
FT                   /note="highly similar to uniprot|P39007 Saccharomyces
FT                   cerevisiae YGL022W STT3 Subunit of the
FT                   oligosaccharyltransferase complex of the ER lumen which
FT                   catalyzes asparagine-linked glycosylation of newly
FT                   synthesized proteins forms a subcomplex with Ost3p and
FT                   Ost4p and is directly involved in catalysis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09878g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29488"
FT                   /db_xref="GOA:C5E054"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:C5E054"
FT                   /protein_id="CAR29488.1"
FT                   /translation="MVTTGKSTIAESAKTPVLTGKSSLVRWVQTVLTFTIFLAIFGAAV
FT                   SSRLFSVIRFESIIHEFDPWFNFRATKYLVTHSFLEFLNWFDDRTWYPLGRVTGGTLYP
FT                   GLMTTSGAVWHLLKRIGLPVDIRNVCVMFAPAFSGITALATYHFTKEIKDSGAGLLAAA
FT                   FMAIVPGYISRSVAGSYDNEAIAITLLMVTFMFWIKAQKTGSILHATLTALFYFYMVSA
FT                   WGGYVFITNLIPLHIFILILMGRYNAKLYSAYTTWYAIGTLASMQIPFVGFLPIRSNDH
FT                   MAALGVFGLLQLVAFGHFVKTKVSSDKFRVVMIVSLALILVVGVAALFALTYFGFIAPW
FT                   TGRFYSLWDTNYAKIHIPIIASVSEHQPVAWPAFFFDTHFLIWLFPAGVFLLFLDLKDE
FT                   HVFVIVYSVLCSYFAGVMIRLMLTLTPVICVAAAVALSKIFDVYLDFSHTMKNKKVNVS
FT                   NLVSRLLVSSTFIFYLVLFVFHCTWVNKMAYSSPSVVLPSTTYDGRTVLIDDFREAYYW
FT                   LRLNTEEDAKIASWWDYGYQIGGMADRTTLVDNNTWNNTHIALVGKAMASPEEKSYEIL
FT                   KQLDADYVLVIFGGLLGFSGDDVNKFLWMVRISEGIWPDEINERNYFSATGEYRVDSSA
FT                   SQTMKECLMYKMSYQGYPELFGGQGIDKVRGQTILPSDVLPLDYFEEVFTSENWLVRLY
FT                   QLKKEDSEGRSLKDAGDYERSTTKSNKKKNFKKPDLDLRV"
FT   gene            complement(<789474..>790421)
FT                   /locus_tag="ZYRO0G09900g"
FT                   /old_locus_tag="ZYRO-ORF1103"
FT   CDS_pept        complement(789474..790421)
FT                   /locus_tag="ZYRO0G09900g"
FT                   /old_locus_tag="ZYRO-ORF1103"
FT                   /product="ZYRO0G09900p"
FT                   /note="similar to uniprot|P32788 Saccharomyces cerevisiae
FT                   YBL010C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29489"
FT                   /db_xref="UniProtKB/TrEMBL:C5E055"
FT                   /protein_id="CAR29489.1"
FT                   /translation="MDMSHSNPSNEPHADPVTQDTRDKEIKVNDVESRQVANSDEIADE
FT                   HKGDTQQEQESDSDDFGSFSDASIEQEEEHIAEEVSQELDDDSNNVEKYLDQILPLDDS
FT                   IPKEPLPNVELDTLIQDERPRIIYEQLVLLRTVLRPFIWDKSHIKSNLWHILRIPERTI
FT                   PNKQELGREPLNDSLFIALLNMLDDNKSRSQTALRDQLGINYSPPLAPIFLQEEVEKQE
FT                   EKEIPGLLAISPDEVENLQGYHDKLCQSIDLLLIKLQESRAEQIDLVKDKTTFENVVTN
FT                   LTGHTQRLYRDEVAFYNKHKNKNKRKNRFSWVGH"
FT   gene            <792083..>794320
FT                   /locus_tag="ZYRO0G09922g"
FT                   /old_locus_tag="ZYRO-ORF1101"
FT   CDS_pept        792083..794320
FT                   /locus_tag="ZYRO0G09922g"
FT                   /old_locus_tag="ZYRO-ORF1101"
FT                   /product="ZYRO0G09922p"
FT                   /note="some similarities with uniprot|P32789 Saccharomyces
FT                   cerevisiae YBL009W haspin"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09922g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29490"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5E056"
FT                   /protein_id="CAR29490.1"
FT                   /translation="MAMDLDSSFGEFADDRRFIALVVSDNEDDYDSSTDEAASDDESLE
FT                   ATPKANITPLGVRNSSNLNILNQDTSHSNNNNNNYGANNNKTPVPNSPRVSGSVRSPAT
FT                   TKSNKDEKKRWSFISNHSSTSSNNAKKRWSTLSSFTDSKDKDAKRDEKEKDKFVRRVPT
FT                   QGSGSVSSHKRISIDQHFEHSPTSKRSSTGSSLKQLFGLIALNDENKENHYPQKKQESA
FT                   KVPSTASTRGQPLKERRNTNVETPSSQRNSAFLGKTEMPRRQSRLHTHSPSISSLSSLT
FT                   SSSKWKFWQRSGNSIRDRTISRPLSTHSLVGPPTDPTTKTKSSFSELHKAIYANNNSTF
FT                   EDNSSSISNSLSKRLSSSNLSLGNLKHRSSQSSLKHKSSQSSLQRFKTRRKSNNMAEEG
FT                   SISSSGSHSHHPKISLPVVDQMSRDKIKTKLRNSSSLLSLHSSLPIMMKDYDEVVLQQI
FT                   LEYCDVSKELPYDDDYIPVLKNATELSTHVWRAQSEGTNVIYKKLPLETLEDVTYSKSM
FT                   CLHELKMLRLSKGTTGLPYLLRSFVIRERPIFDEETASTTEGKLYLLIILRDNGTPLSQ
FT                   IKLNTWPQALKIFWQVVTTLYVAETKFEFEHRSLSLDHILVDDHLNVTLCDLKGARAYW
FT                   ASRKETLFTRLDHPLFFQGGGDYQFDVYNLMRAILSETSWDNYEPRTNLLWLHFLLYKL
FT                   FHAYGDKLVLQGRERLAALAQLLDPSSNARRSIFKRNEREVRSCGDLLRFK"
FT   gene            complement(<794352..>795065)
FT                   /locus_tag="ZYRO0G09944g"
FT                   /old_locus_tag="ZYRO-ORF1099"
FT   CDS_pept        complement(794352..795065)
FT                   /locus_tag="ZYRO0G09944g"
FT                   /old_locus_tag="ZYRO-ORF1099"
FT                   /product="ZYRO0G09944p"
FT                   /note="similar to uniprot|P53192 Saccharomyces cerevisiae
FT                   YGL020C MDM39 Protein involved in determination of
FT                   mitochondrial structure"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29491"
FT                   /db_xref="GOA:C5E057"
FT                   /db_xref="InterPro:IPR027538"
FT                   /db_xref="InterPro:IPR028945"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E057"
FT                   /protein_id="CAR29491.1"
FT                   /translation="MDSGGWIVYCCIFFILLGKVLEYTSSYQDKWFTKLTLTPEARKLN
FT                   SQYHELLSERLRLQEENHSISAQDNYARWTKNNRKLGELDKKLGTIRDKLQETNTSSKK
FT                   VFGRVKLIGLTIPFWILKIWQRSHVVYHFPKQDLFPKLVTGVWARGWLYLALGPLQYLR
FT                   NGSLNIQDYAPHGVSLGIWIWALQATINTLEFLVKQVILEKPVSPPPQKSKSATKAETK
FT                   RPEKLEITDDKVELD"
FT   gene            <795332..>796150
FT                   /locus_tag="ZYRO0G09966g"
FT                   /old_locus_tag="ZYRO-ORF1098"
FT   CDS_pept        795332..796150
FT                   /locus_tag="ZYRO0G09966g"
FT                   /old_locus_tag="ZYRO-ORF1098"
FT                   /product="ZYRO0G09966p"
FT                   /note="highly similar to uniprot|P43639 Saccharomyces
FT                   cerevisiae YGL019W CKB1 beta (38kDa) subunit of protein
FT                   kinase CK2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29492"
FT                   /db_xref="GOA:C5E058"
FT                   /db_xref="InterPro:IPR000704"
FT                   /db_xref="InterPro:IPR016149"
FT                   /db_xref="InterPro:IPR035991"
FT                   /db_xref="UniProtKB/TrEMBL:C5E058"
FT                   /protein_id="CAR29492.1"
FT                   /translation="MPQDFIEDLSHPGSSEDDSGTYDEWIPTFCSRFGHEYFCQVPTDF
FT                   IEDDFNMTSLSQEVPHYRKALDLILDLEAMSDEEDEDEDADMGTQNGNESGGGKPQLVN
FT                   RSLAEHAAEQLYGLIHARYILTKPGLQAMAEKFDHKEFGTCPRYYCGGMQLLPCGLNDT
FT                   IGKNTVRLYCPSCQDLYLPQSSRHLCMEGAYWGTSFPGVFLKHFEELEEYVERKNKEIF
FT                   ELKVFGFRINDAAISGPRMKWLRQYPSTPDEWEEFSKCEFEIPELPETNA"
FT   gene            complement(<796338..>796919)
FT                   /locus_tag="ZYRO0G09988g"
FT                   /old_locus_tag="ZYRO-ORF1095"
FT   CDS_pept        complement(796338..796919)
FT                   /locus_tag="ZYRO0G09988g"
FT                   /old_locus_tag="ZYRO-ORF1095"
FT                   /product="ZYRO0G09988p"
FT                   /note="similar to uniprot|P53193 Saccharomyces cerevisiae
FT                   YGL018C JAC1 Molecular chaperone involved with partner
FT                   Ssq1p in assembly of Fe/S clusters and in mitochondrial
FT                   iron metabolism contains a J domain typical to J-type
FT                   chaperones localizes to the mitochondrial matrix"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G09988g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29493"
FT                   /db_xref="GOA:C5E059"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5E059"
FT                   /protein_id="CAR29493.1"
FT                   /translation="MLNLVRQRRFLSTFYELFPQTFPKKAPVWNFNERQLRKEYRNLQA
FT                   QHHPDMLGGNLSQEVSSSGGNYSSLLNKAYHTLKEPLPRSQYMLKVLNNMDLTEERLSQ
FT                   SIMQSDPSILMQVLDTHEQLEEVLSEEDVRNIDLENRDRIKGIESQLQECYETMDYGRA
FT                   ARLTVELKYWVNLAKAIKEWQPGKPVTINH"
FT   gene            <797095..>798582
FT                   /locus_tag="ZYRO0G10010g"
FT                   /old_locus_tag="ZYRO-ORF1094"
FT   CDS_pept        797095..798582
FT                   /locus_tag="ZYRO0G10010g"
FT                   /old_locus_tag="ZYRO-ORF1094"
FT                   /product="ZYRO0G10010p"
FT                   /note="similar to uniprot|P16639 Saccharomyces cerevisiae
FT                   YGL017W ATE1 Arginyl-tRNA-protein transferase catalyzes
FT                   post-translational conjugation of arginine to the amino
FT                   termini of acceptor proteins which are then subject to
FT                   degradation via the N-end rule pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10010g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29494"
FT                   /db_xref="GOA:C5E060"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:C5E060"
FT                   /protein_id="CAR29494.1"
FT                   /translation="MTERLIISEPYYFSDSISHCGYCKGQKPDKNDNFAVKSWYDKHSE
FT                   AKDGLDAQNCTLGVQAELVSVEMYDRLCNMGFRRSGKFLYKPDLLRNCCRMYTIRTTTD
FT                   QVRVSKDMKTCVKRFKKAVSPEYNQENKKDHKGPFNFTQEIIDTESKSDNFYTKFEPAV
FT                   YSDEKYRLFAKYQESVHNDFDHNAKSFKRFLCDAPFSPEVIRGTKQEWDQLNDWKNPER
FT                   SHFERVGPAHECYYYNGNLIAIAVIDILPSGISSVYFIWDPEYGKLSLGKLSALRELAI
FT                   SSKINRKHYYMGYYIQDCPKMNYKGKYGGELMDLCNYRYTPLTRVEKEIDHSKFFVLSD
FT                   DPNLTNEPHLNERFSGTADVWQTPGSLHNVVENIYGVNGGAFKVADDAAEQLSRREIPY
FT                   SRELTHDICNDGNGKNDIYRIPNVVPGLLPLEEILQMVLQKKINLVNNSMVLFDTSVGH
FT                   IRLVVDFDSESPKIKKAVCDLVRLFGLQNTMDSLVIV"
FT   gene            <799068..>802061
FT                   /locus_tag="ZYRO0G10032g"
FT                   /old_locus_tag="ZYRO-ORF1093"
FT   CDS_pept        799068..802061
FT                   /locus_tag="ZYRO0G10032g"
FT                   /old_locus_tag="ZYRO-ORF1093"
FT                   /product="ZYRO0G10032p"
FT                   /note="similar to uniprot|P32767 Saccharomyces cerevisiae
FT                   YGL016W KAP122 Karyopherin beta responsible for import of
FT                   the Toa1p-Toa2p complex into the nucleus binds to
FT                   nucleoporins Nup1p and Nup2p may play a role in regulation
FT                   of pleiotropic drug resistance"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10032g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29495"
FT                   /db_xref="GOA:C5E061"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5E061"
FT                   /protein_id="CAR29495.1"
FT                   /translation="MLWKLFKANLLHLVKFCNQYVKDPSTCAPLLITIKKLMSNLSLIF
FT                   TNINELGNAETTGNAVTHWNNPIDTLVLMLSHEEQFASENWQDTLQTDELIHRLINSPV
FT                   PYNGLMQFIKTSELCNKLVLMFTEIIVEDLTKLQSRKGSMSKTYEVVHEHLYISTMALI
FT                   NANLSEWQVSEDILYNCIGAWINYISMARNVSPHGRMDLSEMFDNMINRMCQSSEATDD
FT                   FYQAEKILSILANVFANDPIIMGHPQREQLEVIFLGVSRTGNADSSKNEWMLQYMNHLV
FT                   TNEMTDDLKELAVCVVDFLQVNTLDMCNKLFTVISSSQVNGENLQQYVKVLLQLTNFPL
FT                   VPVLQEFFSVRMVDFWLDLADCYSNTITETYTEQAPQLATEIFQQVVNIYLPKISLLNK
FT                   QKAMEAESDDTATHEFDDFRSAIADLMESLWSILGNDKLTNILITGVGENTLSAGGAGN
FT                   VDIFEIEAMSFLLNTLLTDMNLSESPWICDILDSCEFFIRNILMLFQVGCESPADSVVA
FT                   RTLKLDFVRTGSSLIGTMAGYFQQSPSQLSTCVDALFQGLEKCTVSASPADSQLNDKME
FT                   VMIIKTISILCDTCRHELSSYLMQFINVFNTIMRPESNVSTFTREKLTRSMGFIIESQV
FT                   ENGPEKQANCMLEVLNTIENYIQQALSIPEPPSEQQRSYLHCMLSCISELGTAMIHSSD
FT                   VENEAFVQRIAEFQNYWQSDPLQISYKVLNLLQLVLSNPAYAKDMAFVEVSCLILGKAL
FT                   GLPNEDPHFLKYSMSDIMEFLLKHISTTEVALALPYYVYLLEKLIKHYKDQLSSQDFDF
FT                   LFENFFFKYYQSAILHDPDLLQTTINFVNSVLDSKPGLVVHGTYWTSFLLPEFVKYLSA
FT                   KERFTIVAVTKFWCKVINNKKYTREDIELTHHQFVSMGQDIVYQAMFGLFHSQRSDLNS
FT                   YTDLLRTIMAKLPLQTPKWLVTALPAISNNNAAHEKFVSKLSVTRGSRAANNVILEWWL
FT                   SCNALPSL"
FT   gene            <802784..>805312
FT                   /locus_tag="ZYRO0G10054g"
FT                   /old_locus_tag="ZYRO-ORF1089"
FT   CDS_pept        802784..805312
FT                   /locus_tag="ZYRO0G10054g"
FT                   /old_locus_tag="ZYRO-ORF1089"
FT                   /product="ZYRO0G10054p"
FT                   /note="similar to uniprot|P32479 Saccharomyces cerevisiae
FT                   YBL008W HIR1 Non-essential transcriptional corepressor
FT                   involved in the cell cycle-regulated transcription of
FT                   histone H2A H2B H3 and H4 genes contributes to nucleosome
FT                   formation heterochromatic gene silencing and formation of
FT                   functional kinetochores"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10054g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29496"
FT                   /db_xref="GOA:C5E062"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011494"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019015"
FT                   /db_xref="InterPro:IPR031120"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E062"
FT                   /protein_id="CAR29496.1"
FT                   /translation="MKIVKFPWLSHREERRKYEVYTVDVSADGKRIATGGLDGKIRIWS
FT                   VASIQEAAKEESAKRTVDEELKRPLASMSRHTGSVTCVKFSPDGKYLASGSDDRILLIW
FT                   AKDEEPRTEPIFGNEFEKEHWMVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSIIIWS
FT                   GSTFEKIKRFDVHQSLVKGVVFDPANKYFATASDDRTLKVFRYHKAGDLAFTIEHVVSD
FT                   AFKGSPLTTYFRRPSWSPDGQHIAVPNATNGPVSSVCIVNRANWDTSISLIGHDAPTEV
FT                   ARFNPRLFEVQNGGQSNAEGTEDQKNKREEVESIVATAGQDKSLALWGTSKARPIFVAY
FT                   DIANKSITDMAWTPQGDTLFVSSLDSSLTVLFFDKGELGKAIPLEKNIEQLHRYGVDKD
FT                   SLDFPESVKQLSLEEEARKWRPQPREPSIGFLESRVGVKESQRANNNNDNSNDNDFNKE
FT                   KEKEQTPAVSRNENINILIPKRKKDNKLNQTEVKDGRKRVAPTLLSSGYSPVRATPSFD
FT                   KPSGGVTKPTTAAPKKKPVSLSMQGAEGKMSIQSYPMPRLGIHTLIMGMKERGKDVFYK
FT                   EKDLTAQSQKDGNDISPGVEGGIPNADTDISEEEHTMTLNSKLTQDKVWVDEPNVRYLK
FT                   TPGIIPDTDAVLLECGTFEDFYVLEIRNGVERSIQFDTEALLDNPTRILGYHKGKRTIE
FT                   LFVPEVVICAVGSINCKLWCLATANGSIFIISHSGQYRSPKISLGHKVIKLRAQDEYLI
FT                   AFTERGLFFVWNLATLKLIYKNVPILPILNGEPVEGNRVRSGKRIKSFCLDADAKSLLV
FT                   HMTNPDMIYQWIGQLGCWCEYDEDKIVGAE"
FT   gene            <805645..>807993
FT                   /locus_tag="ZYRO0G10076g"
FT                   /old_locus_tag="ZYRO-ORF1087"
FT   CDS_pept        805645..807993
FT                   /locus_tag="ZYRO0G10076g"
FT                   /old_locus_tag="ZYRO-ORF1087"
FT                   /product="ZYRO0G10076p"
FT                   /note="highly similar to uniprot|P07264 Saccharomyces
FT                   cerevisiae YGL009C LEU1 Isopropylmalate isomerase catalyzes
FT                   the second step in the leucine biosynthesis pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10076g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29497"
FT                   /db_xref="GOA:C5E063"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR012235"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C5E063"
FT                   /protein_id="CAR29497.1"
FT                   /translation="MSYVSTKGPRTLYDKVFDAHVVKRDSSGSCLLYIDRHLVHEVTSP
FT                   QAFEGLRNAGRKVRRTDCTLATVDHNIPTASRKTYKSTATFIDQADSRLQVQTLEQNVK
FT                   DFDVAFFGMAENRQGIVHVIGPEQGFTLPGTTVVCGDSHTSTHGAFGALAFGIGTSEVE
FT                   HVLATQTIIQSKSKNMRIMVKGDLTPGVTSKDLMLHIIGVIGTAGGTGSVMEFAGKAIE
FT                   DLSMEARMSMCNMSIEAGARAGMIKPDETTFNYVKNKPLAPKGAEWDKAVAYWKTLHTD
FT                   EGAKFDHEVIINAADIVPTITWGTSPQDALPITASVPDPAEANDPIIKSGMERALAYMG
FT                   LTPKTPLKDIKIDKVFIGSCTNSRIEDLRNAAAVVKGYKIADNIKRAMVVPGSGLVKSQ
FT                   AEKEGLDQIFKEAGFEWREAGCSMCLGMNPDILSPEERCASTSNRNFEGRQGAKSRTHL
FT                   MSPAMAAAAGIAGHFMDIREFKYKNGDVPKVSIGQEEEDRKLQDAVYAHEEEVLQPNDL
FT                   SESMAEEEVDDIPVNEPERKIVKPNGSSAPPAGLPPFLTLEGIAAPLEKANVDTDAIIP
FT                   KQFLKTIKRTGLSAGLFYEWRFVKDAEGKEQATDFVLNVDPYKQAKILVVTGDNFGCGS
FT                   SREHAPWALNDFGIKCIIAPSFGDIFYNNSFKNGMLPIRVDQQVIVNKLCPLAKEGKQL
FT                   VVDLPKQQILSSDGEVLVDHFDVEEFRKHCLVNGLDDIGLTLQNESDISKYETLRRDKF
FT                   SFLEGGSSKLIKPVRGTKKSPFGNKAQEW"
FT   gene            complement(<808399..>812577)
FT                   /locus_tag="ZYRO0G10098g"
FT                   /old_locus_tag="ZYRO-ORF1085"
FT   CDS_pept        complement(808399..812577)
FT                   /locus_tag="ZYRO0G10098g"
FT                   /old_locus_tag="ZYRO-ORF1085"
FT                   /product="ZYRO0G10098p"
FT                   /note="similar to uniprot|P32790 Saccharomyces cerevisiae
FT                   YBL007C SLA1 Cytoskeletal protein binding protein required
FT                   for assembly of the cortical actin cytoskeleton contains 3
FT                   SH3 domains interacts with proteins regulating actin
FT                   dynamics and with proteins required for endocytosis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10098g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29498"
FT                   /db_xref="GOA:C5E064"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007131"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR029922"
FT                   /db_xref="InterPro:IPR035800"
FT                   /db_xref="InterPro:IPR035821"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038159"
FT                   /db_xref="UniProtKB/TrEMBL:C5E064"
FT                   /protein_id="CAR29498.1"
FT                   /translation="MTVFIGVVKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVK
FT                   KRVIGLDAEEPTGLVPSNYVEPANVIGTVRALYDYEEAQNPDEEITFLENELFDLFDDQ
FT                   DQDWLLVQSKSSGAYGFIPGNYVEPAQGAPTTPAAAPAPAPIAPPGPTPIAPPIMTPAG
FT                   ADELPPPPQPQRPGREPEDVTPALPKRPRDQEPPLPEPPLPPMRDEEEPPLPSRPRDRV
FT                   DEDEDEELPPPPKPVRPTSTGGGPSLGGLAGAGTERDDYRLGRRVESEDDYEDDNYGGG
FT                   YNDMGLNSSDHHTWSIAEVDGRKKKKCKLTVGGSKIYFEPSDGPHEEWTIDNLTTYDNE
FT                   KKHIFLEFVKPYRSLELHAGSTDTCNEIMSILGEYKGAQRDPGIREIEEASKPKKEANV
FT                   VHDFRAEADDELTVRQGQVVYIINDKKSRDWWLCELVSNGQRGIVPADCLESVKEKSSS
FT                   SGFFGSLRKITGNTDKYNAKQNAKQASHKERDRERERLKNGSHARNHGRSESGSWKDDE
FT                   AQSLNSVSNERRNTDRRRSNSMSAKKSSSGSTSKSQFPDPKKTRIWADRSNTFKVEAQF
FT                   IGCTEGKIHLHKANGVKIAVAAGKLSDEDLVYVERTTGFSLDKFKSRSSEGSDEKRKRS
FT                   TRDQDDEERDRYLREKELEELRKARELLDEERTRMQELTEKKPAKPPRPQTTGGTNTMT
FT                   LNYQPQYDWFEFFLNCGVDVNNCQRYTINFEREKITEDMMKDINEPMLRTLGLREGDIV
FT                   RVMKYLDKKFDREPKLPQGQATGGMFSQPDGSLKVSNADVSPAPPLTQNLLPQATGAAV
FT                   AQPTQASQTPLETAIPNATRNADDDAWTSKPAAKSESSVLDKNNNSNFTGSMQDLIDLR
FT                   PLEPKKKEPTAAPEPNLKDLEPVKTGGETKAAPLSSAPTGGTTLQPLDPFKTGGNNLLP
FT                   LTTGFVMMPVATGGLMPMQRTGGLAMPQTTFGNQNMDGLMQPQKTNSALMPMGLQTTGG
FT                   LKPQVTNPSLAPMNFQTTGSMLQPQRTNPGLIPIGTGGAMQPQGNSNMISMGTTGGGMM
FT                   PQTTFGSQPMSQPMGASMPLQTTGGTMPRLGSVLPVQKTGSGILPLQPTGSAMPMQATG
FT                   SAMHFQGTGGFIPFQRTGGMPQQPTGNLIPLQRTGGNMMPQTSFGANVTGGANMMPQTS
FT                   FGANVTGGANMMPQTSFGTNVTGGANMMPQTSFGGPQLTGTGNMMPQTSFGGPQLTGAG
FT                   NMMPQTSFGANVTGGPNMMPQSSFGAQQMTGGANMMPQTNFGGSQISGGFPQTSFGSGA
FT                   QGTGGYPGMVQSVPQMTGGFQQNGHFGSQNQFTGGPMPQQSFPGSSFNSGVDNATQGMQ
FT                   NMSLSQAPLQAQPTGFGFGNGPQQPQQPQQHGAKQANLFNATPDNPFGF"
FT   gene            complement(<812965..>813471)
FT                   /locus_tag="ZYRO0G10120g"
FT                   /old_locus_tag="ZYRO-ORF1081"
FT   CDS_pept        complement(812965..813471)
FT                   /locus_tag="ZYRO0G10120g"
FT                   /old_locus_tag="ZYRO-ORF1081"
FT                   /product="ZYRO0G10120p"
FT                   /note="similar to uniprot|P25338 Saccharomyces cerevisiae
FT                   YGL010W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10120g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29499"
FT                   /db_xref="GOA:C5E065"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:C5E065"
FT                   /protein_id="CAR29499.1"
FT                   /translation="MFHNQLDLKAQLKQYKLYHREKTNVLIHMVFVPTILFSTCCMAHR
FT                   IPLGHGITLTNVLTTVFALHYVLLCFVPGLIASLLLAVLNWSLDNGKIRLHAYQEVSLF
FT                   VMGWIVQFIGHGYFEHCRPAIIDNLIQSLVTAPYFVLFEVLFKLGFYKQLQAELDRDIK
FT                   EETSR"
FT   gene            <813980..>814070
FT                   /locus_tag="ZYRO0G10142r"
FT                   /old_locus_tag="Zyro0G.tPhe.GAA.17"
FT   tRNA            join(813980..814016,814035..814070)
FT                   /locus_tag="ZYRO0G10142r"
FT                   /old_locus_tag="Zyro0G.tPhe.GAA.17"
FT                   /note="tRNA-Phe (GAA) cove"
FT   gene            <814364..>815125
FT                   /locus_tag="ZYRO0G10164g"
FT                   /old_locus_tag="ZYRO-ORF1080"
FT   CDS_pept        814364..815125
FT                   /locus_tag="ZYRO0G10164g"
FT                   /old_locus_tag="ZYRO-ORF1080"
FT                   /product="ZYRO0G10164p"
FT                   /note="highly similar to uniprot|P21243 Saccharomyces
FT                   cerevisiae YGL011C SCL1 Proteasome subunit YC7alpha/Y8
FT                   (protease yscE subunit 7)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29500"
FT                   /db_xref="GOA:C5E066"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR034642"
FT                   /db_xref="UniProtKB/TrEMBL:C5E066"
FT                   /protein_id="CAR29500.1"
FT                   /translation="MSGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTSINSLAI
FT                   RGKNCSVIISQKKVPDKLLDPSTVSYIFKISKTIGMVINGPIPDARNAALRAKAETAEF
FT                   RYKFGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYF
FT                   VGYKATATGPKQQEITTRLENYIKKTPSQDYMQEESWEKVVEFGITTLTDSLGTEFSKK
FT                   DLEVGIAVPDNFFTLTPDEIEERLVAIAEQD"
FT   gene            complement(<815183..>815779)
FT                   /locus_tag="ZYRO0G10186g"
FT                   /old_locus_tag="ZYRO-ORF1079"
FT   CDS_pept        complement(815183..815779)
FT                   /locus_tag="ZYRO0G10186g"
FT                   /old_locus_tag="ZYRO-ORF1079"
FT                   /product="ZYRO0G10186p"
FT                   /note="similar to gnl|GLV|CAGL0E02761g Candida glabrata
FT                   CAGL0E02761g and some similarites with YBL006C
FT                   uniprot|P38210 Saccharomyces cerevisiae YBL006C LDB7
FT                   Protein of unknown function null mutant shows a reduced
FT                   affinity for the alcian blue dye suggesting a decreased net
FT                   negative charge of the cell surface"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10186g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29501"
FT                   /db_xref="GOA:C5E067"
FT                   /db_xref="InterPro:IPR013895"
FT                   /db_xref="UniProtKB/TrEMBL:C5E067"
FT                   /protein_id="CAR29501.1"
FT                   /translation="MEVMNSQLPKRRTYYEVIAGLASFERSQDVSLSHPELQELVKAEF
FT                   HNKQAEKLPNTTNEETKRKKVTVHGYLGGKVDLDEASNASYDLSHTLLGGYVPRRQLES
FT                   LSSIDFAHYFHKSLECEDALQIYDMFVANNFRRATALPSTVTHVNNNNSSNHNEPHASS
FT                   GSAVKKSLVCKKCGTKFSGSHRMHRLRKHDCNSKR"
FT   gene            complement(<815992..>817398)
FT                   /locus_tag="ZYRO0G10208g"
FT                   /old_locus_tag="ZYRO-ORF1077"
FT   CDS_pept        complement(815992..817398)
FT                   /locus_tag="ZYRO0G10208g"
FT                   /old_locus_tag="ZYRO-ORF1077"
FT                   /product="ZYRO0G10208p"
FT                   /note="highly similar to gnl|GLV|CAGL0A00429g Candida
FT                   glabrata CAGL0A00429g and similar to YGL012W uniprot|P25340
FT                   Saccharomyces cerevisiae YGL012W ERG4 C- 24(28) sterol
FT                   reductase catalyzes the final step in ergosterol
FT                   biosynthesis mutants are viable but lack ergosterol"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10208g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29502"
FT                   /db_xref="GOA:C5E068"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniProtKB/TrEMBL:C5E068"
FT                   /protein_id="CAR29502.1"
FT                   /translation="MATPEKIPQTEKSTKAANFLPQGKWLKPEEIEYEFGGTPGVLGMM
FT                   IGFPLLMYYMWISAEFYHGYPAWPAGGESWCQFVKHLYQLFLENGVPTKYAWTIFLTFW
FT                   AFQIFFYYTLPGVWTKGQPLTHLKNKQLPYYCNAMWTLYTSTVLILTLHASGLFKLYTI
FT                   IEIFGQIMTCAIISGFAFSIGLYLWTMLISKDYHRMTGNPIYDIFMGAPLNPRWGILDL
FT                   KMFFEVRLPWFTLFYITLGACLKQYETYGYVTPQLGVVMLAHWLYANACAKGEELIVPT
FT                   WDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLYYHHPSEYQWSTGYNISLYLTLLTAYYF
FT                   FDTTNGQKNSFRKQMAGDKRVRKTFPFLPYQVLNNPKYMVTSNGSYLLIDGWYRYARKI
FT                   HYTVDWVQSLVWALSCGFNSIFPWFFPIFFFVVLVHRATRDQAKCKKKYGKDWDTYCQH
FT                   CPYTFIPYIF"
FT   gene            complement(<817779..>818978)
FT                   /locus_tag="ZYRO0G10230g"
FT                   /old_locus_tag="ZYRO-ORF1076"
FT   CDS_pept        complement(817779..818978)
FT                   /locus_tag="ZYRO0G10230g"
FT                   /old_locus_tag="ZYRO-ORF1076"
FT                   /product="ZYRO0G10230p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29503"
FT                   /db_xref="UniProtKB/TrEMBL:C5E069"
FT                   /protein_id="CAR29503.1"
FT                   /translation="MRTLTRNTSGKSADANSELYSRVSSDDQNILNFNSRSQRLKRTIS
FT                   NGFRRSSSADSKSSKHCHKFRFWLNRKNNCVRSKSQDTDSYSTTSSVSTKVGAEPKLYS
FT                   RNNLRDYKESVVYKSSPRHHLRTWLNDDDHEGEASSILEIRQSNITTRIVKAKHYISLA
FT                   AKQTAQIASVRRTAQLMAFTGAVTAAAVARVRAAQRNPNASHGSIANDTMYSLQEVSNA
FT                   IDQSGAPESDYNELNDIFKLHFQYKGAPGYFKRLKPLRIEELNPNSAAYKMYYKMKFIP
FT                   NPPIGADPLEFYLNRATFRQEKRIEEEDNLEPQHSKLTEFSDIQSTKSVQTRVSTAKSI
FT                   FWSFVGMEAESTKEMENSQKDIQTSQNFLQEIHAEPSEHENELNSSSKSLFWSFISGKS
FT                   "
FT   gene            <819658..>822768
FT                   /locus_tag="ZYRO0G10252g"
FT                   /old_locus_tag="ZYRO-ORF1074"
FT   CDS_pept        819658..822768
FT                   /locus_tag="ZYRO0G10252g"
FT                   /old_locus_tag="ZYRO-ORF1074"
FT                   /product="ZYRO0G10252p"
FT                   /note="similar to uniprot|P12383 Saccharomyces cerevisiae
FT                   YGL013C PDR1 Zinc cluster protein that is a master
FT                   regulator involved in recruiting other zinc cluster
FT                   proteins to pleiotropic drug response elements (PDREs) to
FT                   fine tune the regulation of multidrug resistance genes"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29504"
FT                   /db_xref="GOA:C5E070"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E070"
FT                   /protein_id="CAR29504.1"
FT                   /translation="MESGRVRRPRNKVNRACYNCRRRKIKCTGKYPCSSCEAYQCECLY
FT                   FPGYVPTKSNTSTNGNTNVNAKADDNSWKLPIENPQPNKLQSNESSSSTGRSSSTADGS
FT                   GKTPTSSFNSNQTDEDELIQDWEAGELASMPPIELNGGSVGFYKDDIEFQKKLSNLQQC
FT                   LKQLKSIPNPNEQIKEIINSINVQVDTLVSDWEPEYDVKEYNKVLKNDGESMKSIETHL
FT                   MKNKYADQVALTSFAVWTDTSKSEKNGIPASSFLANQPLVDDMFGLYSPVQALSLRGIG
FT                   HLFQRCVKLATSTEKTVQMKSNLYLLLRFFDICIDHFNQSCVSIANPLESYLQRKSLLL
FT                   SSPNTTSSVSSRNSANSKDLIGVLINRLPQPFTQNVTSIDNKKLLDSMHDDFDMFSLLL
FT                   KMFDDHKKGFESLMIKITANPGHLTMFAPKMSTADIQDFIWYCEQEELLVALSYSYYNS
FT                   TLYHFDEFSRSLEYFDLLLSLIDKQVWLHEKYGFEKVLDVATSYATGLGLSRWEFYVGL
FT                   DELTAERRRESWWKYYCIEKQHNFFTGILSSINDSKMNCLLPRVFRDAGFSDHRHFVSN
FT                   VHLTVNNPVFHSMALNDLAFYGECAVCQVISEFYGGTLYEERYTSIKNTAKPPFVKYCL
FT                   LEEVLRDTDMLKTKLQAIKIQTKRLYDIAYSKNEYEGDSVCRQDKVLAVKHVLLQGCLL
FT                   FYVSSAVNNLISRLRVHSDQSNVRSRENEYREILREEYINMTKLMLSLEDDYSVSRAFG
FT                   HYSHVFLMVVSGSFSGCRFEPTIDEVVMVLRLFRRLRDISIYRENKDQDTIRNSKAYSD
FT                   FLQLCTFVSILTNSLLQSYMFLNDLTKEQLFTVLADAAPELQGLVPLILNPKSEIYRHL
FT                   MEPVQESGVHTNVKKMLEKGQKFPNKKRVYPKTAVQSLSPSNKNSPEVQSFPFAQADIP
FT                   VCQKARDGLSPGRNMATPVDALLNSDVPGGTIINERPNGSPDYGFQPMFGAGDGSNKFN
FT                   LGTVDEFVHKGDLNDLYTTLWSDLYSDESGQSILALNNFAPDLGDQN"
FT   gene            complement(<823030..>825732)
FT                   /locus_tag="ZYRO0G10274g"
FT                   /old_locus_tag="ZYRO-ORF1072"
FT   CDS_pept        complement(823030..825732)
FT                   /locus_tag="ZYRO0G10274g"
FT                   /old_locus_tag="ZYRO-ORF1072"
FT                   /product="ZYRO0G10274p"
FT                   /note="similar to uniprot|P25339 Saccharomyces cerevisiae
FT                   YGL014W PUF4 member of the PUF protein family YGL014W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29505"
FT                   /db_xref="GOA:C5E071"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:C5E071"
FT                   /protein_id="CAR29505.1"
FT                   /translation="MSVDSGSKENKHFSDVNPIVSESLDTALGQLHLEELDQNLKANPT
FT                   ANSNQSQSTPKNGPQVTNQNSTDATAGNGGGAVSGSGPNGENSGADPNMVPPSHMFPPH
FT                   PQMIGMGFIPFSQMMPIPHHTGFFPPSDFKDGPQAPPPHPPPMGVATPPAPAVAAAAVA
FT                   AASPGATPMAATPPTATPVHPATGPILFNNTNDASVFAAPAALTPGFTTGAHVNAPAPI
FT                   DPLWSGPPMGTGSAAADPVSSSTVEDSSALEDGLPQKAGSVAGLSFRRQTFHALSPNDM
FT                   VGGTGNDTGLSAADSVMDSGAQKTANVAAPAAARRQSVHMDKMFGSKADDNVAIVEDTS
FT                   NESEGDQGSKTFAAAYPYGGPLLQPNPILSGHHPPGSAHAFGIPSPFPAGYGFTSPFQS
FT                   FSPVLGAANTPMQAHSSIAMAHSPLQGAPMPADPTVNPLMAASTADPGSKSMEQFTVPR
FT                   DSASMQPPQTLPMGLHQQGGTPPPWMYGGHPFGMVPHPHSVPQKPPHVVGLNPGMATNN
FT                   NANHQGRRHANNRGGRSAHMGNGKNRHNRNYYYGNSNYHENHQRKLEENSRYANATLDQ
FT                   FIGNIYSLCKDQHGCRFLQMQLDVLGPEAADAIYDETRDYTVELMTDSFGNYLIQKLLE
FT                   KVTVDQRIFLARIAAPHFVRIASNPHGTRALQKLVECVSTEEEAQIVINSLKGSIVELS
FT                   KDLNGNHIVQKCLQKLQPKDVQFIFDAACQHCTEIATHRHGCCVLQRCLDHGSKAQCQA
FT                   LCNILLKHVDHLTLDPFGNYVVQYIITKEVEQDSYDYTYKVVHLLKPKVVELSLHKFGS
FT                   NVIEKIIRTRVVSETMIMEILNNRGDTDVPALLNDGYGNYVLQTALDVSHENNEYLYKR
FT                   LSDIVRPMMIGSIKNTPHGRRIMGILQME"
FT   gene            complement(<826937..>829696)
FT                   /locus_tag="ZYRO0G10296g"
FT                   /old_locus_tag="ZYRO-ORF1068"
FT   CDS_pept        complement(826937..829696)
FT                   /locus_tag="ZYRO0G10296g"
FT                   /old_locus_tag="ZYRO-ORF1068"
FT                   /product="ZYRO0G10296p"
FT                   /note="uniprot|P24545 Zygosaccharomyces rouxii Plasma
FT                   membrane ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29506"
FT                   /db_xref="GOA:C5E072"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E072"
FT                   /protein_id="CAR29506.1"
FT                   /translation="MSDERITEKPPHQQPDSEGEPVPEEEVEEETEEEVPDEESEDDDI
FT                   DGLIDELQSQEAHEEEEEEDGPAAAGEARKIPEELLQTDPSFGLTSDEVVNRRKKYGLN
FT                   QMREESENLVVKFLMFFIGPIQFVMEAAAVLAAGLEDWVDFGVICGLLFLNAGVGFIQE
FT                   FQAGSIVEELKKTLANTATVIRDGSVQEAPANEIVPGDILKLEDGTVIPADGRLVTEEC
FT                   FLQVDQSSITGESLAVDKHYGDEVFSSSTVKRGEGFMIVTATGDNTFVGRAASLVNAAA
FT                   GGQGHFTEVLNGIGVILLVLVVITLLLIWTACFYRTVRIVPILRYTLGITIVGVPVGLP
FT                   AVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEG
FT                   VSSDDLMLTACLAASRKKKGLDAIDKAFLKSLAQYPKAKGALTKYKVLEFHPFDPVSKK
FT                   VTAVVESPEGERIICVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVA
FT                   RKRGEGHWEILGVMPCMDPPRDDTAATVNEAKRLGLSVKMLTGDAVGIAKETCRQLGLG
FT                   TNIYDAERLGLGGGGSMPGSEMYDFVENADGFAEVFPQHKFAVVDILQQRGYLVAMTGD
FT                   GVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYAYVV
FT                   YRIALSLHLEIFLGLWIAILNHSLDIDLIVFIAIFADVATLAIAYDNAPFSPSPVKWNL
FT                   PRLWGMSIMMGIILAAGTWITLTTMFLPKGGIIQNFGSIDGILFLEISLTENWLIFITR
FT                   AVGPFWSSIPSWQLAGAVFVVDVVATMFTLFGWWSQNWTDIVTVVRIYIWSIGIFCCLG
FT                   GAYYLMSESETFDRLMNGKPLKENKSTRSVEDFLASMRRVSTQHEKGN"
FT   gene            <831554..>832684
FT                   /locus_tag="ZYRO0G10318g"
FT                   /old_locus_tag="ZYRO-ORF1060"
FT   CDS_pept        831554..832684
FT                   /locus_tag="ZYRO0G10318g"
FT                   /old_locus_tag="ZYRO-ORF1060"
FT                   /product="ZYRO0G10318p"
FT                   /note="similar to uniprot|Q04894 Saccharomyces cerevisiae
FT                   YMR318C ADH6 NADPH-dependent cinnamyl alcohol dehydrogenase
FT                   family member with broad substrate specificity may be
FT                   involved in fusel alcohol synthesis or in aldehyde
FT                   tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10318g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29507"
FT                   /db_xref="GOA:C5E073"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E073"
FT                   /protein_id="CAR29507.1"
FT                   /translation="MTVDYPKEFQGFAINDPKDWDHPKLTKFEPKKFDAHDVDIEVECC
FT                   GICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVAVGDKVSLCKVGDRIGL
FT                   GAQASSCMSCPRCHGNNEQYCAKSVTTYCSKYEDGYVSQGGYASHVRAHEQFCFPVPEE
FT                   IESEYVAPLMCGGLTVYSPIKRSIQGSKEPRVGVIGIGGLGHMAIMISKALGAHVVAFS
FT                   RSNRKRADAEKMGADAFVATGEEKDWSERYMDQFDLILNCASSTSELDLDSFLRVLRVN
FT                   KNFVSVGLPEKDDRFNLSPLTFMGNGATVGVSKLGSRQEAVELLDLAAKHGFRPWVETI
FT                   KLSEAGVHEGLTRLDAGDVRYRFALVGFNEFFGTGK"
FT   gene            complement(<832829..>833596)
FT                   /locus_tag="ZYRO0G10340g"
FT                   /old_locus_tag="ZYRO-ORF1057"
FT   CDS_pept        complement(832829..833596)
FT                   /locus_tag="ZYRO0G10340g"
FT                   /old_locus_tag="ZYRO-ORF1057"
FT                   /product="ZYRO0G10340p"
FT                   /note="similar to uniprot|P39707 Saccharomyces cerevisiae
FT                   YAR008W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29508"
FT                   /db_xref="GOA:C5E074"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016690"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:C5E074"
FT                   /protein_id="CAR29508.1"
FT                   /translation="MRIVLIGETPLVFNLDDIRQLRQHGIVGVLSGTLPSLSQQNVFLS
FT                   VPLRLMMEELLWLLWDSPLDVNVVGGGLPHFSKDVKSGQIHGQQSALRVQESFEQQRLQ
FT                   RWENHVRKLRLIGVEPQPGDSNLLEGSLFMQTHDSRKDDVKSEHTSSELNPTADQIRHY
FT                   KLYRKLRQMGFTVHPGGRFGGKYVVYPGDPLRFHSHVVISEPLEDDEPLDFLQMVAGAR
FT                   LATTVKKSYVASCVEAKGEEEARFYSFEWAGFG"
FT   gene            <834438..>837830
FT                   /locus_tag="ZYRO0G10362g"
FT                   /old_locus_tag="ZYRO-ORF1054"
FT   CDS_pept        834438..837830
FT                   /locus_tag="ZYRO0G10362g"
FT                   /old_locus_tag="ZYRO-ORF1054"
FT                   /product="ZYRO0G10362p"
FT                   /note="similar to uniprot|P38929 Saccharomyces cerevisiae
FT                   YGL006W PMC1 May be involved in depleting cytosol of Ca2
FT                   ions putative vacuolar Ca2 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10362g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29509"
FT                   /db_xref="GOA:C5E075"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E075"
FT                   /protein_id="CAR29509.1"
FT                   /translation="MGFSVTAGQLAGMYEPKSLAKFGQLFDEEPAKLYEKLQTDKEQGI
FT                   SDASTESERYKCFNDNRVPERPPKTFLALAWEAFNDKTMLLLTAAAIVSLILGLYEALT
FT                   QPPEYDPDGNKIPRVDWIEGVAIMLAVVVVVLVGASNDYQKEKQFLELNRKKEDRQVVV
FT                   YRNGEEQLVGVHDLLVGDLMHLQTGEVVPADCILVDGNCEVDESTVTGETDAIKVAPLE
FT                   QVWKRYVKAIHGNGNGNGDSSSNNIDPEAADCMLISGSKLISGLGKAVVTAVGVNSVHG
FT                   KTMMSLKTETESTPLQERLSELSDSISVFGCASAIILFLVLFIQFLFDIREGGRLADLP
FT                   AAKRGSQFMSILITSITVIVVAVPEGLPLAVTLSLAFATTRMTKDGNLVRVLSACETMG
FT                   SATAVCSDKTGTLTENRMTVVKGYMGSAEFDENNENNESTIKSLLEGEISDDIKKDVMT
FT                   NIVLNSTAFENKRFQEQQQHRQQREDQRLRGHTSDNPFSSILTRGRSRLQKLLHGGDDD
FT                   DLSASQANSVEEPYIGSKTETALLTMANKNFGLDNLKEWRKNHKGHFNIAKIVQVIPFE
FT                   SSRKWGGIVVKYEGEKNYRFFVKGAAEILFSRSLYYRNSDGSVAKLDGQSRQTIDEHIQ
FT                   GLASNALRAISIAHKDLNYEGSWPPENITSDEPGEALPEKLFGEVVNEKSQDGLVLDAL
FT                   VGIQDPLRPGVKNSIEQCQKAGVTIRMVTGDNVTTARAIARNCNILNEEDWVDSDCAME
FT                   GPKFRELSNDERVKILPKLRVLARSSPEDKKILVATLKQMGDVVASTGDGTNDAPALKM
FT                   ADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVSGSIKKFIQFQLTVNVTA
FT                   VVLTFISSVTTGKSVLTAVQLLWVNLIMDTLAALALATDRPDKNIMDRKPIGRQAPLIS
FT                   VSSWKMIMCQSFWQLVITLTLTYRSGQIFFGREATGHEKQILNACTFNTFVWLQFFTLF
FT                   VSRKLDEADGIKDWRKRISRENLDFFQDLGRNGYFLGVMAVIGLFQVFIMKFGGVAFSI
FT                   AEQTPSMWACAILTSLLAIPVGALVRICPDEVALAIYPKRFIGLVWYICTLGFFKKNAQ
FT                   KGLHDDEESLLGEAQEESSISTR"
FT   gene            complement(<838456..>839289)
FT                   /locus_tag="ZYRO0G10384g"
FT                   /old_locus_tag="ZYRO-ORF1051"
FT   CDS_pept        complement(838456..839289)
FT                   /locus_tag="ZYRO0G10384g"
FT                   /old_locus_tag="ZYRO-ORF1051"
FT                   /product="ZYRO0G10384p"
FT                   /note="similar to uniprot|P53195 Saccharomyces cerevisiae
FT                   YGL005C COG7 Component of the conserved oligomeric Golgi
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10384g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29510"
FT                   /db_xref="GOA:C5E076"
FT                   /db_xref="UniProtKB/TrEMBL:C5E076"
FT                   /protein_id="CAR29510.1"
FT                   /translation="MSDASVSGEDEILEMFFDEGFVPHAFVDILLSNAANKDISQVQAT
FT                   SSSLLSRFDFYTKNLTKELEMTIQKLEKLSETLPGTWTVKMDAADNDSTSVSAVGSSKL
FT                   EYYLDTLSSAVRVLEGDMAKINGQLDELDNNYESSSDIVNQLRNLEKIKTRLHKVLNLF
FT                   NQIKTILTISTATNDKSKTNVKNENGSSITVGEFRDSLQTLEETISQSFTEATNKETVM
FT                   EKDEDLLKRIDLFTELKPLFQGLHKFNPVYSQFVDGIRKRTNEYLSAKDIGGELN"
FT   gene            complement(<839502..>840677)
FT                   /locus_tag="ZYRO0G10406g"
FT                   /old_locus_tag="ZYRO-ORF1050"
FT   CDS_pept        complement(839502..840677)
FT                   /locus_tag="ZYRO0G10406g"
FT                   /old_locus_tag="ZYRO-ORF1050"
FT                   /product="ZYRO0G10406p"
FT                   /note="similar to uniprot|P53196 Saccharomyces cerevisiae
FT                   YGL004C RPN14 Putative non-ATPase subunit of the 19S
FT                   regulatory particle of the 26S proteasome localized to the
FT                   cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10406g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29511"
FT                   /db_xref="GOA:C5E077"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E077"
FT                   /protein_id="CAR29511.1"
FT                   /translation="MVKTVPVCHIQPDFADLIDAEDDGDFYINVDESLEHVKEYRLNTG
FT                   EHNNFVQIGSKLYSVELDGRKYKFRVKEGNYANVVQDRWTCIDAVDQPTTQFALGDSDG
FT                   NIRVFDSSPSLQHHIREAHLDEITCLKFFPSGQVLLSGSTDMRLKIWSLADESNPRTFE
FT                   GHKSQITDACMVERGRNFVSSSQDGTVKLWETGSGLAVHTFFRRENPLDGINTLALNKS
FT                   SDVVSPRGSNALEFGTEGKTVLAGHNSGVITVYDLFNKNQVTQLPSFFMSSCNTLTRIP
FT                   NEQNYLYAGYSNGALAQWDLRKPDKPVDHVLINEGISINHIYYHSNALYVSSGVDTAIK
FT                   LDVQLPEGNIIAEAPTFLVANDCQVAQFVATPNNKSIIAVGNWGLCVRFQC"
FT   gene            <840882..>842729
FT                   /locus_tag="ZYRO0G10428g"
FT                   /old_locus_tag="ZYRO-ORF1049"
FT   CDS_pept        840882..842729
FT                   /locus_tag="ZYRO0G10428g"
FT                   /old_locus_tag="ZYRO-ORF1049"
FT                   /product="ZYRO0G10428p"
FT                   /note="highly similar to uniprot|P22336 Saccharomyces
FT                   cerevisiae YAR007C RFA1 Subunit of heterotrimeric
FT                   Replication Factor A (RF-A) which is a highly conserved
FT                   single-stranded DNA binding protein involved in DNA
FT                   replication repair and recombination"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29512"
FT                   /db_xref="GOA:C5E078"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004591"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013955"
FT                   /db_xref="InterPro:IPR031657"
FT                   /db_xref="UniProtKB/TrEMBL:C5E078"
FT                   /protein_id="CAR29512.1"
FT                   /translation="MSDVQLSRGDFHLIFTSQKRYDNPVDGVYQVYNIRKSEAGNSNRK
FT                   NLIMISDGVYHMKALMRNKAAAKLDSLELQRGDVICVTVAEPAIVKEKGKYVLLVDDFD
FT                   LVQSGLALFNSSSEFLDHYFAANPNETLRDDTGNRSGATSTASGEPNNTPKPQQAKPNT
FT                   GSNFPMGSGSQKSRPIFAIEQLSPYQNIWTIKARVSYKGDIKTWHNQRGDGKLLNLNFL
FT                   DTSGEIRGTAFNDNATKFNEILQEGKVYFLSKARLQPAKPQFSNLPHPYELMLDRDTVV
FT                   EECLDASDVPKTHFSFIKLNTIQNQEANSTVDVLGIIQTVNPHFELISRAGKRFDRRDI
FT                   TIVDDSEYSIAVGLWNQQAVDFNLPEGSVVAIKSVRVTDFGGKSLSMGFTSTMIPNPEI
FT                   PEAYSLKGWFDNTGRNLQYHSLKEEVNETNSTTNLVKYISERTTIATAQAQNLGRNEKG
FT                   DFFSIKAAVSFLKVDNFAYPACLNENCNKKVIEQPDQTWRCEKCDTNHPSPDWRYLLTI
FT                   SVLDETGQLWLTLFNDQAKQLLKVEASELVLLKESDPTAFSKITQSLQMNQYSFRIRAR
FT                   EDNYNNQSRIRYTVSNLHNINYKAEADFLAEQLTQSLLE"
FT   gene            <842921..>844840
FT                   /locus_tag="ZYRO0G10450g"
FT                   /old_locus_tag="ZYRO-ORF1047"
FT   CDS_pept        842921..844840
FT                   /locus_tag="ZYRO0G10450g"
FT                   /old_locus_tag="ZYRO-ORF1047"
FT                   /product="ZYRO0G10450p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10450g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29513"
FT                   /db_xref="GOA:C5E079"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E079"
FT                   /protein_id="CAR29513.1"
FT                   /translation="MQRQKIRRHRAIKSCRYCYVHKLKCNKALPCYTCSTMNTTSECIY
FT                   GFNKNDNNSEEIKADNKSNEKSSRPLTTRGIDKTPKGTLVYRSKYFYPFFANSINDRVL
FT                   SSHAYGLLSPSQKFKRNEITKFNRFTNPLDSIEDALALLPPSRETALSQVETYFDSVHP
FT                   IIPILSKSKIMNALQTIKNTDNDQENINVPNLLLIMALFFCSSYAAVASGVIPDLLLCN
FT                   KYYAGYRLLLEISEFPLRPQLESLKAFTIVNFVIDPNMVDATAYSSMLVRMGQQLGLHK
FT                   MEDIQSKLLWGYLLYIEGSASVVSGFPYFTPGNLATETISPTPESKDQNGLSAAYTIGR
FT                   WKVNAVFRNVMDLSGRQTISESDFLSTKKQIEKLYDEILEINDILRIEFPTYFTYLTST
FT                   LLVFLYRLHLRHTALSYWQSRKDKLLQKTDNQVNSAQPIDITSSLTTRHIYGDDVVHLS
FT                   LLLLFHTYERLVQENTAKFVWYTRGSTVMQYLFVVIKDLYQNELKPCELNSFSEPLKKT
FT                   VNTDIEEILKRDDVFFKFVLIDHVIGLLELKLAALWNDEDLYKFILVKAIKEKVWQVFR
FT                   TQLGHNKNRIEEVSKCKLFVSGEKHLQNLKSINFEDYIDNWESDIVLLEMNKILVNWID
FT                   DLQG"
FT   gene            complement(<844939..>846621)
FT                   /locus_tag="ZYRO0G10472g"
FT                   /old_locus_tag="ZYRO-ORF1046"
FT   CDS_pept        complement(844939..846621)
FT                   /locus_tag="ZYRO0G10472g"
FT                   /old_locus_tag="ZYRO-ORF1046"
FT                   /product="ZYRO0G10472p"
FT                   /note="similar to uniprot|P53197 Saccharomyces cerevisiae
FT                   YGL003C CDH1 CDC20 homolog 1 protein required for Clb2 and
FT                   Ase1 degradation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29514"
FT                   /db_xref="GOA:C5E080"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR033010"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E080"
FT                   /protein_id="CAR29514.1"
FT                   /translation="MAGYSGNPFINNTPSSSPLKNADNNRVTKRPLGSSSSSSLMSSPT
FT                   RRSRITGSAAYGDRFIPSRTEIDLNTMASIGSVASLPPAPPSISEDQVELQREMQAHET
FT                   FDAVLKNELFGEKLSRDAVGNESSIDRIKNTRPSRVNLNEPIEEEAPTTPPDSVDVDSQ
FT                   VQSAPVTPHRGLHSHSEELFRPSSNAIRGASLLTYRERTGTRPSTASMMQSQFFDTSSS
FT                   VRPDSKQLLLSPGKQFRQIAKIPYRVLDAPSLADDFYYDLIDWSSTDMLAVALGKSIFL
FT                   ADNATGDVLHLCDTENEYTSLSWVGAGSHLAVGQGNGLVEIYDVVKKKCIRTLSGHMDR
FT                   VACLSWNNYVLTSGSRDRRILHRDVRIPDSYFERIEAHTQEVCGLKWNVDDNKLASGGN
FT                   DNMLFVYDSTARNPVLTFNEHTAAVKAMAWSPHKRGVLGSGGGTADRRLKVWNVNTSQK
FT                   ISDVDTGSQVCNMVWSKNTDEILTSHGYSRYNLTLWDFPTMDPVAILKGHSFRVLHLTL
FT                   SADGTTVVSGAGDETLRYWKIFDKPKVKAKPDSVIFSAFNQIR"
FT   gene            complement(<846835..>848133)
FT                   /locus_tag="ZYRO0G10494g"
FT                   /old_locus_tag="ZYRO-ORF1045"
FT   CDS_pept        complement(846835..848133)
FT                   /locus_tag="ZYRO0G10494g"
FT                   /old_locus_tag="ZYRO-ORF1045"
FT                   /product="ZYRO0G10494p"
FT                   /note="similar to uniprot|P39706 Saccharomyces cerevisiae
FT                   YAR003W SWD1 Subunit of the COMPASS complex which
FT                   methylates histone H3 on lysine 4 and is required in
FT                   transcriptional silencing near telomeres"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29515"
FT                   /db_xref="GOA:C5E081"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037850"
FT                   /db_xref="UniProtKB/TrEMBL:C5E081"
FT                   /protein_id="CAR29515.1"
FT                   /translation="MTNLLLQDPFSVLKEYPDKLTHSLENPLHTECVRFSPRGDYLALG
FT                   CSNGGVIIYDMDTFRPICVLGNKMGAHMRSVQSISWSSDGKYLLTGSRDWSVKLWDLAS
FT                   AGQPLKQVRFDSPIWNCQWVNADQFTCVVTVLEESSAFLIYFAHDQPLVRTLHGNENND
FT                   DHGYVLTSTVHTKFSDIIFTGTSKGWINVYQLCKGESESNVAQMLKGLKVANANIKHVI
FT                   VSQQGDKIAVNCSDRSIRQYAFTLTADRSSVELELEHKYQDVINKLQWNSIFFSNKAAE
FT                   YLVASTHGSSAHELYLWETSSGTLVRVLEGSEEELMDIDWNFYKMFIASNGLESGDVYI
FT                   WSIVIAPKWSALAPDFEEVEENVDYREKEDEFDQIDELEQQEELNQAEEVDIDLRTREQ
FT                   FDVRGNDLLVAQFTIPTDYERILTLKAAKLAQD"
FT   gene            <848326..>848982
FT                   /locus_tag="ZYRO0G10516g"
FT                   /old_locus_tag="ZYRO-ORF1044"
FT   CDS_pept        848326..848982
FT                   /locus_tag="ZYRO0G10516g"
FT                   /old_locus_tag="ZYRO-ORF1044"
FT                   /product="ZYRO0G10516p"
FT                   /note="similar to uniprot|Q05359 Saccharomyces cerevisiae
FT                   YAR002C-A ERP1 Protein that forms a heterotrimeric complex
FT                   with Erp2p Emp24p and Erv25p member along with Emp24p and
FT                   Erv25p of the p24 family involved in ER to Golgi transport
FT                   and localized to COPII-coated vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10516g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29516"
FT                   /db_xref="GOA:C5E082"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/TrEMBL:C5E082"
FT                   /protein_id="CAR29516.1"
FT                   /translation="MLLVSALLQLAIVALLFPSQVAAFSLYSNGERRCFYKELSKGTLL
FT                   QGKYSVKAYDDGIQSYRDTNPQEFDVSMEVEEVFDDYHRVVHQKGVSGELNLLALDSGE
FT                   HRICIQAQPNSWMGKSKTKINLDFEIGSDVKLDSKQKTVVDSLHQKVNILNDKVLSIRR
FT                   EQKLVRDREAQFRDISESVNSHAMWWSVIQLVVLVLTCIWQMRHLRTFFVKQKVL"
FT   gene            complement(<849067..>850605)
FT                   /locus_tag="ZYRO0G10538g"
FT                   /old_locus_tag="ZYRO-ORF1043"
FT   CDS_pept        complement(849067..850605)
FT                   /locus_tag="ZYRO0G10538g"
FT                   /old_locus_tag="ZYRO-ORF1043"
FT                   /product="ZYRO0G10538p"
FT                   /note="weakly similar to uniprot|P39705 Saccharomyces
FT                   cerevisiae YAR002W NUP60 Subunit of the nuclear pore
FT                   complex (NPC) functions to anchor Nup2p to the NPC in a
FT                   dynamic process that is controlled by the nucleoplasmic
FT                   concentration of Gsp1p-GTP potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10538g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29517"
FT                   /db_xref="GOA:C5E083"
FT                   /db_xref="InterPro:IPR034432"
FT                   /db_xref="UniProtKB/TrEMBL:C5E083"
FT                   /protein_id="CAR29517.1"
FT                   /translation="MVDQSKSYRSRGAIAPYRRPMSSNNRSKPSILNKLKSFFTNDGND
FT                   GKEENSGLKRRHLASGGSPTVSIPGGFFNSDDASPSIVLPKCPGEAQISNSTPNVDAIN
FT                   EGERDEEASADEEPYNADISNAKLADFFSRKGGEPLSEMEMEGVKSLMKKSSKSVRSSR
FT                   AGSIVNTTLSHDDPTDLVYSRILKHSRTPSLATSTMRAPAFTPRYDDSFGSHSFANTSR
FT                   GSVSSRRRVFDYSSLPSPYKTTVYKYSAADNDSSDAHGTKTPDASKSMVVKPSNGKKLS
FT                   NTASALVSLLENDNSKEETSNRLANPYSSHVNQLRKYKKSLPTLPATKQEPSKFAPIKS
FT                   SALQELENAKTKVTNEVAPKSQQHNSVDKYKPMRSSSLRSNVVKADESPERKITTKETE
FT                   PEVPKAPTFNFQFQTNDKIEPNTKSQPHAHPAAKPEFAFKFQPQKFGPPDNNSDSDVVD
FT                   KIPTKVANAYSTAPSIIATESDPEYDFGQISPSNIDPSAVDNKKVQDFKTLFVF"
FT   gene            complement(<850769..>850840)
FT                   /locus_tag="ZYRO0G10560r"
FT                   /old_locus_tag="Zyro0G.tPro.TGG.49"
FT   tRNA            complement(850769..850840)
FT                   /locus_tag="ZYRO0G10560r"
FT                   /old_locus_tag="Zyro0G.tPro.TGG.49"
FT                   /note="tRNA-Pro (TGG) cove score=66.07"
FT   gene            complement(<850978..>852027)
FT                   /locus_tag="ZYRO0G10582g"
FT                   /old_locus_tag="ZYRO-ORF1041"
FT   CDS_pept        complement(850978..852027)
FT                   /locus_tag="ZYRO0G10582g"
FT                   /old_locus_tag="ZYRO-ORF1041"
FT                   /product="ZYRO0G10582p"
FT                   /note="uniprot|Q96WU2 Zygosaccharomyces rouxii gl001
FT                   Putative C- 3 sterol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10582g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29518"
FT                   /db_xref="GOA:C5E084"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E084"
FT                   /protein_id="CAR29518.1"
FT                   /translation="MSDECPILLVGGAGFLGLHLIQQFYDLTVRPRIHVFDVRPIPEKL
FT                   SRQFTFDPTEIVFHQGDLTSAEDVTNALLKSKARVIVHSASPMHGNAQSIYEHVNVKGT
FT                   RNLLDVSKKLGVKAFIYTSSAGVIFNGQDVHNADETWPIPEVAMDGYNETKAIAEDMVL
FT                   KANSFQENFLTVALRPAGIFGPGDRQLVPGLRNVAKLGQSKFQLGDNNNLFDWTYAGNV
FT                   ADAHVLATQKLLNSETASKVAGETFFITNDEPAYFWALARTVWKADGHVDKSVIVLNRP
FT                   VAILAGYLSEFFSKLLGKEPGLTPFRAKIVCATRYHNVTKAKELLDYKPRVNIEEGIEK
FT                   TLAWMDEKL"
FT   misc_feature    complement(852385..852551)
FT                   /locus_tag="ZYRO0G10604s"
FT                   /old_locus_tag="centromere.zyro0G"
FT                   /note="Centromere Zyro0G"
FT   gene            complement(<852624..>853487)
FT                   /locus_tag="ZYRO0G10626g"
FT                   /old_locus_tag="Zyro0G.mRNA.4163.m"
FT   CDS_pept        complement(join(852624..852838,852926..853404,
FT                   853465..853487))
FT                   /locus_tag="ZYRO0G10626g"
FT                   /old_locus_tag="Zyro0G.mRNA.4163.m"
FT                   /product="ZYRO0G10626p"
FT                   /note="uniprot|Q96WU1 Zygosaccharomyces rouxii orf
FT                   Hypothetical protein, highly similar to YGR001C
FT                   uniprot|P53200 Saccharomyces cerevisiae YGR001C Protein
FT                   with similarity to methyltransferase family members;
FT                   required for replication of Brome mosaic virus in S.
FT                   cerevisiae, which is a model system for studying
FT                   replication of positive-strand RNA viruses in their natural
FT                   hosts"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10626g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29519"
FT                   /db_xref="GOA:C5E085"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR019369"
FT                   /db_xref="InterPro:IPR041370"
FT                   /db_xref="UniProtKB/TrEMBL:C5E085"
FT                   /protein_id="CAR29519.1"
FT                   /translation="MSESDDELTLSSNALAALQEFKQEEQQRQENFEKLLQQADEEFEE
FT                   KKRIQGMELFKEDWQLSQFWYADDTADVLAEALLEGADPDTVIAVVSAPSVYAAILKRP
FT                   KEQIPTKNIYLFEYDTRFELLAGRDHYVYYDYVQPLEFTDQLKGKVDRLLIDPPFLHNN
FT                   CQTNSLLAPKDGSKTMNGYLRHRFMSCTGERMADLISKLYPDSKITTFLPQHANGLSNE
FT                   FRCYADFEWKKWKFST"
FT   gene            <853727..>857292
FT                   /locus_tag="ZYRO0G10648g"
FT                   /old_locus_tag="Zyro0G.mRNA.2193.p"
FT   CDS_pept        join(853727..853799,853877..857292)
FT                   /locus_tag="ZYRO0G10648g"
FT                   /old_locus_tag="Zyro0G.mRNA.2193.p"
FT                   /product="ZYRO0G10648p"
FT                   /note="similar to uniprot|P34111 Saccharomyces cerevisiae
FT                   YAL001C TFC3 Largest of six subunits of the RNA polymerase
FT                   III transcription initiation factor complex (TFIIIC); part
FT                   of the TauB domain of TFIIIC that binds DNA at the BoxB
FT                   promoter sites of tRNA and similar genes; cooperates with
FT                   Tfc6p in DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10648g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29520"
FT                   /db_xref="GOA:C5E086"
FT                   /db_xref="InterPro:IPR007309"
FT                   /db_xref="InterPro:IPR035625"
FT                   /db_xref="UniProtKB/TrEMBL:C5E086"
FT                   /protein_id="CAR29520.1"
FT                   /translation="MAQIPVFPDELVHLICEVVAYNKGEITLPELWRSSESFVGLSDDK
FT                   LKEFVFSSVSSHPDVKLYEGGKVCDKLYSEVAENEDAYTLRIGEDTLWTILTGYRKKEA
FT                   NIGGFAFELLLEIAKAGDKGINTKDLAQATNQDPRSITGRVKKIGHLICSVQMIYKGHV
FT                   VKLLKLKRYSESDNAVKPYVNLRDYLGQIVDVVKKSKNGVRQIIDLKRELKFDVEKRLS
FT                   KAFIAAIAWLDEKEYLKKVLLVSPTNPSVKIRCVKYLRDYVQEDKSTNDFDYESEPGDD
FT                   PLDDDKLGLEEEDAYEGLDSSNATNILQEEGLLVQDEKSTGKDDILMNRFYPIQNQTYD
FT                   MTEKAGLQGISTMEVIKRLTGRDYKRAFTKSSEYYVESVGKPKNNVDEYRIVRVYDFEG
FT                   RKKFYRFFTEENFKKLTDAPQTYVSGRFEPIESQKEALAELNESNFIPLSSSLRFVDND
FT                   GQESFFWNGEIKSPVSVSARGRKRKQEDVAAVQKAISVNNKRRSVKQKEKPPSMSSTVP
FT                   ATASGDVVNSPSSPSENDGTNKPRVLEIGGFSAGSLRSLWRQRAILEVVRKAGGVTYLR
FT                   EQFFEDVSHFMGSNTLLDKKTVRGDVNLMLQNEKLRMEDEPHTGKRIIYLPEVDPNAIA
FT                   SYIIKDKDNKKAYFKDVIHNTDIYFFDQTEKHRFHRGVKSAERVRNYQDRSRTKKDAQK
FT                   KAWKKAEDALSLQRQYKLSRDLTAVGEKDLSKKSGKPGKGKKKALFQVGNKLGARALVM
FT                   AVVITKSIKNEILWDEITKLFPSNSLSNLKKQWTARRIRMGHVGWRAYVDKWRKILVSA
FT                   TREERVTLEDVERLDLPKLIDLWITSDVDEDQKPTLLYRDYLENKKRYTLIRVGTNVGM
FT                   KSGLAMSSMIQRETSSLKKIFVYDNYDTSSKRLPPWGTEGDVRAVIRSILYDHPDTSRE
FT                   KIEVLSTIPKELVDKVIMDMAKEKHLYLQGSRLEATDTIKEFLETRGNYRMFEQCEIYR
FT                   NKLEEMFQAGNGVIISEEIPDIASWIFIDLIAQSKVNLDVIPTVDSSQKLSYVTRRLGI
FT                   RGLTPPLIMSAKKSTKLTKEIHVPLPMGEPNSKLWIDGTGCLRGEVWKCLLSMITNEIL
FT                   FNPGVTLDMLEQNCNFVLSRRELKDICGWLLKKGLVIETPFEGLQAGHEWYTLLK"
FT   gene            complement(<857355..>861167)
FT                   /locus_tag="ZYRO0G10670g"
FT                   /old_locus_tag="ZYRO-ORF1036"
FT   CDS_pept        complement(857355..861167)
FT                   /locus_tag="ZYRO0G10670g"
FT                   /old_locus_tag="ZYRO-ORF1036"
FT                   /product="ZYRO0G10670p"
FT                   /note="similar to uniprot|P39702 Saccharomyces cerevisiae
FT                   YAL002W VPS8 involved in vacuolar protein sorting required
FT                   for localization and trafficking of the CPY sorting
FT                   receptor Vps8p is a membrane-associated hydrophilic protein
FT                   which contains a C-terminal cysteine-rich region that
FT                   conforms to the H2 variant of the RING finger Zn2 binding
FT                   motif."
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10670g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29521"
FT                   /db_xref="GOA:C5E087"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR025941"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E087"
FT                   /protein_id="CAR29521.1"
FT                   /translation="MQNDLFNESPTTSNASSNVSSGDISFLDYRAYTRLSERPVYSGNN
FT                   SIFNESNDTNQNGNFFDDFNNLSSTVKWKTLNKIYPILGAFGGPTCIYPTKSCHVLGTS
FT                   KGPILIFSTKQFILNRLVPQIVGEPTSKHLRSPVLDIVVSADGTHLAASYQSGDIFLWN
FT                   LNANTVELNAEEANDGNEKMAPSRAILQITNHRGRTINGIGFIGSRHTALIVSDNTGGV
FT                   FYHSGFRTHLWSLTYSSKQVLHISTGEKLLASQAAPEIQKREPLHMIAVLTTSRFAIIS
FT                   TTPRPMTLMLEDLKSIGSREITSNSCLAWHENASKVAFSLNESAFVFEIKGVSTFSTQK
FT                   TFTKIGEPALSLQWITDDLLGILTVSHNFLMVDVNEDLRVVAKFDFLVHHLLMPPNKHV
FT                   AVCDKKLLLLTNYGLKVGQLPSWSDITLNHVQTGNYPGALKFIKSLLQEYMPLWPLLRL
FT                   TQDFSKREQELEKPFYNLALAALRFIITHQNADLNKIYELFSLVLSTVDLFQDRQLKIE
FT                   PMNAFLEKSMEFFSEDNVDIFFEVLLNMVLEGSMNALPAAIFKPMLINFADAEKLSILE
FT                   DMIVMLDLRTLDIDLAVKLCQKYGLFCVLMYICNTIFDEYVLPLVDAVSRINDKPEETF
FT                   IFRTGEVGSVNTIFDYLSFVLTGRQFPKSDLIMPMKRQIDAKVSLYHMLFSGTCVEWPP
FT                   GSGKKLHTEADSAHEPAFPYFNLLINFNTARMLSTLNEIFEDSLLNEGYAENGLGENPP
FT                   VQITRQYMVDVVLDMMKKKESTRDKVLMGIFVACNVAKYPQFIRLSSRALEDVIATICG
FT                   VKDLQLTNDCQRALECLLSTYTPKNSERFIAELKELNFKRVLFILYVKTKKFFDILPLA
FT                   LSSEDTKTDYNQSFPTVISFVLFGARYDSLEHTRVVGLIRGHFESLVDKLGPKLAVEFF
FT                   QKFDPGIHQSVVSLSCEDTQQKYLEELYSFGELEGTEMNDLKDLYFELSCKYKSKQALL
FT                   QWLGVLEFKNLDTERATNILLSAKNYEAAAVVHRRLQVNSMVVNDMLNCINDWFKVGDK
FT                   QYATLNRYLNIAIDAISDSSDDKLHNWTKLIACFMKLYGSHKNDADVGQSCNRAFQELF
FT                   VRLAMSEASANGDKKGQFWSILTSALEHQEVIMMKAKDLRTLLFDVFTTYDIERHISRL
FT                   ILEIVQESSVGVGQLYESTLTKGWPIENDECEICGKTLWGLGLDSINFVIWKNKRLLGE
FT                   SAPSTSTNEDKAIVSFGCHHVFHKRCLRNLGQVSGKYSCLTCKKE"
FT   gene            complement(<862084..>863754)
FT                   /locus_tag="ZYRO0G10692g"
FT                   /old_locus_tag="ZYRO-ORF1032"
FT   CDS_pept        complement(862084..863754)
FT                   /locus_tag="ZYRO0G10692g"
FT                   /old_locus_tag="ZYRO-ORF1032"
FT                   /product="ZYRO0G10692p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10692g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29522"
FT                   /db_xref="UniProtKB/TrEMBL:C5E088"
FT                   /protein_id="CAR29522.1"
FT                   /translation="MSSKENFQYPSAKGSKGGYSSFRRLKTFRKNESLFDASGTNFIRY
FT                   RGNSNHITSQQSDNYTNTFRVKATLAEHDLVESSDQNDIVRAVLKDAAHGKTSPDMGSD
FT                   SATIVAEDQVTFGIANNLLDSTSDLGTLDSNYPRVNEASSSYDVEKTNRAMVGSPKISQ
FT                   HGPGAGVSYVPKIYKGVSNNGPIGGKRHKVRFWRNNRRRNKHKKFCVNENHFSEESTSR
FT                   SNQLPIRKHHFRRWLNEKTDESATVNHIEEARHRAKYVASEAALAAIIRCHARAAIRAG
FT                   AAATAAYAKVTFEELNPGVSHATMIATINKACEDVAKTSLKSKTENADYLKLLHLLNQH
FT                   LNFKGNELQIPLKSCDDKGELEKKDEAFETSIRQADEHLYNSQTVTSLKIPPKNSSENK
FT                   KLLQKSDDHTRQTASSLISENSISEKLILQVDAGAELPLTQLVVPNDSARDDNYSKEYL
FT                   DELSDPLKSMTVEDEDEDFEGSRFVLFSSAESALDFDDDDSRRKDETELSLIDSAYSYV
FT                   DSEEGIWPQVASMRRQRLLLQMESLAPRSLLLESLTKDC"
FT   gene            complement(<864592..>865421)
FT                   /locus_tag="ZYRO0G10714g"
FT                   /old_locus_tag="Zyro0G.mRNA.2305.m"
FT   CDS_pept        complement(join(864592..865123,865342..865421))
FT                   /locus_tag="ZYRO0G10714g"
FT                   /old_locus_tag="Zyro0G.mRNA.2305.m"
FT                   /product="ZYRO0G10714p"
FT                   /note="highly similar to uniprot|P32471 Saccharomyces
FT                   cerevisiae YAL003W EFB1 Translation elongation factor 1
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10714g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29523"
FT                   /db_xref="GOA:C5E089"
FT                   /db_xref="InterPro:IPR001326"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR018940"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C5E089"
FT                   /protein_id="CAR29523.1"
FT                   /translation="MSFTDFSNIESLQKLNSHLADKSYVEGTSASQADVTAYKAFQKAF
FT                   PDFTRWFNHVASKADEFDSFPASKAAPAAEDDDVDLFGSDEEEDAEAEKIKAQRVAEYE
FT                   EKKSKKPSKGASKSIVTLDVKPWDDETNMEELIANVLAIKKDGLTWGAHKLVPQGYGIS
FT                   KLQINMVVEDDKVSMDDLQETVEGDEDHVQSTDVAAMQKL"
FT   gene            complement(<865184..>865294)
FT                   /gene="SNR18"
FT                   /locus_tag="ZYRO0G10736r"
FT                   /old_locus_tag="Zyro0G_snoRNA_159"
FT   ncRNA           complement(865184..865294)
FT                   /gene="SNR18"
FT                   /locus_tag="ZYRO0G10736r"
FT                   /old_locus_tag="Zyro0G_snoRNA_159"
FT                   /product="U18 RNA"
FT                   /note="C/D snoRNA intronic SNR18 (U18 RNA)"
FT                   /ncRNA_class="snoRNA"
FT   gene            <866250..>867635
FT                   /locus_tag="ZYRO0G10758g"
FT                   /old_locus_tag="ZYRO-ORF1028"
FT   CDS_pept        866250..867635
FT                   /locus_tag="ZYRO0G10758g"
FT                   /old_locus_tag="ZYRO-ORF1028"
FT                   /product="ZYRO0G10758p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10758g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29524"
FT                   /db_xref="UniProtKB/TrEMBL:C5E090"
FT                   /protein_id="CAR29524.1"
FT                   /translation="MITNIHSQSDEQMDNIFVLNNFDQLNTVLLEEADILTVEKIWEII
FT                   TTSGSLASDKSNGNSRVISQKNATHNSKNSTTGFTPGYVSDFELNAFGEFWQGASGEKS
FT                   DTLGFSSRCFLELAPVVGGPVMVDLREFMEQVKPDAIEEQKRPLQDINIAGNPIFENSS
FT                   QIEFSNVPETSKNSRVSEDATELITNATQFLGDNKVSEFQSTNLRGSRHILNTKKLACK
FT                   QKSRSTVTNLNDGYRKLKGKLKREISTCNKLELEKQDQLLQLQGLKDEYSRLQDKLTGV
FT                   LAMNNELEKRNQMTDFYKLNFTNQYRKFDSKFDEFEKSTLLLQKERSARRALLREMKAC
FT                   SINMKSLKKRKIKPAGNKELNNLKGWESKYMQFAERCSTVERIIQKGEVNLQKLFYELR
FT                   NHSKEFHPVKIDETSFFPSTPTDSCMTESSWISKYLVLEKNSLSEDLNTIPPLSSGLCR
FT                   SVC"
FT   gene            <867947..>869140
FT                   /locus_tag="ZYRO0G10780g"
FT                   /old_locus_tag="ZYRO-ORF1027"
FT   CDS_pept        867947..869140
FT                   /locus_tag="ZYRO0G10780g"
FT                   /old_locus_tag="ZYRO-ORF1027"
FT                   /product="ZYRO0G10780p"
FT                   /note="similar to uniprot|Q06168 Saccharomyces cerevisiae
FT                   YLR321C SFH1 Involved in chromatin modeling cell cycle
FT                   progression homolog of Snf5p member of the chromatin
FT                   remodeling complex RSC"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10780g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29525"
FT                   /db_xref="GOA:C5E091"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="InterPro:IPR017393"
FT                   /db_xref="UniProtKB/TrEMBL:C5E091"
FT                   /protein_id="CAR29525.1"
FT                   /translation="MSQQQLLPQGYLSNFHNRIRNEQVPLFVTAQPARGHKRAKVVNYA
FT                   EFDPDIFDEFNNMGMEDDDMGEKKDSTNGGGTPGMGSPGQTGSMGANGDEKDSKINGEG
FT                   NPDANGGNNHANPEEHALNIALPDIQEQDDRLSILRYPKIRETFLQSKIATPYRLDIPP
FT                   TLSTDQQEPIIIPITLNFEHGGHQINDFFTWNINDRSITPDEFSTIYCRDLDFPNSTVL
FT                   HSQIVSSINEQLQEYETVAAVMVPDLQVIVNLTCSLDNRLYEDNFQWNLNDKSVSPEKF
FT                   AEIVVQDLGLPRDFMPAIAHAHHEYLLRVKKEWLEGHLNQEHVPNGAAFGYLSGIRLDV
FT                   DELGVSWCPKVEVLTQEEIQKREIEKERNLRRLKRESDRMHRRGRRRVDDLETTMRI"
FT   gene            <869531..>869980
FT                   /locus_tag="ZYRO0G10802g"
FT                   /old_locus_tag="ZYRO-ORF1024"
FT   CDS_pept        869531..869980
FT                   /locus_tag="ZYRO0G10802g"
FT                   /old_locus_tag="ZYRO-ORF1024"
FT                   /product="ZYRO0G10802p"
FT                   /note="weakly similar to uniprot|Q06162 Saccharomyces
FT                   cerevisiae YLR315W NKP2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10802g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29526"
FT                   /db_xref="UniProtKB/TrEMBL:C5E092"
FT                   /protein_id="CAR29526.1"
FT                   /translation="MSSEQLLVRHVRDNLITHKHTLEEFAQLVAQHHRSKHESEPDEAT
FT                   IKDWYTKYEQQDDAALQLSEQRIENFLNDARQAQLLELEKSQLAESFSLEDVVNKLYHV
FT                   DQLLDKRLAYMNESMKDNVTELQKFNELLELANSTKTDDDEDISS"
FT   gene            complement(<870040..>871035)
FT                   /locus_tag="ZYRO0G10824g"
FT                   /old_locus_tag="ZYRO-ORF1023"
FT   CDS_pept        complement(870040..871035)
FT                   /locus_tag="ZYRO0G10824g"
FT                   /old_locus_tag="ZYRO-ORF1023"
FT                   /product="ZYRO0G10824p"
FT                   /note="similar to uniprot|Q9URQ3 Saccharomyces cerevisiae
FT                   YLR316C TAD3 tRNA-specific adenosine-34 deaminase subunit
FT                   Tad3p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10824g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29527"
FT                   /db_xref="GOA:C5E093"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C5E093"
FT                   /protein_id="CAR29527.1"
FT                   /translation="MVKKNLNPLKIDYRRCIVEDRLLQIRNEKIIDVADPVRVWTIDID
FT                   AKDSKQIVDFIRRTTQPNDPVPLMHVKRIKKKNAEKKILCVLICSVEMAREKSEVASLL
FT                   EQAVPNLKFSNLENTQCVPRQAAPTKELVVEWSNEYWPLTWYGNPNDQILNDYVFDMDF
FT                   IKSLLALISSRSKEELQNGNKFPIVTAFVNPRDTKNPIISVDSRDHHDHTLLDHSIMSG
FT                   IKSVAEREAERRYQVEKGDREDTGSVYLCFDFDVYTTHEPCSMCSMALIHSRVKRCIFL
FT                   QPMIKTGCLKTESGNGYCMHNNRKLNSKYEVFQWIGNEYPIPTIDENICC"
FT   gene            <871341..>873908
FT                   /locus_tag="ZYRO0G10846g"
FT                   /old_locus_tag="ZYRO-ORF1022"
FT   CDS_pept        871341..873908
FT                   /locus_tag="ZYRO0G10846g"
FT                   /old_locus_tag="ZYRO-ORF1022"
FT                   /product="ZYRO0G10846p"
FT                   /note="similar to uniprot|Q06163 Saccharomyces cerevisiae
FT                   YLR318W EST2 Reverse transcriptase subunit of the
FT                   telomerase holoenzyme essential for telomerase core
FT                   catalytic activity involved in other aspects of telomerase
FT                   assembly and function"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10846g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29528"
FT                   /db_xref="GOA:C5E094"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR003545"
FT                   /db_xref="InterPro:IPR021891"
FT                   /db_xref="UniProtKB/TrEMBL:C5E094"
FT                   /protein_id="CAR29528.1"
FT                   /translation="MKSLQEFIKNDLNIYPSDSEYERLVSFSQLNGLHELLNACFVVAN
FT                   SHNIDLPEIVPGSDHKRVIDYCIVHLLEKNLFDNILTFGYAVGRTEHVNNSLHCLYTNS
FT                   NVSRIKNSQWHQLHKLIGTHNFVNLLINYTVLQFTGGFFTQVIGNRANRPHTSPPWYYQ
FT                   QNQNQKHLHNSTPITLRTSLQRKSSIFKGPNMIPTKDDIDELIDSIFEPFANEIKCIRK
FT                   SQIKPLIKRLSLNHTRVKYLGILDNICPISKDDNSYQLDTRTPVKQVNRFIIVLVEKLV
FT                   PIQMFGSKRNKSKVFHFISILLRLPLGGNIPLAEIMTSLRINDFTWLQMNRSDTVKTED
FT                   LVAHFIFWFFQRFVVKIIATFFYTTEVSSNVEILFFRHDVWESISTPFLKAYFEKYLVE
FT                   NKPCRNHKSYLLSRFNHSKLRLVPKKAKGEFRVLAAPQKGSDKEESSAYFLHFKYVTYP
FT                   VQCILDFVRKKRRTHFDKVYSQNEIVERIKTFKKALLKKHGFIPELSFMKFDIESCYDS
FT                   IRREKVMEVISRLLEHETGFFVRSQSIFNPSTGSLKVQNVVNGSRRPSDDEVYIDNVRT
FT                   VYLTKQDVLEVLELEFFRTALSFNGRCYLRKDGLFQGSRLSALVVDLAYDDLVESESVF
FT                   KPHPNYDGLVIRLADDFLIISSDKNQILSLERMSQVGFPAYGAKVKADKICIAHSGSAC
FT                   KTLQFCALEISLKNLDTWKTSCLFNIPNFRFHSTFKTYQKLRHLYELRLSYGTVDGNVN
FT                   EPPTILYQIHQIGDNIATTFVHAFKGKPICLEEFEEFIHNIFASSELAWRHCPEDVVFK
FT                   SQVRLALLRSFLEVLVKNTSKFENAIGFLISEVNKCMYISSLA"
FT   gene            complement(<874035..>876629)
FT                   /locus_tag="ZYRO0G10868g"
FT                   /old_locus_tag="ZYRO-ORF1020"
FT   CDS_pept        complement(874035..876629)
FT                   /locus_tag="ZYRO0G10868g"
FT                   /old_locus_tag="ZYRO-ORF1020"
FT                   /product="ZYRO0G10868p"
FT                   /note="similar to uniprot|P41697 Saccharomyces cerevisiae
FT                   YLR319C BUD6 Actin- and formin-interacting protein involved
FT                   in actin cable nucleation and polarized cell growth
FT                   isolated as bipolar budding mutant potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10868g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29529"
FT                   /db_xref="GOA:C5E095"
FT                   /db_xref="InterPro:IPR005613"
FT                   /db_xref="InterPro:IPR022782"
FT                   /db_xref="UniProtKB/TrEMBL:C5E095"
FT                   /protein_id="CAR29529.1"
FT                   /translation="MLSSGREGLEYPNGRHSSNSSRKSSSSTLSNSSVETTVTKLLMST
FT                   KQLLQTLTQWSKGIVNERMVSDAYVQLGNDFKLVSKFFSHSGLEVSDLGDVPMDLRRVL
FT                   EVALRDEPSDETLNKYLPSIREIIVTLLDKLKVKQALLKSMKSEKGTKRSLHQQRPSTV
FT                   SSLSLSNKSTPPSSRTPSVSFTPKTHGQEISEPRTHRKNDIMSPEIAKNASLASPVNSS
FT                   SSNVPDAATHMAAPKQQNLSETEALSELKKGNNLQRRASKRFSAYQMAKLTNHSNTEAA
FT                   AAGALASVPPSLANTVTPSLPASSPASLAPPLPRDLMAQTLESPVDKEAPSSQRGTGNN
FT                   YDNDYDKELNHQTTAKSTTNKSPVPPDVSPVPVFQPRLHADTSGASFTSAKTDHINEKQ
FT                   DEDPSGPLYTIFLRMNGKTKKCHLPPPTSMHELQLLFVEKFAYSFDEDSFPDLYLQDPK
FT                   FSVFYELDQQGLSDLHDGCIVELKVKDKKEDEGKTGNKDVEMEKEPKINFAEVISSLRG
FT                   EISRAQEDMLDQMRDLSMKTQESLKTHELSLASRNMDKSVLSGNVPTSTSTPAPAFTRP
FT                   AVPVETVSALKQELSVLRQLHNESKRKSESTIGTVLSKLENFKNLSLEADKSSSNNRYI
FT                   ETSQNRLSELSDALLSKVDDLQDVIEVLRKDVAVHGVKPSKKKLDSVQKELVLAENDLS
FT                   MMQMFMQNEKPQWKKIWKAELEKVCEEQQFLTLQEDLTADLKEDLGKALETFDLVNMCC
FT                   VEQERHPKKSRSNPILPIPEPGTFHRVRDQVLNEVQALNPDHNERIEALERAQKMWERE
FT                   REYRDTDAFEDELGNFVEKGNLKTAGGVEEVERIRKQKDENNLRAYFGGLDL"
FT   gene            <876838..>881109
FT                   /locus_tag="ZYRO0G10890g"
FT                   /old_locus_tag="ZYRO-ORF1018"
FT   CDS_pept        876838..881109
FT                   /locus_tag="ZYRO0G10890g"
FT                   /old_locus_tag="ZYRO-ORF1018"
FT                   /product="ZYRO0G10890p"
FT                   /note="weakly similar to uniprot|Q06164 Saccharomyces
FT                   cerevisiae YLR320W MMS22 Protein involved in resistance to
FT                   ionizing radiation acts with Mms1p in a repair pathway that
FT                   may be involved in resolving replication intermediates or
FT                   preventing the damage caused by blocked replication forks"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29530"
FT                   /db_xref="GOA:C5E096"
FT                   /db_xref="InterPro:IPR019021"
FT                   /db_xref="UniProtKB/TrEMBL:C5E096"
FT                   /protein_id="CAR29530.1"
FT                   /translation="MVVDDSGTVVVPDSEGDGEGEETLIFSPHDNDNIMAPIEAGVVPL
FT                   GQAVRLEPEDLPSEHSRRFLRRRKAIQRMPYSLERIKHKQLLQGYDMSGFESISEELKL
FT                   PRPNPDLLGSFQDTKIPTDLSRRRNDKGHHDEEDVVTEPIIGPVSEDEASEAEEEERQE
FT                   QEDEVEEEEGEEDNEEELVKFRGRLINIKTGFRGVLPRVAWEKAIKQHNSTTRNFKRRR
FT                   DSASGNHRGVAKKKNVATEKNVNQDDSLLNDLIVPDDEVPLDDQISLPLRKTNQQEVHD
FT                   LKQLDQQYQKKYDHQYLSDYEDEVEEDQMDNFIIELGEVQNKNQVEIAPTFVLTPQDTF
FT                   NQDDDDPDLMEVGAVENDEGAIDGMLSKGPRIKGQGKFKSSTKRLGDTTRPGSTRKPSS
FT                   YRMTPQRRSVRAPNRGNQQRIKQQTRLPSNYLPSQNSLKEAESSNLKPTSTQKKHNDKA
FT                   KNKKQNSETIGPFAPLGSTNTRRANVFSTVMEAPSDKYALPKHGISKSESSDLIILDNT
FT                   NEDLREEAPLSALKSLFDEKQVIPPDTISLNLPDRQFVLSKFHRNDTPLVLSNIFDHIT
FT                   ERGVTDKELLQISESVTLFLLHFNHLGVLPVISEFHKRFRSKVSLLREKAKSIHFYQIA
FT                   VCQLMLLEVSKYSDISNASRVELNSSILNHIISFFKLLSYCYDAVAKSDPNYLFQSFDI
FT                   LSKIAKMLNQYDTLWDKLQEQGFRPEVCSFLIDSFHTNNPHWEILKIEQDYTSIKEAFR
FT                   FVNHCKRRYNWKITKNLIFLFDKIFKRRRFEDFTNECALTSGYILKPSQALRNNTMFNN
FT                   YLNLLQEIELSDLVVERIIPMGELSPNDSVAALINRLNLLMVLARGSHVNLEKRMEDLL
FT                   RPLLDSEYLSKQDHQSLKKIGQLVLDGILSLADINRIKNLPFRGKILVMTFKNLLFECG
FT                   ETLEGAWTNFLDQLIPIIERSTKSKLLFCKEFYPCLILMSQRDIFTENLVQVLQLYLRN
FT                   LSLLGAKWAQRNILQVVKNKVDLSANWIDYYCTVGKFLIQSNVMSWWSFYMYNDVRNSL
FT                   TNKFYFDCKILQMCDNQSFELIKKSMFTTATNSILQISSTWFRRFLIQLMNRECSIIID
FT                   HRYNKSSNDTLNIAKRFVWMLNRLSYNDLLLQFISNLKNCHQKKVVSIEFVTQMLEYLN
FT                   LKFIDNIKDSHDFFSLKRELGISDIETEKSAFRDAFRSQKDPISQASFVEWGLIHAHSN
FT                   EEEMKRYMDKLESLFNFSAPEGSFRFFIRLITVHLRGYFLHCKRRLLIYFLYLINGVLN
FT                   ARHLQISNSEFLELCMLHKILCSPNDVMNNAIVTEDPSSQKNLRAEYLQFQFNVLRIAD
FT                   GFLEFELLAQMSRKFLSGSPWSGELLYEELFDIELSNKIEDIFRYNSLTEQLDHVYILH
FT                   DLNEEELESSISELIKDTPPQ"
FT   gene            complement(<881179..>882603)
FT                   /locus_tag="ZYRO0G10912g"
FT                   /old_locus_tag="ZYRO-ORF1016"
FT   CDS_pept        complement(881179..882603)
FT                   /locus_tag="ZYRO0G10912g"
FT                   /old_locus_tag="ZYRO-ORF1016"
FT                   /product="ZYRO0G10912p"
FT                   /note="similar to uniprot|P53201 Saccharomyces cerevisiae
FT                   YGR002C SWC4 Protein of unknown function component of the
FT                   Swr1p complex that incorporates Htz1p into chromatin
FT                   component of the NuA4 histone acetyltransferase complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29531"
FT                   /db_xref="GOA:C5E097"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR027109"
FT                   /db_xref="InterPro:IPR032563"
FT                   /db_xref="UniProtKB/TrEMBL:C5E097"
FT                   /protein_id="CAR29531.1"
FT                   /translation="MSSSDILDVLNIQQKPKSHGNSASPPPTASASGASKAPRPQVTGM
FT                   QRELYNLLGENQPPIVVQPASRFKDKLTNTTKPSPWTNAEFKANDHLNLHHWVKGSKEL
FT                   VGEEAKESSYTKFNVHLRIPSFDKETYESFMANNIPNEELIKKEDSGTSSQEDTDDWEY
FT                   EEVDYLFQLCRKYDLRWFVIQDRYNYGRSRTLEELKEKFYKVCQRYFVAKSPNDPLLPS
FT                   LDFPKEKELERKKYLQRLLARSAAEIAEEEALIVESRKFEMAAKKTLNERESLLRLLDS
FT                   PNSDQSVSQYLTSQGMSQLYGSLLSDKSRKRKHESTVPENPWMKQQQLFALQRQQLQQI
FT                   QDKKQETQDTNQLKKTKRQKQEMQTAIKRKAETVYAEHLLEKFSADERKSLGVMAHGDK
FT                   LPPGVYLRSSKISTFKPALQSKVAAMLQELGLSVRPAMPSYDVVQRHEELLKRIVALVD
FT                   LKKHLDKLEAEKAITK"
FT   gene            <882760..>884988
FT                   /locus_tag="ZYRO0G10934g"
FT                   /old_locus_tag="ZYRO-ORF1015"
FT   CDS_pept        882760..884988
FT                   /locus_tag="ZYRO0G10934g"
FT                   /old_locus_tag="ZYRO-ORF1015"
FT                   /product="ZYRO0G10934p"
FT                   /note="similar to uniprot|P53202 Saccharomyces cerevisiae
FT                   YGR003W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10934g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29532"
FT                   /db_xref="GOA:C5E098"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5E098"
FT                   /protein_id="CAR29532.1"
FT                   /translation="MISSKKAKIRVPNRLGLPGQNFESLWGILKDAIDHIYADQVSELS
FT                   FELLYRTVYTLVLRRKALDLYSHLESYLGDKLDELKQNNLKDVEGFELLQKLFEIWKSQ
FT                   CRCFKLISDVMIYLDKVYCKYERKMETYDMGLESFKKHVINPIKENISEAMLSDINKVR
FT                   SQGSLQVPHADTWKGIVGMMETLEDEKDNYFSAHLEPVLLRETENYYKNAINYRELLPV
FT                   EYLETMKKLKSYEFSLDQKFINGDSTVKVTTVLESVLIWTEQFMEAIPILIRDSLTNNN
FT                   VELLKELCSLSSEEKYCTKILDCIKNCIWEDVTSLSVDKNSRRRAQVATQWTTKVIEIY
FT                   NYYQSLLSTVDLHIFIFDGQDNSSLNLINEVIGKYLNQDAVQTCEFITLHLDAFAKSTE
FT                   DKRDINSVKESLEDCVKIFKLISEKDVFENFYKKQMSKRLLHQRSSIKLEKWLVKQIKG
FT                   EMGTFFTSKLDGMLRDINLSAGLSRSFKPDENLLPDCVFTSQILTMTSWPFQTANVLDE
FT                   NVILPPQMRQYKEEFEVFYNRKYNDRTLRWAHHLGFMEIGFQFKNGYYEISMPIYGAIV
FT                   FLLFEDHEELTTEQISELTNMPEQELQRQLISLSLAPKSRVLKKKPLSKTISPQDTFCI
FT                   NYGFTSPTQKVKLQTIANITTKSEAQSQAGQDSLEKERVIEVNAAIVRIMKSCKKSIHD
FT                   ELFQQVSETLKDRFTLTQSVFKKSVANLLNKEYLQRDMEDTNIYHYIS"
FT   gene            complement(<884976..>885692)
FT                   /locus_tag="ZYRO0G10956g"
FT                   /old_locus_tag="ZYRO-ORF1014"
FT   CDS_pept        complement(884976..885692)
FT                   /locus_tag="ZYRO0G10956g"
FT                   /old_locus_tag="ZYRO-ORF1014"
FT                   /product="ZYRO0G10956p"
FT                   /note="similar to uniprot|P53769 Saccharomyces cerevisiae
FT                   YLR323C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10956g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29533"
FT                   /db_xref="GOA:C5E099"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039971"
FT                   /db_xref="UniProtKB/TrEMBL:C5E099"
FT                   /protein_id="CAR29533.1"
FT                   /translation="MFKKRSIKQGSGVKRKKVDLSGCGEDESGKVIKVPEVKGKSMMGL
FT                   ESNGVEGRSISNAEIQDDNDDNDDKFKLLFGEQEVKTSEGEPVVNFKMKGKGAMTQPKN
FT                   VKVSILTDFHPDVCKDFKQTGYCGYGDSCKFLHSRDDFKTGWKMNQDWKIDESSSSKSD
FT                   KSKVEGIPFKCLICKEDYKSPIVTNCGHYFCSSCFTQRVRKDPNCAICGQDTHGVARIA
FT                   KNLKCILKDQKQNQDI"
FT   gene            <885983..>887521
FT                   /locus_tag="ZYRO0G10978g"
FT                   /old_locus_tag="ZYRO-ORF1012"
FT   CDS_pept        885983..887521
FT                   /locus_tag="ZYRO0G10978g"
FT                   /old_locus_tag="ZYRO-ORF1012"
FT                   /product="ZYRO0G10978p"
FT                   /note="similar to uniprot|Q06169 Saccharomyces cerevisiae
FT                   YLR324W PEX30 Peroxisomal integral membrane protein
FT                   involved in negative regulation of peroxisome number
FT                   partially functionally redundant with Pex31p genetic
FT                   interactions suggest action at a step downstream of steps
FT                   mediated by Pex28p and Pex29p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G10978g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29534"
FT                   /db_xref="GOA:C5E0A0"
FT                   /db_xref="InterPro:IPR006614"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0A0"
FT                   /protein_id="CAR29534.1"
FT                   /translation="MSDNSAKDRETRAQFVDEPTNRIGGNTTKVIRSALKKRSGSGQDD
FT                   SDDSGAIVSSPLLTSTPPTISKALVKLYPNLIVVDRTLSLLTWTSDDIWPSVLMVLSYM
FT                   AVILYFETIAKYFGHLVVVAIMWGYSQLDNHVEETLSTHPTLDDIVYVMNRVITKADIL
FT                   LSPITILSAQDIRKLLFTTAFLSPIYVIITLFILPPRKLLFIGGIYVLTYHSSWSKVTR
FT                   RLLWRFKLVRLLVFYVTGLDLGGISRSQGIFAAVHKQMNNLSGTNNDSDEGWPIRFTYV
FT                   LYENQRRWLGIGWTSSMLSYERSPWTDEFFNEAPPPDQFQLPDENTGMVWRWVDKTWRL
FT                   DNTNDGAIQLSSTKPKTTASPNADEGFIYYDNTWKKPSTEDSFSKYTRRRRWVRTAELL
FT                   KIKNVEGTESPNITVDSTSHNSTSQAANTDTGGSGHSTAIAPENSNHQNGSKPHENLKR
FT                   RGVSFSDVQNVHIVPLENEDEDESKNESSNDDGNYHDNQLDAENKNESTPLLRD"
FT   gene            complement(<887798..>888034)
FT                   /locus_tag="ZYRO0G11000g"
FT                   /old_locus_tag="Zyro0G.mRNA.299CM.m"
FT   CDS_pept        complement(887798..888034)
FT                   /locus_tag="ZYRO0G11000g"
FT                   /old_locus_tag="Zyro0G.mRNA.299CM.m"
FT                   /product="ZYRO0G11000p"
FT                   /note="highly similar to uniprot|P49167 Saccharomyces
FT                   cerevisiae YLR325C RPL38 Protein component of the large
FT                   (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11000g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29535"
FT                   /db_xref="GOA:C5E0A1"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="InterPro:IPR038464"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0A1"
FT                   /protein_id="CAR29535.1"
FT                   /translation="MAKEIADIKQFLELTRRNDVKVATVKVNKKLNKAGKSFRQTKFKV
FT                   RGSKSLYTLVVNDAGKAKKLIQSLPPTLNVNRL"
FT   gene            complement(<888384..>889550)
FT                   /locus_tag="ZYRO0G11022g"
FT                   /old_locus_tag="ZYRO-ORF1008"
FT   CDS_pept        complement(888384..889550)
FT                   /locus_tag="ZYRO0G11022g"
FT                   /old_locus_tag="ZYRO-ORF1008"
FT                   /product="ZYRO0G11022p"
FT                   /note="similar to uniprot|P41896 Saccharomyces cerevisiae
FT                   YGR005C TFG2 transcription initiation factor TFIIF middle
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11022g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29536"
FT                   /db_xref="GOA:C5E0A2"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040450"
FT                   /db_xref="InterPro:IPR040504"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0A2"
FT                   /protein_id="CAR29536.1"
FT                   /translation="MSNDTGAVTNASTGNDSGDEYLSQEEEVFDGNDIENNENKVYEES
FT                   LDLDLNQSNRQVWLVRLPMFLAEKWRDRNNIHGQQLGKIRINKDGSKIQLVLDENDNDS
FT                   IPHQYDLELTKKVVENEFVFTEQNLRKYQQRVRELATDPEKQKQAFQRKQEREEELKRR
FT                   QQQLKRRNNRKKFNHRVMTDRDGRDRYIPYVKTIPKKTSITGTVCHECQVMPSMNDPNY
FT                   HKIVEQRRNLIKNNNKERITTLDETVGVTMSHTGMSMRGDNSNFLKVGREKAKSNTKSI
FT                   RMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLVKKGPYAFKYTL
FT                   RPEYKRLKEEERKATLGELADEQGTGEDGQDGEGENEGDDEIEMEDVV"
FT   gene            <889694..>890428
FT                   /locus_tag="ZYRO0G11044g"
FT                   /old_locus_tag="ZYRO-ORF1007"
FT   CDS_pept        889694..890428
FT                   /locus_tag="ZYRO0G11044g"
FT                   /old_locus_tag="ZYRO-ORF1007"
FT                   /product="ZYRO0G11044p"
FT                   /note="similar to uniprot|P33411 Saccharomyces cerevisiae
FT                   YGR006W PRP18 Splicing factor involved in the positioning
FT                   of the 3' splice site during the second catalytic step of
FT                   splicing recruited to the spliceosome by Slu7p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11044g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29537"
FT                   /db_xref="GOA:C5E0A3"
FT                   /db_xref="InterPro:IPR004098"
FT                   /db_xref="InterPro:IPR039979"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0A3"
FT                   /protein_id="CAR29537.1"
FT                   /translation="MDIGNLLKAEIDKKKNALDLKNRQVEEEPRVASSLPAHPEQGEKS
FT                   SDMLDLTQNNGHKAENASNPDESTLERLRTRPERIERAIEEDSQVSIDIDPVTIGDSER
FT                   RQELSMQCNIYIHDLLKDWSNREYQPHLLPETAKCFFPLLVRLRKSNLDLDLLTSLATV
FT                   LYHLQRDEFQQATESYMKLSIGNVAWPIGVTSVGIHARSAQSRIQGDHNVANIMVDDRT
FT                   RLWITSVKRLITFRESCSVGSN"
FT   gene            <890621..>891628
FT                   /locus_tag="ZYRO0G11066g"
FT                   /old_locus_tag="ZYRO-ORF1006"
FT   CDS_pept        890621..891628
FT                   /locus_tag="ZYRO0G11066g"
FT                   /old_locus_tag="ZYRO-ORF1006"
FT                   /product="ZYRO0G11066p"
FT                   /note="similar to uniprot|Q06170 Saccharomyces cerevisiae
FT                   YLR326W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11066g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29538"
FT                   /db_xref="GOA:C5E0A4"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0A4"
FT                   /protein_id="CAR29538.1"
FT                   /translation="MSGIITGLIGSYGQGWLQDKANEYAEEHFQPTKDPYYEELPSGKK
FT                   VRRRLPDYCSKQESKAYKKLQNQAWSHDKGMCGGCCWSECIGWAPLLTIIPIIGPAIMY
FT                   SIHGKMVDRAQIQFDLPQDMVLKMHGNIGVDLAIALVPVLGIVFSWMNACSTRNCAMVY
FT                   NFVSQRAIEAHNQKMRGKAGIAETKRNDKAEAAQAKQNAKAAKHSKSPTPVAAATPPAS
FT                   APAATSNVKSSKYTQKEVRSASPPLRNVPNTVSPFERSSPQPYSRPAAPLPPPSAAMPN
FT                   SAVGGRVGGGNPYVVQSTNQSYPMQDWGQRPYQRPPAPTPGPAGTKSRAQRPYI"
FT   gene            <891717..>892667
FT                   /locus_tag="ZYRO0G11088g"
FT                   /old_locus_tag="ZYRO-ORF1004"
FT   CDS_pept        891717..892667
FT                   /locus_tag="ZYRO0G11088g"
FT                   /old_locus_tag="ZYRO-ORF1004"
FT                   /product="ZYRO0G11088p"
FT                   /note="similar to uniprot|P33412 YGR007W Saccharomyces
FT                   cerevisiae MUQ1 Choline phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11088g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29539"
FT                   /db_xref="GOA:C5E0A5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR041723"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0A5"
FT                   /protein_id="CAR29539.1"
FT                   /translation="MTVADSNRIWIDGCFDFSHHGHAGAILQARRTIGDPQRGWLVCGV
FT                   HNDEAITLNKGTKPVMNQWERYGHTRSNRWCSEVVEDAPYVTEPSWLDRYNCQYVVHGD
FT                   DITLDANGENCYRVVIEQGRFLMVKRTEGVSTSEIIHRILGKSKPVDRTSLPTFDELQM
FT                   FSSGYNGYEPHCYVFENDLKNVVVKGGYDFHSYDGRTKLITGDFDLFHVGHIEQLSQLQ
FT                   GPNHSYRLIVVVQLDEGSIMTLREIALSLLSCKYVDGILVKPSADFLKQYSDKFIPMQS
FT                   TFDGHFGYLNKQIIMDRVLENKQTYTERNKRKGFE"
FT   gene            complement(<892799..>893062)
FT                   /locus_tag="ZYRO0G11110g"
FT                   /old_locus_tag="ZYRO-ORF1003"
FT   CDS_pept        complement(892799..893062)
FT                   /locus_tag="ZYRO0G11110g"
FT                   /old_locus_tag="ZYRO-ORF1003"
FT                   /product="ZYRO0G11110p"
FT                   /note="similar to uniprot|Q06177 Saccharomyces cerevisiae
FT                   YLR327C RBF9 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29540"
FT                   /db_xref="GOA:C5E0A6"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0A6"
FT                   /protein_id="CAR29540.1"
FT                   /translation="MTRTTKWTEHEGRPDPKYFTHNGHFGENPYNVKKQGYGKGNWGRP
FT                   GDEIEDLIDDGEIPEVFNKSRRGSNVQSNEKKYGKLQHIGDA"
FT   gene            <893563..>893662
FT                   /locus_tag="ZYRO0G11132r"
FT                   /old_locus_tag="Zyro0G.tSer.GCT.18"
FT   tRNA            join(893563..893599,893618..893662)
FT                   /locus_tag="ZYRO0G11132r"
FT                   /old_locus_tag="Zyro0G.tSer.GCT.18"
FT                   /note="tRNA-Ser (GCT) cove"
FT   gene            <894075..>895475
FT                   /locus_tag="ZYRO0G11154g"
FT                   /old_locus_tag="ZYRO-ORF1000"
FT   CDS_pept        894075..895475
FT                   /locus_tag="ZYRO0G11154g"
FT                   /old_locus_tag="ZYRO-ORF1000"
FT                   /product="ZYRO0G11154p"
FT                   /note="highly similar to uniprot|Q06178 Saccharomyces
FT                   cerevisiae YLR328W NMA1 Nicotinic acid mononucleotide
FT                   adenylyltransferase involved in NAD( ) salvage pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29541"
FT                   /db_xref="GOA:C5E0A7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0A7"
FT                   /protein_id="CAR29541.1"
FT                   /translation="MDPTKAPDFKPTDSKSRPEPPPDPISTIPKSSPIVPYVLADYNSS
FT                   IDAPFNLETAFKGRTKSKTRPPAPPPSEARTPASDTGGVGVGVGSSSGSSSRAPHSHYQ
FT                   LHPYHRHRGGHRNPEEKEQHRRASHIPMNTTDFQPLSAEISSTEEEEDTEGNEEELAEG
FT                   IDSRLNLDDDPEKEEKSGGISVGVRKNQIADLEEVPHGIVRQARNLDDYEFPTHRLAKK
FT                   LKNPNKMPLVIVACGSFSPITYLHLRMFEMALDAIREQTRFEVIGGYYSPVSDNYQKPG
FT                   LAAASHRVRMCELACERTSSWLMVDAWESLQPTYTRTAKVLDHFNYEVNVKRGGVSTVT
FT                   GEKMGVKIMLLAGGDLIESMGEPNVWADADLHHILGNYGCLILERTGSDVRSFLLSHDI
FT                   MYQHRRNVLVIKQLIYNDISSTKVRLFIRRNMSVQYLLPNSVIRYIQEHGLYVNQTESV
FT                   KQVMGTKD"
FT   gene            <895757..>896074
FT                   /locus_tag="ZYRO0G11176g"
FT                   /old_locus_tag="ZYRO-ORF998"
FT   CDS_pept        895757..896074
FT                   /locus_tag="ZYRO0G11176g"
FT                   /old_locus_tag="ZYRO-ORF998"
FT                   /product="ZYRO0G11176p"
FT                   /note="some similarities with uniprot|Q07927 Saccharomyces
FT                   cerevisiae YLR012C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29542"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0A8"
FT                   /protein_id="CAR29542.1"
FT                   /translation="MTIAMTTTQILRGFSQITYMQYKSLPPEIQDEYLDWAQEQWEKQW
FT                   AQLQFERQGGVSGIAKKKAEQEVQWLERVTTWSYLHAYIPRNRCRKSSRVYYSMYNSVS
FT                   L"
FT   gene            <896227..>897378
FT                   /locus_tag="ZYRO0G11198g"
FT                   /old_locus_tag="ZYRO-ORF996"
FT   CDS_pept        896227..897378
FT                   /locus_tag="ZYRO0G11198g"
FT                   /old_locus_tag="ZYRO-ORF996"
FT                   /product="ZYRO0G11198p"
FT                   /note="highly similar to uniprot|P53206 Saccharomyces
FT                   cerevisiae YGR012W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29543"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0A9"
FT                   /protein_id="CAR29543.1"
FT                   /translation="MSIDSGYWKNAVTFVSVSLAAYTSWKYYQAVLRRDTPPVKQSVDE
FT                   LIGNTPLVLIKSLSKATGTQIYAKMELCNPAGSAKDRVAFNAIREAEQDGRLIKGEPGW
FT                   VFEGTSGSTGISIALLCNSLGYRAHISLPDDTSNEKLSLLESLGATVNKVKPASIVDPN
FT                   QYVNAAKRACEELVKKGGRGIFADQFENEANWRIHYETTGPEIYKQMNGLIDGFVAGCG
FT                   TGGTITGVSKYLKERISPHVVLADPQGSGFYNRINYGVMYDKVEKEGTRRRHQVDTMVE
FT                   GIGLNRITRNFELGEHYIDESIRVTDDQALKMSKFLSVQDGLFIGSSTAINAVAAVKLS
FT                   RKLGKGSRIVIIACDSGSRHLSKFWKTAKDVDRDISLEQVMVD"
FT   gene            <897546..>899417
FT                   /locus_tag="ZYRO0G11220g"
FT                   /old_locus_tag="ZYRO-ORF995"
FT   CDS_pept        897546..899417
FT                   /locus_tag="ZYRO0G11220g"
FT                   /old_locus_tag="ZYRO-ORF995"
FT                   /product="ZYRO0G11220p"
FT                   /note="similar to uniprot|P53207 Saccharomyces cerevisiae
FT                   YGR013W SNU71 associated with U1 snRNP (no counterpart in
FT                   mammalian U1 snRNP contains few SR- RE- and RD-dipeptides
FT                   U1 snRNP protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29544"
FT                   /db_xref="GOA:C5E0B0"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0B0"
FT                   /protein_id="CAR29544.1"
FT                   /translation="MSEIIYVSPQLYLNSDTKWKSDGEKPGYIPILRADLYKFQESLKG
FT                   VLSSRSDQNQGKDGNLNSITYSIGSDAKTEYVANSGPDGVNQGPTGSTKFQTLQHFLPI
FT                   SLEQQLHTVSIMGIPVKVANKDVETFLHQCIRLLLQHLDAAQQRYEDFWQCWTSVQSLE
FT                   TQEVFVRFSDIDSKLFASFVKIVQGWFQSDKRPGAAEIHMDVNTEQLIKDQQVEPRKPS
FT                   DTLIDSLNRLWQELDQSPTDKTQKQESNVEYQVDLTTLSDLPQDSLDQLCQDIVKFRTR
FT                   VLTIEREKRVRESYEESKRRRQQMMMIFDQIRRSRRDAGDDRAELEEEEEGEEEEDEEE
FT                   IEAGDEDDWTLEQRRQDLQRQEADHRYKSLLTQLQSEWEPELADLQRKLFRANHYEQVR
FT                   LEEQPLHLKELSHLAVDPHYDHNRSYRQEEETRDEIDRKEHVIESTETNIQNKEQLLEG
FT                   KQSAATIYNSADQDNGAENNAAEQQFKIKFAFKRAIDNSTRALSDEEDEGRPIVAQVSD
FT                   TPTTPTSTTTTTTTTTTTEAATNAPDVLPEDGLDTKLEELNRSGLVQELVKEYLGVYEQ
FT                   ELVDYIFDTIRKERNKVALLTELRETFDEDAATIVENIWGSVHLTTS"
FT   gene            <900370..>904833
FT                   /locus_tag="ZYRO0G11242g"
FT                   /old_locus_tag="ZYRO-ORF989"
FT   CDS_pept        900370..904833
FT                   /locus_tag="ZYRO0G11242g"
FT                   /old_locus_tag="ZYRO-ORF989"
FT                   /product="ZYRO0G11242p"
FT                   /note="weakly similar to uniprot|P32334 Saccharomyces
FT                   cerevisiae YGR014W MSB2 Mucin family member at the head of
FT                   the Cdc42p- and MAP kinase-dependent filamentous growth
FT                   signaling pathway also functions as an osmosensor in
FT                   parallel to the Sho1p-mediated pathway potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29545"
FT                   /db_xref="GOA:C5E0B1"
FT                   /db_xref="InterPro:IPR039295"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0B1"
FT                   /protein_id="CAR29545.1"
FT                   /translation="MHHRSCLWRILVLLLSLQQVYADWPSGGGFDSSQSIGSQQDIPSS
FT                   NPNGGSSSSPNANGASSAGSASPSTTPFLESSDSNSGRPTAANSSPSQAVTSNSGNPND
FT                   ANTQGQELSSSQPTSGSSAQSQQSSVSSYPSAALTSNYQPSISSSAPGTSISQTPSTSQ
FT                   GLASSIEALTSGSQAPDSSSQTQISNAYSQGTTTSGFQSSPQTPSSSQGPTLSSQGPAS
FT                   SSETSPSSSQEPASSSQGLPSSSQAPTFSSQGSTSSTQGSTPSSEASPSGSQEPASSSQ
FT                   APTSSSQGLPSSSQVPTPSSEAPFSSSQVPTPSSVAPSSSSQAPTSSSQGPTSSSEAPF
FT                   SSSQVPTPSSETPSSSSQVPTPSSAAPSSSSEASPSSSQEPASNSQAPTSSSQGLTSSF
FT                   EGLSSSSQGVSSSSQEPSSSQSTSSSSQTPYSSSQAPTSDSQAPASSSVSQPALSVSQP
FT                   SSSSAQLAAASTPSSSSTSLSISSSQAASSSSPVPSTSFEASNSNSEVPSTSSEVPSSN
FT                   SEAPSTSSEAPSSSYQAPSTSSEVPSSNSEVPSASSESSSSNSEVPSTSSEAPSSSYQA
FT                   PSTSSEPPSSSYQAPSTSSEPPSSSYQAPSTSSEPPSPSSDVPTSSYQVPSSSSSSEVA
FT                   SSNSEVPSSSYQVPGSSSKVPSSSYQVPSSSYQVPSSSSEIQSLSSQEPSSLTSQLSSS
FT                   GSTFNGLTSQTGSSSSSSSYVVPSSSSSYEVPSSSSSYVIPSSSSSYVIPSSSSSYVVP
FT                   SSSSSYVVPSSSSSYVIPSSSSSYVVPSSSSSYVIPSSSSSYVVPSSSSSYVVPSSSSS
FT                   YVVPSSSSSYVIPSSSSSYVVPSSSSSYVIPSSSSSYVVPSSSSSYVVPSSSSSYVVPS
FT                   SSSSYVIPSSSSSYVIPSSSSSYVIPSSSSSYVVPSSSSSYVVPSSSSSYVIPSSSSSY
FT                   VIPSSSSSYVPTTSSSYLIPTSSSANVLTMPSSDVVSLSSSSIGYYSGSSSSSSSIPPP
FT                   TSSTSSYVDPTVSSSSLAQVPTGTSSYTYSSIPSTSSQSTIQSQSSSSPVYTVPASTFS
FT                   SPQTGSTSSSLTTGIASSNTSPETSSAQPTSLLTQTPLPASSQTSSVATGGFSSSAALS
FT                   QAVSTPSVIPSTATTQSTSHRHGYSMTQSYWPVSGPTTTLAPSSSTTNDNWWVPTKIIT
FT                   QPAPNTTASSTSSQATATLPQAIAAATQQVRPKGYSLLTIGFKSALNYNFLISSPLSSA
FT                   QIFAFLPSILNDPFQNQFNNVSIYQIVPLKSESLDYLATVAEVYFPTKHISDLNSLITN
FT                   NASSLYTDAHGSAKYLAELIDPTIPLTGLVPTGDKSQGFGSDSNYDSASFDGDNGGSAY
FT                   EGALGSSGKFTSSSHGHGSSGGKTAGLVVGVVVGGCTYLAAMILLVRYFVKRQIKRSIL
FT                   KDPENCSIDSSDSNLDLSHLEKRNNSFNDQESVSPSMKIHNWMNQSHNDNMAGSDVRLA
FT                   NDGRRFQVPKISRPIATQNSLGWNEV"
FT   gene            complement(<905177..>906127)
FT                   /locus_tag="ZYRO0G11264g"
FT                   /old_locus_tag="ZYRO-ORF985"
FT   CDS_pept        complement(905177..906127)
FT                   /locus_tag="ZYRO0G11264g"
FT                   /old_locus_tag="ZYRO-ORF985"
FT                   /product="ZYRO0G11264p"
FT                   /note="similar to uniprot|P53208 Saccharomyces cerevisiae
FT                   YGR015C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29546"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0B2"
FT                   /protein_id="CAR29546.1"
FT                   /translation="MKRFLHHGKIPLKSIVDLAFHHQPPPNPVSHVVNSRPAIINIHGI
FT                   FGSRRLFRPFSKPLANALNTDVYSVDLRNHGDSPIAQPFNYVSFTKDVIHFIKKHIGDK
FT                   RPVQLIGFSLGAKVALLATLCSQINASKCIAIDAPPYETVAVDSVLVENYELITKIINQ
FT                   EIKIEKGSKNWKKKLLKLFQGLPANATNNGDPSLYFANGFYSVKRNAEPPTAGQDPYIE
FT                   YSIPLEEFPNLIDEIIGWPDLQGKDNLEGLFKLSTDSPALFMKAMHSLAISDDYSLLKK
FT                   HFPRAVVKEIDSGHNMTVEKPEESLQCMIDFLKDS"
FT   gene            <906294..>906842
FT                   /locus_tag="ZYRO0G11286g"
FT                   /old_locus_tag="ZYRO-ORF984"
FT   CDS_pept        906294..906842
FT                   /locus_tag="ZYRO0G11286g"
FT                   /old_locus_tag="ZYRO-ORF984"
FT                   /product="ZYRO0G11286p"
FT                   /note="similar to uniprot|P53209 Saccharomyces cerevisiae
FT                   YGR016W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29547"
FT                   /db_xref="GOA:C5E0B3"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0B3"
FT                   /protein_id="CAR29547.1"
FT                   /translation="MPELKRIHRSVMDPDNNTDDGEDAIPMQPLDIDEQEDLIQQLEKG
FT                   NSKRNHLYVNVLTGIYAICGLSFLCQTRKSLGKEFWVYGLGCISMALSIVSVRYEIVTD
FT                   FQVFMTSQVQMNNIALQRFNVAVLVLVEWLALTELPLGMVSQIPLFLFFVSILTKRWVR
FT                   SMENEITSLRGLKYKYKSA"
FT   gene            complement(<906839..>907249)
FT                   /locus_tag="ZYRO0G11308g"
FT                   /old_locus_tag="ZYRO-ORF983"
FT   CDS_pept        complement(906839..907249)
FT                   /locus_tag="ZYRO0G11308g"
FT                   /old_locus_tag="ZYRO-ORF983"
FT                   /product="ZYRO0G11308p"
FT                   /note="similar to uniprot|Q02721 Saccharomyces cerevisiae
FT                   YLR329W REC102 Protein involved in early stages of meiotic
FT                   recombination required for chromosome synapsis forms a
FT                   complex with Rec104p and Spo11p necessary during the
FT                   initiation of recombination"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29548"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0B4"
FT                   /protein_id="CAR29548.1"
FT                   /translation="MTTLLAKPIEFRPHIKLPIVAHCTDLKIDADFHHCPHLWSPVDVV
FT                   SQLNEYLASLIVSQLEFQFPMVFSTIARNRFKSQETDIGPISYSLVYSSALIPITVQLI
FT                   AGERTATTACQLLRPKRRTSRIDFQILKQPLD"
FT   gene            complement(<907780..>908892)
FT                   /locus_tag="ZYRO0G11330g"
FT                   /old_locus_tag="ZYRO-ORF981"
FT   CDS_pept        complement(907780..908892)
FT                   /locus_tag="ZYRO0G11330g"
FT                   /old_locus_tag="ZYRO-ORF981"
FT                   /product="ZYRO0G11330p"
FT                   /note="highly similar to uniprot|P53295 Saccharomyces
FT                   cerevisiae YGR173W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29549"
FT                   /db_xref="GOA:C5E0B5"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0B5"
FT                   /protein_id="CAR29549.1"
FT                   /translation="MAMGITERIKAIEDEMARTQKNKATEYHLGLLKGKLARLRQQLLA
FT                   DEANSGGGGGQGFEVAKSGDARVVLIGYPSVGKSSLLGKVTTTKSEIAHYAFTTLTSVP
FT                   GVLRYQGAEIQVVDLPGIIYGASQGKGRGRQVVATARTADLVVMILDATKSEHQRASLE
FT                   KELEAVGIRLNKEKPNISFKKKDTGGVKVTFTSPSKTTLTEDSIKMILKDYRIHNADVL
FT                   VRDDKCTIDDFIDIINDQHRNYIRCLYVFNKIDSVSLEEVDRLARQPNTVVMSCEMDLG
FT                   MEDVVEEIWYQLNLSRVFTKKRGVKPDFSDPLVVRNNSTVGDLCHSIHRDFKDQFKYAL
FT                   IWGSSAKHSPQKCGLNHKIHDEDVVSLFTK"
FT   gene            <909110..>909191
FT                   /locus_tag="ZYRO0G11352r"
FT                   /old_locus_tag="Zyro0G.tSer.AGA.19"
FT   tRNA            909110..909191
FT                   /locus_tag="ZYRO0G11352r"
FT                   /old_locus_tag="Zyro0G.tSer.AGA.19"
FT                   /note="tRNA-Ser (AGA) cove score=83.48"
FT   gene            <909992..>910771
FT                   /locus_tag="ZYRO0G11374g"
FT                   /old_locus_tag="ZYRO-ORF978"
FT   CDS_pept        909992..910771
FT                   /locus_tag="ZYRO0G11374g"
FT                   /old_locus_tag="ZYRO-ORF978"
FT                   /product="ZYRO0G11374p"
FT                   /note="similar to uniprot|P42940 YGR207C Saccharomyces
FT                   cerevisiae YGR2 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29550"
FT                   /db_xref="GOA:C5E0B6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0B6"
FT                   /protein_id="CAR29550.1"
FT                   /translation="MSSKGLRILVPVKRVIDYQIRPRVNKTKTAIETTGVKFSINPFDD
FT                   IALEEALRIKEKKKATVDAIHAISIGPSKSQDILRNCLAKGADTSTLVDAGSQELEPLA
FT                   VAKILKQVVEKQGSNLVILGKQAIDDDNNNTGQMLAGMLNWPQATNAANVEFENGGDRI
FT                   KITREVDGGEEIVSAPLPLVITTDLRLNQPRYVGLQNLMKAKKKPMDKLKLKDFADLDL
FT                   ESRLKLLQVVEPEPRSPGIKVGSVDELVQNLKDAKAI"
FT   gene            complement(<910799..>911092)
FT                   /locus_tag="ZYRO0G11396g"
FT                   /old_locus_tag="ZYRO-ORF977"
FT   CDS_pept        complement(910799..911092)
FT                   /locus_tag="ZYRO0G11396g"
FT                   /old_locus_tag="ZYRO-ORF977"
FT                   /product="ZYRO0G11396p"
FT                   /note="similar to uniprot|P42939 Saccharomyces cerevisiae
FT                   YGR206W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29551"
FT                   /db_xref="GOA:C5E0B7"
FT                   /db_xref="InterPro:IPR019014"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0B7"
FT                   /protein_id="CAR29551.1"
FT                   /translation="MDLVEETLRNRPLVNSRGSKFPHEVPPRLHIPQIKLQPLQPASQM
FT                   FGPWYNECDQLVQLAELHDKRSQQFESWYVSQCLSKKPPGMAMTMLSPSRRE"
FT   gene            <911178..>911708
FT                   /locus_tag="ZYRO0G11418g"
FT                   /old_locus_tag="ZYRO-ORF976"
FT   CDS_pept        911178..911708
FT                   /locus_tag="ZYRO0G11418g"
FT                   /old_locus_tag="ZYRO-ORF976"
FT                   /product="ZYRO0G11418p"
FT                   /note="highly similar to uniprot|P47096 Saccharomyces
FT                   cerevisiae YJR025C BNA1 3-hydroxyanthranilic acid
FT                   dioxygenase required for biosynthesis of nicotinic acid
FT                   from tryptophan via kynurenine pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29552"
FT                   /db_xref="GOA:C5E0B8"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0B8"
FT                   /protein_id="CAR29552.1"
FT                   /translation="MLNTTPINLDQWLKENSHLLQPPVNNFCLHRGGFTVMIVGGPNER
FT                   TDYHINPTPEYFLQKKGHMTLRVVDESSEGDDRFKDIRIDEGSSYLLPGNTPHSPVRYA
FT                   NTVGIVVEQDRPEGSHDKMRWYCSKCRSIVHEIELQMLDLGTQVKEGILSFESDVSKRT
FT                   CNKCGTLNYARPV"
FT   gene            <911837..>912568
FT                   /locus_tag="ZYRO0G11440g"
FT                   /old_locus_tag="ZYRO-ORF975"
FT   CDS_pept        911837..912568
FT                   /locus_tag="ZYRO0G11440g"
FT                   /old_locus_tag="ZYRO-ORF975"
FT                   /product="ZYRO0G11440p"
FT                   /note="similar to uniprot|P47095 Saccharomyces cerevisiae
FT                   YJR024C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29553"
FT                   /db_xref="GOA:C5E0B9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="InterPro:IPR027514"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E0B9"
FT                   /protein_id="CAR29553.1"
FT                   /translation="MPTDADYLIDSQDPRHPANLICTLCKQFFDFNWCTGTGGGISIKH
FT                   PQTGHLYVAPSGVQKEQMKPHDMFVVDGKSYEYLRIPPGLKPSACTPLFNACYKYKSAG
FT                   AIVHTHSLNAVTCSLIFGQEFRIRGVEQIKAIPSDRKDPSTGKVLNLNWDDTCVIPIIE
FT                   NRPHEDQLEDPLMETFEKYPHACAVIVRRHGIFVWGPTIEKAKVINEALDYLMELAVKM
FT                   HQLGIPPDCSVGQESKYISKH"
FT   gene            complement(<912593..>912904)
FT                   /locus_tag="ZYRO0G11462g"
FT                   /old_locus_tag="ZYRO-ORF974"
FT   CDS_pept        complement(912593..912904)
FT                   /locus_tag="ZYRO0G11462g"
FT                   /old_locus_tag="ZYRO-ORF974"
FT                   /product="ZYRO0G11462p"
FT                   /note="similar to uniprot|P47093 Saccharomyces cerevisiae
FT                   YJR022W LSM8 Component of small nuclear ribonucleoprotein
FT                   complexes involved in RNA processing and splicing"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29554"
FT                   /db_xref="GOA:C5E0C0"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034103"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0C0"
FT                   /protein_id="CAR29554.1"
FT                   /translation="MSPLLKDYLHRRVLVITTAGDCIVATLEGFDKNTNVVISDVVDRC
FT                   TLRPMAMAQAVRGSEIVAMGPIDDAPTGTVDPLKDTKNKIPNEHLIWEKVGQRKLYRH"
FT   gene            <912905..>913668
FT                   /pseudo
FT                   /locus_tag="ZYRO0G11484g"
FT                   /old_locus_tag="pseudo-Zyro0G-912904-913668"
FT   gene            complement(<913680..>914534)
FT                   /locus_tag="ZYRO0G11506g"
FT                   /old_locus_tag="ZYRO-ORF971"
FT   CDS_pept        complement(913680..914534)
FT                   /locus_tag="ZYRO0G11506g"
FT                   /old_locus_tag="ZYRO-ORF971"
FT                   /product="ZYRO0G11506p"
FT                   /note="similar to uniprot|P42938 Saccharomyces cerevisiae
FT                   YGR205W Protein that binds ATP crystal structure resembles
FT                   that of E.coli pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29555"
FT                   /db_xref="GOA:C5E0C1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0C1"
FT                   /protein_id="CAR29555.1"
FT                   /translation="METVERVLQFVDKYVPLFMERRDHGGGSEPLFVFVCGPQGSGKTF
FT                   TTDAIVKHLGSKYRVAGASIDDFYLTHEDQLKFSRTFRRNKLLQGRGLPGTHDIALLTQ
FT                   CIENVVRGKEGKLDIPTYDKSLCNGEGDRSEFRQVDLPLDVFVLEGWFLGFNPLLSKQE
FT                   INSHPLLQGGGDMVQVNANLLFYKDLLWGNSELKSLGVILEADDIKNVYQWRAEQEQEL
FT                   HKLKGQGMDDDQVKKFVDRYWPCYELYYEPLVQSESFGSVATLTLGLDLQRNVISIKDR
FT                   CIE"
FT   gene            <914854..>915867
FT                   /locus_tag="ZYRO0G11528g"
FT                   /old_locus_tag="ZYRO-ORF969"
FT   CDS_pept        914854..915867
FT                   /locus_tag="ZYRO0G11528g"
FT                   /old_locus_tag="ZYRO-ORF969"
FT                   /product="ZYRO0G11528p"
FT                   /note="similar to uniprot|P41903 Saccharomyces cerevisiae
FT                   YJR019C TES1 Thioesterase peroxisomal acyl-CoA
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29556"
FT                   /db_xref="GOA:C5E0C2"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0C2"
FT                   /protein_id="CAR29556.1"
FT                   /translation="MESLFADIEKILELQSVSKSIYRSKRLGIPPVGSRGTFGGILLGQ
FT                   SLLAAMYTVPTTFVPSSLHCYFVNGGDPTVLLQYEVEDIRRGKSFLHQQVKAYQADKLV
FT                   SIVAVLWSLEKQVSKDALHYFKTLEQDEFPPMDRFEDAGPLYRRTVIETNGLKRLDDDL
FT                   PSFRNFKLRDTFLDSFFNGCVDHRFPTDFFHSHGAKKKLDYYVRIRDLITNTGRNEAPQ
FT                   VSVNPRNDFRYNYVAFCYLSDSYFIFTVPNFHGLPLFTYKFSVSLDHSIHFHGVPEVNG
FT                   WMYMRIHNPRSYKDKHLVQGEYFNAETGQIVASTSQEGLTVYHSEKKIREMIRPKL"
FT   gene            complement(<915944..>918787)
FT                   /locus_tag="ZYRO0G11550g"
FT                   /old_locus_tag="ZYRO-ORF968"
FT   CDS_pept        complement(915944..918787)
FT                   /locus_tag="ZYRO0G11550g"
FT                   /old_locus_tag="ZYRO-ORF968"
FT                   /product="ZYRO0G11550p"
FT                   /note="highly similar to uniprot|P07245 Saccharomyces
FT                   cerevisiae YGR204W ADE3 Cytoplasmic trifunctional enzyme
FT                   C1-tetrahydrofolate synthase involved in single carbon
FT                   metabolism and required for biosynthesis of purines
FT                   thymidylate methionine and histidine"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29557"
FT                   /db_xref="GOA:C5E0C3"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0C3"
FT                   /protein_id="CAR29557.1"
FT                   /translation="MSAQLIDGKSCAQAIRSEVAQEIVDIKSRDPSFKPCLAIVQVSDR
FT                   QDSSTYVRMKCKAAAEADIKTEFVHLNEDVSEAQVLEKVSELNEDPSIHGVLVQLPLPA
FT                   HINEDKVTSSVLARKDVDGFGPFNVGELNKRSGKPFFYPCTPLGIIELLKRYEITISGT
FT                   KSVVIGRSDIVGSPVAELLKSLDSTVTVAHSKTQNLESYLEDADIVVVGIGCAQFVKGE
FT                   WFKNNKRGVVVIDVGTNYVEDPSKKSGYRSVGDVEFEEALKYVRLITPVPGGVGPMTVA
FT                   MLMKNTLTAAKREWENGGKLRKFEPLPLNLQKPVPSDFEISRARKPKDISEVALEAGIL
FT                   PSELEPYGSTKAKVNLKILDRLQNRKNGKYVLVTGITPTPLGEGKSTTTVGLAQALGAH
FT                   LNKTVFANVRQPSMGPTFGIKGGAAGGGYSQVIPMDEFNLHVTGDIHAISMANNLLAAA
FT                   IDTRMFHESTQKDGPLYKRLVPAKKGVRKFSKTMLKRLEKMGIDKTNPNDLTPEEITKF
FT                   ARLDIDPETITWRRVVDCNDRMLRGITIGEAPTEKGHTRHTAFDISVASECMAILALSN
FT                   SLQDMRERLGRIVVAASKSGEPITCEDIGCAGAMTALLKDAIKPNIMQTLEGTPVFVHA
FT                   GPFANISIGANSVLADKMALKLAGVDPETPVDLQKNRSGYVITEAGFDFTMGGERFINI
FT                   KCRSSGLIPDVVVIVATVRALKVHGGGPEVKAGAPLPIEYLQENVDLLRKGCANLGKHI
FT                   ENAKQYGLPVVVAINKMASDTDLEHQVIKEESLKAGAFDAIVSNHWEQGGLGAIELAEG
FT                   IVKATNEIDSSKFDFLYGLQGTVEDRIREIAQKMYGAADVEFLPEAQRKIELYTKQGFA
FT                   HLPVCIAKTQYSLSHDANLKGVPKGFVFPVRDIKASVGAGYLYALAAEIQTIPGLPTHC
FT                   GFMNVEVTEDGEIEGMF"
FT   gene            <919421..>919909
FT                   /locus_tag="ZYRO0G11572g"
FT                   /old_locus_tag="ZYRO-ORF965"
FT   CDS_pept        919421..919909
FT                   /locus_tag="ZYRO0G11572g"
FT                   /old_locus_tag="ZYRO-ORF965"
FT                   /product="ZYRO0G11572p"
FT                   /note="highly similar to gnl|GLV|KLLA0E16610g Kluyveromyces
FT                   lactis KLLA0E16610g and similar to YJR017C uniprot|P22696
FT                   Saccharomyces cerevisiae ESS1 Peptidylprolyl-
FT                   cis/trans-isomerase (PPIase) specific for phosphorylated
FT                   serine and threonine residues N-terminal to proline"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29558"
FT                   /db_xref="GOA:C5E0C4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0C4"
FT                   /protein_id="CAR29558.1"
FT                   /translation="MSDTGLPSPWTVRYSRSKKREYFFNPDTKQSIWEEPEGTNHSQLK
FT                   QYLSEHPVRVRALHILAKHSESRRPASHRSDHITLPKEQAIQELEQLQNRIESGESFES
FT                   LAKERSDCSSFKRGGDLGWFGKGEMQPTFEKTAFHLNVGQVSSIVESDSGVHLIKRVG"
FT   gene            complement(<919989..>920423)
FT                   /locus_tag="ZYRO0G11594g"
FT                   /old_locus_tag="ZYRO-ORF964"
FT   CDS_pept        complement(919989..920423)
FT                   /locus_tag="ZYRO0G11594g"
FT                   /old_locus_tag="ZYRO-ORF964"
FT                   /product="ZYRO0G11594p"
FT                   /note="similar to uniprot|P42937 YGR203W Saccharomyces
FT                   cerevisiae Probable protein tyrosine phosphatase of the
FT                   CDC25-like phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29559"
FT                   /db_xref="GOA:C5E0C5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0C5"
FT                   /protein_id="CAR29559.1"
FT                   /translation="MQSRTVASIKYIDASQLFNMMKRGSSTPFQVIDVRGSDYIGGHIR
FT                   GGWNYPYKKFSDSIPELLDRLQEKRSSNSNDTTINVVFHCAQSQQRGPSAAMKFLREIP
FT                   EPDLDKFEISVLRGGFINWQDLYGSDSTVTEDYHPDLWSW"
FT   gene            <920796..>922013
FT                   /locus_tag="ZYRO0G11616g"
FT                   /old_locus_tag="ZYRO-ORF963"
FT   CDS_pept        920796..922013
FT                   /locus_tag="ZYRO0G11616g"
FT                   /old_locus_tag="ZYRO-ORF963"
FT                   /product="ZYRO0G11616p"
FT                   /note="similar to uniprot|P33412 YGR007W Saccharomyces
FT                   cerevisiae MUQ1 Choline phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29560"
FT                   /db_xref="GOA:C5E0C6"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR041723"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0C6"
FT                   /protein_id="CAR29560.1"
FT                   /translation="MGPSSRNKSLKSRLSNTSLSNLFHLSKKRKHSDDEAESEAEGEEE
FT                   SEFDSQQSTDQNTTGETEDTQVAKRHHSQKHEEDKKFEEEELQRDAELPEDLRKYRPRG
FT                   FKLNIPPKDRPVRVYADGVFDLFHLGHMKQLEQCKKSLPNVVLICGVPSDSVTHKLKGL
FT                   TVLTDEQRCETLYHCKWVDEVIPNAPWCVTPEFLAQHKIDYVAHDDIPYGSADSDDIYR
FT                   PIKELGQFLTTQRTDGISTSDIITRIIKDYDKYLVRNFARGATRQELNVSWLKKNELDF
FT                   KKHVNEFRAYFKKNQENLNNVSKDLYFEVREILLRKTLGRKLYSKLAGDGGGELQDTLS
FT                   KRGKLIREKSPVSDFASQFTGEEKSGSSNKLEQGNDAHYEKHERSPRRRGSSSTSKRSQ
FT                   QRKMKR"
FT   gene            <922274..>924025
FT                   /locus_tag="ZYRO0G11638g"
FT                   /old_locus_tag="ZYRO-ORF960"
FT   CDS_pept        922274..924025
FT                   /locus_tag="ZYRO0G11638g"
FT                   /old_locus_tag="ZYRO-ORF960"
FT                   /product="ZYRO0G11638p"
FT                   /note="highly similar to uniprot|P39522 Saccharomyces
FT                   cerevisiae YJR016C ILV3 Dihydroxyacid dehydratase catalyzes
FT                   third step in the common pathway leading to biosynthesis of
FT                   branched-chain amino acids"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29561"
FT                   /db_xref="GOA:C5E0C7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0C7"
FT                   /protein_id="CAR29561.1"
FT                   /translation="MGLVDKASRKFCTTRIVGKKLNKYSYIVTEPKDQGGSQAMLYATG
FT                   FKPDDLSKGQVGVGSCWWSGNPCNMHLLDLNHRCAESVNKAGFKAMQFNTIGVSDGIPM
FT                   GTSGMRYSLQSREIIADSFETQMMAQHYDANIAIPSCDKNMPGVLMAMGRHNKPSIMVY
FT                   GGTILPGTPTCGSSKLPKNIDLVAAYQSYGQYISKQITEEERSDVVSHACPGPGSCGGM
FT                   YTANSMAAAAEVMGITLPNTSTSPATSKEKLAECASIGDAIKKTMELNILPRDVLTREA
FT                   FENAITYVIATGGSTNAVLHLVAIAHSAGVKLTPDDFQRISDKTPLLGDFKPSGKYFIA
FT                   DLYKVGGTQAVIKFLYENGFLHGNTLTITGETLAERAAKAAPLSEGQDLISSVSQPVNP
FT                   NGHLQILYGSLAPGGAVGKITGKEGTYFKGKAKVFEEEVSFIHALEKGEIKKGEKTVVV
FT                   IRYEGPKGGPGMPEMLKPSAALMGYGLGQDVAMLTDGRFSGGSHGFLIGHVVPEAAEGG
FT                   PIGLVKDGDEIVIDAQNNKIDLLVDENEMAKRRADWTPPSPRYTKGTLWKYSKLVSNAS
FT                   QGCVLDA"
FT   gene            <924314..>926665
FT                   /locus_tag="ZYRO0G11660g"
FT                   /old_locus_tag="ZYRO-ORF958"
FT   CDS_pept        924314..926665
FT                   /locus_tag="ZYRO0G11660g"
FT                   /old_locus_tag="ZYRO-ORF958"
FT                   /product="ZYRO0G11660p"
FT                   /note="similar to uniprot|P42935 Saccharomyces cerevisiae
FT                   YGR200C ELP2 Elongator protein part of the six-subunit RNA
FT                   polymerase II Elongator histone acetyltransferase complex
FT                   target of Kluyveromyces lactis zymocin"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29562"
FT                   /db_xref="GOA:C5E0C8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037289"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0C8"
FT                   /protein_id="CAR29562.1"
FT                   /translation="MVSVIPEATFIGANRQNQVSDVNKDAKVAFGAGKTIALWDPVNKD
FT                   AKGVYATLKGHQAEVTCVKFIPNMDLMVSTSEDHHVKIWKFSSLECLQTIEHYKHSIVS
FT                   LAVWKDLIVVGSADGLVSLWVFRDNEFVLDYEFTNRKGFFPLSLSVTNIEDGGFLLAVG
FT                   GTKPNIIVYSFVLRDSRVHECRLAAELEGHEDWVKSLAFRHKDTPGECLLASGSQDRYI
FT                   RLWKVRLNELIDDSDENTERPKLLSNKQYKFEIKSGLRVSMSFEALIVGHDDWISSLQW
FT                   HESRMQLLASTADTSLMVWEPDESSGVWICGSRLGEISSKGASTATGSSGGFWSCLWFN
FT                   HDGLEYILTNGKSGSWRVWSSSDNYYWEQHLGVTGATKQVTDIAWSPSGDYLLSTSLDQ
FT                   TTRLYAPWLFNNDGTPRGQVTWHEFSRPQIHGYDMVCVEPLSNFRFVSGGDEKILRSFD
FT                   LPKGVFEILHKLAGYNSDFQNALPVSASLPALGLSNKATAVEDQEIEEEEQDPNLRETN
FT                   ENKNISYDMASSLTIPPLEDQLQRHLLWPEIEKLYGHGYEISCVDVSSDGKLIASACRS
FT                   NNAQHAGVRIFDSNNWLEVKPTLLFHTLTITRLRFSKDNNYLLSVSRDRQWAIWQRNFE
FT                   DQTFSLKYKNEKAHTRIIWDCDWAPIEFGQVFLTASRDRTVKSWRYDQESDNFTSENSV
FT                   KFEQPVTALSICEKVIDGQLIVAIGLEGGSIHLYSYTPQGFKLLEQIDESLTPADKITR
FT                   LRWSPSFREDRLYLGVSSSDTSTRIYSLKC"
FT   gene            complement(<926745..>928904)
FT                   /locus_tag="ZYRO0G11682g"
FT                   /old_locus_tag="ZYRO-ORF956"
FT   CDS_pept        complement(926745..928904)
FT                   /locus_tag="ZYRO0G11682g"
FT                   /old_locus_tag="ZYRO-ORF956"
FT                   /product="ZYRO0G11682p"
FT                   /note="similar to uniprot|P42934 Saccharomyces cerevisiae
FT                   YGR199W PMT6 Transfers mannose residues from dolichyl
FT                   phosphate-D-mannose to specific serine/threonine residues
FT                   of proteins in the secretory pathway dolichyl phosphate-D-
FT                   mannose:protein O-D-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29563"
FT                   /db_xref="GOA:C5E0C9"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0C9"
FT                   /protein_id="CAR29563.1"
FT                   /translation="MSESVEKGKVPQLQNFYRGLLRLESIISPIAYTLLALYVRFQNID
FT                   KNPDVVWDEAHFGKFGSYYIKHEFYHDVHPPLGKMLIALTEWLAGFDGEFDFDSNQSYP
FT                   ENVNYKLIRQINACFGVACCPLAYWTAKNMGFQLLTVHLIAIMVTLEHSYIVLSKFILL
FT                   DSMLLFFTIATFACLVKMYTARREPFTRRWKLWMWLTGLSIGCVCSVKWVGLFVTLVVG
FT                   AYTILELFTLRFDPKVSRKQYFKHWAIRVINLIVTPFLIYLFLFKIHFTLLYKSGPGDA
FT                   STNTLFQVNLENNEIETGPRTVAFGSLITIRSHGLSPNLLHSHFQTYPEGSNQNQVTGY
FT                   GFADDNNVWQVRFPRSSELNWEEDYLPDEGSGYITDGSVIRLFHNQQKVNLHTHRIPSH
FT                   VSRGNYEVSGYGSEEIGDLKDDWIVEIVRQTDSSDPDYPKENYDELHPVSTFFRLRNKE
FT                   LGCYLTSTGFSYPKWGFQQAEIVCKHSWSKHDKSTWWNVEEHWNENLPIDTDWHPPKSR
FT                   FWTDFVMINFAMASSNSALVEDHDKFDNLATDAWEWPTLHRGLRMCSWSKDSYRYFLMG
FT                   SPFNTWLSTLSLFVFLAITAKLLYQWKRQTKPMTESTFWEFIIQGVMPFTAWVTHYLPF
FT                   VVMGRVTYVHHYLPALYFAILIFGFVVDRLLRSSFNWIKYPVYIALFGGCIKTYTYFSP
FT                   ICQGMTGMWTDYIYLEWLKSWDMAV"
FT   gene            complement(<929043..>929936)
FT                   /locus_tag="ZYRO0G11704g"
FT                   /old_locus_tag="ZYRO-ORF954"
FT   CDS_pept        complement(929043..929936)
FT                   /locus_tag="ZYRO0G11704g"
FT                   /old_locus_tag="ZYRO-ORF954"
FT                   /product="ZYRO0G11704p"
FT                   /note="some similarities with uniprot|P42835 Saccharomyces
FT                   cerevisiae YNL327W EGT2 Glycosylphosphatidylinositol (GPI)-
FT                   anchored cell wall endoglucanase required for proper cell
FT                   separation after cytokinesis expression is activated by
FT                   Swi5p and tightly regulated in a cell cycle-dependent
FT                   manner"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29564"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0D0"
FT                   /protein_id="CAR29564.1"
FT                   /translation="MRFFLQCLFYYCVTAAVTLVNAKDDSFFTNVGLRDSVSGYAYCRD
FT                   PNHWFQIDAELFLSEGQDRDVFLSIPREFTGLPTEPFELMHKSQVIGKVMISDDHLVQI
FT                   SFPIPPKENITGNLRFMAKLDPDAVESIEAPRIINYNFYSSQGEHFKEPIRFEPRSLGA
FT                   VHVDGGMFLHNNTAWFVVDIPVEQLNEPVYVSSDPGAGSPVNQHQIIQGTARCELVTSV
FT                   DSFHRPRITEPIEPLEDYTSESSVLMKFDHNLDGYYVRILYYTRPRILEFDRPIRAQTA
FT                   FYKRTVKGLTKYAIYS"
FT   gene            <930786..>931763
FT                   /locus_tag="ZYRO0G11726g"
FT                   /old_locus_tag="ZYRO-ORF952"
FT   CDS_pept        930786..931763
FT                   /locus_tag="ZYRO0G11726g"
FT                   /old_locus_tag="ZYRO-ORF952"
FT                   /product="ZYRO0G11726p"
FT                   /note="highly similar to uniprot|P32318 Saccharomyces
FT                   cerevisiae YGR144W THI4 Protein required for thiamine
FT                   biosynthesis and for mitochondrial genome stability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29565"
FT                   /db_xref="GOA:C5E0D1"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR027495"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0D1"
FT                   /protein_id="CAR29565.1"
FT                   /translation="MSATATQTQEVTQLQLNAQQPIRHALSDVVKTEDWSDFQFTPIRE
FT                   STVSRAMTRRYFQDLDKHAVSDVVIIGAGSSGLSAAYVICKNRPDLTVTCVEANVSPGG
FT                   GAWLGGQLFSAMIMRKPAHLFLDELEVPYDDEGDYVVVKHAALFTSTVLSKVLQFPNFK
FT                   LFNATAVEDLVTRPAGPNGEVTVAGVVTNWTLVTMAHDLQSCMDPNVIELAGYKNDGTR
FT                   DAEKKHGVILSTTGHDGPFGAFSAKRIVDIDSTNKLKGMKGLDMNHAEADVVKNSGSYN
FT                   NVGSVYFAGMEVSELSGCNRMGPTFGAMAVSGIKAAEEILRHFA"
FT   gene            complement(<931918..>934203)
FT                   /locus_tag="ZYRO0G11748g"
FT                   /old_locus_tag="ZYRO-ORF949"
FT   CDS_pept        complement(931918..934203)
FT                   /locus_tag="ZYRO0G11748g"
FT                   /old_locus_tag="ZYRO-ORF949"
FT                   /product="ZYRO0G11748p"
FT                   /note="similar to uniprot|P46951 Saccharomyces cerevisiae
FT                   YGR198W Essential protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cytoplasm in a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29566"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0D2"
FT                   /protein_id="CAR29566.1"
FT                   /translation="MSSVEDPVVESLRSRLVGSGNFHSGIHSLDTALTLQSRIHDHLFG
FT                   IGLDPTVAKVLSDDCKKLLGNFKVEPGNQDINIRNLLNKILYNCEGVLHYHMERPNDAN
FT                   IYFSKSKVIELRDLPFAQFLNLENLYYRGLCKDDTLLYGEELFRIIDSVPNDSQGLTLH
FT                   YLSMIFNHISRDKEVAGRILATFPSSSPLTCLASLHLGEYEDTKFLNILAQLVNESHFP
FT                   QAEANNNKALEDFHMFLHYYFKKATKLSPDWKKYIIESMEKTFQSVAVAKSAFIYFGRN
FT                   SITSPVDTKESILNFVNFVKYTQREYVLHGNKHDDLVSLIDSYAYILKIAQDSSHDVEN
FT                   VFNFQDSVNKLLDLLRLMHKQNGFPLMSGQDSLNWLENRDELILPRTVSKRLTNAWEML
FT                   FTIDKNSLTLLNDNSLTAYLTNALSVATDPLKLYQLNFQYCYLLAQKGLIEPAIKILET
FT                   VLLEENPECYSAWHLLALCKSINEDKEVSFKIVCSVLQAMQEGFEEGRLAVTDRWQFVH
FT                   LKMTQLKIVEDIFGIMDALEMLPELFELFSLLFPADDKRFDRIGNGYNQTKEYLLQIVW
FT                   LFASGLYMRVPENYTDAADAINESIGVSKEFKNLNCNIAKGYLCLARGQCKRASKEFNT
FT                   VLLADPYNVSALVGLAQVVYPEGDTEICDYYKLRPLTPDSLDQKQDCQPESVFVSEADR
FT                   SANIARLKLLLESAIAHSIEADHSPEIWWYLSLIYEQYKDIGYKDALLNCVRYKETEPV
FT                   RPFKYCNF"
FT   gene            complement(<934447..>935031)
FT                   /locus_tag="ZYRO0G11770g"
FT                   /old_locus_tag="ZYRO-ORF948"
FT   CDS_pept        complement(934447..935031)
FT                   /locus_tag="ZYRO0G11770g"
FT                   /old_locus_tag="ZYRO-ORF948"
FT                   /product="ZYRO0G11770p"
FT                   /note="similar to uniprot|P47089 Saccharomyces cerevisiae
FT                   YJR014W RBF22 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29567"
FT                   /db_xref="GOA:C5E0D3"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005873"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0D3"
FT                   /protein_id="CAR29567.1"
FT                   /translation="MLREVVYCGVCSFPPEYCEFSGKLKRCKIWLQENHAELFEKLYSG
FT                   EDAEVEGVTGKLAESSIGEKREEKLEKDLLKMQAKEENREQRELAKKLSSKIIIKREAR
FT                   TKRKSVVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVIQGDVMGEVENY
FT                   LHSILAEKGLKDVKVEVVDGAAKKKKKPEGA"
FT   gene            <935438..>937981
FT                   /locus_tag="ZYRO0G11792g"
FT                   /old_locus_tag="ZYRO-ORF946"
FT   CDS_pept        935438..937981
FT                   /locus_tag="ZYRO0G11792g"
FT                   /old_locus_tag="ZYRO-ORF946"
FT                   /product="ZYRO0G11792p"
FT                   /note="some similarities with uniprot|P46949 Saccharomyces
FT                   cerevisiae YGR196C FYV8 Protein of unknown function
FT                   required for survival upon exposure to K1 killer toxin"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29568"
FT                   /db_xref="InterPro:IPR026248"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0D4"
FT                   /protein_id="CAR29568.1"
FT                   /translation="MADQVGRKKSYRWVSASQASYDGSEWDSDDDDIIYGDKKGTSENH
FT                   LKRDDTISNLPALPKLNYEDYEDNNTIKEEGSEKGDNEHDHSLEEEPAVVRESAGSRRD
FT                   SRVESFAGDDLLENYFGNTVASQAERNSNDKHHNGLIDRKKPEPLPLEEHGEDMKEDGA
FT                   VPKLEFNSSRESLRSPLPQKTPVNEDLDNLMAQISKEMEQQKKRYTREGDDLNASPKDS
FT                   SGDDDDEEEELGVSKNGYFSNLVQSDKEDEHLMDKESPRSYQRDSALGEYSPDNHLERS
FT                   VLASSLSYSHSSRETGREPIENYEEDRVKDTPSSKSSVEPPERSALRSPLRSPPHSPPH
FT                   SPSHSPPHSPPRSPPRSPPRSPPRSPPRSPPKSSSRSPVRSPASMSSSLEDSEDDALSF
FT                   TESLNYHGSANGDDGEDNDSDNVNDNNYNEDEDEDEESDDEGIMRVHKSGYFGKMVSED
FT                   DDAETIRRGNDSDNEKEERVSTERGDQNGLLHEDNNKGEMQNQQGFTEGAEDDLSDAGE
FT                   SVEAGEGKRSISGQKSVNLGGWRPDIGGARSGFLQETARKAPPGYVYDENGELVNLTPS
FT                   SMKSRAVSTYSEMESAWNPFPSGDDDDDDLQTVGDTKTIYDNQTIYNVPGLITNNQNLP
FT                   PLPNLDNETHLVNEPTGSNSSDPRSLTVDSSLATVSEIDSERDKGPLKSHFHEVLNTSA
FT                   PDLNGEPMKGKRTGESSGAETPTQKTPIISGSTTVPLLDLNKVISSKSSHAHKIQELQH
FT                   YYDQLVEHDTGIHAWIEASLTSSTKPEKGYLFEQYKVNKHVKDAYANADELSKKHTVTN
FT                   TVASVNQNVSQLKKKVFLHPMKSRGLFSSIGKKKV"
FT   gene            complement(<938076..>938813)
FT                   /locus_tag="ZYRO0G11814g"
FT                   /old_locus_tag="ZYRO-ORF943"
FT   CDS_pept        complement(938076..938813)
FT                   /locus_tag="ZYRO0G11814g"
FT                   /old_locus_tag="ZYRO-ORF943"
FT                   /product="ZYRO0G11814p"
FT                   /note="highly similar to uniprot|P46948 Saccharomyces
FT                   cerevisiae YGR195W SKI6 superkiller ExtraCellular Mutant
FT                   Ribosomal RNA Processing homolog of RNAse PH"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29569"
FT                   /db_xref="GOA:C5E0D5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0D5"
FT                   /protein_id="CAR29569.1"
FT                   /translation="MSRFEIYSPEGLRVDGRRWNELRRFDCSINTHSHAADGSSYLEQG
FT                   NNKIITLVKGPKEPSLRSQMDPTKALLKVSVNITKFSKTERSKTSHKNERRVLEIQTAL
FT                   TRTFNKNVMLHIYPRTLIDIEIHVLQQDGGLVGTLINGITLALIDAGIAMFDYISGVSV
FT                   GLYDTTPLLEVNSLEENVMSSVTLGVVGKTEKLSLLLVEDKIPLDRLESVLAIGIAGAH
FT                   RVRELMDSELRKRAEKRVANSTN"
FT   gene            complement(<938959..>940149)
FT                   /locus_tag="ZYRO0G11836g"
FT                   /old_locus_tag="ZYRO-ORF942"
FT   CDS_pept        complement(938959..940149)
FT                   /locus_tag="ZYRO0G11836g"
FT                   /old_locus_tag="ZYRO-ORF942"
FT                   /product="ZYRO0G11836p"
FT                   /note="similar to uniprot|P47088 Saccharomyces cerevisiae
FT                   YJR013W GPI14 Glycosylphosphatidylinositol-alpha 1 4
FT                   mannosyltransferase I involved in GPI anchor biosynthesis
FT                   requires Pbn1p for function homolog of mammalian PIG-M"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29570"
FT                   /db_xref="GOA:C5E0D6"
FT                   /db_xref="InterPro:IPR007704"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0D6"
FT                   /protein_id="CAR29570.1"
FT                   /translation="MVSGGVWLLVSSLLLRIGFFTFGIYQDAHMQVKYTDIDYYVFHDA
FT                   AGYVFKHGSPFMRDTYRYTPLLSWLLVPNHYLAWIHYGKLLFVIFDLITGVIIMRQLAG
FT                   SSKANWLASLWLLNPMVITISTRGNAESILGFMVMLTLYWLQNGQLVLAGLMYGISIHF
FT                   KIYPVIYSLPISIYTYNRYKGHRWFYKLVLLGAAALIGLAGCSIWMYQIYGQEFLENAY
FT                   LYHLYRTDHRHNFSIWNLLLYFDSARPEKSALSKIAFVPQLIVTASISILQWWNPSFEN
FT                   LPCVLFVQTFAFVTFNKVCTSQYFIWYLIFLPLYISRSNISPLKGVIMLAVWGITQGLW
FT                   LLQGYRLEFLGQDVFFPDLLAASAAFFLGNVWLLGQFIEDIKNSQQPKIDRVKKEL"
FT   gene            <940285..>940620
FT                   /locus_tag="ZYRO0G11858g"
FT                   /old_locus_tag="ZYRO-ORF941"
FT   CDS_pept        940285..940620
FT                   /locus_tag="ZYRO0G11858g"
FT                   /old_locus_tag="ZYRO-ORF941"
FT                   /product="ZYRO0G11858p"
FT                   /note="some similarities with uniprot|P47087 Saccharomyces
FT                   cerevisiae YJR012C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29571"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0D7"
FT                   /protein_id="CAR29571.1"
FT                   /translation="MAEGLCYEELIDHIIANKPIPNVVQVPEVTYDESERTHSELKPRP
FT                   KPWEMQEKVEEAPLVNEPLQDPSQLPSNIRLSEELRALTRSQSIESLSNYYAREAELDA
FT                   ALENDNR"
FT   gene            complement(<940728..>941624)
FT                   /locus_tag="ZYRO0G11880g"
FT                   /old_locus_tag="ZYRO-ORF940"
FT   CDS_pept        complement(940728..941624)
FT                   /locus_tag="ZYRO0G11880g"
FT                   /old_locus_tag="ZYRO-ORF940"
FT                   /product="ZYRO0G11880p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29572"
FT                   /db_xref="GOA:C5E0D8"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0D8"
FT                   /protein_id="CAR29572.1"
FT                   /translation="MGNGLVTDETYSRLMGFVAGTFSGVAKNTVGHPFDTVKVRLQTSQ
FT                   GTGRFNGPLDCVAKTLKQQGVRGLYLGFTPPLVGWVIMDAVLLGSLHNYRMLLHQYVYP
FT                   SYEKLPLAGCVTAGVMSGWTVSFVAAPVELAKAKLQVQYDAKNANYKGPIDVIKKVYGA
FT                   EGIRGLYKGLISTLIFRSHFVFWWGSYELITNWFQTHTKMSAPAINFWAGGLSACFGFW
FT                   TTAYPSDVVKQVVLTNDKYGSDFKSWRMAVRDIYTQRGINGFFKGFVPSILRSFPANAA
FT                   ALAAFEFVLRTSGAKPA"
FT   gene            <941981..>942775
FT                   /locus_tag="ZYRO0G11902g"
FT                   /old_locus_tag="ZYRO-ORF939"
FT   CDS_pept        941981..942775
FT                   /locus_tag="ZYRO0G11902g"
FT                   /old_locus_tag="ZYRO-ORF939"
FT                   /product="ZYRO0G11902p"
FT                   /note="similar to uniprot|P47086 Saccharomyces cerevisiae
FT                   YJR011C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29573"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0D9"
FT                   /protein_id="CAR29573.1"
FT                   /translation="MSSGTIDDALFPLHRIDQDMVFEDKKNILLSNQIILFVLNTSHYM
FT                   TDLIYALYFLSFCEREDINDGTNSASARNSHGGSEEHKRDVAEQLAEIRKQLYALVYQV
FT                   RTNFRQLLDDCRKTRVDSAPKFRRLVDWNLVCVLGVINDLLISEMRHISTPLSVQLHNC
FT                   MLGFANLYQFLKKIPLQHQYQITKPQLDVLLQALGVELIPSWKLQLDLLNYRLFSTLAC
FT                   NDSIVSEYRKSTGDSDTNVKNGEGFKVLVNWLKDEIIGDVTL"
FT   gene            <943039..>943326
FT                   /locus_tag="ZYRO0G11924g"
FT                   /old_locus_tag="ZYRO-ORF938"
FT   CDS_pept        943039..943326
FT                   /locus_tag="ZYRO0G11924g"
FT                   /old_locus_tag="ZYRO-ORF938"
FT                   /product="ZYRO0G11924p"
FT                   /note="similar to uniprot|P46965 Saccharomyces cerevisiae
FT                   YJR010C-A SPC1 Subunit of the signal peptidase complex
FT                   (SPC) which cleaves the signal sequence from proteins
FT                   targeted to the endoplasmic reticulum (ER) homolog of the
FT                   SPC12 subunit of mammalian signal peptidase complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29574"
FT                   /db_xref="GOA:C5E0E0"
FT                   /db_xref="InterPro:IPR009542"
FT                   /db_xref="InterPro:IPR037713"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0E0"
FT                   /protein_id="CAR29574.1"
FT                   /translation="MSELLQDFQKKLIFPLDFPSQRYTERLQQITLLVGAIVASIVGLS
FT                   TQSLKNLIIVYGISIAITALVVLPAYPAYTRRKLQWVQPKVVNISTESIE"
FT   gene            <943526..>945268
FT                   /locus_tag="ZYRO0G11946g"
FT                   /old_locus_tag="ZYRO-ORF937"
FT   CDS_pept        943526..945268
FT                   /locus_tag="ZYRO0G11946g"
FT                   /old_locus_tag="ZYRO-ORF937"
FT                   /product="ZYRO0G11946p"
FT                   /note="similar to uniprot|P42826 Saccharomyces cerevisiae
FT                   YGR194C ; XKS1 third enzyme in the xylose pathway,
FT                   Xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29575"
FT                   /db_xref="GOA:C5E0E1"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042024"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0E1"
FT                   /protein_id="CAR29575.1"
FT                   /translation="MTETNDSFYLGFDLSTQQLKCLAINESLRIVHTETVAFGDELPQY
FT                   ETSKGVYVKGDSIQSPVSMWLEALDLLFSKFTQHGFDLSKVRAVSGSCQQHGSVYWTQK
FT                   ADELLRGLKSTKGSLAEQLSPEAFSRPTAPNWQDHSTGKQCHEFEDAVGGPQELARITG
FT                   SRAHFRFTGTQILKIAEEEPEAYANTATVSLVSSFLASVLTGQLTSIEEAEACGMNLYD
FT                   IPKREYHPKLLDLVDKDRKSIESKLKSPPIHCDKPVCLGSICSYFVDKYGFNKDCSVYP
FT                   FTGDNLATICSLPLEKNDVLVSLGTSTTILLVTDQYHPSADYHLFIHPTLPNHYMGMIC
FT                   YCNGALARERVRDYINGSPTSDWTPFNDALNDTNLNNDDEIGVYFPLGEIVPSVPSVYK
FT                   RAKFDPSTGHIKEFVDNFADDRHDAKNIVESQALSCRVRISPLLTSGVPVEGLAKDPNV
FT                   RFDYDDIPLSQYYGRRPRRAFFVGGASKNDAIVNKFIQVLGATEGNYRLETPNSCALGG
FT                   CYKAIWSHKIHEKQITATFDHFLGEKFPWGEVEHIRDSDDASWHHYNKKILPLSELEAS
FT                   LPKH"
FT   gene            <945485..>946705
FT                   /locus_tag="ZYRO0G11968g"
FT                   /old_locus_tag="ZYRO-ORF936"
FT   CDS_pept        945485..946705
FT                   /locus_tag="ZYRO0G11968g"
FT                   /old_locus_tag="ZYRO-ORF936"
FT                   /product="ZYRO0G11968p"
FT                   /note="similar to uniprot|P16451 Saccharomyces cerevisiae
FT                   YGR193C PDX1 Dihydrolipoamide dehydrogenase (E3)-binding
FT                   protein (E3BP) of the mitochondrial pyruvate dehydrogenase
FT                   (PDH) complex plays a structural role in the complex by
FT                   binding and positioning E3 to the dihydrolipoamide
FT                   acetyltransferase (E2) core"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29576"
FT                   /db_xref="GOA:C5E0E2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0E2"
FT                   /protein_id="CAR29576.1"
FT                   /translation="MLRSTFIRSSKALFAGQLRRFHVSNQLLDAQPYKMPAVSPTMDKG
FT                   NLVEWKVKVGDEINAGDVLLEVESDKAQVDVECQDDVKLAKILVDNGTKDVPVGQVIAW
FT                   LADVDDDLSSLEIPDVAPEAGAQPKKQASSKPQAEEKKPSEPKKSASTKPSGILNAANP
FT                   DQTLLPSVHTLLVGNGISKEDALKNIKASGSNGRLLKGDVLAHLGKISEDSVVKVAEYI
FT                   KSGEKLDLSNIELREASKAEATEAKQSQDGGKAEAPAPKPAKPEPVVIRDQLTVQVPAG
FT                   VSLEQYKSSLRAFVDSAFHIAHEQPVANTHSQYYDDIFESLITPAPKKPRFSVSYDLVS
FT                   ESPISQRQNNDIFDFLAGRVQKVTPESPIDGGNYIFQFQVKVDDKLFDAKDKAQKFVKS
FT                   LKELKIQ"
FT   gene            complement(<946793..>948316)
FT                   /locus_tag="ZYRO0G11990g"
FT                   /old_locus_tag="ZYRO-ORF934"
FT   CDS_pept        complement(946793..948316)
FT                   /locus_tag="ZYRO0G11990g"
FT                   /old_locus_tag="ZYRO-ORF934"
FT                   /product="ZYRO0G11990p"
FT                   /note="highly similar to uniprot|P08536 Saccharomyces
FT                   cerevisiae YJR010W MET3 ATP sulfurylase catalyzes the
FT                   primary step of intracellular sulfate activation essential
FT                   for assimilatory reduction of sulfate to sulfide involved
FT                   in methionine metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G11990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29577"
FT                   /db_xref="GOA:C5E0E3"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027535"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0E3"
FT                   /protein_id="CAR29577.1"
FT                   /translation="MPAPHGGILKDLVARDAHKRQDLLAEAKSGKLLEWNLTARQICDL
FT                   ELILNGGFSPLEGFLTEKEYLSVVNDSRLSSGIVWTMPINLDVDEKFAKQLASGKRVVL
FT                   LQDNEIPVAVLNVSDVYKPEKALEAKKVFRGDPDHPAIQYLYNQAGEYYVGGSLEAIQL
FT                   PQHYDYPGLRKTPAQLRLEFESRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIH
FT                   PVVGLTKPGDIDHHTRVRVYQEIIKRYPAGIAYMSLLPLAMRMGGDKEAVWHAIIRKNY
FT                   GASHFIVGRDHAGPGSNSKGEDFYGPYDAQQLVESYKNELGIEVVPFRMVTFLPDENRY
FT                   APIDEIDTTKTRTLNISGTELRRRLRDGGEIPEWFSYPEVVKILRESNPPRSKQGFAIV
FT                   LENSLKASKNQLAIALLSTFLQLGGGRHYKIFEHGNSSELLSLVPDFIQSGTGLVVPHQ
FT                   WNHAVKANNLYKLGASQDSDIKLDSDDESILHIVQKVVLFLEDNGFIVF"
FT   gene            <949469..>950470
FT                   /locus_tag="ZYRO0G12012g"
FT                   /old_locus_tag="ZYRO-ORF930"
FT   CDS_pept        949469..950470
FT                   /locus_tag="ZYRO0G12012g"
FT                   /old_locus_tag="ZYRO-ORF930"
FT                   /product="ZYRO0G12012p"
FT                   /note="uniprot|P08439 Zygosaccharomyces rouxii
FT                   Glyceraldehyde-3- phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G12012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29578"
FT                   /db_xref="GOA:C5E0E4"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0E4"
FT                   /protein_id="CAR29578.1"
FT                   /translation="MVNVAVNGFGRIGRLVTRIAEGRKDINLVAINDPFITTDYAAYMF
FT                   KYDSTHGRFAGEVSHDKDHIILNGHKVAVFNERDPASLPWGKLGIDVAIDSTGIFKELD
FT                   SANKHIEAGAKKVVITAPSGTAPMYVMGVNEETYTPDQKIVSNASCTTNCLAPLAKVIH
FT                   NEFGIKEGLMTTVHSMTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPSL
FT                   QGKLTGMAFRVPTVDVSVVDLTVNLAKETTYDEIKAALKKASEGSLKGILGYTEDDVVS
FT                   SDFLGDAHSSIVDAAAGIQLTPTFVKLVSWYDNEYGYSTRVVDLVEHVAKSA"
FT   gene            complement(<950590..>951549)
FT                   /locus_tag="ZYRO0G12034g"
FT                   /old_locus_tag="ZYRO-ORF928"
FT   CDS_pept        complement(950590..951549)
FT                   /locus_tag="ZYRO0G12034g"
FT                   /old_locus_tag="ZYRO-ORF928"
FT                   /product="ZYRO0G12034p"
FT                   /note="similar to uniprot|P47085 Saccharomyces cerevisiae
FT                   YJR008W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G12034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29579"
FT                   /db_xref="GOA:C5E0E5"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0E5"
FT                   /protein_id="CAR29579.1"
FT                   /translation="MSRPATHAGSWYSDDPRLLKSQLLGYLEATGLRGEPGANIIVSPH
FT                   AGYRYCGKTMAHAYASLDLTNVSRVFIMGPSHHVYFKNKVLVSGFDSLETPLGTLKIDR
FT                   ELGDELITSRHFAEMDPGVDMEEHSIEMQFSMLAQTLQWKNVPLDTVKVVPLMVSHNSK
FT                   EVDWQIGNVLGKYLGPGTIFIISSDFCHWGRRFGYTGYVGSQDELNDAIAQETEIEMLT
FT                   SRSKLSHHQLDIWKSIELLDRAAMDVLKLQGDKYDEWKKYLEVTGNTICGARPIALMLA
FT                   ILAQTRDARFQFPAYSQSSHVRDLHDSSVSYGSGFATM"
FT   gene            complement(<951793..>952704)
FT                   /locus_tag="ZYRO0G12056g"
FT                   /old_locus_tag="ZYRO-ORF925"
FT   CDS_pept        complement(951793..952704)
FT                   /locus_tag="ZYRO0G12056g"
FT                   /old_locus_tag="ZYRO-ORF925"
FT                   /product="ZYRO0G12056p"
FT                   /note="highly similar to uniprot|P20459 Saccharomyces
FT                   cerevisiae YJR007W SUI2 Alpha subunit of the translation
FT                   initiation factor eIF2 involved in the identification of
FT                   the start codon phosphorylation of Ser51 is required for
FT                   regulation of translation by inhibiting the exchange of GDP
FT                   for GTP"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G12056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29580"
FT                   /db_xref="GOA:C5E0E6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0E6"
FT                   /protein_id="CAR29580.1"
FT                   /translation="MSTSHCRFYENKYPEVDDIVMVNVQQIAEMGAYVKLLEYDNIEGM
FT                   ILLSELSRRRIRSIQKLIRVGKNDVVVVLRVDKEKGYIDLSKRRVSSEDIIKCEERYQK
FT                   SKTVHAILRYCAEKFQIPLEDLYKTIAWPLSRKYGHAYEAFKLSIIDQSVWEGIEPPSK
FT                   DVFEELKTYISKRLTPQAVKIRADVEVSCFSYEGIDAIKNALMEAESLSTEQMQIKVKL
FT                   VAAPLYVITTQSLDKQQGIEVLQNAIEKINEAISKHGGVCNITMPPKAVTATEDAELQA
FT                   LLESKELDNRSDSDEDEDESDE"
FT   gene            complement(<952903..>957006)
FT                   /locus_tag="ZYRO0G12078g"
FT                   /old_locus_tag="ZYRO-ORF924"
FT   CDS_pept        complement(952903..957006)
FT                   /locus_tag="ZYRO0G12078g"
FT                   /old_locus_tag="ZYRO-ORF924"
FT                   /product="ZYRO0G12078p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G12078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29581"
FT                   /db_xref="GOA:C5E0E7"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR018515"
FT                   /db_xref="InterPro:IPR024584"
FT                   /db_xref="InterPro:IPR027107"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0E7"
FT                   /protein_id="CAR29581.1"
FT                   /translation="MPSPSYAFKKKARGLDLLKSVRGSDGLGPSSRDRIRRPSEKYFDK
FT                   VLKTIGDSSMEYVERTQAIVEMSQLLDMVPQDSISEVWFTAHPLVSIDVPRATRRATLE
FT                   LLRECVTKTKDDFIKSIFFQIIYDCLVSSNGAGEKFTELDPDLDLILSSLNAMFKEDDE
FT                   LLDSDEKKLLTETVSDLTELELIKDSKCTHVSVVMELLVLAQKLTFPLNDSDVGNFIEI
FT                   LKRVSDSATVRTMNTFQTIAIRFLEKFLDQVHVDALDSLVLILLQISASMPPDKVETAL
FT                   IPLLNCILRSKHRLLLGEKLLMMPHGKKFDRAIIARCYADIYAQAVREGHVTANEAFHL
FT                   LSKLFDAKVDDEFLRFVDLFLGVHSFLENWVSVEGSTGTILWSMIQEALVRFKGPSPSI
FT                   VDKLLISVTNYPSLIPISPGALVHFISQYKTSIHIENLIPLFELRRWDFKSAETLNELT
FT                   DLVMVPEAAPKYRLQFLRLCKSWFQETNDQEFQWNISQMNCLWNIYSKVESWMAPESEL
FT                   IEFGELLYTFLQLTTVDIFYQLLNTRLLPTLRKILLQKSKRRSFVGSLGAFGRVKAYSE
FT                   ERLRLLPILVKTLVKAFIWSPLEPTGSKCTTLFDVLISVYEYAEHCADSITLLTIARPM
FT                   VRVRCDTEGNFYFADPEDAVGISSAFGRLKEQVAVGTSVQWTFPETLDFIDGNLLGERN
FT                   EHVQFDSGRAGPSNGKINMGIWLSLAVGTIEDPADWEIYSYLLTHLCSQLSELTLFEGH
FT                   YEEINKFKNVICQHLRQSLPSNIKPGDGLNRSDLNSAYVRNLSAVLAYNQYESKNFADD
FT                   LVGALVFGLTSWEKTLIPILHILTVSCFEIPGSIKRYITPILLELQKRITTLHAIPSIL
FT                   EFLLALKSSPPLVSNLTLDETKRVFAIVFNLIENSTFLKERSKSFAVPPSASSSKLPPS
FT                   SVSKNYDMEISPSTEGFLVGESMTRFFQYQSFMVLASWLSNVKADKMDELIPFVSNGLD
FT                   KLAKIEDLKYDALAYKDFVLRLKFTNSNETPLRRGRDSDDFKTSTHLSRWIGENCLISI
FT                   RTWETTNKVIVGLRRPSCECSFEVKPQMQLLQPKYKLFGFQDDEPQQFSSTTIKPEQIL
FT                   PLVCTKDVDSLIPLPSEDPKFNRSIGLLDRIPQVEFQKTGIIYLGPGQNQESQVLSNNH
FT                   GSTQYNWFLSQIGDFIKLKETGRFFYKGGLDPETDGEYALVWNNATTQVTFHTVTLMPA
FT                   DNDLSFKKRHVGNNFVNIFYNESGLSSSHFNFNIIKSQFTFINIVVTPEHTGVTEKISQ
FT                   HYKVKIYRRSGVPGLLSCAHFKILNRYNLARYVRHVSLIANALAEKYNETGSQDACSIW
FT                   GVRCKQLLGIRERAANLNEGPSSF"
FT   gene            <958000..>958458
FT                   /locus_tag="ZYRO0G12100g"
FT                   /old_locus_tag="ZYRO-ORF923"
FT   CDS_pept        958000..958458
FT                   /locus_tag="ZYRO0G12100g"
FT                   /old_locus_tag="ZYRO-ORF923"
FT                   /product="ZYRO0G12100p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G12100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29582"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0E8"
FT                   /protein_id="CAR29582.1"
FT                   /translation="MKYSTTLALLHLFAIGIAASTCASGEKSSYLVIDGEDKEAAIKLY
FT                   REKYADVKVPDGPLKITKCADGSLKINFEATQEEPVKVNCVAAEEGDKGAVPAEGFSSG
FT                   EGDGGNDFSSFSSWTINWNGPHLRLNLPSRASMRFPTFNLEGATDENN"
FT   gene            <958525..>958625
FT                   /locus_tag="ZYRO0G12122r"
FT                   /old_locus_tag="Zyro0G.tTrp.CCA.20"
FT   tRNA            join(958525..958560,958590..958625)
FT                   /locus_tag="ZYRO0G12122r"
FT                   /old_locus_tag="Zyro0G.tTrp.CCA.20"
FT                   /note="tRNA-Trp (CCA) cove"
FT   gene            <959555..>960925
FT                   /locus_tag="ZYRO0G12144g"
FT                   /old_locus_tag="ZYRO-ORF920"
FT   CDS_pept        959555..960925
FT                   /locus_tag="ZYRO0G12144g"
FT                   /old_locus_tag="ZYRO-ORF920"
FT                   /product="ZYRO0G12144p"
FT                   /note="highly similar to uniprot|P53301 Saccharomyces
FT                   cerevisiae YGR189C CRH1 Putative glycosidase of the cell
FT                   wall may have a role in cell wall architecture"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G12144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29583"
FT                   /db_xref="GOA:C5E0E9"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017168"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0E9"
FT                   /protein_id="CAR29583.1"
FT                   /translation="MVQLKLLSLLAAGSSVAQAATAPKACNPLKATSCSPDTALGTSIA
FT                   EDFTKDSPWFPYVMGGGLVNYTNEGLAMTLDKRYNNPTLQSDFYIMYGKVEVELKAGPG
FT                   RGVISSFYLQSDDLDELDIEWVGSDNTQFQSNYFSKGNTTTYDRGQFHGVDSPVDKFHN
FT                   YTLDWNVDKATWALDGQVVRTLTNDSSEGYPQTPMFIKMGIWAGGDPDNAPGTIEWAGG
FT                   KIDYSQAPFSMYVKRVVVTDYSSGKKYSYQGQSGSWESIEAEDGEVLGRASQANEDYSV
FT                   LNNGGQISSATPRSLSSTTSSSKSQSTSQSSSHSMNSTTTSHSMNSTTTSDIKTSSSSN
FT                   ATSSHALASKTSSSDQSSNSEARSTLKPTSTSKSKEDEATSSSTSEVSDSKSASGTAAA
FT                   AASDSSSSSASASASDSSSSGSASPSHDLQPASNVAAAVGFSANSLPFFAAVVALLL"
FT   gene            complement(<961089..>961161)
FT                   /locus_tag="ZYRO0G12166r"
FT                   /old_locus_tag="Zyro0G.tLys.CTT.48"
FT   tRNA            complement(961089..961161)
FT                   /locus_tag="ZYRO0G12166r"
FT                   /old_locus_tag="Zyro0G.tLys.CTT.48"
FT                   /note="tRNA-Lys (CTT) cove score=75.47"
FT   gene            <961357..>961812
FT                   /locus_tag="ZYRO0G12188g"
FT                   /old_locus_tag="ZYRO-ORF918"
FT   CDS_pept        961357..961812
FT                   /locus_tag="ZYRO0G12188g"
FT                   /old_locus_tag="ZYRO-ORF918"
FT                   /product="ZYRO0G12188p"
FT                   /note="similar to uniprot|P47076 Saccharomyces cerevisiae
FT                   YJL011C RPC17 RNA polymerase III subunit C17 physically
FT                   interacts with C31 C11 and TFIIIB70 may be involved in the
FT                   recruitment of pol III by the preinitiation complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G12188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29584"
FT                   /db_xref="GOA:C5E0F0"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="InterPro:IPR038846"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0F0"
FT                   /protein_id="CAR29584.1"
FT                   /translation="MKVFETRDAFLSDYEVLQFLSKLERQHHWDEESTLANQKNQRKKI
FT                   KTHRPYNHPELQSITRDTIAYLKSNKSATQEEDAPTTSPISRLNDEKFSELVRNLNQYS
FT                   LFKAEKLQIVNQLPQSMVHLYSVVEECDSRFTQEQMETMLSTIAGYI"
FT   gene            <962112..>964259
FT                   /locus_tag="ZYRO0G12210g"
FT                   /old_locus_tag="ZYRO-ORF917"
FT   CDS_pept        962112..964259
FT                   /locus_tag="ZYRO0G12210g"
FT                   /old_locus_tag="ZYRO-ORF917"
FT                   /product="ZYRO0G12210p"
FT                   /note="highly similar to uniprot|P47075 Saccharomyces
FT                   cerevisiae YJL012C VTC4 Phosphate metabolism transcription
FT                   is regulated by PHO system polyphosphate synthetase
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G12210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29585"
FT                   /db_xref="GOA:C5E0F1"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0F1"
FT                   /protein_id="CAR29585.1"
FT                   /translation="MKFGEQLQNSLIRQYSYYYIAYDDLKKELEQNLQKAGGNWSQQLE
FT                   TGFLESLEVELDKVYTFSKVKHGEVLRRVKDAQKQVQTTVRMLNSNSPPSEMDFDAIEE
FT                   GLSDIIADVHDLAKFCRLNYIGFQKIIKKHDKKTGYILKPIFQVRLDSKPFFKENYDDL
FT                   VQKISQLYDVTRTRGNPVRGDSSAGGGQQNFVRQTTKYWVHPDNIMELKLIILKHLPVL
FT                   VFNTNKEFEKEDSAITSIYYDNADLDLYYGRLRKDEGAEAHRLRWYGGMASDTIFLERK
FT                   THREDWTGEKSVKARFSLKERHVNDFLKGKYTVDQAFAKMHKEGKKSLKEIENLEALAT
FT                   EIQYTMLKKRLRPVVRTFYNRTAFQLPGDARVRISLDTELTMVREDDFDGVDRTHGNWR
FT                   RTDIGVDWPFKQLDDKDVCRFPYAVLEVKLQTQMGQEPPEWIRELVGSHLVESVPKFSK
FT                   FLNGVSSLLYDRVQEIPFWLPQMDVDIKRPPKANNINITRPNRSDEDDYDEDDEDDSAM
FT                   IDAMQAPGNTMDLEEIAASGYGSIDNSDAPENNPEISGYYQRKIRMAENPMLRNYYKLM
FT                   ASLDHYFNGDQMSKVPPGTTFDTKVKAPPGKTIYVPVRVEPKVYFATERTFLSWLSIAI
FT                   ILFGVSTTLLTYGTPTTMIASVGFFITSLATIIHSVITYARRVVYIRLKRAVDYEDRLA
FT                   PPAICVLLTLSILFSFYCNMV"
FT   gene            <964508..>967591
FT                   /locus_tag="ZYRO0G12232g"
FT                   /old_locus_tag="ZYRO-ORF916"
FT   CDS_pept        964508..967591
FT                   /locus_tag="ZYRO0G12232g"
FT                   /old_locus_tag="ZYRO-ORF916"
FT                   /product="ZYRO0G12232p"
FT                   /note="similar to uniprot|P41695 Saccharomyces cerevisiae
FT                   YGR188C BUB1 Protein kinase that forms a complex with Mad1p
FT                   and Bub3p that is crucial in the checkpoint mechanism
FT                   required to prevent cell cycle progression into anaphase in
FT                   the presence of spindle damage associates with centromere
FT                   DNA via Skp1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0G12232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR29586"
FT                   /db_xref="GOA:C5E0F2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012572"
FT                   /db_xref="InterPro:IPR013212"
FT                   /db_xref="InterPro:IPR015661"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E0F2"
FT                   /protein_id="CAR29586.1"
FT                   /translation="MRSGSDILNGPIEFEAIEPEKENIIPLKEGRSARGLAQALTLGSS
FT                   ELHDTRVQYERRLLEELEDMDDPLELFLEYISWINNAFPQGGTSKKSGMLDVIERCIMY
FT                   FKDMETYKNDPRYLKVWLWYVELYSSDVLQESKDIFVYMFRKRIGAKLTLFYEEFATLL
FT                   FQMEKFNEAHNILKLGVEENSRPQNRLLRKLNEFEVKLRELNVNFSQENAADTRFLSSD
FT                   PNSFILGRRRASFTNNENNVNPQPQGHQQQASKYEVFQDNNIPDSNNSENINREGWDVL
FT                   ESKATRRKENKQHSLLLEPGSNVGTIEQTSDVIPNKRPSSSQKLAIFKDDLGRSDPVYK
FT                   ILHVPGKKPEKIDCNFDLIYPNPGEEYCIEEILAKSRDLYYRREPVKRAEYPKQDLQEN
FT                   KKKRKLAPLGEKIPLSGKKPLGEKKPTDDGLALVESHPLDKKSPGIFPQPSGPSSSERI
FT                   DGSHSRADVEPPLEYKGVTRTSILPLRDTSDEMKTPVSNLKETPQPPKSPTMTFFSNAA
FT                   MSEVYSMYNQHYNEPKEPFDNNETTNKFIFDNLTQEFTRQHMDDLTEIKPTDQSAGKDS
FT                   EKTPNRQTNEITFGSDFNNEQQLYSNGAAKDFMTPIQERTEKTDHFSPNGKNINWTSQK
FT                   DEISSTQSSPFLTQPQHEIREEEKYPILENPLDPHMRRQLLAGIRPPLDQYDTFYRYNQ
FT                   PLKMSTLLKRIQKMSKTENKNPIVDFKKTGDLYCIRTELGEGGYATVYLAESSTGNLRA
FT                   LKVEKPASIWEYYILKQVEERLREQSVLPSIINANSLHCFEDESYLVLNYASQGTILDL
FT                   INLQKGKTRGPLDECLCMFFTVELMKIVESIHRVDILHGDLKPDNCMIRFENGSLGPYR
FT                   PDGSLGWNKKGIYLIDFGRSFDMRLLPPNTKFKANWKTDQQDCLEMRSGKPWTYEADYY
FT                   GLAGIIHAMLFGNFIESVQLPNGRFKLRQSFKRYWRQALWSSVFDVLLNSNEFGPFPIT
FT                   DQITKLRLEIESHLLDQFDDKLKEIVTDLELELTRFRR"
FT   gene            complement(<967703..>969319)
FT                   /locus_tag="ZYRO0G12254g"
FT