(data stored in ACNUC8465 zone)

EMBL: CU928180

ID   CU928180; SV 1; linear; genomic DNA; STD; FUN; 1423902 BP.
XX
AC   CU928180;
XX
PR   Project:PRJNA12499;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Lachancea thermotolerans CBS 6340 chromosome H complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans CBS 6340
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-1423902
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1423902
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   MD5; 50d2cf01f73fdaa45a9739539fb8fae1.
DR   BioSample; SAMEA3138300.
DR   CABRI; CBS 6340.
DR   EnsemblGenomes-Gn; ENSRNA049513531.
DR   EnsemblGenomes-Gn; ENSRNA049513577.
DR   EnsemblGenomes-Gn; ENSRNA049513616.
DR   EnsemblGenomes-Gn; ENSRNA049513666.
DR   EnsemblGenomes-Gn; ENSRNA049513721.
DR   EnsemblGenomes-Gn; ENSRNA049513753.
DR   EnsemblGenomes-Gn; ENSRNA049513816.
DR   EnsemblGenomes-Gn; ENSRNA049513842.
DR   EnsemblGenomes-Gn; ENSRNA049513881.
DR   EnsemblGenomes-Gn; ENSRNA049513914.
DR   EnsemblGenomes-Gn; ENSRNA049513935.
DR   EnsemblGenomes-Gn; ENSRNA049513970.
DR   EnsemblGenomes-Gn; ENSRNA049514025.
DR   EnsemblGenomes-Gn; ENSRNA049514051.
DR   EnsemblGenomes-Gn; ENSRNA049514097.
DR   EnsemblGenomes-Gn; ENSRNA049514131.
DR   EnsemblGenomes-Gn; ENSRNA049514162.
DR   EnsemblGenomes-Gn; ENSRNA049514216.
DR   EnsemblGenomes-Gn; ENSRNA049564692.
DR   EnsemblGenomes-Gn; ENSRNA049564770.
DR   EnsemblGenomes-Gn; ENSRNA049564845.
DR   EnsemblGenomes-Gn; ENSRNA049564944.
DR   EnsemblGenomes-Gn; ENSRNA049565040.
DR   EnsemblGenomes-Gn; ENSRNA049565144.
DR   EnsemblGenomes-Gn; ENSRNA049565291.
DR   EnsemblGenomes-Gn; ENSRNA049565374.
DR   EnsemblGenomes-Gn; ENSRNA049565461.
DR   EnsemblGenomes-Gn; ENSRNA049565538.
DR   EnsemblGenomes-Gn; ENSRNA049565612.
DR   EnsemblGenomes-Gn; ENSRNA049565659.
DR   EnsemblGenomes-Gn; ENSRNA049565745.
DR   EnsemblGenomes-Gn; ENSRNA049565841.
DR   EnsemblGenomes-Gn; ENSRNA049565948.
DR   EnsemblGenomes-Gn; ENSRNA049566010.
DR   EnsemblGenomes-Gn; ENSRNA049566078.
DR   EnsemblGenomes-Gn; ENSRNA049566131.
DR   EnsemblGenomes-Gn; ENSRNA049566219.
DR   EnsemblGenomes-Gn; ENSRNA049566276.
DR   EnsemblGenomes-Gn; ENSRNA049566350.
DR   EnsemblGenomes-Gn; ENSRNA049566443.
DR   EnsemblGenomes-Gn; ENSRNA049566501.
DR   EnsemblGenomes-Gn; ENSRNA049566559.
DR   EnsemblGenomes-Gn; ENSRNA049566651.
DR   EnsemblGenomes-Gn; ENSRNA049566733.
DR   EnsemblGenomes-Gn; ENSRNA049566817.
DR   EnsemblGenomes-Gn; ENSRNA049566900.
DR   EnsemblGenomes-Gn; ENSRNA049566961.
DR   EnsemblGenomes-Gn; ENSRNA049567021.
DR   EnsemblGenomes-Gn; ENSRNA049567086.
DR   EnsemblGenomes-Gn; ENSRNA049567151.
DR   EnsemblGenomes-Gn; ENSRNA049567247.
DR   EnsemblGenomes-Gn; ENSRNA049567355.
DR   EnsemblGenomes-Gn; ENSRNA049567439.
DR   EnsemblGenomes-Gn; KLTH0H04378r.
DR   EnsemblGenomes-Gn; KLTH0H04422r.
DR   EnsemblGenomes-Gn; KLTH0H04708r.
DR   EnsemblGenomes-Gn; KLTH0H05192r.
DR   EnsemblGenomes-Gn; KLTH0H06138r.
DR   EnsemblGenomes-Gn; KLTH0H06908r.
DR   EnsemblGenomes-Gn; KLTH0H07392r.
DR   EnsemblGenomes-Gn; KLTH0H08052r.
DR   EnsemblGenomes-Gn; KLTH0H08360r.
DR   EnsemblGenomes-Gn; KLTH0H08404r.
DR   EnsemblGenomes-Gn; KLTH0H08426r.
DR   EnsemblGenomes-Gn; KLTH0H08558r.
DR   EnsemblGenomes-Gn; KLTH0H08580r.
DR   EnsemblGenomes-Gn; KLTH0H08822r.
DR   EnsemblGenomes-Gn; KLTH0H09878r.
DR   EnsemblGenomes-Gn; KLTH0H09988r.
DR   EnsemblGenomes-Gn; KLTH0H10076r.
DR   EnsemblGenomes-Gn; KLTH0H10098r.
DR   EnsemblGenomes-Gn; KLTH0H10120r.
DR   EnsemblGenomes-Gn; KLTH0H10230r.
DR   EnsemblGenomes-Gn; KLTH0H11132r.
DR   EnsemblGenomes-Gn; KLTH0H11352r.
DR   EnsemblGenomes-Gn; KLTH0H11528r.
DR   EnsemblGenomes-Gn; KLTH0H11814r.
DR   EnsemblGenomes-Gn; KLTH0H11836r.
DR   EnsemblGenomes-Gn; KLTH0H12034r.
DR   EnsemblGenomes-Gn; KLTH0H12364r.
DR   EnsemblGenomes-Gn; KLTH0H12408r.
DR   EnsemblGenomes-Gn; KLTH0H12628r.
DR   EnsemblGenomes-Gn; KLTH0H12826r.
DR   EnsemblGenomes-Gn; KLTH0H13112r.
DR   EnsemblGenomes-Gn; KLTH0H13178r.
DR   EnsemblGenomes-Gn; KLTH0H13185r.
DR   EnsemblGenomes-Gn; KLTH0H13192r.
DR   EnsemblGenomes-Gn; KLTH0H13203r.
DR   EnsemblGenomes-Gn; KLTH0H13205r.
DR   EnsemblGenomes-Gn; KLTH0H13210r.
DR   EnsemblGenomes-Gn; KLTH0H13213r.
DR   EnsemblGenomes-Gn; KLTH0H13216r.
DR   EnsemblGenomes-Gn; KLTH0H13219r.
DR   EnsemblGenomes-Gn; KLTH0H13227r.
DR   EnsemblGenomes-Gn; KLTH0H13232r.
DR   EnsemblGenomes-Gn; KLTH0H13249r.
DR   EnsemblGenomes-Gn; KLTH0H13254r.
DR   EnsemblGenomes-Gn; KLTH0H13259r.
DR   EnsemblGenomes-Gn; KLTH0H13464r.
DR   EnsemblGenomes-Gn; KLTH0H13904r.
DR   EnsemblGenomes-Gn; KLTH0H14124r.
DR   EnsemblGenomes-Gn; KLTH0H14542r.
DR   EnsemblGenomes-Gn; KLTH0H14762r.
DR   EnsemblGenomes-Gn; KLTH0H15092r.
DR   EnsemblGenomes-Gn; KLTH0H15290r.
DR   EnsemblGenomes-Gn; KLTH0H16324r.
DR   EnsemblGenomes-Gn; KLTH0H16368r.
DR   EnsemblGenomes-Tr; EFT00001979488.
DR   EnsemblGenomes-Tr; EFT00001979489.
DR   EnsemblGenomes-Tr; EFT00001979490.
DR   EnsemblGenomes-Tr; EFT00001979492.
DR   EnsemblGenomes-Tr; EFT00001979494.
DR   EnsemblGenomes-Tr; EFT00001979496.
DR   EnsemblGenomes-Tr; EFT00001979499.
DR   EnsemblGenomes-Tr; EFT00001979501.
DR   EnsemblGenomes-Tr; EFT00001979503.
DR   EnsemblGenomes-Tr; EFT00001979504.
DR   EnsemblGenomes-Tr; EFT00001979505.
DR   EnsemblGenomes-Tr; EFT00001979507.
DR   EnsemblGenomes-Tr; EFT00001979509.
DR   EnsemblGenomes-Tr; EFT00001979510.
DR   EnsemblGenomes-Tr; EFT00001979511.
DR   EnsemblGenomes-Tr; EFT00001979514.
DR   EnsemblGenomes-Tr; EFT00001979516.
DR   EnsemblGenomes-Tr; EFT00001979520.
DR   EnsemblGenomes-Tr; EFT00001979521.
DR   EnsemblGenomes-Tr; EFT00001979522.
DR   EnsemblGenomes-Tr; EFT00001979523.
DR   EnsemblGenomes-Tr; EFT00001979524.
DR   EnsemblGenomes-Tr; EFT00001979525.
DR   EnsemblGenomes-Tr; EFT00001979526.
DR   EnsemblGenomes-Tr; EFT00001979527.
DR   EnsemblGenomes-Tr; EFT00001979529.
DR   EnsemblGenomes-Tr; EFT00001979531.
DR   EnsemblGenomes-Tr; EFT00001979533.
DR   EnsemblGenomes-Tr; EFT00001979534.
DR   EnsemblGenomes-Tr; EFT00001979536.
DR   EnsemblGenomes-Tr; EFT00001979539.
DR   EnsemblGenomes-Tr; EFT00001979543.
DR   EnsemblGenomes-Tr; EFT00001979545.
DR   EnsemblGenomes-Tr; EFT00001979547.
DR   EnsemblGenomes-Tr; EFT00001979548.
DR   EnsemblGenomes-Tr; EFT00001979549.
DR   EnsemblGenomes-Tr; EFT00001979551.
DR   EnsemblGenomes-Tr; EFT00001979553.
DR   EnsemblGenomes-Tr; EFT00001979557.
DR   EnsemblGenomes-Tr; EFT00001979560.
DR   EnsemblGenomes-Tr; EFT00001979563.
DR   EnsemblGenomes-Tr; EFT00001979564.
DR   EnsemblGenomes-Tr; EFT00001979566.
DR   EnsemblGenomes-Tr; EFT00001979568.
DR   EnsemblGenomes-Tr; EFT00001979569.
DR   EnsemblGenomes-Tr; EFT00001979570.
DR   EnsemblGenomes-Tr; EFT00001979572.
DR   EnsemblGenomes-Tr; EFT00001979574.
DR   EnsemblGenomes-Tr; EFT00001979576.
DR   EnsemblGenomes-Tr; EFT00001979579.
DR   EnsemblGenomes-Tr; EFT00001979581.
DR   EnsemblGenomes-Tr; EFT00001979582.
DR   EnsemblGenomes-Tr; EFT00001979583.
DR   EnsemblGenomes-Tr; EFT00001979585.
DR   EnsemblGenomes-Tr; EFT00001979587.
DR   EnsemblGenomes-Tr; EFT00001979588.
DR   EnsemblGenomes-Tr; EFT00001979590.
DR   EnsemblGenomes-Tr; EFT00001979593.
DR   EnsemblGenomes-Tr; EFT00001979595.
DR   EnsemblGenomes-Tr; EFT00001979597.
DR   EnsemblGenomes-Tr; EFT00001979599.
DR   EnsemblGenomes-Tr; EFT00001979602.
DR   EnsemblGenomes-Tr; EFT00001979607.
DR   EnsemblGenomes-Tr; EFT00001979611.
DR   EnsemblGenomes-Tr; EFT00001979613.
DR   EnsemblGenomes-Tr; KLTH0H04378r-1.
DR   EnsemblGenomes-Tr; KLTH0H04422r-1.
DR   EnsemblGenomes-Tr; KLTH0H04708r-1.
DR   EnsemblGenomes-Tr; KLTH0H05192r-1.
DR   EnsemblGenomes-Tr; KLTH0H06138r-1.
DR   EnsemblGenomes-Tr; KLTH0H06908r-1.
DR   EnsemblGenomes-Tr; KLTH0H07392r-1.
DR   EnsemblGenomes-Tr; KLTH0H08052r-1.
DR   EnsemblGenomes-Tr; KLTH0H08360r-1.
DR   EnsemblGenomes-Tr; KLTH0H08404r-1.
DR   EnsemblGenomes-Tr; KLTH0H08426r-1.
DR   EnsemblGenomes-Tr; KLTH0H08558r-1.
DR   EnsemblGenomes-Tr; KLTH0H08580r-1.
DR   EnsemblGenomes-Tr; KLTH0H08822r-1.
DR   EnsemblGenomes-Tr; KLTH0H09878r-1.
DR   EnsemblGenomes-Tr; KLTH0H09988r-1.
DR   EnsemblGenomes-Tr; KLTH0H10076r-1.
DR   EnsemblGenomes-Tr; KLTH0H10098r-1.
DR   EnsemblGenomes-Tr; KLTH0H10120r-1.
DR   EnsemblGenomes-Tr; KLTH0H10230r-1.
DR   EnsemblGenomes-Tr; KLTH0H11132r-1.
DR   EnsemblGenomes-Tr; KLTH0H11352r-1.
DR   EnsemblGenomes-Tr; KLTH0H11528r-1.
DR   EnsemblGenomes-Tr; KLTH0H11814r-1.
DR   EnsemblGenomes-Tr; KLTH0H11836r-1.
DR   EnsemblGenomes-Tr; KLTH0H12034r-1.
DR   EnsemblGenomes-Tr; KLTH0H12364r-1.
DR   EnsemblGenomes-Tr; KLTH0H12408r-1.
DR   EnsemblGenomes-Tr; KLTH0H12628r-1.
DR   EnsemblGenomes-Tr; KLTH0H12826r-1.
DR   EnsemblGenomes-Tr; KLTH0H13112r-1.
DR   EnsemblGenomes-Tr; KLTH0H13178r-1.
DR   EnsemblGenomes-Tr; KLTH0H13185r-1.
DR   EnsemblGenomes-Tr; KLTH0H13192r-1.
DR   EnsemblGenomes-Tr; KLTH0H13203r-1.
DR   EnsemblGenomes-Tr; KLTH0H13205r-1.
DR   EnsemblGenomes-Tr; KLTH0H13210r-1.
DR   EnsemblGenomes-Tr; KLTH0H13213r-1.
DR   EnsemblGenomes-Tr; KLTH0H13216r-1.
DR   EnsemblGenomes-Tr; KLTH0H13219r-1.
DR   EnsemblGenomes-Tr; KLTH0H13227r-1.
DR   EnsemblGenomes-Tr; KLTH0H13232r-1.
DR   EnsemblGenomes-Tr; KLTH0H13249r-1.
DR   EnsemblGenomes-Tr; KLTH0H13254r-1.
DR   EnsemblGenomes-Tr; KLTH0H13259r-1.
DR   EnsemblGenomes-Tr; KLTH0H13464r-1.
DR   EnsemblGenomes-Tr; KLTH0H13904r-1.
DR   EnsemblGenomes-Tr; KLTH0H14124r-1.
DR   EnsemblGenomes-Tr; KLTH0H14542r-1.
DR   EnsemblGenomes-Tr; KLTH0H14762r-1.
DR   EnsemblGenomes-Tr; KLTH0H15092r-1.
DR   EnsemblGenomes-Tr; KLTH0H15290r-1.
DR   EnsemblGenomes-Tr; KLTH0H16324r-1.
DR   EnsemblGenomes-Tr; KLTH0H16368r-1.
DR   EuropePMC; PMC2765284; 19525356.
DR   EuropePMC; PMC5754089; 29300759.
DR   PR2; CU928180.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00004; U2.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00009; RNaseP_nuc.
DR   RFAM; RF00134; snoZ196.
DR   RFAM; RF00309; snosnR60_Z15.
DR   RFAM; RF01243; snR33.
DR   RFAM; RF01256; snR43.
DR   RFAM; RF01258; snR10.
DR   RFAM; RF01260; snR11.
DR   RFAM; RF01261; snR82.
DR   RFAM; RF01502; Fungi_SRP.
DR   RFAM; RF01960; SSU_rRNA_eukarya.
DR   SILVA-LSU; CU928180.
DR   SILVA-SSU; CU928180.
DR   StrainInfo; 318472; 0.
XX
CC   The Lachancea thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1423902
FT                   /organism="Lachancea thermotolerans CBS 6340"
FT                   /chromosome="H"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0H"
FT                   /db_xref="taxon:559295"
FT   gene            complement(<1..>1980)
FT                   /pseudo
FT                   /locus_tag="KLTH0H00110g"
FT                   /old_locus_tag="KLTH-ORF2312"
FT                   /note="some similarities with uniprot|P33302 Saccharomyces
FT                   cerevisiae YOR153W PDR5 Short-lived membrane ABC (ATP-
FT                   binding cassette) transporter actively exports various
FT                   drugs expression regulated by Pdr1p also involved in
FT                   steroid transport cation resistance and cellular
FT                   detoxification during exponential growth"
FT   gene            complement(<3987..>5309)
FT                   /locus_tag="KLTH0H00132g"
FT                   /old_locus_tag="KLTH-ORF2311"
FT   CDS_pept        complement(3987..5309)
FT                   /locus_tag="KLTH0H00132g"
FT                   /old_locus_tag="KLTH-ORF2311"
FT                   /product="KLTH0H00132p"
FT                   /note="highly similar to uniprot|P40896 Saccharomyces
FT                   cerevisiae YJL213W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30025"
FT                   /db_xref="GOA:C5E1W4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W4"
FT                   /protein_id="CAR30025.1"
FT                   /translation="MKTCTIDVNERNNKKLEDLVAPWRLKPLQNYYITNTNLIDVVEGK
FT                   THPEAYIFINEGKISKVNFGREPKSETSKDYEIIEGTGKYVMPGLFDNHVHMGAVPGEM
FT                   GLAQLAMMPESVAVLRLRFTMEASLARGFTTVRDCGGIEGFVKAAVANGSLIGPRLITC
FT                   GHAISQTGGHGDLRPGSLPASAFDSCSCHTGTVGVVADGVDGCYTAAREEFRRGADFIK
FT                   MMGSGGVASPTDKITNLQFCHDEIKALVDVAKTYHTYVTAHVYTPEAIQNCIKLGVKGV
FT                   EHGNLLDEETAELMAELGCYLTPTLVTYKIMASDQFGTFLGPVNRKKNAEVLGQGIDAI
FT                   KIAQEKGVKICFGSDLLGPLGGYQTQEFFIRGKVQSARDVLLSATVTPAEMNGLGNKLG
FT                   QVKPGFIADLLMMKSNPLEDVSIMDEPETNLVFVMKEGRIY"
FT   gene            complement(<6702..>8039)
FT                   /locus_tag="KLTH0H00154g"
FT                   /old_locus_tag="KLTH-ORF2306"
FT   CDS_pept        complement(6702..8039)
FT                   /locus_tag="KLTH0H00154g"
FT                   /old_locus_tag="KLTH-ORF2306"
FT                   /product="KLTH0H00154p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30026"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W5"
FT                   /protein_id="CAR30026.1"
FT                   /translation="MVRKAHLPLLASIASACATCPSISDVNVLSADDGSSSFWGTGLGA
FT                   YIELTLSATEKGECWFSAPSNVFGNFPACPFSWDYGTVNSAGGNNYSIQFNQIPHGGVA
FT                   KLGFLTSLAEGYKSSITSGKTDTYSFVTSSGEHKSSVSFNDFPSDQVYCGSCGTQQEGN
FT                   SLSFDVSVPAAIIESAFTINIEKQQGYKFQTGGIKLYYTQSSNSFDEASNEQLVPSSSI
FT                   TDSSTEDKISIAFNGNLPSGCSGLRLSYDVAVLEEMTYYSSVCNVEFSSFSQQLTAYVY
FT                   TKNHMGSIETPAVSKGPGCGSQTSSSSGYSSSTVTTLSPSTGFTSSSTSAAVTSATSSS
FT                   GCDDGCDDGSGSSSSSSSPAAPTSSSGCDSGCDDNTATSSATPSTSTSSSSSSGTSCDS
FT                   GCDENSGSGSGSGSGHGSGHYAGHGGRHNWGHNSGHKGGQGSGCKS"
FT   gene            <10151..>13992
FT                   /pseudo
FT                   /locus_tag="KLTH0H00176g"
FT                   /old_locus_tag="pseudo-Klth0H-10151-13992"
FT   gene            <17248..>17763
FT                   /locus_tag="KLTH0H00198g"
FT                   /old_locus_tag="KLTH-ORF2293"
FT   CDS_pept        17248..17763
FT                   /locus_tag="KLTH0H00198g"
FT                   /old_locus_tag="KLTH-ORF2293"
FT                   /product="KLTH0H00198p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30027"
FT                   /db_xref="GOA:C5E1W6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W6"
FT                   /protein_id="CAR30027.1"
FT                   /translation="MLFIRKAAIGDLSDITNIIESAKIFLKSQNIDQWQNGYPNQEQAR
FT                   VDIAGGQCYVLICNNEVAAVGTITTDVDPSYTTIQGSWRKDSRKSYASLHRLAVSERFR
FT                   GKHLAQELLSGMIMKCKELGFVDVRVDTHKQNKVMQALLVKNYFEYRGVIYKNENRSSR
FT                   NAYQLLLH"
FT   gene            complement(<18972..>19883)
FT                   /locus_tag="KLTH0H00220g"
FT                   /old_locus_tag="KLTH-ORF2292"
FT   CDS_pept        complement(18972..19883)
FT                   /locus_tag="KLTH0H00220g"
FT                   /old_locus_tag="KLTH-ORF2292"
FT                   /product="KLTH0H00220p"
FT                   /note="similar to uniprot|P32331 Saccharomyces cerevisiae
FT                   YPR058W YMC1 Putative mitochondrial inner membrane
FT                   transporter member of the mitochondrial carrier (MCF)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30028"
FT                   /db_xref="GOA:C5E1W7"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W7"
FT                   /protein_id="CAR30028.1"
FT                   /translation="MSEELTSPQVVDDLVDSHDVNQAFKDIFCGTVGGFAQVLVGQPFD
FT                   ITKVRLQTSPVPSTAVEVIKNLVKNEGILAFYKGTLVPLVGVGACVSCQFGINEAMKRH
FT                   FRRDHTESDQTLTLSQYYTCGFVSGFANAFLASPIEHVRIRLQLQTKSLDKAEYRGCID
FT                   CTKKLLQGGALMRGLSATMLRTSHGFGVYFATYEALIANQAHHGVLRQEIPAWKVCLYG
FT                   AFSGAFFWAMTYPFDVIKSVMQADSLKSPKYGRTVFSVARSIRRERGIGAFLKGFWPTM
FT                   LRSLPVNGATFAAFETAMRLIN"
FT   gene            <20372..>21772
FT                   /pseudo
FT                   /locus_tag="KLTH0H00242g"
FT                   /old_locus_tag="pseudo-Klth0H-20372-21772"
FT   gene            complement(<23047..>23715)
FT                   /locus_tag="KLTH0H00264g"
FT                   /old_locus_tag="KLTH-ORF2285"
FT   CDS_pept        complement(23047..23715)
FT                   /locus_tag="KLTH0H00264g"
FT                   /old_locus_tag="KLTH-ORF2285"
FT                   /product="KLTH0H00264p"
FT                   /note="similar to uniprot|P40008 Saccharomyces cerevisiae
FT                   YER004W FMP52 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30029"
FT                   /db_xref="InterPro:IPR014843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W8"
FT                   /protein_id="CAR30029.1"
FT                   /translation="MSSRALIIGATGLCGSAFVKYVAKDPSFTEIATISRKALNGNYDG
FT                   KVRSLILEDSSNWSAAVPENYDILFSGLATTRGEAGKENFYKVDHDMNLQLARSAKEKG
FT                   YSTYVVVSSTGADENSMFYYMKTKGELERDILALGFERTIILRPGPLLGERTKSKGLLN
FT                   GLSSKIGSIVYRTKLQSVFGCPVYGDEVAKVGVKLALDTSDTAKIKIVESAEILRLAGV
FT                   "
FT   gene            complement(<24401..>26059)
FT                   /locus_tag="KLTH0H00286g"
FT                   /old_locus_tag="KLTH-ORF2283"
FT   CDS_pept        complement(24401..26059)
FT                   /locus_tag="KLTH0H00286g"
FT                   /old_locus_tag="KLTH-ORF2283"
FT                   /product="KLTH0H00286p"
FT                   /note="some similarities with uniprot|P53857 Saccharomyces
FT                   cerevisiae YNL234W similar to globins and has a functional
FT                   heme-binding domain involved in glucose signaling or
FT                   metabolism regulated by Rgt1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30030"
FT                   /db_xref="GOA:C5E1W9"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W9"
FT                   /protein_id="CAR30030.1"
FT                   /translation="MFVGTNHRPNAAPQFVESLLTESQSTEDICLQSGDLKHRVSSDRS
FT                   SERIRLLRQSAVSSDTYPRSFLDAYHDEFSSSSSNGELTSERGESEKGDEAKIPKGITP
FT                   EASVTFQKHYKMSLQLQPHEIEMVRCSWSILLDDECSKPKYDAFVDKCVKPRINVPYKP
FT                   PANEDSKNNVKEQLANSGKYEDDLKVPTFLFGAQFLHNIREIIPTIENSFPGIQHAASG
FT                   VTGVVGMAISNLEDLSVMDYYLSSLGKHHARILGVYASHFDVAGIAFLKTLRDRFGYHY
FT                   TKELDELWSRIYIYLANSMLQYGIDPILQDSGSSEITLGFPQLKEDSLSTSNADLSSKD
FT                   SCGENEKIVGSLSDLSKNSTYSSKSAKEVSLVSSNKLLSRTSGWQSSKSSASSGQEGIN
FT                   SKTKKKEPTRNVGSVRGGGAWSGSHPQPTLAEESNVHYGASVRGGGGWQRSSGRSPSEK
FT                   DFKGNSIGVVNDGKHALSTSRINGKSNFSLPASRPGATYAGKTSDITGKTHLRCSENYE
FT                   MVTKAYSTVNSTARSSGGVRGGGGFNSGNGDCTLM"
FT   gene            <28695..>30227
FT                   /locus_tag="KLTH0H00308g"
FT                   /old_locus_tag="KLTH-ORF2280"
FT   CDS_pept        28695..30227
FT                   /locus_tag="KLTH0H00308g"
FT                   /old_locus_tag="KLTH-ORF2280"
FT                   /product="KLTH0H00308p"
FT                   /note="weakly similar to uniprot|Q12300 Saccharomyces
FT                   cerevisiae YDL138W RGT2 Plasma membrane glucose receptor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30031"
FT                   /db_xref="GOA:C5E1X0"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037792"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X0"
FT                   /protein_id="CAR30031.1"
FT                   /translation="MGFLQKVFLAEEDIQGSKFRAIFIGLFVAFGGVLFGYDTGTISGI
FT                   LAMKYVKEHFTHRGSFTAGETSLITSILSAGTFVGAISAPLVSDTMGRRFGLIASTIVF
FT                   SIGVILQVAATGQDLLIVGRVIAGLGVGILSAIVPLYQSEAAPKWIRGAVVSCYQGAIT
FT                   VGLLLAACVNQGTHARTDSGSYRIPIAIQFAWALILFVGMIVLPESPRFYVKQGKIEKA
FT                   GNALSRLRGLPADHPIVEGELEEILANFNYEKSLGSTTVWDCFKRGNHQLKRMLIGLAI
FT                   QALQQLTGINFIFYYGTQFFQNSGIKNPFIIQVIMNVVNVVMTWPGVLLVELAGRRNLL
FT                   LWGAVGMCVSELIVASVGTALPDSTAANKTLIAFSCTFIASFAATWGPLAWVVVGEIYP
FT                   LRVRGKSVALCAASNWLFNFAIAYATPYLVDQEHANLQSKVFFIWGGCTFLCFLFVYFF
FT                   IYETKGLTLEQIDELFETCTSAPDSKNFIPSSGYAHESPDAEKAVVEAVEKV"
FT   gene            <31537..>36237
FT                   /locus_tag="KLTH0H00330g"
FT                   /old_locus_tag="KLTH-ORF2275"
FT   CDS_pept        31537..36237
FT                   /locus_tag="KLTH0H00330g"
FT                   /old_locus_tag="KLTH-ORF2275"
FT                   /product="KLTH0H00330p"
FT                   /note="similar to uniprot|P53855 YNL242W Saccharomyces
FT                   cerevisiae ATG2 Peripheral membrane protein required for
FT                   the formation of cytosolic sequestering vesicles involved
FT                   in vacuolar import through both the Cvt pathway and
FT                   autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30032"
FT                   /db_xref="GOA:C5E1X1"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="InterPro:IPR026849"
FT                   /db_xref="InterPro:IPR026885"
FT                   /db_xref="InterPro:IPR026886"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X1"
FT                   /protein_id="CAR30032.1"
FT                   /translation="MPSWFAQNLQRRLLLYFLQKASLFSNIDVSALDVSLGSSSHFTFH
FT                   DLDLDVESINIPDIALRSGFIEKLELSLTVSGGVKVEGSGLVFVVKPLLTNTYHPQSSS
FT                   FSLSKTVYDLASSVMQYSDKENTPEEDLSGEDNSSESDNRSYENFAAPAPSVLQSMRNK
FT                   ALDLALSNLKIQLKDVTIQFLFPQNNVLELSLQEALVLSANKAREVQLSNLQLLHWKQT
FT                   KSPDEEVESKTDLSMSDSLVYSKAEATSIYMSALQSFQEHENESTFVPQKSEALSFDTL
FT                   SMKFRGFASIDDLSISDIAIDFNECIIDLPLLLELNESISLPLLAMFSSKFHNNISDTA
FT                   KYQPQNLQNYKRFQNEQDIREESLFSNLKGSSAIIKLPGQLKVRLKSLLVKICESGIMS
FT                   STLGDISVLHQGFPIFTHVPTVPPFFSLMCIPGARKIDIALHHDISVVLDVHSLTDIFR
FT                   CVKSFEKCMAAWQQAVPRKSQPRGVKPKPYSIGIESETCHLELRLGEGTLNANLSAFSV
FT                   PNIFESVSLNSVEMNMKKNAQETPLVSIENIKLVTPENPMQFNSYDHGYQEIVISSKCC
FT                   INIESIRAEVPFLELESLSLEVQNLLKKVVASPDIKRSEYSPRKSGNRQLKRSVRILGS
FT                   SSIISKQSSTAQYVIQICTVDICLKDILGHDFGDLRGHLSDFFIYMGTDQRFTAHSNKL
FT                   SINRVSLSQGESLVDVLLVKNEQAPVLMVHKKLTGKICCTLRSVCLRYDAHILDLLKNR
FT                   KTSNDSASQILPKPAAEVKQNTTVLEFKLLECSISLKPYRLKSSVILILNKASIEFVLP
FT                   NFRSKGTLKACYILLIDDISNLVDQPGTNYPSLLSFYTERGFANVGKFDKMTLSLTKSR
FT                   NTMEIRADVNSVSLSLCADSAQALIQTIIDLGVPLTFPEDQKYRTKPTPTDILDDIEND
FT                   FFTEAKIQINPISTKEDPISIFDNFLDKSPEVVDTDSNMPAGESGSPKFGDQRFMVTEE
FT                   DYFSSKGCYPVQSIPEDPDVELSIVFGVENVSLKLYDGFDWKYTRNSISEIISQMESVL
FT                   RQQDLNQDPELIKASIFDSIYLFADKGTDVDSLRQHINRDLQSEPSVFVKGSSKKTRLR
FT                   PSRDFKVRIGISGITAIFTKFVVDEPTEFTSDLSADTLHDVKLQVRDIEVVDNVPSSTW
FT                   NKLLTYLKDKPRAKGSEMLSLNIQTVRPIDFLAATELIMYVHVLPLQVHIDQDTLEFLT
FT                   RFAEFKDSRFELIDEFPDFVYIQKLEVEAVQIRMDYKPKKVDYSGLKSGHASEFMNFFI
FT                   LEGSRFQLQHLIVYGVNGFPELNKTLNNAWLPDITGNQLKGILSGVAPMKTLVTLGSGV
FT                   KALVSTPVKEYKRDQKLGRGLQKGTQVFVKVTTGEFVRLGVKLASGTQALLENAEELMG
FT                   GEGSRARDHSINGFEFDLVPEETVKQYEKLMGGTNPSHKGRVSEAIVVEPPSNEKEPPR
FT                   IFSLYADQPNTLQRGLKEAQSSFGRNIQLAYDALKKAQGEIKESESAQETASSMARVVP
FT                   VALIRPIIGATEALSKTLQGISNEIDEEQVTYLQDKYKSRRPRETL"
FT   gene            <36466..>39633
FT                   /locus_tag="KLTH0H00352g"
FT                   /old_locus_tag="KLTH-ORF2272"
FT   CDS_pept        36466..39633
FT                   /locus_tag="KLTH0H00352g"
FT                   /old_locus_tag="KLTH-ORF2272"
FT                   /product="KLTH0H00352p"
FT                   /note="similar to uniprot|P35688 Saccharomyces cerevisiae
FT                   YDL240W LRG1 Putative GTPase-activating protein (GAP)
FT                   involved in the Pkc1p-mediated signaling pathway that
FT                   controls cell wall integrity appears to specifically
FT                   regulate 1 3-beta-glucan synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00352g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30033"
FT                   /db_xref="GOA:C5E1X2"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X2"
FT                   /protein_id="CAR30033.1"
FT                   /translation="MSYATEPHKQQVLNRNNDRTINSGHLATVPNERLQEKRPSLPHQQ
FT                   SSRTAKICARCNKAIARGSLKALGRYYHEECFVCYDCGKVCKPKYFPFEDPKTRKLIPL
FT                   CQQDYFKRNNLLCFVCGKALRGVYYNAFGKLYDEEHFCCKICKEKCGVNTCFNYQDDLY
FT                   CKYHFLKFFSNRCKGCQYPISDQYIEFPRGEEVHRWHPECYGVHKYWHVSLPPEAVGLP
FT                   QIKRADPNDIFLGEEHLSNRTDLEKYVFTFNKLVSKTWSVLYRFEEETAICISDMFQYL
FT                   TSFDQLKGLNSTALFVLKIECLFRALDSLDSLCGYNLFGKPQGKYGDPADDRLEAADND
FT                   VSSETVDTINLKYAKFPRNLSTKVMIYLQLLRKLSSASREKDVNVSSLMSVITGVAHFL
FT                   KLLVRHGLQTALDRNRSVHSANALIKFLREIEKNELVSGDPFRLINVSINATDCCAACG
FT                   KYIQEDCIQFKARRWHKGCFSCSICQRHIDLYGVADAAFNTKANSVLCAQCAVGDPDSS
FT                   SGFKSVTKLAQLIFLLKIALVRSKAVMEIQLKNREALKRSNSVKESISMQQTYIRTLND
FT                   IKRLKSRRQSVPLTTNKQEARRSRILETSEMDTGRSSQPEDKCLVIQTDKSPETEPENQ
FT                   NMFNSTKTLTLDDISRIVAAEQARELRPNAFAYFKKLKDNDDDAVNIMNKKSGIYYSEL
FT                   KFEELYLIKLISLSLLNASSIDVMKDEATVNSLVPSPPKSLKNGANFWSKMRTIMSKDG
FT                   KRGYSKKVFGTSLEVLTTQWGVDSDLGIGPSKIKIPIIVDELISSLRQLDMSVEGVFRK
FT                   NGNIRRLRELAVAIDDNPSEVPDLSKENAVQLSALLKKFLRELPDPLLTFPLYKLWIEI
FT                   AKIESDLERHKYFGLLYALLPGFNRSVAEVLFSFLHWTSSFSHIDSQMGSKMDIHNLST
FT                   VITPNILYEQGATSAQPTVHGGAIHNTYNDAFAQNEGENYFLAIEVVDYLINHNEDLSV
FT                   VPKYMATLLKEVKEKQLFGFEAIKGFVSAQLEGGRLNFSEYDVVESVKMKTSSSVAKLE
FT                   VKGNNAS"
FT   gene            complement(<39762..>41297)
FT                   /locus_tag="KLTH0H00374g"
FT                   /old_locus_tag="KLTH-ORF2267"
FT   CDS_pept        complement(39762..41297)
FT                   /locus_tag="KLTH0H00374g"
FT                   /old_locus_tag="KLTH-ORF2267"
FT                   /product="KLTH0H00374p"
FT                   /note="highly similar to uniprot|P11412 YNL241C
FT                   Saccharomyces cerevisiae ZWF1 Glucose-6-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00374g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30034"
FT                   /db_xref="GOA:C5E1X3"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X3"
FT                   /protein_id="CAR30034.1"
FT                   /translation="MSKPTEFKENTSIVVFGASGDLSKKKTFPALFGLFREGYLDPSCK
FT                   IIGFARSNLSDEDLHEKIKPNLKTNNDEKGSEKIEQFLKMVSYISGPYDKDEGFDKLAK
FT                   ELDSYEKKQGVKSPHRLFYLALPPSAFVTVATQIKKKVYAEHGETRVVVEKPFGHDLDS
FT                   FRELQSDLSPLFREDELFRIDHYLGKEMVKNLVFMRFGNTFLNAAWNKENIQMIQISFK
FT                   EPFGTEGRGGYFDEIGIIRDVMQNHLLQVLTLLTMERPVTFDSEAVRDEKVKVLKAFAP
FT                   IDHKDILIGQYGKSEDGSKPGYLDDDTVNPDSKCVTFAALGFKIQNERWDGVPIVMRAG
FT                   KALNEGKVEIRIQFKAVPSGVFSEVAHNELVIRVQPDEAIYIKCNSKTPGLSTTSQVSE
FT                   LDLTYARRFKDFWIPEAYEALIKDVLSGDHSNFVRDDELDISWKLFTPLLKYLEGPDAP
FT                   KPEEYAYGSRGPAELVNFLKSHDYVFEDSGSYQWPVITPEVTKKKQNSTDSKM"
FT   gene            complement(<43400..>44791)
FT                   /locus_tag="KLTH0H00396g"
FT                   /old_locus_tag="KLTH-ORF2263"
FT   CDS_pept        complement(43400..44791)
FT                   /locus_tag="KLTH0H00396g"
FT                   /old_locus_tag="KLTH-ORF2263"
FT                   /product="KLTH0H00396p"
FT                   /note="similar to uniprot|P23503 YNL240C Saccharomyces
FT                   cerevisiae NAR1 Nuclear architecture related protein
FT                   component of the cytosolic iron-sulfur (FeS) protein
FT                   assembly machinery"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30035"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X4"
FT                   /protein_id="CAR30035.1"
FT                   /translation="MSSLLSEKDLNDFISPGLACVKPAEPIEKGEKQEGDLEVGKESND
FT                   MGKVSISLQDCLACSGCITSSEEILLSQQSHTVFLEAWKNLARDTALVVSIPPQCRLSL
FT                   AHYYDMSLESFDKSFLTLMKEKFGARYIVGTQIGRNITVNQTNKLLTERKSLSSSKKPA
FT                   LCAVCPGFVLYAEKTKPELVPYLLDVKSPQQITGALLKKAIPNIYHLTIMPCFDKKLEA
FT                   SRKDGEGEVDCVITPREFATMLQEQDLKLTDFLTSTDETVLKQSCSPPGWDISVHWASN
FT                   EGSASGGYAYQYILHQKSLHPGSCISTITGKNSDLKEFRLMDVSNENVIASSSELYGFR
FT                   NIQNMVRKLTSSGSASRNIKVLRKRATTSSNNGSSFGSAVDPSKTDFIEVMACPGGCIN
FT                   GGGLLNGEANSSRRRALAKSLELEYGKVIPKVSCSDHPRDDSTYKYKFSAIEKSQDVLT
FT                   VGNTW"
FT   gene            <46022..>48457
FT                   /locus_tag="KLTH0H00418g"
FT                   /old_locus_tag="KLTH-ORF2261"
FT   CDS_pept        46022..48457
FT                   /locus_tag="KLTH0H00418g"
FT                   /old_locus_tag="KLTH-ORF2261"
FT                   /product="KLTH0H00418p"
FT                   /note="similar to uniprot|P13134 YNL238W Saccharomyces
FT                   cerevisiae KEX2 Subtilisin-like protease (proprotein
FT                   convertase)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30036"
FT                   /db_xref="GOA:C5E1X5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034182"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X5"
FT                   /protein_id="CAR30036.1"
FT                   /translation="MRLAFCKYFLLQVLLLSIVSQAVRVPVKDHSSRSYFAVESVLEVP
FT                   RLLKLHPNWVFEHEARGLDKHYVFSTKKDEYSKRDEVEASYEGVKSYHPLPPKKLQKRL
FT                   PVPDRPVDSSLEVVNEVRDRLSIEDPLFGIQWHLVNGNYPGHDVNVSGLWYENVTGHNV
FT                   VVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDYHGTRCAGEIAAVKNKA
FT                   CGIGVAYNAKVAGIRILSAEVTAEDEAASLIHALDVNDIYSCSWGPLDDGRVLQGPDDL
FT                   VRKALVTGVTKGRNEKGALYVFASGNGGMYDDNCNYDGYTNSIYSITVGAIDHKGLHPP
FT                   YSESCSAVMVVTYSSGSGEHIHSTDIHGKCSDTHGGTSAAAPLAAGVYSLVLEANPNLS
FT                   WRDVQYLSILSSEEINDDDGEWQEGALGKRYSHKYGYGKLDAYRIVTMGREWENVGPQS
FT                   WYYSSVQKVGKSTNSTDEDLVSSISVSSEQLKNANFKRVEHITVTVSIETTIRGRTTIN
FT                   LVSPKGIVSKLGVVRRSDTSPEGFQNWTFMSVAHWGEIGEGDWSLHVRTTEDSNNVEFK
FT                   DWRLKLFGESLDASKAKTFEFGNDKEPTEDLQQQQQEESVSDHPTSLASSTQPTFTAAS
FT                   SITSTHSTVSATTTTAETSDQDVNSPNKLPRPFEGLRYFLAIFAVGFLVLVLYYYFFVK
FT                   SRRLVRRSRAEAYEFDIIDTDSDHDSSLNSASNTSVPMMGELNEEDFNFDLSDEELLRS
FT                   ATVSPAPRYEQNVPAGASSDDLPTADPSKGKVHSENSSNNNGKRNNMPREGSQGPNNG"
FT   gene            <48723..>50072
FT                   /locus_tag="KLTH0H00440g"
FT                   /old_locus_tag="KLTH-ORF2259"
FT   CDS_pept        48723..50072
FT                   /locus_tag="KLTH0H00440g"
FT                   /old_locus_tag="KLTH-ORF2259"
FT                   /product="KLTH0H00440p"
FT                   /note="similar to uniprot|P53584 Saccharomyces cerevisiae
FT                   YNL237W YTP1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30037"
FT                   /db_xref="GOA:C5E1X6"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X6"
FT                   /protein_id="CAR30037.1"
FT                   /translation="MGSHYGCPRKLVAYLAIALLLVEQETCAGMQMDDTEGLTRPDIVQ
FT                   AGPKTFHWLCTLALLLLLPSVSTALSFAGKLYFSMFLQIVSLAYAVAEAFILRFPDGDG
FT                   IENRTSRGTAWFMLALLGVTVFFGSLATGTGALVQNKRLQSLASHTGEKTLRYIHRALS
FT                   FAVVLTGWIKCCLAPVAMFGFCRDKHTGQCIAHGIMGTAFVLYGFVYSMVLVVPWIRNS
FT                   QAEYSQDRIDSWVMCAWGIVNTFTEHRWGREDWNHGDYQHTAMGIIWWAGGLLGIFLSR
FT                   NGRRTFVPSLLIIFTGWAMSEHSQKLIISTKVHALFGLVLMAGGALRIVEISFLLRDRR
FT                   AASEILSFQYLAPFCLVCSGVLFMGANEEQLQLVLRLGADHSAYSLVAISAAFVVYLWI
FT                   LLCLELYLKLVKLAEKGPLDSYTNNRGLESLTEFELDDVDGENHETVSRN"
FT   gene            <51279..>54104
FT                   /locus_tag="KLTH0H00462g"
FT                   /old_locus_tag="KLTH-ORF2257"
FT   CDS_pept        51279..54104
FT                   /locus_tag="KLTH0H00462g"
FT                   /old_locus_tag="KLTH-ORF2257"
FT                   /product="KLTH0H00462p"
FT                   /note="similar to uniprot|P32259 YNL236W Saccharomyces
FT                   cerevisiae SIN4 involved in positive and negative
FT                   regulation of transcription"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30038"
FT                   /db_xref="GOA:C5E1X7"
FT                   /db_xref="InterPro:IPR021665"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X7"
FT                   /protein_id="CAR30038.1"
FT                   /translation="MSLFGTEDGEFVAWSKSGLIAYLDSRSSHANLCITFMETINGTNW
FT                   RLHPCKRYVVHPHLLETQSPAGASSIVGGGGGGSSRSFHNLNSVHWNNLSSHTGEQLAA
FT                   CDELGNLTIIAAGQSMEGQGTLDKMIVLCQDNIYKTYNLTAPLQEVNPAAKIYRKQAKK
FT                   EVHTTIIEFMWIGTQKPVLTMLGARKDSTTSTFHSQIQQCQPYGLFHPASIKSAFIALR
FT                   RGGQLDFWYQFSNSRDHKKISLQLNGSHEARSKQFEWFQMGGFAQMEDDQALLIGAFSK
FT                   LSNSLSFYRLHVNWNLSSQNSMNDPSLKLQHLLEIKPDYVGPQGELLNFTNFELLSPTH
FT                   DRQSPLELLMCYEVAGLSRSIVKRYSLIKAVPSAILTIEFGVLNTEIPSSGSDYSFSEN
FT                   EVITFDSGVTAAKSYNSETLVIFKLKNGRIEVYNRKTWRKENHEFNKINASASHAATLS
FT                   SPFCTGLNFPEIPPPAVTGWSEIAPALGGVLTKSRFDGELQFHPVTAPVTDDSQNDSNI
FT                   AAAFAYAFVCANHLQASGEDLSIAIKTYMLRIRQQSVARSDVFLREVICIIYHLFGLTP
FT                   DASKEVKDKLIMSRPIQRAMLLQLELGSSFDNSNVYNMSRTAMSLRNILFAFNGVSRNI
FT                   QVLIHHSATMNFQQSNGKLFQFAFSKQDLIYSLIPCAKWFVKLVTFLTQQMIVLVNSPQ
FT                   DKDNTLVLGILSSKMTRQLLLSVLSEIRKIIHLVTKFPETAFPILNESSIYLRKVLGDS
FT                   PVNFEKFETFLADVNNKFTSLSEQQAQGNAMKDSYLIIEGDIPEEISHLKEFMLSYSNT
FT                   AVLSHIKPSEVYFSDTRGLRIFASELFSDSIFKLLQPLEKGLVVNSKVLSESISSSSFC
FT                   VAESDDISKDTLKNLNEGQKVKRCCRCGAITRAGYTVSKDNTIVPTSISTKRWTSLYLK
FT                   TCICSGFLYEL"
FT   gene            <54539..>55867
FT                   /pseudo
FT                   /locus_tag="KLTH0H00484g"
FT                   /old_locus_tag="pseudo-Klth0H-54539-55867"
FT   gene            complement(<56283..>57424)
FT                   /locus_tag="KLTH0H00506g"
FT                   /old_locus_tag="Klth0H.mRNA.at.316.m"
FT   CDS_pept        complement(join(56283..57332,57377..57424))
FT                   /locus_tag="KLTH0H00506g"
FT                   /old_locus_tag="Klth0H.mRNA.at.316.m"
FT                   /product="KLTH0H00506p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30039"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X8"
FT                   /protein_id="CAR30039.1"
FT                   /translation="MMKTSDVERLAYLHQERHLKNDGFCEFIENVATNQYLLRYTYGNL
FT                   VIRQATNKLTQRTPQLVLETLEDNGVFHNEERILIEKFTEQLIANQIQFETRKRSRGRG
FT                   KNFCYNKNYHSGGKFKLKYTNTDFRKLTGFCRSDFDRVVEALKMPSYIGAYSLDAFECF
FT                   FIFVVRLKSGCTYTVLTSLCGREASTISRIITFVTCYLFHIASSCLSVTNASWLAGRLA
FT                   NIDQSLLSSSRSISNSRIVGFIDGTHVKIARPHGNARLENAAYSGHKKTHTLKYQAVTT
FT                   PDGICIDLAGPFAGSQHDSFLFANSGLYRRLKPALKVGGIQYRISGDPAYRSSDLLTVG
FT                   YKGQNLTNGQKEYNKILSGSRVSIE"
FT   gene            <57753..>58538
FT                   /locus_tag="KLTH0H00528g"
FT                   /old_locus_tag="KLTH-ORF2244"
FT   CDS_pept        57753..58538
FT                   /locus_tag="KLTH0H00528g"
FT                   /old_locus_tag="KLTH-ORF2244"
FT                   /product="KLTH0H00528p"
FT                   /note="highly similar to uniprot|P32379 Saccharomyces
FT                   cerevisiae YGR253C PUP2 Alpha subunit of the 20S proteasome
FT                   involved in ubiquitin-dependent catabolism human homolog is
FT                   subunit zeta"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30040"
FT                   /db_xref="GOA:C5E1X9"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033812"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X9"
FT                   /protein_id="CAR30040.1"
FT                   /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEG
FT                   VVLGVEKRVTSPLLEGDSIEKIVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYD
FT                   EDISIESLTQSICDLALRFGEGASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGT
FT                   FYRYNAKAIGSGSEGAQSELQNEWHSSLTLKEAELLVLKILKQVMEEKLDEGNAQLSCV
FT                   TKEDGFKVYSDEKTAAIIKELKDKEAQENSETQDVEMST"
FT   gene            complement(<58659..>59945)
FT                   /locus_tag="KLTH0H00550g"
FT                   /old_locus_tag="KLTH-ORF2243"
FT   CDS_pept        complement(58659..59945)
FT                   /locus_tag="KLTH0H00550g"
FT                   /old_locus_tag="KLTH-ORF2243"
FT                   /product="KLTH0H00550p"
FT                   /note="highly similar to uniprot|Q03330 Saccharomyces
FT                   cerevisiae YGR252W GCN5 Histone acetyltransferase
FT                   acetylates lysine 14 on histone H3 catalytic subunit of the
FT                   ADA and SAGA histone acetyltransferase complexes founding
FT                   member of the Gcn5p-related N-acetyltransferase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30041"
FT                   /db_xref="GOA:C5E1Y0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037800"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y0"
FT                   /protein_id="CAR30041.1"
FT                   /translation="MTSKRKDGAEEGSEAKRQKVERNVKDEPESQPEVVDLLEEQPATE
FT                   SRANSGDKEEKESDEAGVTHFTFDGQEYKFKERASVIEEKEGKIEFRVVNNDNTKENMM
FT                   VLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVVRKPLTVVGGITYRPFDNREFAEI
FT                   VFCAISSTEQVRGYGAHLMNHLKDYVRATSKIKYFLTYADNYAIGYFKKQGFTKEISLD
FT                   KSVWMGYIKDYEGGTLMQCSMLPRIRYLDAAKILLLQEAAVQRKVRLMSKSYVVHPGLK
FT                   IFKDLENIKPIDPMEIPGLKESGWTPEMDELAQRPKRGPHFAAMQNVLTELQNHAAAWP
FT                   FLQPVNKDEVPDYYEFIKEPMDLSTMEIKLENNRYEKMENFFYDARLIFNNCRAYNGEN
FT                   TSYFKYANRLEKFFNTKMKEIPEYSHLVD"
FT   gene            complement(<60065..>61960)
FT                   /locus_tag="KLTH0H00572g"
FT                   /old_locus_tag="KLTH-ORF2239"
FT   CDS_pept        complement(60065..61960)
FT                   /locus_tag="KLTH0H00572g"
FT                   /old_locus_tag="KLTH-ORF2239"
FT                   /product="KLTH0H00572p"
FT                   /note="similar to uniprot|P38862 Saccharomyces cerevisiae
FT                   YHR171W ATG7 Autophagy-related protein that is a member of
FT                   the E1 family of ubiquitin-activating enzymes mediates the
FT                   conjugation of Atg12p with Atg5p a required step in the
FT                   formation of autophagosomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30042"
FT                   /db_xref="GOA:C5E1Y1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR006285"
FT                   /db_xref="InterPro:IPR032197"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR042522"
FT                   /db_xref="InterPro:IPR042523"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y1"
FT                   /protein_id="CAR30042.1"
FT                   /translation="MSDPHLKFVAPCQSFLDTSFFQELARLKLDVLKLDSAIKELTSSI
FT                   GISHIPRGSPCAHLFLDSHSFGSRERKEGEMLIKGSLYNFNTIEEFKKVDKTRFLRDRA
FT                   DELWKEGIEDPNDCVKFSIISFADLKAFKFFYWVCVPCFQLDSLTASVRGSGPFKSTSK
FT                   FDEWFAAHPGCWSCLVGESGELMEFNKVNSVRSSTLCMRDTSTVDMVPSALAKSFISLL
FT                   KHFRSDLKEVRLIFIRSETASSFWVDTDMSSILAPDNTKLKVTGWERNLQNKLTPRAVD
FT                   LSSLIDPLHVADQSLDLNLKLMKWRIAPEINLDIIKNTSVLLLGSGTLGCYVARVLLAW
FT                   GVRKITFVDNGTVSFSNPVRQPLFTFNSCGKPKAAAAADSLREIFPLVEAEGVELAVPM
FT                   IGHPITSESKQNEDYKRLLELIKAHDVVFLLMDSRETRWLPTVMGYAEDKIVINAALGF
FT                   DSYLVMRHGNYETDQKADRLGCYFCQDVVAPSDSLTDRTLDQMCTVTRPGVALMAASQS
FT                   VELLVSLLQHPMRNGGRPDEKVILGDLPHQIRGFLSEFKTLQLRVTAYEHCSACSSIIV
FT                   EEFKSRGWDFVRDALNDYKTVEDLCGLSEVQLKAEEVMNDVLDEWDDDGEDGELL"
FT   gene            complement(<62142..>63680)
FT                   /locus_tag="KLTH0H00594g"
FT                   /old_locus_tag="KLTH-ORF2235"
FT   CDS_pept        complement(62142..63680)
FT                   /locus_tag="KLTH0H00594g"
FT                   /old_locus_tag="KLTH-ORF2235"
FT                   /product="KLTH0H00594p"
FT                   /note="highly similar to uniprot|P38861 Saccharomyces
FT                   cerevisiae YHR170W NMD3 Protein involved in nuclear export
FT                   of the large ribosomal subunit acts as a Crm1p-dependent
FT                   adapter protein for export of nascent ribosomal subunits
FT                   through the nuclear pore complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30043"
FT                   /db_xref="GOA:C5E1Y2"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y2"
FT                   /protein_id="CAR30043.1"
FT                   /translation="MNYTPLDQSAFNNHQAATVLCCNCGTPMDGSSGLVMCYDCIKLTV
FT                   DITEGIPRESNVSFCRNCERFLQPPGQWVRAELESRELLALCLRRLKGLNKVRLVDASF
FT                   IWTEPHSRRIRVKLTVQGEAMANTIIQQTFEVEYVVVAMQCADCARSYTTNTWRATVQI
FT                   RQKVSHKRTFLYLEQLILKHNAHVDTINIQEAKDGLDFFYAQKNHAVKMLDFLNAVVPI
FT                   KSKKSEELVSQDTHTGASTYKFSYSVEIVPLCRDDLVVLPKKLAKSLGNISQFVLCSKI
FT                   SNTIQFLDPMTLQTSDLSPSVYWRSPFDSLADVSQLVEFIVLDVDPTGQTKGKWVLADI
FT                   TVARASDLGSNDQVYYVRSHLGAICHPGDSVMGYFIANSNYNSDLFDALNMEHVPDVVL
FT                   VKKQYIRKTRKNRSWKLKRMAREHKDIEASQDYSSRQQKQEMERAEKDYELFLQELEED
FT                   AEMRQAVNLYKSAQQAPQDGEMDEDEEEDAPQIDIDELLDELDEMTLDEGAPPA"
FT   gene            complement(<63837..>64415)
FT                   /locus_tag="KLTH0H00616g"
FT                   /old_locus_tag="KLTH-ORF2233"
FT   CDS_pept        complement(63837..64415)
FT                   /locus_tag="KLTH0H00616g"
FT                   /old_locus_tag="KLTH-ORF2233"
FT                   /product="KLTH0H00616p"
FT                   /note="similar to uniprot|P53317 Saccharomyces cerevisiae
FT                   YGR251W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30044"
FT                   /db_xref="GOA:C5E1Y3"
FT                   /db_xref="InterPro:IPR022592"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y3"
FT                   /protein_id="CAR30044.1"
FT                   /translation="MSRAKEIQEKLSLQAKLQASFNASALKASEWLPKDSLEDQKSDLT
FT                   SSKDSFYSLPVIGVGAGLSFEEKEESNAQGEVSTIGEFINSNKKLSSLAKKKKGKHATN
FT                   SQSQSGGIFKVSSSDTRAMVALKRKMKSGRRQELRNKISRPSALDMSHPGLGTKEDLRH
FT                   SDSDEEPQVTKTSKKSYGLLFESKKPKRK"
FT   gene            complement(<64621..>65922)
FT                   /locus_tag="KLTH0H00638g"
FT                   /old_locus_tag="KLTH-ORF2232"
FT   CDS_pept        complement(64621..65922)
FT                   /locus_tag="KLTH0H00638g"
FT                   /old_locus_tag="KLTH-ORF2232"
FT                   /product="KLTH0H00638p"
FT                   /note="highly similar to uniprot|P38719 Saccharomyces
FT                   cerevisiae YHR169W DBP8 Putative ATP-dependent RNA helicase
FT                   of the DEAD-box family involved in biogenesis of the 40S
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30045"
FT                   /db_xref="GOA:C5E1Y4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y4"
FT                   /protein_id="CAR30045.1"
FT                   /translation="MSSEFATLGISKWLVEALQAMKITQPTAIQKACIPQILQGKDCIG
FT                   GAKTGSGKTIAFGAPMLTKWSEDPSGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVAL
FT                   VVGGESIVDQAINLQRKPHFIVATPGRMAHHIMNSGEDTIGGLKRAKFLVLDEADILLT
FT                   DTFSEHLATCISILPPKEKRQTLLFTATVTDQVKALQNAPAAEGKPPLFSYEVESMDKV
FT                   AIPSTLKTTYLLVPEQVKEAYLYQILTNATYNESSAIIFVNRTVTAEILRRTLKQLDVR
FT                   VASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVQLVINYDISSNPDTFI
FT                   HRAGRTARAGRSGESICFVAPRDVSRIEAIEERINKKMEEFKDVHDTAVIRKALNKVTV
FT                   AKRESLMSMEKENFGERRKLHLKKSGLSKSYRNN"
FT   gene            complement(<67991..>69601)
FT                   /locus_tag="KLTH0H00660g"
FT                   /old_locus_tag="KLTH-ORF2230"
FT   CDS_pept        complement(67991..69601)
FT                   /locus_tag="KLTH0H00660g"
FT                   /old_locus_tag="KLTH-ORF2230"
FT                   /product="KLTH0H00660p"
FT                   /note="similar to uniprot|P38860 Saccharomyces cerevisiae
FT                   YHR168W MTG2 Putative GTPase member of the Obg family
FT                   peripheral protein of the mitochondrial inner membrane that
FT                   associates with the large ribosomal subunit required for
FT                   mitochondrial translation possibly via a role in ribosome
FT                   assembly"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30046"
FT                   /db_xref="GOA:C5E1Y5"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y5"
FT                   /protein_id="CAR30046.1"
FT                   /translation="MVLRRPIQRASLRVRFNSTAPDNAPKASDNEIWLRKLSNNRKLAH
FT                   APEVSQKIQPASSSQDHRNRFEIISTPPDTSFIGVKAPLSEFTSLSHIQSNNQRHAQAK
FT                   KFVDVRILKCRSGQGGDGAVSFFRDAGRAIGPPDGGDGGDGGSVFVQAIEGLNSLAKLK
FT                   TSYIAEDGANGAAKQLDGARGKDVLISVPVGTVVKWCLNPSAVRSFIEKFKNRGTVNLR
FT                   QLLEQNKVSLQCTGRFEMDQKPSFIQLFRESYEAGEGWHFKGKDEEYHLEKNWFKQLKE
FT                   KVSIYDLELASSELSADKFPLLGIDLDKPSDRPICLVKGGKGGLGNMHFLTNLIRNPRF
FT                   SKMGRSGLEQFFMFELKSLADIGLVGLPNAGKSTILNKISKARPKIGHWEFTTTHPSIG
FT                   TFNVGAEGFGFTVADIPGIIKDASKDKGMGLEFLRHIQRSKGWTIVVSLEREDPLADLQ
FT                   LLISELGGMEEVARKNVLVVCNKADIEPHNPQSLDKFLDVQGFCETQNWDIIPISALKG
FT                   ENIDLLIEKMARCAETSAT"
FT   gene            complement(<69803..>70579)
FT                   /locus_tag="KLTH0H00682g"
FT                   /old_locus_tag="KLTH-ORF2228"
FT   CDS_pept        complement(69803..70579)
FT                   /locus_tag="KLTH0H00682g"
FT                   /old_locus_tag="KLTH-ORF2228"
FT                   /product="KLTH0H00682p"
FT                   /note="some similarities with uniprot|O13539 Saccharomyces
FT                   cerevisiae YHR167W THP2 affects transcription elongation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30047"
FT                   /db_xref="GOA:C5E1Y6"
FT                   /db_xref="InterPro:IPR018557"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y6"
FT                   /protein_id="CAR30047.1"
FT                   /translation="MSSKTVERLLDDLHKSLDVNYAHSSELIESLSVLSSDSTDDKMIE
FT                   AIRALQKTFHSFTTSLADLRDENINAMESHNTKRKVEPFANVAKSRLSATFDENGNAST
FT                   LLSYVDEVITGNNLNLEHINLIGRLSSVLTEMLPSELDDSTQNLELAQILEAYNTDSKG
FT                   SEDTDCLKEKLLDWIDSIKMEKARYSLENQHILRDSLKALTMEVTRWRENYESIEGMMF
FT                   GENANSISQMLHKVQRLRPQLNSGSGEGQEEDVKME"
FT   gene            <70712..>72577
FT                   /locus_tag="KLTH0H00704g"
FT                   /old_locus_tag="KLTH-ORF2227"
FT   CDS_pept        70712..72577
FT                   /locus_tag="KLTH0H00704g"
FT                   /old_locus_tag="KLTH-ORF2227"
FT                   /product="KLTH0H00704p"
FT                   /note="similar to uniprot|P16522 Saccharomyces cerevisiae
FT                   YHR166C CDC23 Subunit of the anaphase-promoting
FT                   complex/cyclosome (APC/C) which is a ubiquitin-protein
FT                   ligase required for degradation of anaphase inhibitors
FT                   including mitotic cyclins during the metaphase/anaphase
FT                   transition"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30048"
FT                   /db_xref="GOA:C5E1Y7"
FT                   /db_xref="InterPro:IPR007192"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y7"
FT                   /protein_id="CAR30048.1"
FT                   /translation="MLESSLMNFLSELKLELRESAVQLSRLKLYNSSKWSAEALCGMCE
FT                   IPSVPVMKTFMKNDDSPLRNRSNIQFEQQESPQKHLSGMESSEYDLYLLASTLFECKEY
FT                   DRCAYYLADSKHPELKFLKLYSKYLSWDKKTQENMESSLAPRSSKQNTGFRENAEIANR
FT                   EIMNRLHSHESGNSNALKKSQKSVDLDNGESTSIPMILKELNNYLLLEGEKPTFGISLL
FT                   HYLRGVLYKIQDIPSNAISSFLSSLTLFPFNWVCWTELLSCISRTDESVLLLKILSEKF
FT                   TDEKTQVMLKFFKLSIFQEFSGNIDDFIQELDYLLSIFPNFAFLKTQHALINYHYMDYV
FT                   SAGLIFEQIIKLDPYRLEDMDTYSNILYVMQKPSKLAYLAQFASGVDRFRAETCCIIAN
FT                   YYSAKQEHEKSILYFRRALTLNKNCTSAWTLMGHEFVELKNSHAAIECYRRAVDINPRD
FT                   FKAWYGLGQAYEVLDMHLYSLYYFQKSCALKPLDKRMWQALASCYEKVDNLEESIKCYT
FT                   RALQLSLDSDIDTTILFRLAVLYEKQKDIISCKEYMLRCVEAQHSTDGFINDETTKASL
FT                   WLARYEARYKNFSEAYKHALRVTHGSSQEIEEARAIVRECRKRMD"
FT   gene            <72819..>80063
FT                   /locus_tag="KLTH0H00726g"
FT                   /old_locus_tag="KLTH-ORF2226"
FT   CDS_pept        72819..80063
FT                   /locus_tag="KLTH0H00726g"
FT                   /old_locus_tag="KLTH-ORF2226"
FT                   /product="KLTH0H00726p"
FT                   /note="highly similar to uniprot|P33334 Saccharomyces
FT                   cerevisiae YHR165C PRP8 Component of the U4/U6-U5 snRNP
FT                   complex involved in the second catalytic step of splicing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30049"
FT                   /db_xref="GOA:C5E1Y8"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="InterPro:IPR027652"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR042516"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y8"
FT                   /protein_id="CAR30049.1"
FT                   /translation="MSGLPPPPPPPGFNASVPPPPPPGFRKRTSVSRSEDDFNVKDLKE
FT                   QLLPPPPPPPMPSSISALPPPPPHHHHHKGPDTSKPALKKQKLLSHCLESPRLSVEELK
FT                   ERKREWISSQKKRFRQSSSKCARGKTQKRGVIHSHKVDMPPEHLRKIINDHKDMSSKRF
FT                   IHDKRAFLGALKYMPHAILKLLENMPQPWEQVKEVRVLYHNTGALTFVNEIPRVIEPVF
FT                   TAQWSAAWIAMRREKRDRRHFKRMRFPPFDDEEPPLSYHEHIQGIEPLDGITLQLDEVD
FT                   DALIKDWIFDSKPLLDEKSCVNGSSYKTWSIDHRTMANLHRLSSPLLDSGLDSNKNYLF
FT                   EKKSFFTAKALNNAIPGGPKFEPLFSAEEENDINEFNSLDRVIFRVPIRTGYRIAFPHL
FT                   YNSRPRAVQLSWYHTPIACLAEETQDENAETFRFDPSFNLISASYGTSRPLSLESEDFL
FT                   LDANFRPLLSSEKVCLPDTKAAISLYHAPYPFNLRSGRTVRAQDVALVKKWYLQKPETD
FT                   VPVKVRVSYQKLLKNYVLNELKSSKLGKQSKKKLLRSLRNTKFFQQTSIDWVEAGLQLC
FT                   TQGFNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRFGHAFHLMREILKAIKL
FT                   LVDAHVQYRLGNVDAFQLADGVYYILNHLGQLTGIYRYKYKVMHQIRACKDLKHVVYNR
FT                   FNRVIGKGPGCGFWQPAWRVWIFFMRGIIPLLERWLGNLLARQFEGRSSEVIKTATKQR
FT                   LDAYYDLELRAAVMNDILDMMPEGIRQNKSKTILQHLSEAWRCWKANIAWNVPGMPEPI
FT                   KNIIERYIKAKADGWVSAAHYNRDRIKRGAHVEKTVVRKNLGRLTRLWIKHEQERQQLI
FT                   EKNGPEITPLVATTIFKTMVDWLEQNNFSPVPFPPLTYKNDTKILVLALENLKNAFASK
FT                   VRLNASEREELALIEEAYDNPHDTLNRIKKYLLTQRVFKPVDLSMKDQLQTISPVYSVD
FT                   PLEKITDAYLDQYLWYEADKRQLFPNWIKPSDTEIPPLLVYKWAQGINNLSEVWDVNNG
FT                   QSTVLLQTKLEGLAEKIDLTLLNRLLRLVMDPNLADYITAKNNVVLNFKDMSHVNKYGL
FT                   IRGLQFSSFVYQFYGLMLDLLILGPQRASELAGPSQAPNNFLQFKSLDVEKRNPIRLYC
FT                   RYFDVVHILFHFEEQDSEALVLDFLSENPDPNFENAVGYNNKKCWPKDARMRLMRPDVN
FT                   LGRAVFWEISNRVPISLVNITWENSFASVYSKSNPNLLFTMCGFEARILPNFRTEEMIS
FT                   FDEGVWDLVDERTKQRTAKTFLRVSDEHVEKFNDTIRGILMASGSTTFTKITARWNTAL
FT                   ISLFTYFREAVVSTESLLDVLVKCETKIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLG
FT                   MLSASHILIPASDLSWSKQTDTGITHFRAGMTHEDEKLIPTIFRYITTWENEFLDSQRV
FT                   WADYVAKRQEALKQNRRLAFEELEGSWDRGIPRISTLFQKDRHTLAYDKGHRARSQFKD
FT                   FSLERNNPFWWTDTHHDGKLWNLNAYRTDVIQALGGIETILEHTLFKGTGFNSWEGLFW
FT                   EKASGFEDSMQFKKLTHAQRTGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFL
FT                   HGKIPTLKISLIQIFRAHLWQKIHESIVFDVCQVLDGEMDMLQIESVEKEAIHPRKSYK
FT                   MNSSAADVTLSSNHTWNVSSPSLLHNTNDNFNVSNSSKVWIDVQLRYGDYDSHDISRYV
FT                   RAKFLDYTTDNVSMYPSPTGVMIGIDLAYNMYDAYGNWFDGLKTLLQNGMKTIMKANPS
FT                   LYVLRERIRKGLQIYQSQTQEPFLNSSNYAELFSDETKLFIDDTNVYRVAVHTTYEGNI
FT                   ATKPINGCIFTLNPKTGELFLKIIHTSVWAGQKRLSQLAKWKTAEETSALIRSLPKEEQ
FT                   PKQVIVTRKAMLDPLEVHMLDFPNISIRPTELKLPFSASMAIEKLSDVVTKATEPQMVL
FT                   FNIYDDWLERVSSYTAFSRLILLLRALRTNEERAKMILKADPTIPIKEHHLWPSFSDDQ
FT                   WIEIESQMRDLILVEYGKKYNVNIASLTQTEIKDLILGQNIKAPSVKRQQMAELEMSKT
FT                   TQNSNGLDSSSGSAMKIKSTNAQGEEIMVVTSTNFETQTFSTKNEWRKRAIANSLLYMR
FT                   LKTIYLASDDFVEEKDVFILPKNLLKRFVEISDTKAQVAGYIFGKKAAGHEKVKEIRTI
FT                   VIVPQLGNTHTVQLSMLPEYSPYLQDLELLGWTHTQSQELKYMSAPEVTTHSNIFKGEK
FT                   DLVSLSVCLNPGSISLAAYTVSEEGYSWGSSNKNLFDAEPQGFDPEFSEHAQLMLSDRV
FT                   TGNFLVPSNDVWNYAFMSAVFSPSAKYELKLDIPIEFYNELHRSIHFLQFSDMVENEEL
FT                   EPEKEDVFA"
FT   gene            complement(<81177..>81479)
FT                   /locus_tag="KLTH0H00748g"
FT                   /old_locus_tag="KLTH-ORF2222"
FT   CDS_pept        complement(81177..81479)
FT                   /locus_tag="KLTH0H00748g"
FT                   /old_locus_tag="KLTH-ORF2222"
FT                   /product="KLTH0H00748p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30050"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y9"
FT                   /protein_id="CAR30050.1"
FT                   /translation="MPYSFNIFVGYGFPFNLRTLVAVSSQRSYRTFIPDDILQGMTRCK
FT                   ALGGLSATPDPKSLEKKWVDRLEASRLNCAQVVPRRGVALELDIALQKVLQYLSA"
FT   gene            <81755..>86374
FT                   /locus_tag="KLTH0H00770g"
FT                   /old_locus_tag="KLTH-ORF2221"
FT   CDS_pept        81755..86374
FT                   /locus_tag="KLTH0H00770g"
FT                   /old_locus_tag="KLTH-ORF2221"
FT                   /product="KLTH0H00770p"
FT                   /note="similar to uniprot|P38859 Saccharomyces cerevisiae
FT                   YHR164C DNA2 Essential tripartite DNA replication factor
FT                   with single-stranded DNA-dependent ATPase ATP-dependent
FT                   nuclease and helicase activities required for Okazaki
FT                   fragment processing involved in DNA repair pathways
FT                   potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30051"
FT                   /db_xref="GOA:C5E1Z0"
FT                   /db_xref="InterPro:IPR014808"
FT                   /db_xref="InterPro:IPR026851"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z0"
FT                   /protein_id="CAR30051.1"
FT                   /translation="MRSNETKKHGLSPLASPDRSKQEEHEHHPSRSSAVTRASRKKAVQ
FT                   SKKKYKFAPVDTLTRGASSEPPVLQSLSLSQVRKSKVANAPRVDHDPNLVPKPPTTLKA
FT                   VSKPSKASTSAVGVPKVLEDAPPEEVIWQYSPFKNPRADFSDRDRGYKSTSEDSAIEHV
FT                   VKESSTPIVPNKFKRVLNFPHMHDGQEMLPDAAVMASKKSSLRTNSVPKSFSLQPPSRA
FT                   STRDIDEIINDIEDGFEIKPPFQGKDIPSSPTKMVSQRLRERQGGIQEDSLLTNDSLFA
FT                   HGGTKRVEVDDKLRCSSEDHCSKENKERTDNAESTGDENEEDDEDDESLIELLTQKFVS
FT                   NPSNERGPTNHENEGANSQQSNLLSSDGTQDDSLLEYFQSSETGQHKADPSCAPEKVNF
FT                   ESTIESVEARFSQNVVVQENLNESEKWQSYVEKALCATSREGMERWVVIESKEFLVSNK
FT                   GLQKVLKCLDHKGSVSNLVVRSPWSRLTFKEGDVVHTISGSNTTNRRLFSDDRDPETGK
FT                   INDNLLILNPDILISATTVGRAVECERRALLSNQISGPGEPSLPALVGNIVHELVQMCL
FT                   KYKLDHVHILQERMSSFLDGILDNYVADIIMCQSTKDALLQQITAEHIPNIKQFLDAFV
FT                   KRDKSRTFPSARSFANKQEMSISNIIDIEENIWSPMYGLKGFIDATVETTLPNDSTFVA
FT                   PLELKTGKFKSISHEAQGTIYNLLLSDRYELPVNFFLLFYTKTNDFTKHDTLLHSLKHL
FT                   IVLRNHISEYLRHELSEVTENKWQGTTLPSILGSAACDNCYSKTECMVINNLCEDGSPK
FT                   ESGLKKGEYEALTGHLTSNRLNYKEFYMRYEDLIVKEESSLKGINNEIFLIDSKTRESL
FT                   SGKCVSNLVIVASEDDSESKLIRYTFCRKEGAAESLPSLINSQLSKNDMVIISDEAGHF
FT                   ALCTGRVVSISTMEITISTSRRLQSNNVRAPGFEKGRKQVLETVLMPSKSAKLGQKSIT
FT                   YRIDRNEVQQGLALARFNLLNLFLPSVPEGAVTTDPSTGQEIAFKRSWGGDQKTREIVV
FT                   DGRTPRFVAPSEPPRVPYDEGLKSRFNEDQWKAFEKVMRLDDYALILGMPGTGKTTLIV
FT                   EIVKSLVARGKTILLTSYTHSAIDNILIKLKNCDIDICRLGHKHRVHQEAWEFVPDFTE
FT                   ASTFEKFKEQVEKPSVVATTCLNIHDTLLSLRSKDFDYVILDEASQLSLPICVGPLKFA
FT                   ERFVLVGDHYQLPPLVKNDAARVGGLDLSLFKMLCEKHPDSVVELTHQYRMCEDIMTLS
FT                   NYLIYDGKLKCVSEEVRDQKLEIPHMAELDTMHVPGKHGQWLDIVLNSEKRVVFLDHDK
FT                   CPAFQEIAEKDNIKNPGEAELVWQCVAAMVRCGVSRRDIGVMTLYRAQLRILRKMFEAE
FT                   EHNELEILTADQFQGRDKRCVIISMVRSNDGLNGGSLLRELRRVNVAMTRAKCKLIIIG
FT                   SKATISSVESLRGFMSLLESRGWLHSLPPDCLESYNIPRPAPSQHSRRKKQGSVVANIT
FT                   AESKFTQDKSVLRDTLNGM"
FT   gene            <88079..>90586
FT                   /locus_tag="KLTH0H00792g"
FT                   /old_locus_tag="KLTH-ORF2215"
FT   CDS_pept        88079..90586
FT                   /locus_tag="KLTH0H00792g"
FT                   /old_locus_tag="KLTH-ORF2215"
FT                   /product="KLTH0H00792p"
FT                   /note="some similarities with uniprot|P53316 Saccharomyces
FT                   cerevisiae YGR250C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30052"
FT                   /db_xref="GOA:C5E1Z1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z1"
FT                   /protein_id="CAR30052.1"
FT                   /translation="MTVAEQTEQVASALADVAITDQGPQEAVGSPTAVGTEQEPAGEQE
FT                   ARGREQTRTHAQEQTPGTGQGSAAESSGTSEEDGARSLERDQSQEEFPSKSNSPNSSAL
FT                   QLDQLANTNLLTVRIKWVDNQLLDYKTTQLVNKLSELSHARKGFVVNPSVIENYEYLSD
FT                   SSRLAVLGENQDVYMHESGTKEFADFHSDESSAGGSWLYDYVLQAQFKHWADLEVVRDS
FT                   VVAALGESTIVSKWSVSDNAHALTHPGNLYVRGIPKDLTIDDLVPVFAKFGPVLSMKII
FT                   CDSNTGDSLGYGFLSYPLGSQASRCIKELNGNLMNGSPLFINYHVERKERERIHWDHIK
FT                   EDNDDERFKGVFIGNLPIEDVQGKLITPEDVIAEFQKRLGDGGETSQIVSYYLPKRNSQ
FT                   SDIEYKDDDDKTDDIETCVSKHEESPLKGYGFIKFASHTQALGAIEKFNDMEWLGNKLI
FT                   VNKAVQSKPQSHYHHHHHHHHHQNHNEYRGRRHSERSPSSRQKSMTNISFYAPFSGSQA
FT                   GFGFYGNPPNARYPAPSDLGPHDIAADSSPNSSPSPHQGYIPPPQLSHRYGAPPSLSST
FT                   PESSTAPSSRNDSFFQMHSQGGMMPPSPFMLPIPTKDQQESNLYVKHLPLSWRDEDFFQ
FT                   FYENFGEIISAKIITVGGSKNDGSSDNTFAKQSEPALGSSKGYGFVCFKNPLDASRAML
FT                   ITDRYQVDENHTLYVSFAQKRAKSISNGDTVMVSTNNSRPSSRKNYYYNNARQDFLGKY
FT                   NPKFLNAMFNQQNGGRSYPRPRGSWPAPMPMPVAPPHMVPMMPPVVLPSPISPEAIVPG
FT                   GDIEQDSIAEAPVQIKQGSTTKS"
FT   gene            complement(<90962..>92134)
FT                   /locus_tag="KLTH0H00814g"
FT                   /old_locus_tag="KLTH-ORF2209"
FT   CDS_pept        complement(90962..92134)
FT                   /locus_tag="KLTH0H00814g"
FT                   /old_locus_tag="KLTH-ORF2209"
FT                   /product="KLTH0H00814p"
FT                   /note="some similarities with uniprot|P53050 Saccharomyces
FT                   cerevisiae YGR249W MGA1 Protein similar to heat shock
FT                   transcription factor; multicopy suppressor of pseudohyphal
FT                   growth defects of ammonium permease mutants"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30053"
FT                   /db_xref="GOA:C5E1Z2"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR033049"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z2"
FT                   /protein_id="CAR30053.1"
FT                   /translation="MQNKTFIHQLHAILQQPELERWIRWEPDEQLRGVFSLRPHDAAFS
FT                   TNVLKRYFKHGNVSSFVRQLHMYGFHKLAAPTAPTSTEPASPATSPAASAGSSVAGGGT
FT                   SSADGSAGAAATTAGTKSGKSAVVWQFSHPSGAFCRDSTMSELGRIQRKSGGVGKNGKR
FT                   KNVLSAVCVNYVDTTAAASIVSRPSSAMSGSDEAPQMTPLPSLRPLTTPAPPESARSPS
FT                   SPDLLSQKGSSGSSNSVPQLSALYPGSTPVPAGPQNLTLQHLQHNINLIQRGMVTILDV
FT                   LQQFPPQSSTEAETISATLQALRNDIISADTKWTHLRYPIVSAHSSFSSVGSSFSNAPP
FT                   GSGSRFPSLSTQKSSVFSNTRFSNASIPRSSSSGQSTTDNWGLAPPHKKK"
FT   gene            complement(<92994..>94133)
FT                   /locus_tag="KLTH0H00836g"
FT                   /old_locus_tag="KLTH-ORF2195"
FT   CDS_pept        complement(92994..94133)
FT                   /locus_tag="KLTH0H00836g"
FT                   /old_locus_tag="KLTH-ORF2195"
FT                   /product="KLTH0H00836p"
FT                   /note="similar to uniprot|P38858 Saccharomyces cerevisiae
FT                   YHR163W SOL3 Glucose-6-phosphate dehydrogenase weak
FT                   multicopy suppressor of los1-1 mutation homologous to Sol2p
FT                   and Sol1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30054"
FT                   /db_xref="GOA:C5E1Z3"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z3"
FT                   /protein_id="CAR30054.1"
FT                   /translation="MCACAWERKKRRGAGAGAGRASLRTGRDITLDGMPCTHVTCAMPN
FT                   GCAPARDVYHTVRGVSLHTDSQDPQRHLARALPSPPTNATRAIYRRPALPYIKTRRPRA
FT                   AGLHAPTALHAHFLPPPVPMVPVYTYDDSAALSRDLALYILAQQDAALQRGDRFNLAVS
FT                   GGSLLKALRAGLVEDAELRARANWARWHVFFCDERIVPLEHADSNYGAFKAQVLDPLLQ
FT                   HDGVLGPTCYAINESLVGLGENDRLAAEYESLLPAQFDLILLGCGPDGHTCSLFPGDTH
FT                   SYLLDANTDRRVAWCHSSPKPPADRITFTLPTLASAHALCFVAEGAAKQPVLQRILQSS
FT                   PDTSLPAALVTDRFAQRVSWFVDSAAVQDLSVPAVTYNH"
FT   gene            <94956..>95480
FT                   /locus_tag="KLTH0H00858g"
FT                   /old_locus_tag="Klth0H.mRNA.254.p"
FT   CDS_pept        join(94956..95027,95139..95480)
FT                   /locus_tag="KLTH0H00858g"
FT                   /old_locus_tag="Klth0H.mRNA.254.p"
FT                   /product="KLTH0H00858p"
FT                   /note="similar to uniprot|P53311 Saccharomyces cerevisiae
FT                   YGR243W FMP43"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30055"
FT                   /db_xref="GOA:C5E1Z4"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z4"
FT                   /protein_id="CAR30055.1"
FT                   /translation="MSAAGAAFRRFLNSETGPKTVHFWAPTLKWALVFAGISDVSRPVD
FT                   KLSGVQNLSLLATGVIWTRWSFVIKPKNMLLASVNFFLACTAGYQLTRICNYRRAQGDT
FT                   PGQVANYVINGPPPTHLPSERQHALTRQPSPAT"
FT   gene            complement(<95812..>97068)
FT                   /locus_tag="KLTH0H00880g"
FT                   /old_locus_tag="KLTH-ORF2181"
FT   CDS_pept        complement(95812..97068)
FT                   /locus_tag="KLTH0H00880g"
FT                   /old_locus_tag="KLTH-ORF2181"
FT                   /product="KLTH0H00880p"
FT                   /note="highly similar to uniprot|P53312 Saccharomyces
FT                   cerevisiae YGR244C LSC2 Beta subunit of succinyl-CoA ligase
FT                   which is a mitochondrial enzyme of the TCA cycle that
FT                   catalyzes the nucleotide-dependent conversion of
FT                   succinyl-CoA to succinate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30056"
FT                   /db_xref="GOA:C5E1Z5"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z5"
FT                   /protein_id="CAR30056.1"
FT                   /translation="MLSRTIAANQLKNSLRASKQIRNLSIHEYRSAELLRQYGVGTPAG
FT                   EAAFEPQQAYDIAKKLGHDALVVKAQALTGGRGKGHFDTGLKSGVHMIESAEQARDLAK
FT                   QMLKHRLITKQSGAKGKPVSAVYVVERVNAKHEAYLSILMDRQSKKAMIICSSEGGMNI
FT                   EEVAAKNPDAIKKFTVTESEGLTAETAKQISKSLGFSAEAEADAADAVTKLYKIFKEKD
FT                   ASQIEINPLSEVEGQDTKVMCMDAKFGFDDNASFRQEEVYSWRDLSQEDADEVVAKKSD
FT                   LNFVKLQGNIGCLVNGAGLAMATMDVIKLYGGDPANFLDCGGGATPETIETAFKLILSN
FT                   EKVDGIFVNIFGGIVRCDFVAQGLVSATKNLAVSVPIVARLQGTNLEEGRRIIEESGLK
FT                   IYSFDELDPAAQKVVELTR"
FT   gene            complement(<97752..>99944)
FT                   /locus_tag="KLTH0H00902g"
FT                   /old_locus_tag="KLTH-ORF2175"
FT   CDS_pept        complement(97752..99944)
FT                   /locus_tag="KLTH0H00902g"
FT                   /old_locus_tag="KLTH-ORF2175"
FT                   /product="KLTH0H00902p"
FT                   /note="similar to uniprot|P53313 Saccharomyces cerevisiae
FT                   YGR245C SDA1 Severe Depolymerization of Actin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30057"
FT                   /db_xref="GOA:C5E1Z6"
FT                   /db_xref="InterPro:IPR007949"
FT                   /db_xref="InterPro:IPR012977"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027312"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z6"
FT                   /protein_id="CAR30057.1"
FT                   /translation="MVRKSRAAILPTNVILLQNLVKRDPQSYREEFLQQYSHYESLRDI
FT                   FMLNAMENQVADDSNTSQFVELVGFVSQVCSCFPEETANFPNELRQLVLEYHKSLPFEV
FT                   REKIITSLTMLRNKGVISAETLIQTMFPLLIAYSSHSNALGPNSHAKEVRKLVYSTLIS
FT                   LLKNCNTGSKNQKLNKSTQAICFNLLEQPDSQGVWASRLTRELWRRGIWDDSRAVEIMT
FT                   QAALHDDVKIAYSGVLFFLGADREREENFEDNSDDEDIDVDALKHKMQINKKSGKRGKK
FT                   LEAAVKSVKKKKAGAKTPQGFLNFSAIHLLRDPQGFADKLFTKQLSSKNNNRFDIDQKI
FT                   ALMQLLSRLIGTHKLMVLGIYSFFLKYLTPKQRDVTKIMASAAQACHDLVPPETISVMV
FT                   RKIADEFVSDGVASEVAAAGLNTIREICSRAPLAIDETLLQDLTEYKGSKAKGVSIAAK
FT                   SLVSLYREVAPEMLRRKDRGKVASMEMQDASRKGKESRRPKFGEESHVQGIAGIELLAQ
FT                   WKKDNEKVDDEEGDDKNWEVAEDSDSDADDDDGEWVTMESDKEYDVDMGDSDDEDAKAA
FT                   KKAEAAEEDEPAAPAEKIDAETAFRDLASTRVLTPADFAKLQELRTEQGVARLMGVRNE
FT                   ETVDSDRLVGPVKHKNTKEERLQSVLEGREGREKFGSRKKSRGTEHSTTNREKQRKKNF
FT                   VMMIHKRSVKGKQKMSLRDRQKVLRQHITKQKKRGF"
FT   gene            complement(<100199..>101914)
FT                   /locus_tag="KLTH0H00924g"
FT                   /old_locus_tag="KLTH-ORF2171"
FT   CDS_pept        complement(100199..101914)
FT                   /locus_tag="KLTH0H00924g"
FT                   /old_locus_tag="KLTH-ORF2171"
FT                   /product="KLTH0H00924p"
FT                   /note="similar to uniprot|P29056 Saccharomyces cerevisiae
FT                   YGR246C BRF1 TFIIIB B-related factor one of three subunits
FT                   of RNA polymerase III transcription initiation factor
FT                   TFIIIB binds TFIIIC and TBP and recruits RNA pol III to
FT                   promoters amino-terminal half is homologous to TFIIB"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30058"
FT                   /db_xref="GOA:C5E1Z7"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR029529"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z7"
FT                   /protein_id="CAR30058.1"
FT                   /translation="MAKCKVCGGVDFERDISNANNDLVCKDCGTVSEDNPIVSEVTFGE
FT                   SSSGAAVVHGSYVGAGQSHAAFGPRGGSSALESRQATINNARRKLRAVSHALGIPEYVT
FT                   DAATQWYTLALSNNFVQGRRSQNVIAACLYIACRKEKTHHMLIDFSSRLQVSVYSIGAT
FT                   FLKMVKALHITKLPLADPSLFIQHFAEKLDLGDKKIKVVKDAVKLAQRMARDWMYEGRR
FT                   PAGIAGACLLLACRMNNLRRTHSEIVAVSHVAEETLQQRLNEFKSTKSGKLSINEFRDD
FT                   AAVESEAQPPSFQRNRAKEKRLRQKIVENEFETSDEALTRNPILSQVLGAQELSSREVL
FT                   YYLKQFSQRREKNTQRENISSSTNGLRTHGEATGHSEDAAVSSDSEAGTEHRPDADVDP
FT                   NSRSHFQDAIDGYSVETDPHRPRNLHLLPTTSALLSKVADDPEDLQDVDDEELDSQLLD
FT                   EEASKLKERIWIGINGDFLLEQESKRLKQEADMASGNASVKKRGGPRRKRKAASDADGV
FT                   LADIKDDSGLHAALKLAEDTGDFTTADNVKNMIQKSSFSKKINYNAIDGLFGSS"
FT   gene            <102427..>103074
FT                   /locus_tag="KLTH0H00946g"
FT                   /old_locus_tag="KLTH-ORF2167"
FT   CDS_pept        102427..103074
FT                   /locus_tag="KLTH0H00946g"
FT                   /old_locus_tag="KLTH-ORF2167"
FT                   /product="KLTH0H00946p"
FT                   /note="similar to uniprot|P53314 Saccharomyces cerevisiae
FT                   YGR247W CPD1 Cyclic nucleotide phosphodiesterase hydrolyzes
FT                   ADP-ribose 1'' 2''-cyclic phosphate to ADP- ribose
FT                   1''-phosphate no detectable phenotype is conferred by null
FT                   mutation or by overexpression"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30059"
FT                   /db_xref="GOA:C5E1Z8"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR012386"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z8"
FT                   /protein_id="CAR30059.1"
FT                   /translation="MGIALWFVPHSNSPVYDTIQSLILSLQTLFPDAPVFEPHLTVTSQ
FT                   LKCENLTGVNQILTSCVAAVGAIRESVRGKDGAIVSFSGVSVGKGYFTKVRLTCIENRY
FT                   LMGIAQVIRELFVAEKPEEAAEWLTEEFRPHVSLVYSDMYHVNQALERVIAQRIEDALD
FT                   LQLHKVRVAGDHNQCTWHFDSPMTGWGVPGVFKVVRCEGPVDEWEVLGSVEV"
FT   gene            <103482..>105353
FT                   /locus_tag="KLTH0H00968g"
FT                   /old_locus_tag="KLTH-ORF2165"
FT   CDS_pept        103482..105353
FT                   /locus_tag="KLTH0H00968g"
FT                   /old_locus_tag="KLTH-ORF2165"
FT                   /product="KLTH0H00968p"
FT                   /note="similar to uniprot|P26370 Saccharomyces cerevisiae
FT                   YDL170W UGA3 Transcriptional activator necessary for gamma-
FT                   aminobutyrate (GABA)-dependent induction of GABA genes
FT                   (such as UGA1 UGA2 UGA4) zinc- finger transcription factor
FT                   of the Zn(2)-Cys(6) binuclear cluster domain type localized
FT                   to the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30060"
FT                   /db_xref="GOA:C5E1Z9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z9"
FT                   /protein_id="CAR30060.1"
FT                   /translation="MAEAPQPRNNAISVTACAKRTHRKTGCVPCKIRKKRCSEHKPVCT
FT                   DCQRLGFYCVYLPEKCPKEKVQYYREKVEKQLLEKKTTLDRRKASGVVQAEAQSSSINE
FT                   VVPEESGGTSVSNDEKEGQHVVSNDGLDESQRLLDVTNVAELLGADGGSDSLIPGLLSL
FT                   SGSPLSPRTLASTPAPSLSDPVLAELDDTALHLYQYYRDRLALIVSIAPSQQNHYRKIF
FT                   LPMAHQNEGVMYGLLAWAARHLSLTVDENDTALDGSAAPSSLVAGPLTDPRYTELANKY
FT                   TLFSLQRLSYRNSGFLMSLAQILVLCGAEICQGDVTRWQTLLQCATSMIKEHAPDGDIG
FT                   ALLAKSELASSLADTQTTRWLLSNFVYHDIMGSDQTHFPMSQYARVLQNPMNPLESPVD
FT                   PLHGVNRPVFQILGQVKNLARQVKQELRQELQRSGDLDEKDETRDPRDSASPTAAPAPS
FT                   RETMAIAQELQGALYRISPSESDLAWYDNFAEIGSDIRPLAETLFSVFRTAALILLKTA
FT                   VLRQTTDSYEIRFLVSQLSDELDCVLGSQLEGGLCFPLFICGINAHDRAQRISVEIKFA
FT                   DFIKRYKFRNVERALVVMRQLWESADNGVTQDWFDIVDSVGWDLNFA"
FT   gene            complement(<105471..>105998)
FT                   /locus_tag="KLTH0H00990g"
FT                   /old_locus_tag="KLTH-ORF2161"
FT   CDS_pept        complement(105471..105998)
FT                   /locus_tag="KLTH0H00990g"
FT                   /old_locus_tag="KLTH-ORF2161"
FT                   /product="KLTH0H00990p"
FT                   /note="similar to uniprot|Q05776 Saccharomyces cerevisiae
FT                   YLR193C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30061"
FT                   /db_xref="GOA:C5E200"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="InterPro:IPR037365"
FT                   /db_xref="UniProtKB/TrEMBL:C5E200"
FT                   /protein_id="CAR30061.1"
FT                   /translation="MVLWYQNSHTFNNDFRTVSLAFFNRYPNPYASHVLSIDTLSRELS
FT                   PAGDLCTTRLIKKTGKLPQWVKPFLGRISESWIIEMSEVDVRNQVLRTYTRNLDHTRII
FT                   QVEEFTTYNFDKKSGKTQASSTVKFSSGFNVGIRSRIEQWSHSKFDENVKRSRMGMAFV
FT                   MERLEQHRQAWS"
FT   gene            complement(<106313..>106945)
FT                   /locus_tag="KLTH0H01012g"
FT                   /old_locus_tag="KLTH-ORF2160"
FT   CDS_pept        complement(106313..106945)
FT                   /locus_tag="KLTH0H01012g"
FT                   /old_locus_tag="KLTH-ORF2160"
FT                   /product="KLTH0H01012p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30062"
FT                   /db_xref="UniProtKB/TrEMBL:C5E201"
FT                   /protein_id="CAR30062.1"
FT                   /translation="MQLLKFLAIIASAGAAFGSSGALGGMGSNQDSESKESSKSLVQTA
FT                   NVVSTPQEQTSKTAAASQTLQSTTAGSVESQFASEITSPSATASISNNGGPVTVLTSGS
FT                   VTSTVWWTPSVTKWWTPASELTASSDSSSPSSDASSDTVSTSRIVETITSGSHVTTITT
FT                   DVLTSVKKSSTKSSSTASISNSTNAAAPLSIDVLLSIGALALGAIAA"
FT   gene            complement(<107338..>108687)
FT                   /locus_tag="KLTH0H01034g"
FT                   /old_locus_tag="KLTH-ORF2159"
FT   CDS_pept        complement(107338..108687)
FT                   /locus_tag="KLTH0H01034g"
FT                   /old_locus_tag="KLTH-ORF2159"
FT                   /product="KLTH0H01034p"
FT                   /note="similar to uniprot|P14743 Saccharomyces cerevisiae
FT                   YLR195C NMT1 N-myristoyl transferase catalyzes the
FT                   cotranslational covalent attachment of myristic acid to the
FT                   N-terminal glycine residue of several proteins involved in
FT                   cellular growth and signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30063"
FT                   /db_xref="GOA:C5E202"
FT                   /db_xref="InterPro:IPR000903"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022676"
FT                   /db_xref="InterPro:IPR022677"
FT                   /db_xref="InterPro:IPR022678"
FT                   /db_xref="UniProtKB/TrEMBL:C5E202"
FT                   /protein_id="CAR30063.1"
FT                   /translation="MAQDPDQAKKLQELLKMLSLSQNDASKLTQPQRKQFEEYKFWKTQ
FT                   PVPRFDDEVEDEGPINSSQRPENIPNEPLPLLSEFEWCTVDITDPHQLEDVFVLLNENY
FT                   VEDQDATFRFNYSREFFNWSLKPPGWRKDWHVGVRTRQSKRLVAFISAVPATLRVRTKL
FT                   VKSVEINFLCIHKKLRSKRLTPILIKEVTRRVNKQDIWQALYTAGVVLPSPAATCRYAH
FT                   RPLNWSKLYEVGFTGLPANASKTQMIAKYTLPKEIDTPGLRPLEEKDLDEVYDLLEKYQ
FT                   SRFDLVQVFTKEEFRHLLLSSTSVVYSYVVESNNKITDFVSFYSLPFTVLNNPHYKELG
FT                   IGYLFYYASDADFDYSDRYDSEGSLKLKKRLNRLISDVCIKARDLKMDVFNAMSCQDNS
FT                   LFLDDLKFGPGDGFLNFYLFNYRVRPILGGLRKDNSFDAEKRSNVGVVML"
FT   repeat_region   complement(108814..110229)
FT                   /locus_tag="KLTH0H01056t"
FT                   /old_locus_tag="dnatranposon.3"
FT                   /note="DNA transposon of KLTH part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:degenerate
FT                   copy"
FT   repeat_region   complement(110755..111173)
FT                   /locus_tag="KLTH0H01100t"
FT                   /old_locus_tag="Klth0H.LTR.1"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <113798..>115537
FT                   /locus_tag="KLTH0H01122g"
FT                   /old_locus_tag="KLTH-ORF2153"
FT   CDS_pept        113798..115537
FT                   /locus_tag="KLTH0H01122g"
FT                   /old_locus_tag="KLTH-ORF2153"
FT                   /product="KLTH0H01122p"
FT                   /note="similar to uniprot|P21304 Saccharomyces cerevisiae
FT                   YLR196W PWP1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30064"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E203"
FT                   /protein_id="CAR30064.1"
FT                   /translation="MISSTTWVPRGFPSEFPEKYELDDEEMERINQLAQLNLDDAKDGI
FT                   ESEHDDSELGGEEKNSNEASVRGSAKLASQADNDDNLEEYDMEHYGVKEDEMLGEGAEA
FT                   SMFPGLSDEVKFHEGEDGEDAILSLPTQQDSQEEKQELQVYPTDNMVLATRTEDDVSYL
FT                   DVYVYDDGAGFHDAEVNQEPGDDKDPDVARGLVRDSSLYVHHDLMLPAFPLCVEWVNYK
FT                   PGSSSDDAANFAAVGSFDPQIEIWNLDCVEKAFPDMILGDPHATSNVGGSKSKKNKKNK
FT                   KNKNKHVLTHHTDAVLSLAHSKQFRAVLASTSADHTVKLWDLNEGIAARSVASIHSNKN
FT                   VSSSQWHSTSGSVLLTGGYDSRVALSDVRIAEDSQMSKYWSVMTGEDVECVQFADENTF
FT                   MCGTDSGNVYSFDIRQGEGSKPLWTLNAHDAGISALNVNPFIPNLLATGAMGEKTVKFW
FT                   KISESGPSMVLSRDFGVGNVLTTSFAPDIEVAGNIVIGGVDKGLKLWDVFTNRSIRKNL
FT                   SKELSSLQRQARAEASKIGRASRIARKYTKNDNPDTVVTVDDQGEDEEEGDGQRESGWE
FT                   DTE"
FT   gene            complement(<115683..>116168)
FT                   /locus_tag="KLTH0H01144g"
FT                   /old_locus_tag="KLTH-ORF2151"
FT   CDS_pept        complement(115683..116168)
FT                   /locus_tag="KLTH0H01144g"
FT                   /old_locus_tag="KLTH-ORF2151"
FT                   /product="KLTH0H01144p"
FT                   /note="weakly similar to uniprot|P32772 Saccharomyces
FT                   cerevisiae YDL169C UGX2 Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30065"
FT                   /db_xref="UniProtKB/TrEMBL:C5E204"
FT                   /protein_id="CAR30065.1"
FT                   /translation="MLLSSVMVNSEIPIVYATPFVVSSPNTVQFVIATSQSQGFAWNQD
FT                   IFASQYQQMCKVAFDGHEDHADTVLKRVRSLVQGDGAASFNDSVFDEEDQDMDGKDQYL
FT                   SRRVSQELTRPRRRSERTISFTSDSKNGSYQRTESVIIDVGADTEENRYYRSLLSNS"
FT   gene            <116579..>118102
FT                   /locus_tag="KLTH0H01166g"
FT                   /old_locus_tag="KLTH-ORF2149"
FT   CDS_pept        116579..118102
FT                   /locus_tag="KLTH0H01166g"
FT                   /old_locus_tag="KLTH-ORF2149"
FT                   /product="KLTH0H01166p"
FT                   /note="highly similar to uniprot|Q12460 Saccharomyces
FT                   cerevisiae YLR197W SIK1 Component of the small (ribosomal)
FT                   subunit (SSU) processosome that contains U3 snoRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30066"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012974"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="UniProtKB/TrEMBL:C5E205"
FT                   /protein_id="CAR30066.1"
FT                   /translation="MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINDFGSFT
FT                   KLVELVSFAPFKGAAQALENANDISEGLVSEYLKAVLDMNLPKGSNKKTVTLAISDKNL
FT                   GPSIKEVFPYIDCMSNELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVK
FT                   FSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFI
FT                   KDKASLTEDSLHDLTAILDDDAGIAERVIDNARISMGQDLSETDMENVCVFAERVTSLA
FT                   DYRRQLYDYLCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKA
FT                   LFRALKTKGNTPKYGLIYHSGFIGKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVF
FT                   GTVLKKQVEQRLEFYSTGAPTLKNELAIQEAIELYNKDKPEEPVKESKKRKLEANEDED
FT                   SEEDQKPAKKDKKDKKDKKDKKEKKEKKDKKDKKEKKEKKEKKEKKKKD"
FT   gene            complement(<118222..>119093)
FT                   /locus_tag="KLTH0H01188g"
FT                   /old_locus_tag="KLTH.mRNA.268AT.m"
FT   CDS_pept        complement(join(118222..119019,119088..119093))
FT                   /locus_tag="KLTH0H01188g"
FT                   /old_locus_tag="KLTH.mRNA.268AT.m"
FT                   /product="KLTH0H01188p"
FT                   /note="similar to uniprot|Q05778 Saccharomyces cerevisiae
FT                   YLR199C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30067"
FT                   /db_xref="GOA:C5E206"
FT                   /db_xref="InterPro:IPR018855"
FT                   /db_xref="InterPro:IPR038605"
FT                   /db_xref="UniProtKB/TrEMBL:C5E206"
FT                   /protein_id="CAR30067.1"
FT                   /translation="MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDT
FT                   AGFKRAFIVTNIFRSLFEDRLARAEQISSFVVVWQTKGREQHLYREDYQTQEDSRSTDE
FT                   TKRLEFPVHKLDDGTLFICVREDFLHVPPISINLLSREIAKLCGGLEVLLFGSSDRVER
FT                   VKYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYEKLSM
FT                   ETMDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL"
FT   gene            <119243..>119584
FT                   /locus_tag="KLTH0H01210g"
FT                   /old_locus_tag="KLTH-ORF2145"
FT   CDS_pept        119243..119584
FT                   /locus_tag="KLTH0H01210g"
FT                   /old_locus_tag="KLTH-ORF2145"
FT                   /product="KLTH0H01210p"
FT                   /note="similar to uniprot|P52553 Saccharomyces cerevisiae
FT                   YLR200W YKE2 Yeast nuclear gene"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30068"
FT                   /db_xref="GOA:C5E207"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniProtKB/TrEMBL:C5E207"
FT                   /protein_id="CAR30068.1"
FT                   /translation="MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDG
FT                   LREETQVYKLTGNVLLPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAEL
FT                   LQTQQARQQ"
FT   gene            complement(<119673..>120446)
FT                   /locus_tag="KLTH0H01232g"
FT                   /old_locus_tag="KLTH-ORF2144"
FT   CDS_pept        complement(119673..120446)
FT                   /locus_tag="KLTH0H01232g"
FT                   /old_locus_tag="KLTH-ORF2144"
FT                   /product="KLTH0H01232p"
FT                   /note="similar to uniprot|Q05779 Saccharomyces cerevisiae
FT                   YLR201C FMP53"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30069"
FT                   /db_xref="GOA:C5E208"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:C5E208"
FT                   /protein_id="CAR30069.1"
FT                   /translation="MLALSRILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHAL
FT                   NKHVPSYGFNERALVASLNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRY
FT                   ALTKELDPARTSSPAEPPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPE
FT                   LHRLSDDMVYFSKEPDANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKL
FT                   HNVSKLGQYYNNTEEYMWYTLLMSVNLAKSQLTRS"
FT   gene            <121076..>122221
FT                   /locus_tag="KLTH0H01254g"
FT                   /old_locus_tag="KLTH-ORF2140"
FT   CDS_pept        121076..122221
FT                   /locus_tag="KLTH0H01254g"
FT                   /old_locus_tag="KLTH-ORF2140"
FT                   /product="KLTH0H01254p"
FT                   /note="highly similar to uniprot|P32771 Saccharomyces
FT                   cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
FT                   (glutathione-dependent formaldehyde dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30070"
FT                   /db_xref="GOA:C5E209"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E209"
FT                   /protein_id="CAR30070.1"
FT                   /translation="MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAV
FT                   CHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFC
FT                   KSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAID
FT                   PKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKII
FT                   VVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMR
FT                   SALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDY
FT                   MDGKLKVDEFITHRRGFTDINSAFEDLHHGDCLRTVLDLSK"
FT   gene            complement(<122337..>124010)
FT                   /locus_tag="KLTH0H01276g"
FT                   /old_locus_tag="KLTH-ORF2139"
FT   CDS_pept        complement(122337..124010)
FT                   /locus_tag="KLTH0H01276g"
FT                   /old_locus_tag="KLTH-ORF2139"
FT                   /product="KLTH0H01276p"
FT                   /note="some similarities with uniprot|P32770 Saccharomyces
FT                   cerevisiae YDL167C NRP1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30071"
FT                   /db_xref="GOA:C5E210"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034351"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="UniProtKB/TrEMBL:C5E210"
FT                   /protein_id="CAR30071.1"
FT                   /translation="MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKH
FT                   VELGNGCTLQDAVAQLEKDISEHAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQ
FT                   HPKVFDLWKEYDRWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQN
FT                   GGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVT
FT                   ADDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWT
FT                   VKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANT
FT                   KQPRVIEHIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCF
FT                   RCSFPAASGAGMNNNGYMKNPLQPHNAQAGSQQQAAYKMRTPAGLQAMQVQSGPHMGQP
FT                   QQQQQQQQRMRYNQGQRFGQGQQHQGGSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGP
FT                   KSTEHQQKELGTVNSYTDIQDIGNGMGISLNTRSFSEPAW"
FT   gene            complement(<124206..>124850)
FT                   /locus_tag="KLTH0H01298g"
FT                   /old_locus_tag="KLTH-ORF2137"
FT   CDS_pept        complement(124206..124850)
FT                   /locus_tag="KLTH0H01298g"
FT                   /old_locus_tag="KLTH-ORF2137"
FT                   /product="KLTH0H01298p"
FT                   /note="similar to uniprot|Q12055 Saccharomyces cerevisiae
FT                   YDL166C FAP7 Essential nuclear protein involved in the
FT                   oxidative stress response"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30072"
FT                   /db_xref="GOA:C5E211"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E211"
FT                   /protein_id="CAR30072.1"
FT                   /translation="MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQ
FT                   HECYDGYDEARKSHIVDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDN
FT                   TVLYDRLKSRGYHEAKIQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDR
FT                   IASWSAAWLEQNPKGVTNELVERGSDEEDGTDEEGGSYGNSASSGEDGEDA"
FT   gene            <125017..>125589
FT                   /locus_tag="KLTH0H01320g"
FT                   /old_locus_tag="KLTH-ORF2136"
FT   CDS_pept        125017..125589
FT                   /locus_tag="KLTH0H01320g"
FT                   /old_locus_tag="KLTH-ORF2136"
FT                   /product="KLTH0H01320p"
FT                   /note="highly similar to uniprot|P06100 Saccharomyces
FT                   cerevisiae YDL165W CDC36 Component of the CCR4-NOT complex
FT                   which has multiple roles in regulating mRNA levels
FT                   including regulation of transcription and destabilizing
FT                   mRNAs by deadenylation basal transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30073"
FT                   /db_xref="GOA:C5E212"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:C5E212"
FT                   /protein_id="CAR30073.1"
FT                   /translation="MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQ
FT                   PSRNRVLDTFQSPWVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKIS
FT                   LFQDETLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASE
FT                   RGSYVFFDPQRWEKCQRDFVLFYNAIM"
FT   gene            complement(<125673..>126941)
FT                   /locus_tag="KLTH0H01342g"
FT                   /old_locus_tag="KLTH-ORF2134"
FT   CDS_pept        complement(125673..126941)
FT                   /locus_tag="KLTH0H01342g"
FT                   /old_locus_tag="KLTH-ORF2134"
FT                   /product="KLTH0H01342p"
FT                   /note="similar to uniprot|P32335 Saccharomyces cerevisiae
FT                   YLR203C MSS51 Protein required for the maturation and
FT                   translation of COX1 mRNA involved in maturation of COX1 and
FT                   COB mRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30074"
FT                   /db_xref="InterPro:IPR013272"
FT                   /db_xref="InterPro:IPR032717"
FT                   /db_xref="UniProtKB/TrEMBL:C5E213"
FT                   /protein_id="CAR30074.1"
FT                   /translation="MQRCILSRNTVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPE
FT                   NRFHPWDQSPSPDLRERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQ
FT                   QSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTE
FT                   FQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTS
FT                   ITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSS
FT                   SPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKT
FT                   MEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNP
FT                   QEVYQFNMFIAGFRGKRYHAIEV"
FT   gene            <127939..>128232
FT                   /locus_tag="KLTH0H01364g"
FT                   /old_locus_tag="KLTH-ORF2131"
FT   CDS_pept        127939..128232
FT                   /locus_tag="KLTH0H01364g"
FT                   /old_locus_tag="KLTH-ORF2131"
FT                   /product="KLTH0H01364p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30075"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:C5E214"
FT                   /protein_id="CAR30075.1"
FT                   /translation="MLGAFTRAFSSLVKTRAPAARLSSTLHAFRGFELPLRCMEPLMLL
FT                   RPLAPVERAPTAMEEMLADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK"
FT   gene            complement(<128402..>129325)
FT                   /locus_tag="KLTH0H01386g"
FT                   /old_locus_tag="KLTH-ORF2129"
FT   CDS_pept        complement(128402..129325)
FT                   /locus_tag="KLTH0H01386g"
FT                   /old_locus_tag="KLTH-ORF2129"
FT                   /product="KLTH0H01386p"
FT                   /note="similar to uniprot|P32339 Saccharomyces cerevisiae
FT                   YLR205C HMX1 ER localized, heme-binding peroxidase involved
FT                   in the degradation of heme"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30076"
FT                   /db_xref="GOA:C5E215"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C5E215"
FT                   /protein_id="CAR30076.1"
FT                   /translation="MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFI
FT                   YRQGVLAFFYVFQAIEQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELL
FT                   YAKEFPTSASLRTFLEETTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRV
FT                   MRSTIYRSTGLFPKFPNLTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQG
FT                   LTEEQKLNILDVSNAIFEWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTR
FT                   KQKSLVLATGVVLQILMMYWVLRKFF"
FT   gene            complement(<129752..>131923)
FT                   /locus_tag="KLTH0H01408g"
FT                   /old_locus_tag="KLTH-ORF2126"
FT   CDS_pept        complement(129752..131923)
FT                   /locus_tag="KLTH0H01408g"
FT                   /old_locus_tag="KLTH-ORF2126"
FT                   /product="KLTH0H01408p"
FT                   /note="similar to uniprot|P04819 Saccharomyces cerevisiae
FT                   YDL164C CDC9 DNA ligase found in the nucleus and
FT                   mitochondria an essential enzyme that joins Okazaki
FT                   fragments during DNA replication also acts in nucleotide
FT                   excision repair base excision repair and recombination"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30077"
FT                   /db_xref="GOA:C5E216"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:C5E216"
FT                   /protein_id="CAR30077.1"
FT                   /translation="MLRLVRAEMSSIKKQATLAKFFSSKKRSVEEEKSHEPAKKLHSDP
FT                   IGAGSGSPSSSPPLATGSSDAGSVKVETSATSTGENTKAGTPTLPDSDEPAKRAVAATK
FT                   GDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPI
FT                   TYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARA
FT                   VQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLE
FT                   SKLRIGLAEKSVLVALSKALLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETA
FT                   LEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLL
FT                   PDGSMRIYSRNGENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVL
FT                   STRKRKGVAVEDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLAS
FT                   EVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGD
FT                   SLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSP
FT                   TAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRF
FT                   IRLRDDKTPEEATSSEQVVEFYESQSHVS"
FT   gene            <132738..>134246
FT                   /locus_tag="KLTH0H01430g"
FT                   /old_locus_tag="KLTH-ORF2120"
FT   CDS_pept        132738..134246
FT                   /locus_tag="KLTH0H01430g"
FT                   /old_locus_tag="KLTH-ORF2120"
FT                   /product="KLTH0H01430p"
FT                   /note="some similarities with uniprot|Q12518 Saccharomyces
FT                   cerevisiae YDL161W ENT1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30078"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniProtKB/TrEMBL:C5E217"
FT                   /protein_id="CAR30078.1"
FT                   /translation="MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAER
FT                   SWDSVSFFEIMDMLDKRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKT
FT                   LREFTHEDETGVDQGQIVRVKARELTALLQDEERLREERELKGRNRRPRRRKNSDSYDD
FT                   DMQRALEESRMTAEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQM
FT                   QQAQQQMFGLQQQQTQQPMYYDVFGNPISAEEYLQYQQQMLEQQQMLEQQQQQQALAQQ
FT                   LAQQQYLAQQQYLAQQQQQQQALAQQQYMQAYAQQQNAQQQLLPLETGSNNPFAKNAQQ
FT                   PSAEDPSKYAAASSPQRTQQLSPQLQPQPEQFQQQQQQIPQQPLKQTRTGNQSVTDKFS
FT                   DLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMPQGKHNPFLGQQ
FT                   YTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL"
FT   gene            complement(<134324..>134584)
FT                   /locus_tag="KLTH0H01452g"
FT                   /old_locus_tag="KLTH-ORF2116"
FT   CDS_pept        complement(134324..134584)
FT                   /locus_tag="KLTH0H01452g"
FT                   /old_locus_tag="KLTH-ORF2116"
FT                   /product="KLTH0H01452p"
FT                   /note="weakly similar to uniprot|Q3E829 Saccharomyces
FT                   cerevisiae YDL160c-a"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30079"
FT                   /db_xref="GOA:C5E218"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR018552"
FT                   /db_xref="UniProtKB/TrEMBL:C5E218"
FT                   /protein_id="CAR30079.1"
FT                   /translation="MPNSIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREA
FT                   LLRSIENKEQVKSEHQDQLGDQVVLTHKDLERVSGLLLLDM"
FT   gene            complement(<134657..>135802)
FT                   /locus_tag="KLTH0H01474g"
FT                   /old_locus_tag="KLTH-ORF2115"
FT   CDS_pept        complement(134657..135802)
FT                   /locus_tag="KLTH0H01474g"
FT                   /old_locus_tag="KLTH-ORF2115"
FT                   /product="KLTH0H01474p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30080"
FT                   /db_xref="GOA:C5E219"
FT                   /db_xref="InterPro:IPR008603"
FT                   /db_xref="UniProtKB/TrEMBL:C5E219"
FT                   /protein_id="CAR30080.1"
FT                   /translation="MIAQWLCSCSTEPNSIYKLNICAKCHRVSCNWCQKPELLIKYCPG
FT                   CFRVAESEGQLRCVHNCLECPRCELILSVSMEKLASGHKRFEMVCNGCSWRYKTPEVST
FT                   LKTLTGCVEELRKKEDPYTQRFNSLREFYGFKRELQYMEEGGEVSESIASKELFDRLNE
FT                   TKLYKMINEECPIEFKDTKDSGDIALPLPLRLRAKFDYRCPSCGEWLTKSHPDPRSSRF
FT                   LLESFAAHMLPSLEIVHRSKVEPSVSDENAMALVFTASDQSDTPVEITILGSATIHIPV
FT                   RQFTLAYDGPVKCESTMETIKRLVTRVPTYQLNSNTNILATEKSRRLTRPETAPHKNNM
FT                   IDQGSGWCILPMYILEPAKTHRIQLTIPIKGVYVTLQAVLH"
FT   gene            <135932..>138172
FT                   /locus_tag="KLTH0H01496g"
FT                   /old_locus_tag="KLTH-ORF2113"
FT   CDS_pept        135932..138172
FT                   /locus_tag="KLTH0H01496g"
FT                   /old_locus_tag="KLTH-ORF2113"
FT                   /product="KLTH0H01496p"
FT                   /note="weakly similar to uniprot|Q05787 Saccharomyces
FT                   cerevisiae YLR207W HRD3 Resident protein of the ER membrane
FT                   that plays a central role in ER-associated protein
FT                   degradation (ERAD) forms HRD complex with Hrd1p and ERAD
FT                   determinants that engages in lumen to cytosol communication
FT                   and coordination of ERAD events"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30081"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5E220"
FT                   /protein_id="CAR30081.1"
FT                   /translation="MRLQHLWTAAVWCQLVLSTQDPWQEAVALLETLPMKADPMVSSAQ
FT                   ESDPYMEQVGRGIKITLPIDYYEREQESNYKSFFENEASPVQQEAYKKLVRSSDEFNNT
FT                   EATYTLAQMHLVQNFGFPHNKTLAFKYMQRFNELTDFQNASAVFELGVMHITGLFGAIP
FT                   IDVSKGLAFYEQAAKLGDYRARMALAYRYLNGINTPKDLNRSQFLYSLLARELREHFND
FT                   TEWNIFPPYVESYSVRIPDFSGGLLGSGLSVTASSAKRTRSSRPDITSSILTNLQSGKI
FT                   VLRFVGGQGDFLEDDDDDENKIVDYYYTALDNYQGTYTQKRNLEKAFYLLNSTVHEFRP
FT                   FLKFMDPLPKYYYARCLELLGHMYLTGEGIERADVDSSEVCLKDAIGIRDALPQAYLDL
FT                   GIINHYFRNNITEAVKCYTHLRESQSSTGAELFQLDKIYKSGLLPKDGEFASLWIEKES
FT                   SPNVISIGMLPEKFIEHAAIFYGCNRAVYENAVNYESDVFFKGPGGGSLVALNGFRRFV
FT                   HSRENLVAPHLREAFVELLLGNTEAALWLYAQAAEQGFETAQTNTAFLLYQPSFLLEDP
FT                   PQVPQERKLLAATYYKRAYGQHNTDALVVAGNIYYNMGLYVEAAELYRASSTPQGSWNL
FT                   GYMYEFGLGVKQSFRLASRHYKSSLSQTRKVYLGVKLTLLKLQLKKWLSWLSDKPIVRP
FT                   LLGASADEENGSLGTSLPGSGTFKWMKKKQERQTHAPEQTTPWSLLSRFFSF"
FT   gene            <138469..>139353
FT                   /locus_tag="KLTH0H01518g"
FT                   /old_locus_tag="KLTH-ORF2110"
FT   CDS_pept        138469..139353
FT                   /locus_tag="KLTH0H01518g"
FT                   /old_locus_tag="KLTH-ORF2110"
FT                   /product="KLTH0H01518p"
FT                   /note="highly similar to uniprot|Q04491 Saccharomyces
FT                   cerevisiae YLR208W SEC13 Component of both the Nup84
FT                   nuclear pore sub-complex and of the COPII complex (Sar1p
FT                   Sec13p Sec16p Sec23p Sec24p Sec31p Sfb2p and Sfb3p) which
FT                   is important for the formation of ER to Golgi transport
FT                   vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30082"
FT                   /db_xref="GOA:C5E221"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037363"
FT                   /db_xref="InterPro:IPR037596"
FT                   /db_xref="UniProtKB/TrEMBL:C5E221"
FT                   /protein_id="CAR30082.1"
FT                   /translation="MVTITNAHTELIHDAVLDYYGKRLATCSSDKSIKIFEVEGETHRL
FT                   VETLYGHEGPVWQVDWAHPKFGVILASSSYDGKVLIWREENGRWSQIAVHAVHSASVNS
FT                   VKWAPHEYGPLLLAASSDGKVSVVEFKENGTTAPILIDAHAIGVNTASWASAALQDGAA
FT                   PQQMRRFVTGGADNLVKVWKFNPDANTYLLEDTLEGHSDWVRDVAWSPSVLLRSYLASV
FT                   SQDRTCIIWTQENSQGPWKKTLLKEDKFPDVLWRASWSLSGNILALSGGDNKVTLWKEN
FT                   LEGKWEPAGEVEQ"
FT   gene            complement(<139430..>140347)
FT                   /locus_tag="KLTH0H01540g"
FT                   /old_locus_tag="KLTH-ORF2107"
FT   CDS_pept        complement(139430..140347)
FT                   /locus_tag="KLTH0H01540g"
FT                   /old_locus_tag="KLTH-ORF2107"
FT                   /product="KLTH0H01540p"
FT                   /note="similar to uniprot|Q05788 Saccharomyces cerevisiae
FT                   YLR209C PNP1 purine nucleoside phosphorylase specifically
FT                   metabolizes inosine and guanosine nucleosides"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30083"
FT                   /db_xref="GOA:C5E222"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C5E222"
FT                   /protein_id="CAR30083.1"
FT                   /translation="MNVFDLEEQRLLIGYAVEFLKHAFFEHFTRFEPRTLIICGSGLGG
FT                   IVDKVAPKPAPLVIPYEKIPGFKSSTVAGHQGKLVFGYMKGSPVVLMCGRLHYYEGHAL
FT                   HETVFPIRVVNELKTVKHLIVTNACGAINPSYQTGDLMCLNDHINMPGIAGQHPLRGPN
FT                   FEEYGPRFLPLSDAYDLDLRKLLFNKRAELGLERPLHEGVYTYVSGPTFETRAEARLIR
FT                   LVGGDVVGMSTVPEVIVARHCGIRVLALSLITNEVVTDFPASAMDESPVPLDRGKATHE
FT                   EVLEAGFLASVDVERLVEEVVGEL"
FT   gene            complement(<140915..>142390)
FT                   /locus_tag="KLTH0H01562g"
FT                   /old_locus_tag="KLTH-ORF2105"
FT   CDS_pept        complement(140915..142390)
FT                   /locus_tag="KLTH0H01562g"
FT                   /old_locus_tag="KLTH-ORF2105"
FT                   /product="KLTH0H01562p"
FT                   /note="similar to uniprot|P39517 Saccharomyces cerevisiae
FT                   YDL160C DHH1 Cytoplasmic DExD/H-box helicase stimulates
FT                   mRNA decapping coordinates distinct steps in mRNA function
FT                   and decay interacts with both the decapping and deadenylase
FT                   complexes may have a role in mRNA export and translation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30084"
FT                   /db_xref="GOA:C5E223"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E223"
FT                   /protein_id="CAR30084.1"
FT                   /translation="MEDDWKSQLNIPKKDTRPQTDDVLNTRGNTFEDFYLKRELLMGIF
FT                   EAGFEKPSPIQEEAIPIAIAGRDVLARAKNGTGKTAAFVVPTLEKVKPKVNKIQALIMV
FT                   PTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNEPVHILVGTPGRVLDLAS
FT                   RKVADLSECPLFVMDEADKMLSRDFKAIIEQILTFLPPVHQSLLFSATFPLTVKEFMVK
FT                   HLHKPYEINLMDELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVEL
FT                   LAKKITDLGYSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVIN
FT                   FDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPAQIDKS
FT                   LYVAEDDSAVPVPFPLASLPNTMANVAGQQQQLPPQLTQPQFTAVPQQYAPQQQQYMPQ
FT                   QQYQYPPQAFMQGPPQSMEQAPSMQGHAPQQTY"
FT   gene            <143065..>144453
FT                   /locus_tag="KLTH0H01584g"
FT                   /old_locus_tag="KLTH-ORF2101"
FT   CDS_pept        143065..144453
FT                   /locus_tag="KLTH0H01584g"
FT                   /old_locus_tag="KLTH-ORF2101"
FT                   /product="KLTH0H01584p"
FT                   /note="similar to uniprot|P06784 Saccharomyces cerevisiae
FT                   YDL159W STE7 Signal transducing MAP kinase kinase involved
FT                   in pheromone response where it phosphorylates Fus3p and in
FT                   the pseudohyphal/invasive growth pathway through
FT                   phosphorylation of Kss1p phosphorylated by Ste11p degraded
FT                   by ubiquitin pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30085"
FT                   /db_xref="GOA:C5E224"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E224"
FT                   /protein_id="CAR30085.1"
FT                   /translation="MSFASQDVSLRQKSRPGESGLFQPSSLKRKNLKKLTLGGAVGTGR
FT                   GLRTDNMVPVSITGSSGSNGIEAPLGLNGIPNGDLRGYGSSGVSPTSDPSSAGITPTEE
FT                   VPGLTSDLENLSLFQDTTIELQDLVQLGKIGSGNSGTVLKTLHVPDSRIIAKKSIPVEN
FT                   KQLVKSQLMRELSIMRNVKPHDNIVGFFGAFYTASTSNEIVILMEYMDCGSLDKIMSTY
FT                   KAFVARGIQSPTENWFSEPVLSKISFAVLNGLLYLYRGYKIIHRDIKPSNVLINSKGCV
FT                   KICDFGVSKKLINSIADTFVGTSTYMSPERIQGSVYSTKGDVWSLGLMIIELVTGEFPL
FT                   GGHSDTPEGILDLLQRIVNEPPPRLPPQLPNGLQYSREMFDFVNRCCVKDERERSSLQE
FT                   LLCHDFIEKSRSQGDREFRHWCKRIKKWLKEDKMLRREEQERAKLVKRQLESAANAATA
FT                   ARHR"
FT   gene            complement(<144510..>144836)
FT                   /locus_tag="KLTH0H01606g"
FT                   /old_locus_tag="KLTH-ORF2099"
FT   CDS_pept        complement(144510..144836)
FT                   /locus_tag="KLTH0H01606g"
FT                   /old_locus_tag="KLTH-ORF2099"
FT                   /product="KLTH0H01606p"
FT                   /note="similar to uniprot|Q12082 Saccharomyces cerevisiae
FT                   YDL157C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30086"
FT                   /db_xref="UniProtKB/TrEMBL:C5E225"
FT                   /protein_id="CAR30086.1"
FT                   /translation="MQSNILSVFNPPPQRELSSEETKDCIPCQVMSTMFSLGFGTYLLS
FT                   GKPFEYSEKEKKRGITAEKFQQMNPKWWRTSLRTMGGSLIIFGLIRGSEGWLWNKKKPG
FT                   TNEH"
FT   gene            <144953..>146488
FT                   /locus_tag="KLTH0H01628g"
FT                   /old_locus_tag="KLTH-ORF2098"
FT   CDS_pept        144953..146488
FT                   /locus_tag="KLTH0H01628g"
FT                   /old_locus_tag="KLTH-ORF2098"
FT                   /product="KLTH0H01628p"
FT                   /note="similar to uniprot|Q12510 Saccharomyces cerevisiae
FT                   YDL156W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30087"
FT                   /db_xref="GOA:C5E226"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR033052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E226"
FT                   /protein_id="CAR30087.1"
FT                   /translation="MGELSEFQKRRLENIKRNNDLLKKLNLSGVSNQIKNEAGAKDERK
FT                   PKKKAAKQRVVKKEPKPEKVPTRRSRRLMGESADGKEVPHVSDYELLKGSRSNDPELLD
FT                   NLKSTALVGDVKLSDLLKSEDENELLARFQNYNSKGFSSGDFFKELQKHQKVSEDIQEL
FT                   QQEFNLELYEIFQPNEIKIVQDRISALFFHPSVDQKLVVGGDTTGHVGLWNVIDEEPND
FT                   DLAEPDITTVQLFSKNVAKIDVYPTDPGKLLTASYDGMIRSIQLDSLKSEELLSLKNEY
FT                   DESLGVSDFQFSYENPNEIFLTTLSGEFTTFDTRTKPTSINLRRLADKKIGSFSINPKR
FT                   PYEIATGSLDRTLKIWDLRKTVKNPEWSAFDDYSSHEVVSTYDSRLSVSAVSYSPLDGS
FT                   LVCNGYDDTLRIFDVKDVPPQDLQPKLTLKHNCQTGRWTSILKARFKANMDVFAIANMS
FT                   RAIDIYHSSGQQLAHLKTATVPAVVSWHPLKNWIVGGNSSGKVFLFQSPNKDS"
FT   gene            complement(<146708..>147451)
FT                   /locus_tag="KLTH0H01650g"
FT                   /old_locus_tag="KLTH-ORF2097"
FT   CDS_pept        complement(146708..147451)
FT                   /locus_tag="KLTH0H01650g"
FT                   /old_locus_tag="KLTH-ORF2097"
FT                   /product="KLTH0H01650p"
FT                   /note="similar to uniprot|Q04170 Saccharomyces cerevisiae
FT                   YDR391C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30088"
FT                   /db_xref="UniProtKB/TrEMBL:C5E227"
FT                   /protein_id="CAR30088.1"
FT                   /translation="MMKQSPLSPPASPLVDLESKPVVKVNNGHCRTVVPVNKVTNIERA
FT                   TLTLAKAFHDSKANDYLMKKFANIPSSEEVPKARINEILHQFNLLYAAKGGEIVEANDF
FT                   DAVAVWTGPGHHFDQDLTNDPVFNHIFFEVLHDKRDEILKELDCYYLFIVGKDLTNPKV
FT                   RGSVRAIFDTYKRKADEEGVALVLEAINEHARSVYEYFGFKNYHTFHFGAGEVDANGKA
FT                   NPNGEGFVGYLMIYYKDELPGAIDN"
FT   gene            complement(<148024..>150129)
FT                   /locus_tag="KLTH0H01672g"
FT                   /old_locus_tag="KLTH-ORF2094"
FT   CDS_pept        complement(148024..150129)
FT                   /locus_tag="KLTH0H01672g"
FT                   /old_locus_tag="KLTH-ORF2094"
FT                   /product="KLTH0H01672p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30089"
FT                   /db_xref="GOA:C5E228"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E228"
FT                   /protein_id="CAR30089.1"
FT                   /translation="MTATTAAQSPDNPTKHDSGHALRPKRNRSRAGCFTCRLRRKKCDE
FT                   VHPKCGTCTKHVLKCIWPRKGQGRLTKEMREKMKREVDLYDESSLLVPITSPPVSEGPA
FT                   SRRGSRTQAQHFVNYAIDHASKALVLHSTDLPMNDASQIFNSQSSGEDEEDLEASETES
FT                   HTEGSETAQPVAEPTETPLEQSHALIPTRRDREEWASFLDSPGNLPGTPQTGFFWEKLF
FT                   DMNFTEPIVSPNFSIISPVCASPLPDGDLVAAASIMSAVHTEDDLNAYGLDEEQTEKFY
FT                   GKLMEKFVDWTSTNNQTKRTSVAKLMSQYQFTQQDLLLYYTCVYYFLPAVGPQQTLPQL
FT                   TTTETFVPLLTQHPIVKDVFLCCGATFLAWCQPQKYSQLAERLYQSSKSRLQKELASNR
FT                   IRGDETWAFACFQLLCLTNKLHNGEGISMVDRCVDNLAHSFNIIKRKYQTIKERGSTPT
FT                   DRMLIESFMYNYTVSLLVARDLSKLPNPFSDMFANLTTLLKSPIFNDCDVEWMNNPVLG
FT                   PSVDAFGMLAKVSFLSRMPLPLTSPHWTDEAQKLLQDCLYYTPPQLPEEVRNDERKYEV
FT                   YRPGLLSGSIISKACYLLLSKIIRYDDFDVRNLEIQGVVKYSIQSLRDIEKGNPLLCIL
FT                   LWSLLIIGAFSVDPEDRLVIKEYLKSTSETIHSYGALKIDNLLELIWDRDDINLLFVRE
FT                   NISQVII"
FT   gene            <151103..>152431
FT                   /locus_tag="KLTH0H01694g"
FT                   /old_locus_tag="KLTH-ORF2086"
FT   CDS_pept        151103..152431
FT                   /locus_tag="KLTH0H01694g"
FT                   /old_locus_tag="KLTH-ORF2086"
FT                   /product="KLTH0H01694p"
FT                   /note="similar to uniprot|P24871 Saccharomyces cerevisiae
FT                   YLR210W CLB4 Involved in mitotic induction G(sub)2-
FT                   specific B-type cyclin and uniprot|P24870 Saccharomyces
FT                   cerevisiae YDL155W CLB3"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30090"
FT                   /db_xref="GOA:C5E229"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/TrEMBL:C5E229"
FT                   /protein_id="CAR30090.1"
FT                   /translation="MQYSRFASDENRVFDHAAHARFTNDENAVPQGPAGLAGSKLALGV
FT                   AESVQTSGRRVALGDVTSQANKQAHGKPGVLAHAHSRHASENHNGPATAQLEHTGAQPM
FT                   SPPMELRSPEKMYSDDTLQGADHVGEDFNDDTSSVSSDSEPLLLVSTEESMRAVQLANQ
FT                   EFYSESPDPLDEDTYDLVMVVEYTQEVFQYLHELEEKYRPHPRYMHFQPELKWSYRSTL
FT                   IDWIVQVHARFQLLPETLYLTVNIIDRFLSRKTVTLNRFQLVGAAALFLAAKFEEINCP
FT                   TLKEILYMLDNSYTKDELLRAERYMINTLEFELGWPGPMSFLRRVSKADDYEYDIRTLA
FT                   KYLLETTIMDCRLVSAQPSWLAAGAYYLSRVILGFNNWTKQHIYCSGYTAEQLFPLATI
FT                   ILENCRHASKRHQAIFEKYSERRHRRSSQVVARWIAMAEERIS"
FT   gene            complement(<152669..>154462)
FT                   /locus_tag="KLTH0H01716g"
FT                   /old_locus_tag="KLTH-ORF2082"
FT   CDS_pept        complement(152669..154462)
FT                   /locus_tag="KLTH0H01716g"
FT                   /old_locus_tag="KLTH-ORF2082"
FT                   /product="KLTH0H01716p"
FT                   /note="similar to uniprot|Q05842 Saccharomyces cerevisiae
FT                   YDL153C SAS10 Component of the small (ribosomal) subunit
FT                   (SSU) processosome required for pre- 18S rRNa processing
FT                   essential nucleolar protein that when overproduced disrupts
FT                   silencing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30091"
FT                   /db_xref="InterPro:IPR018972"
FT                   /db_xref="UniProtKB/TrEMBL:C5E230"
FT                   /protein_id="CAR30091.1"
FT                   /translation="MARRKNARQAPKGGQEDFYGLNEVDDFAKKREKVMLDKAGLTEYP
FT                   ESGDSDGLMSDENEEGVMNVDDESSEGDQDEEPEEDDEPLDGEKAYRQVFGRKLDLGDA
FT                   RDAEDGGETMLDNESAWGSTKNEYYGADDLDDEEAAKEIEREALRQQKKHLEDLDMNDY
FT                   LDEEVEEDWAKSAKDFSLGQFQEATNQPQTQVRARDILKMSADGKEKLLKVWCPEFFPL
FT                   SKELAHLAPQLDELKAQQNSSETTSIKITALSSYLGAISSYFTILLHEIQTNDDFKSMK
FT                   EHPIMESILLCKEVWRQAQELPEEVPVEEEQDSEGIASDVENMEDDLLEDENAQESDKE
FT                   SAGAVGSDHEPEYHSDDLDIDISRPRVNQSASNKVPSAEIDDYVESEVADVDAQEKKAR
FT                   KKTLRFYTSKIDQQATKKGDKFKGDDDIPYKERLYERQQRLLEEARKRGQSGPDGTELN
FT                   AQDYDSEDEKVAKNVNTGSSTDYYNEIQQSGLNKKQARKQAHKDAVLASREGKLAELAG
FT                   EVGENGKRAISYQIMKNKGLTPRRKKENQNSRVKKRKKYDQAKKKLKSVRSVYSGGLSG
FT                   VYEGEKTGIKKNLTKSVKFKN"
FT   gene            <154705..>155961
FT                   /locus_tag="KLTH0H01738g"
FT                   /old_locus_tag="KLTH-ORF2080"
FT   CDS_pept        154705..155961
FT                   /locus_tag="KLTH0H01738g"
FT                   /old_locus_tag="KLTH-ORF2080"
FT                   /product="KLTH0H01738p"
FT                   /note="similar to uniprot|P25441 Saccharomyces cerevisiae
FT                   YDL150W RPC53 RNA polymerase III subunit C53"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30092"
FT                   /db_xref="GOA:C5E231"
FT                   /db_xref="InterPro:IPR007811"
FT                   /db_xref="UniProtKB/TrEMBL:C5E231"
FT                   /protein_id="CAR30092.1"
FT                   /translation="MSGTGRLPTLSQGNAKPSLKFKPKALARRSKEEREASVPKPAPEE
FT                   IKKPFNNKKKYSKRENGPNGQRRIPKYLLNTRVVNAGFGAENFTGGGGDMRTGFIKTEG
FT                   SNHDYLQKGLKAANEGDEGLDSEGEGATKINMGREYKSSELYASEEEDEDESSSADIDE
FT                   EALQSKRLARFFPVRALRVKHDEVELVKKEIQDTMSDPTTRDPTPGLPKLEDPQDGGQG
FT                   LQEVLNNRSLELQDKLNDLRLQNEFASVDSGEAMQEVALLNQDYRHIQKKIIKINNQPG
FT                   KFMFFQLPAVLPDFEEPKPPAPDAVEEPTVKPENEDEKTEEPTKESQDSSKKPEDSAKK
FT                   PEPETIQEPKPLAGRIGSLRIHKSGRLSVKIGNVEMDVSRGAENTFLQEVVALDEREEE
FT                   RTVELLGQIVGKAVVTPKF"
FT   gene            <156245..>159010
FT                   /locus_tag="KLTH0H01760g"
FT                   /old_locus_tag="KLTH-ORF2079"
FT   CDS_pept        156245..159010
FT                   /locus_tag="KLTH0H01760g"
FT                   /old_locus_tag="KLTH-ORF2079"
FT                   /product="KLTH0H01760p"
FT                   /note="similar to uniprot|Q12142 Saccharomyces cerevisiae
FT                   YDL149W ATG9 Transmembrane protein involved in formation of
FT                   Cvt and autophagic vesicles cycles between the pre-
FT                   autophagosomal structure and other cytosolic punctate
FT                   structures not found in autophagosomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30093"
FT                   /db_xref="GOA:C5E232"
FT                   /db_xref="InterPro:IPR007241"
FT                   /db_xref="UniProtKB/TrEMBL:C5E232"
FT                   /protein_id="CAR30093.1"
FT                   /translation="MDGSSSKYHEPERNTFLSRVFGPHSTEGNSMGNTEMTQIQASEQS
FT                   FVQSGGMRMIESDQGSSSDDDASFEREEDDSRVRAFHGIQSVVLDADSDAGSSSGAGSI
FT                   ASVQKLGQGADSDSEYQERRPGAEEDNNDEDSPLFRQNLKSLDFKSPSPVPAGPSVGFG
FT                   PEVSDRRAFKSKFIDKHTQFLKLGKDEAEAESFLFRKNSAWDEENQQPKAQTNVPRIFG
FT                   NFAAIGNTPAARLHTLSPRERALWKWANVENLDIFLQEVYNYYLGNGFYCICIEKALNI
FT                   ATLLFVVFISTFMGCCIDYSKLPHSTKISEVYVHKCYSTQISGTTKVLLWGFYIFVALK
FT                   VAQFYFDVRALRDIHNFYSFLLNISDKELQTVSWQKVIKQIMLLKDQNAVTANVAEVKA
FT                   KNRIDAHDVANRIMRRENYLIALFNNDILDLTLPIPLYRTSTLTKTLEWNLNLCIIGFA
FT                   FNESGYLKQSFLKSSQRSYLEEELRKRFMLAGFLNIILSPFLVAYFILLYFFRYFNEYK
FT                   TSPSALSSRQYTPIAEWKFREYNELYHLFQKRLGLSVEVANNYIDQFPKEKTNIIMKFI
FT                   AFVSGSFVAILALLTVFDPENFLNFEITKDKSVLFYISVFGTVWAICKNSVSGQYRVFD
FT                   PEESLREVVSYLHYKPKEWEGKYHTEDVKQDFCKLFNLRVILLLRELASLVMTPFILWF
FT                   SLPKSSGKIVDFMREVSVYVDGLGYVCKYATFEVQGRHHDAKSRASRIIKNHQNFDAPQ
FT                   GYDESEHSSASDSEDDDKSVNKMMRSYMYFLDSYQNNDNEVGKHQLPKSGRNGKGPGNV
FT                   DWLNTNYSWKRQFQPGQRPGDFQGNNVGYSSSMPTGTKDPVTKRSSEFKADSRSTGRGQ
FT                   TRFDSSLGESFINSVPLGEYRHLDRAEEVPGGNGVLGLLNQYYKKSDVGR"
FT   gene            complement(<159110..>161554)
FT                   /locus_tag="KLTH0H01782g"
FT                   /old_locus_tag="KLTH-ORF2078"
FT   CDS_pept        complement(159110..161554)
FT                   /locus_tag="KLTH0H01782g"
FT                   /old_locus_tag="KLTH-ORF2078"
FT                   /product="KLTH0H01782p"
FT                   /note="similar to uniprot|Q99207 Saccharomyces cerevisiae
FT                   YDL148C NOP14 Nucleolar protein forms a complex with Noc4p
FT                   that mediates maturation and nuclear export of 40S
FT                   ribosomal subunits also present in the small subunit
FT                   processome complex which is required for processing of pre-
FT                   18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30094"
FT                   /db_xref="GOA:C5E233"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniProtKB/TrEMBL:C5E233"
FT                   /protein_id="CAR30094.1"
FT                   /translation="MAGSQLKNLKNALKEQGFTGQTNVKGSKKLKRKAKEYDRDERTKA
FT                   IARIREQFNPFDVKMNRDKRGAEAKRVAQPVGKPGISKQIGEEQRKQVYEAKKKSKNRL
FT                   GGLLDRRFGENFKGLTEEEKMLERFTREKQSQASSRRSLFNLDDDDDAGDDDVYGEKLT
FT                   HYGKSLSFQDDFQEDDLGLDEDTGNKGSSKRSEREFGDENAELPARKKTKAEVMKEVIA
FT                   KSKFYKQERQKAQEKLEDDIQDVDDEFEDVMAELNSLPKAKKTDQNNSKEFDKEYDTKV
FT                   RELGLDRRAAPAERTKTEEELEKENEEKRQKLEQARLDRMRGMFGEEEDQGVEDLGEEF
FT                   WAGEDSENEDLNETDGSELEDVELPGGDETKSFGGKSKAVSVIPCPQTEEELKDFLQSY
FT                   ELREHPNMVKEIIRTYQPSLAMGNKGKLGVFTGVLLRHILSLSVSYDDSHLELFGSVQN
FT                   SLIAILRSMAQKYNEPLSETCREITSEIQERFKNERSHGLSTADLIFFTLVGYIFSTSD
FT                   HYHLVVTPCNVLIGELLEQTKLNSFQNVFFCAVLARISLSYQNMGKRLVPELVYFFEKS
FT                   LVTLLPLTSKEKSSSGLAHIIQDSEDLNAPQKLDLAAIGSHNLNLRQAMSQDYVPNDQE
FT                   KSALLCNILASLEEAISLVWKELSSFQELTLSFKRILSAFSQIYEDFEKPKVILEKIEK
FT                   FEKFHEHFPLSLQNHRPVSIPSHVPKYEENFNPDKKSYDPDRTRNEVNKMKAQLKKERK
FT                   FTMKEIRKDTRFEARQQIETKKKDYADYHSKMARIINQISTEEGMEKGKYEREKKLRNS
FT                   KK"
FT   gene            <161820..>163145
FT                   /locus_tag="KLTH0H01804g"
FT                   /old_locus_tag="KLTH-ORF2073"
FT   CDS_pept        161820..163145
FT                   /locus_tag="KLTH0H01804g"
FT                   /old_locus_tag="KLTH-ORF2073"
FT                   /product="KLTH0H01804p"
FT                   /note="highly similar to uniprot|Q12250 Saccharomyces
FT                   cerevisiae YDL147W RPN5 Essential, non-ATPase regulatory
FT                   subunit of the 26S proteasome lid"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30095"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR035297"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040134"
FT                   /db_xref="InterPro:IPR040896"
FT                   /db_xref="UniProtKB/TrEMBL:C5E234"
FT                   /protein_id="CAR30095.1"
FT                   /translation="MSRDAPLKAEKDYTEILKEELPKIEVLAQNDTQGALDKLLVLEKK
FT                   TRQSSDLESSKKVLASIVELLVGKNQWGELDEQLIALSKKHGQLKMSVQFMVQKIMEHL
FT                   EQLQDLKTKVKAIETIRTVTENKIFVEVERARVTRILTEIRRSEGDIDQATDLLCSLQV
FT                   ETFGSMDMYEKIGFILEQMELSILRGDYSQATVLSRKVLRKTFKNEKYEALKLDYFELL
FT                   IKIGLHKRDYLQVAQYYQEIYNTESIKKDEAKWKHALTHVVLFLVLTPYDNLQNDLIHK
FT                   VQLDNNLKKLEKPESLVKLFTTAELMRWPFVKESYESFLNSDDVAFGKNNAHWEDLRKR
FT                   VIEHNLRVVSKYYTRINLSRLNELLDLTETETERFISDLVNQGVIYAKINRPAKIVNFG
FT                   RPKNSSLLLNEWSQNVDQLLEHIETIGHLITKEEILHGLKGN"
FT   gene            complement(<163221..>163757)
FT                   /locus_tag="KLTH0H01826g"
FT                   /old_locus_tag="KLTH-ORF2071"
FT   CDS_pept        complement(163221..163757)
FT                   /locus_tag="KLTH0H01826g"
FT                   /old_locus_tag="KLTH-ORF2071"
FT                   /product="KLTH0H01826p"
FT                   /note="weakly similar to uniprot|Q05789 Saccharomyces
FT                   cerevisiae YLR211C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30096"
FT                   /db_xref="UniProtKB/TrEMBL:C5E235"
FT                   /protein_id="CAR30096.1"
FT                   /translation="MQLRDRKFSESIETYKKSAEAINQLEIQHKSIANVGDLKQALNLL
FT                   KKDLNRKIREIQILGKFSAQSSPIETNDTASHEPMAAYRLSGFQNNILAIVRGKTDPKS
FT                   GVSASEIENSISKEVSQLFKSFALIDQQKFKEYDNKVEQLVRENRKLTGQIVKLKERWD
FT                   SLVESARQKRNQQNE"
FT   gene            <164062..>165513
FT                   /locus_tag="KLTH0H01848g"
FT                   /old_locus_tag="KLTH-ORF2070"
FT   CDS_pept        164062..165513
FT                   /locus_tag="KLTH0H01848g"
FT                   /old_locus_tag="KLTH-ORF2070"
FT                   /product="KLTH0H01848p"
FT                   /note="similar to uniprot|Q12342 Saccharomyces cerevisiae
FT                   YDL146W Protein of unknown function green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cell
FT                   periphery cytoplasm bud and bud neck"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30097"
FT                   /db_xref="InterPro:IPR018556"
FT                   /db_xref="UniProtKB/TrEMBL:C5E236"
FT                   /protein_id="CAR30097.1"
FT                   /translation="MERGSSSPDDEEPNAAYSPSIFWEEMEHLLKVPDVTDETQVNTAL
FT                   VKYIKHGSDSYQKCVKTEQGLYRLGVTFTESTMFHRNKMFVVSKLLSLLSVDLLECNLK
FT                   FIISYIILCASKSDLSVLELLVEFQGFTVVYNNLYSTFAYLNRYGEDIAPSSSSGPRSD
FT                   AGTEIESEIIESLKQVSTILMDILFQIFKYSKCDIVNLSIVDDFFVYYLMRTMRSETTE
FT                   DIFNNAKFKLLLALNEQYMIFSYQYELENRVYKYLVDSTVSKSFVELLLLKFNRVTDRS
FT                   LQIMLCKIVYLILTMDESYAKDFFYLNDLHVLVDVLIRELNNIADDEELIRNTVLRVLF
FT                   PLLRNTELAQTQYRRSDLIDILQHLSSLDNVCSSGETKDEHRTTVRLAQKCLKQIDWLQ
FT                   VPVVDTSDQTVPVYSDDSREMSVSTGSLSSPYDFQEKHLYGNYDASLSAESITKRLQPP
FT                   PPPPARKHPHRLGSGQKIAQFRPKS"
FT   gene            complement(<165566..>166972)
FT                   /locus_tag="KLTH0H01870g"
FT                   /old_locus_tag="KLTH-ORF2069"
FT   CDS_pept        complement(165566..166972)
FT                   /locus_tag="KLTH0H01870g"
FT                   /old_locus_tag="KLTH-ORF2069"
FT                   /product="KLTH0H01870p"
FT                   /note="similar to uniprot|P53378 Saccharomyces cerevisiae
FT                   YLR212C TUB4 Gamma-tubulin involved in nucleating
FT                   microtubules from both the cytoplasmic and nuclear faces of
FT                   the spindle pole body"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30098"
FT                   /db_xref="GOA:C5E237"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002454"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:C5E237"
FT                   /protein_id="CAR30098.1"
FT                   /translation="MTGEIITLQIGQCGNQVGKQFWSQLIKEHGISRDGQSLSTNESDT
FT                   VEEDDPTIFFKQNDSNRYTPRALLFDLEPSAIADVQNSFPGLFNERNVWVSKDELGAGN
FT                   AWSKGYDHGLENQEEFINMVDKEIDATESFEGFQLLHSVAGGTGSGLGSNFLEALSDRY
FT                   HKKIITTYSVFPSSESEVVIQPYNTILTLRRLIEHSDASVVFDNKALLNLATRVFRDRN
FT                   TSYEQTNQLIASVLSSITNSLRFPSYMYNSLPSIFSTLVPTADLHFLVPSFTPFTSDFI
FT                   PGVRDFKKSSAYDVILDLFDKSNSMVLRNNDTPVYLSIYNSILGPTDQADITRAILKSQ
FT                   QRIKFPPWSSSALHVNVGKKSAYNVTPDSDKVSGMMLANTTSVNALLQTACSSFDVLFK
FT                   RGAFLHMYQDGKMFQNGAEEFIESREVVQSCINEYYAAEQETFMDDVLMEEENIVGNGG
FT                   MLDADGDDII"
FT   gene            complement(<167262..>170891)
FT                   /locus_tag="KLTH0H01892g"
FT                   /old_locus_tag="KLTH-ORF2068"
FT   CDS_pept        complement(167262..170891)
FT                   /locus_tag="KLTH0H01892g"
FT                   /old_locus_tag="KLTH-ORF2068"
FT                   /product="KLTH0H01892p"
FT                   /note="highly similar to uniprot|P53622 Saccharomyces
FT                   cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
FT                   coatomer complex which surrounds transport vesicles in the
FT                   early secretory pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30099"
FT                   /db_xref="GOA:C5E238"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E238"
FT                   /protein_id="CAR30099.1"
FT                   /translation="MKMLTKFESKSTRAKGLAFHPSRPWVLVALFSSSIQLWDYRMGTL
FT                   LHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFH
FT                   RELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRV
FT                   WDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHARGVNWASFHPTLP
FT                   LIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTIRVWD
FT                   LDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERPCSAINQNQLIFV
FT                   NKEKQVQTFDYNKKVVSLPYVSLKNIGHAWNAFRSLSYNPSQHSVLVNCSDNQGSKFAL
FT                   CPLPKQATGAIEPTGVLEDSGSFATFVARNRFVVYNSSTSSLEVRGLDNKITKSIKIDG
FT                   DNTVKDIVYGGPGSVLLLQAKSVTLFDVQQARKLAEVPSKNVKYVSWSLDNQFIALMSK
FT                   HTITIVTKNLEVVTSMHETIRIKSAAWDETGVLIYSTLNHIKYTLLNGDNGIIKTLENT
FT                   LYINKVHGKFVYALNREGEVEVVTIDPTEYRFKKALVNKNFPEVLRIIKNSNLVGQNII
FT                   SYLQKSGFPDIALQFVQEPQTRFDLALEYGDLNIALEEANKLNSSIVWEQLGKAALQQG
FT                   NIEMVELVYQTQKLFDKLSFLYLITGDLSKLSRMESIAERRGDISSLILNTFYSDSAEK
FT                   RGSVFAQSGALPLAYAIAKANNDDDAVAQILEKAGVDESDVKLPKNLTSSRLCKSPVVS
FT                   EAITQWPLESPGASFFEKALSGQVEGLSLEEGADEEELERDAGIVAPEPNDFSDEEEVL
FT                   EDDGGWDIGEEDLGLEEDAQEAFLADKGTAKIVDENEVTQWTKNCKLPYVLIASGAFEA
FT                   AAQALNKQAGVANFEPLRPRFLEIYESCRTYMAATPAELPSITGVIRAVAEEEERGKLL
FT                   PFVAGIDVVTSKMNEGFSLFKANKLEAAIEIFRDVVYIVTLFATDNEEDESTARKALAK
FT                   AREYILGITIELARRALPADQVKRNLELASYFTTTKLLPPHRSTAFQVAMSQSFKHKNF
FT                   IQASYFASEFLKIVTTGPRADQAQKVKDRADLMAHDAIEVDFDPHAEFAICASTLTPIY
FT                   SGTPTLSDSLTGAKYHASEKGKLDAIALISKIGTPASGLRILI"
FT   gene            complement(<171281..>172708)
FT                   /locus_tag="KLTH0H01914g"
FT                   /old_locus_tag="KLTH-ORF2062"
FT   CDS_pept        complement(171281..172708)
FT                   /locus_tag="KLTH0H01914g"
FT                   /old_locus_tag="KLTH-ORF2062"
FT                   /product="KLTH0H01914p"
FT                   /note="similar to uniprot|Q05790 Saccharomyces cerevisiae
FT                   YLR213C CRR1 Putative glycoside hydrolase of the spore wall
FT                   envelope; required for normal spore wall assembly, possibly
FT                   for cross-linking between the glucan and chitosan layers"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30100"
FT                   /db_xref="GOA:C5E239"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C5E239"
FT                   /protein_id="CAR30100.1"
FT                   /translation="MVALALAASLLIGAEFVQCFVETYKSDPAIACSNDNHCPKEWPCC
FT                   SQYGQCGDGPLCVGGCDPRSSFDAHSCAAIPALVPSASSGIQVLGGSTGGAGDREDQFL
FT                   PALDTQFGIYSARHGPKPDAERIQKALESAKMLHYSEFKVEPELSSADYTYSGFLDFDA
FT                   GPQPALMLTMPPETTGSLLSSARSFLYGRVAVTMKAAPGQGVVSAMVLMSAVKDEVDFE
FT                   ILGGDPEFAQSNYYYQGELVHTRMTKARIQPDSCSEFHTYEFDWNENRIHWLIDGAIVR
FT                   TLRREDTYDPVLKIHKYPQTPMRLEVAIWPGGVPSNNPGTIMWAGGLIDWVNAAAIVNG
FT                   GRFQLAVKQVTITPYANAFTQVKPAKLQARSEDSVFFYFYDPDCSNFDEACVRAAPQQK
FT                   EDRVQEAASAPLDSSISVQPSSTPVSSSSVPTPASSRTSAHSSYKPSVFTITRHENIGP
FT                   AMSRQNLLYKLRSWLLS"
FT   gene            <173705..>175792
FT                   /locus_tag="KLTH0H01936g"
FT                   /old_locus_tag="KLTH-ORF2056"
FT   CDS_pept        173705..175792
FT                   /locus_tag="KLTH0H01936g"
FT                   /old_locus_tag="KLTH-ORF2056"
FT                   /product="KLTH0H01936p"
FT                   /note="similar to uniprot|P32791 Saccharomyces cerevisiae
FT                   YLR214W FRE1 Ferric reductase and cupric reductase reduces
FT                   siderophore-bound iron and oxidized copper prior to uptake
FT                   by transporters expression induced by low copper and iron
FT                   levels"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30101"
FT                   /db_xref="GOA:C5E240"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5E240"
FT                   /protein_id="CAR30101.1"
FT                   /translation="MRVQNLRLLALAVFSFAVTCVRGLELIDSSLASACIYYEKTFDWG
FT                   CHSHGNGAAAYRCRCGNVNWLGTITNCIANNTKSLRLRNHGFRHVARRCYEKGDFNYTL
FT                   ADMQRFYANGTGYLRDPTTADLSSPVFTTLRVNQTEFDWYYKKMKDLTFSVQRSQWFGW
FT                   GLVFFWATIIAVTTLFNFNEKFVGLKLTDNWLARSLMIPSLFENMTQRYPRLRAISPGP
FT                   HPNRLQALVVTAFVIQTIITVGVGYEMKLPHPYLTTRWFMNLDLVSYRVDLMALSLFPV
FT                   IYFFGIRNNPFIPLTGMSYTTFSYFHKWCAYVCVVLAFIHSIIWTVYARHDGGYKMWAM
FT                   DSYWQYGIAAMTLMALLVFHSFKLLRDKIYEVFLFFHQMMNIFFIVCMYYHLNKLGWLG
FT                   WVWSMAGILCFDRAARIVRIILSGGLQKSTLTDCGSGVIKLTVMNPRFLTYRPGSYAFI
FT                   YFMSPQDPWYYPWQSHPFTVLSTAKGKGIHGNEMAVYFKAQKGVTGHMLYKLLRSGEES
FT                   INIRVMVEGPYGDTLPQIAKVNRRIVGVAAGLGVTAVYAQILHLLEAQVPEMGCKLYWA
FT                   VNDLSHVSWFEEELKWLLSQKCQITILCTSPKELEETGSSFNTDNKLLEILDVRSLFAR
FT                   PDLRALVSEEVKEASDQSKDLTFISCGPSTFNIDFRASVSNTLRQKQSIDVALKEESFV
FT                   W"
FT   gene            complement(<175829..>176929)
FT                   /locus_tag="KLTH0H01958g"
FT                   /old_locus_tag="KLTH-ORF2053"
FT   CDS_pept        complement(175829..176929)
FT                   /locus_tag="KLTH0H01958g"
FT                   /old_locus_tag="KLTH-ORF2053"
FT                   /product="KLTH0H01958p"
FT                   /note="similar to uniprot|Q05791 Saccharomyces cerevisiae
FT                   YLR215C CDC123"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30102"
FT                   /db_xref="GOA:C5E241"
FT                   /db_xref="InterPro:IPR009772"
FT                   /db_xref="UniProtKB/TrEMBL:C5E241"
FT                   /protein_id="CAR30102.1"
FT                   /translation="MTNEYVELSEIKVSVQQVKNCAFSQWYSKFAGHTPQAKVIKPVPG
FT                   GFLEYLEQDGIKLPNDSQFGKSSYYAEIGNNEDNEYSDWEASSDEEHPQGQDVVQLFPE
FT                   LHKELKDIFREMGSLTPKLTWSSPKDATWILANNTLKCTEVNDMYLLLKASNYITHDLD
FT                   RALAECFDKNSALEQDGPLQHELVLRKWFDLNPALEFRVFVKDSAIIGVSQRDLNYYDY
FT                   LELLTETFKDLLDEFVEDIVLPRFPDSSFVCDVYIPRPFEKVWLIDFNPFARKTDSLLF
FT                   SWNELATIDPYKLESDYELRLVQENNVARFASKEHSENQVPKEVADAITNPKAIQELAE
FT                   KWGELLNMQKAGDSSDDEPGEQNNSL"
FT   gene            <177187..>178773
FT                   /locus_tag="KLTH0H01980g"
FT                   /old_locus_tag="KLTH-ORF2050"
FT   CDS_pept        177187..178773
FT                   /locus_tag="KLTH0H01980g"
FT                   /old_locus_tag="KLTH-ORF2050"
FT                   /product="KLTH0H01980p"
FT                   /note="highly similar to uniprot|P39078 Saccharomyces
FT                   cerevisiae YDL143W CCT4 Subunit of the cytosolic chaperonin
FT                   Cct ring complex related to Tcp1p required for the assembly
FT                   of actin and tubulins in vivo"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30103"
FT                   /db_xref="GOA:C5E242"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012717"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C5E242"
FT                   /protein_id="CAR30103.1"
FT                   /translation="MTGKASTNSTFKNREKPQEVRKANIIAARAVADAIRTSLGPKGMD
FT                   KMIKTSRGEVIISNDGHTILKQMAILHPVAKMLVEVSAAQDTEAGDGTTSVVILTGALL
FT                   GAAEKLLNKGVHPTIIAESFQRAAKRSVEILLDMSQKISLSDKQALTRAAATSLSSKIV
FT                   SQHSSFLAPLAVDCVLSIIDENATNVDLNDIRLIKKVGGTIDDTEMVDGVVLTQNVVKT
FT                   AGGPTRIEKAKIGLIQFQISPPKPDTENNIVVNDYRQMDKILKEERAYLLNICKKIKKA
FT                   KCNVLLIQKSILRDAVNDLALHFLSKLGIMVIKDVEREEIEFLSKSLNCKPISDPEFFT
FT                   EDRLGAADLIEEVDSDGSKIVKITGVKSNVARPTVSVIVRGANNVILDETERSLHDALC
FT                   VIRCLVKERALIAGGGAPEIEASRTLMKEARTLQGVEAFVWQEFAAALEVIPTTLAENA
FT                   GLYSIRVVTDLRTLHENGEKNAGISIRRSATTNTFDEHVLQPVLVSTSAITLASECVKS
FT                   ILRIDDITFSR"
FT   gene            complement(<179383..>180156)
FT                   /locus_tag="KLTH0H02002g"
FT                   /old_locus_tag="KLTH-ORF2048"
FT   CDS_pept        complement(179383..180156)
FT                   /locus_tag="KLTH0H02002g"
FT                   /old_locus_tag="KLTH-ORF2048"
FT                   /product="KLTH0H02002p"
FT                   /note="similar to uniprot|Q07560 Saccharomyces cerevisiae
FT                   YDL142C CRD1 Cardiolipin synthase produces cardiolipin
FT                   which is an important constituent of mitochondrial
FT                   membranes required for normal mitochondrial membrane
FT                   potential and function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30104"
FT                   /db_xref="GOA:C5E243"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:C5E243"
FT                   /protein_id="CAR30104.1"
FT                   /translation="MLARPGIFVGQKLPLLCRSTAIRFSSTTPPAPQKMRSVLSSIYTI
FT                   PNMLTITRIAAAPLIGHCIMTNNLVPALGLFSYSCLTDFLDGYMARKYNMKSVAGTVLD
FT                   PMADKILMLVTTVSLACPGGPQVIPIPLASLIIGRDVLLALSAIYYRISSLRHTYGKAT
FT                   WKSFWDVFRYPSAEVRPTKVSKWNTFLQMIYLGWAVATMIFQTRDEDKENDSEQTNIYQ
FT                   RAFEWLGYVVGCTTVLSGASYVFSKNAVKYLKKVR"
FT   gene            <180518..>182566
FT                   /locus_tag="KLTH0H02024g"
FT                   /old_locus_tag="KLTH-ORF2046"
FT   CDS_pept        180518..182566
FT                   /locus_tag="KLTH0H02024g"
FT                   /old_locus_tag="KLTH-ORF2046"
FT                   /product="KLTH0H02024p"
FT                   /note="similar to uniprot|P48445 Saccharomyces cerevisiae
FT                   YDL141W BPL1 Biotin:apoprotein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30105"
FT                   /db_xref="GOA:C5E244"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5E244"
FT                   /protein_id="CAR30105.1"
FT                   /translation="MNVLVYNGPGASPDSVKHALNTLRRLLEPFYAVCTTNARVLQTEP
FT                   WAGKTSAVVFPGGADLPYTKECASVISQLKKFVSKQGGTFIGFCAGGYFATNCVEFAQG
FT                   DPQLEVVGKRELKFFPDTGRGPAFHGFKYNSEAGARAASLRLSNGEELKTYYNGGCVFV
FT                   NAEKYENVEVLAHYNEALDVPYSQDPSSLGAAVVLCQIGKGRALLTGPHPEFVPKLLQK
FT                   TNDDKYNSSVVEVLLEYEKGRLNFMKDILTKAGLHCNNDFADRVAPSLTPLLVMASSNN
FT                   HLIEELENNVRNSDGIFEDGAAILEGETDSFRIYKGFDQYEAAKSELLGEEPDEVPKSI
FT                   IISSASEPFAPRKLTPNFDTAKYFQYLNPQSSVGSLLMYGEVITSTSSLLNNNKKLLSL
FT                   FPRNSMLHVGTIQVSGRGRGGNTWVNPKGVSASTACINLPLVSPTTGRPVSIVFVQYLA
FT                   MLAYCKAILSYAPGFEDLPVKIKWPNDLYAMKPEYYRTKKLRLTGRGLAGSKTPLTDVE
FT                   PAYVKISGLLVNTNFLNNCYSLLLGCGLNVSHDGPTTSLNSWVSILNKEREKANMNPLP
FT                   FVEIEKLQALYMNNLNVVLDTFLNKGPVSVLPEYYDLWLHNDQIVTLTDHQNVKAKIVG
FT                   ITKDYGLLIAKELVSGTNTQFTGNVYHLQPDGNTFDIFKGLISKKVI"
FT   gene            complement(<182788..>188010)
FT                   /locus_tag="KLTH0H02046g"
FT                   /old_locus_tag="KLTH-ORF2041"
FT   CDS_pept        complement(182788..188010)
FT                   /locus_tag="KLTH0H02046g"
FT                   /old_locus_tag="KLTH-ORF2041"
FT                   /product="KLTH0H02046p"
FT                   /note="highly similar to uniprot|P04050 Saccharomyces
FT                   cerevisiae YDL140C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30106"
FT                   /db_xref="GOA:C5E245"
FT                   /db_xref="InterPro:IPR000684"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007073"
FT                   /db_xref="InterPro:IPR007075"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR038593"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C5E245"
FT                   /protein_id="CAR30106.1"
FT                   /translation="MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMDETQ
FT                   MRAKVGGLNDPRLGSIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCE
FT                   CVCMHCGKLLLDEHSELMRQAIKIKDPKRRFNAVWSLCKAKMVCETEVPSDNDPAQYVS
FT                   RGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRVISADEVLNVFKHISPEDSVRL
FT                   GFNEDFARPEWMILTVLPVPPPPVRPSISFNETQRGEDDLTYKLGDILKANINVQRLEI
FT                   NGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSGRPIKSIRARLKGKEGRIRGNL
FT                   MGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPNEH
FT                   PGAKYIIRDNGDRIDLRYSKRAGDIQLQYGWKVERHIIDEDPVLFNRQPSLHKMSMMAH
FT                   RVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSAQSN
FT                   KPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWIPDWDGVIPTPIILKPKPLWSGKQ
FT                   ILSIAIPSGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVDKKTVGSSSGGLIHVVTR
FT                   EKGPKICARLFSNLQKVVNFWLLHNGFSIGIGDTIADEKSMREITEAIIVAKRKVEEVT
FT                   KEAQANLLTAKHGMTLRESFEDSVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKG
FT                   SFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQE
FT                   FFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGED
FT                   GMDAAHIEKQTIDTIASSDAAFERRFRIDLLNPRHALDPSLLESGSEIIGDLKLQALLD
FT                   EEFKQLVEDREFLRKIFVDGEQNWPLPVNIRRIIQNAQQTFRIDQTKPTDLTIRDVVYG
FT                   VKELQEKLLVLRGKSKILQEAQQNAVTLFCCLLRSRLATRRVIQEYRLNKQTFEWVLSN
FT                   VESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNV
FT                   AKNMKTPSLTVYLDKDHAADQEKAKLIRSAIEHTTLKSITVASEIYYDPDPRSTVIEED
FT                   EEIIQLHFSLMDEETEQSLDYQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLF
FT                   VIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKRIENTMLESITLRGVEDITRVV
FT                   MMKYDRKVPSPTGEYHKVPEWVLETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIE
FT                   AGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCS
FT                   FEETVEILFEAGAAAELDDCRGVSENVLLGQVAPIGTGAFDVMIDEESLVKFMPQQKME
FT                   EVADGHDGARTPYNNESGLVNADIDVKDELMFSPLVDSGSTDAMSGGFTAYGGADYGGA
FT                   SSPFSGYGDAPTSPGFGGVASPGFSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSY
FT                   SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT
FT                   SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
FT                   YSPTSPSYSPTSPSYSPGSPSYSPGSPKKENDNDNNNNNNNNN"
FT   gene            complement(<188834..>189946)
FT                   /locus_tag="KLTH0H02068g"
FT                   /old_locus_tag="KLTH-ORF2036"
FT   CDS_pept        complement(188834..189946)
FT                   /locus_tag="KLTH0H02068g"
FT                   /old_locus_tag="KLTH-ORF2036"
FT                   /product="KLTH0H02068p"
FT                   /note="similar to uniprot|P53691 Saccharomyces cerevisiae
FT                   YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
FT                   (cyclophilin) catalyzes the cis-trans isomerization of
FT                   peptide bonds N-terminal to proline residues binds to
FT                   Hsp82p and contributes to chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30107"
FT                   /db_xref="GOA:C5E246"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C5E246"
FT                   /protein_id="CAR30107.1"
FT                   /translation="MSRSKVFFDISIGGIPKGRMVFELYNDVVPKTAENFYKLCEGKSG
FT                   NCKSKPEIPLCYKGSIFHRIIKGFMCQFGDFTNFNGTGGESIYGEKFEDENFTMKHDKP
FT                   FLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGELIQGKRIARAIESQATDSADKPL
FT                   SDVKVDDCGVLPADYVVPEDAEKTPTDEFGDNYDDSLADDSKVDLENVDSVLKAVSAVK
FT                   DIGTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFLNIALCAIK
FT                   TGDYQKALTSTTEVVHDAAADDKSKAKALYRRGLAYYHLKDPEMAITDLEFATTYQQND
FT                   AAILKAISDAKKLKKEQVAKQKKSLSKMFS"
FT   gene            complement(<190131..>190814)
FT                   /locus_tag="KLTH0H02090g"
FT                   /old_locus_tag="KLTH-ORF2033"
FT   CDS_pept        complement(190131..190814)
FT                   /locus_tag="KLTH0H02090g"
FT                   /old_locus_tag="KLTH-ORF2033"
FT                   /product="KLTH0H02090p"
FT                   /note="some similarities with uniprot|Q12334 Saccharomyces
FT                   cerevisiae YDL139C SCM3 Suppressor of chromosome
FT                   missegregation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30108"
FT                   /db_xref="GOA:C5E247"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR018465"
FT                   /db_xref="UniProtKB/TrEMBL:C5E247"
FT                   /protein_id="CAR30108.1"
FT                   /translation="MIRRYIAALKEEVGDESTNNCMSGVNKKRDKRKVLKNLKGALKGL
FT                   LAADNGSASARPSAEVALTKPSTSEEPKRATPPRSLHTPHVPEQMSQSPKLSKQEPPSS
FT                   DKVVYIMSKESHLIPKLTDEQVMSRHKQADENMKRVWAHLIEKYGSLEDQGDVLDLATG
FT                   EIIEDNGHVRGLGTQTTDNNERYVSVLSDLLDIDTTTDNVWDMSSETEEEASEEAGEPP
FT                   LSPET"
FT   gene            complement(<190872..>191120)
FT                   /locus_tag="KLTH0H02112g"
FT                   /old_locus_tag="KLTH-ORF2031"
FT   CDS_pept        complement(190872..191120)
FT                   /locus_tag="KLTH0H02112g"
FT                   /old_locus_tag="KLTH-ORF2031"
FT                   /product="KLTH0H02112p"
FT                   /note="similar to uniprot|Q05809 Saccharomyces cerevisiae
FT                   YLR218C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02112g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30109"
FT                   /db_xref="GOA:C5E248"
FT                   /db_xref="InterPro:IPR039870"
FT                   /db_xref="UniProtKB/TrEMBL:C5E248"
FT                   /protein_id="CAR30109.1"
FT                   /translation="MAQKEDSKYYKEALEEYKELCNDEEDVWDKRINDTGCYVENMALQ
FT                   LCHADTNDWRQCLGEMALFRKCWDQKGNRERVSTVDK"
FT   gene            <191540..>195439
FT                   /locus_tag="KLTH0H02134g"
FT                   /old_locus_tag="KLTH-ORF2030"
FT   CDS_pept        191540..195439
FT                   /locus_tag="KLTH0H02134g"
FT                   /old_locus_tag="KLTH-ORF2030"
FT                   /product="KLTH0H02134p"
FT                   /note="similar to uniprot|P38968 Saccharomyces cerevisiae
FT                   YDL195W SEC31 involved in protein transport from
FT                   endoplasmic reticulum to Golgi Component (p150) of COPII
FT                   coat of secretory pathway vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30110"
FT                   /db_xref="GOA:C5E249"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR009917"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR021614"
FT                   /db_xref="InterPro:IPR024298"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040251"
FT                   /db_xref="UniProtKB/TrEMBL:C5E249"
FT                   /protein_id="CAR30110.1"
FT                   /translation="MVKLAEYPRTATFAWSYDRSPLLATGTASGTIDADFSSESTLEIW
FT                   SLLSPHEATPQASITADAKFNDLDWSHDNAIIAGALENGVVEFFAPEEPRSVAKLAQHT
FT                   TPVKTVTFNARQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWN
FT                   QNQAHVFASAGSSGYASIWDLKAKKEVIHLSYASPVTGQRNQLSIVEWHPNNSTRIATA
FT                   SGNDSDPSILIWDLRNANVPMQVLSQPHTKGVLSLDWCKQDETLLLSSGRDNVCVLWNP
FT                   EEGQSLTQYPTRGNWCFKTKFAPQTPDLFASASFDNKIEVQTLQNVTCSLDTDATATKQ
FT                   RESETEFWNNVSVQDANEKPIVKKLQAPAWYGNKSQAAQWAFGGKLVQITSDKKGVKIS
FT                   KPAIPGAEKNVLLDKALETKDFNPIINKRLVQSIDATNEEDWNLLEKLSLDGKDAFLSE
FT                   ALAFDDEDTDETKEKDVKDDGGDFFSSLNEKFVPEGSFRLDASDKLNDLFKSLVRGDKK
FT                   SAISSALEQDLLLESLLIALDSDDQTLKQKVKNAYFTKHGKTSSLARVLHCVSEGDADD
FT                   LVKNIEVDQWKYAVKAIDSYTSDLSKKNELFIALGDRLSDAGNRQDALLLYLSAQSLDK
FT                   VASIWLKEFVGLESKLESKKETVYEAHLECLTEFVERFTVFISLISDDQHQSLANEELI
FT                   AKFLEFVNLTSSNGDFDLALKFLEILPGDNEDVVTEKQRVLIASNKLPSAATKSQKPRY
FT                   AGGNVLSGTSVAGLGLTNDRTPGGVKMPPAQPMQTVNPSAPFAPSTPFNQQTPLRSRAA
FT                   SFAAPAPELLKSNPYAPASTQATTGSKYAPPPITSPSSAPRGSSVASSVPITHKNAGTY
FT                   APAVAQPSVAGAVPPNPYAPSAGAYGNFSGQPAYSQPLKPVANVIGASAPGANSMSPPL
FT                   APPASNAASGQTPHLNKNANDGWNDLPLNVKEKPTRAKAVSVAPVSVAPSSAAPGPQVN
FT                   FGSIPPPPLSRVTSSANLQTPVPQRVPSKTYTPPNGSASPASVNPYAPPLASAAPAPVV
FT                   PSNPYAPSAVSTGQPVPGNPYAPAAAMPSNPYASPPPNGAPQPHLGKSYGPGSGLNGLS
FT                   APPASQKAPIGPPPKHMKRRTHASNDIDSANAILESVQKRSEAPTPQVGGAPPTSIPKN
FT                   QPLSEVTSSGTTPAPLAAEQGSSSGIPVEQQPIVDFLSSELGRVTPLIPQEYTKQLKDC
FT                   NKRLRILFGHLERQDLLTQPTVDKLHSIVALMKERRYADAMQVHVDIATNHAQEAGNWL
FT                   TGVKRLIGIAEVTSS"
FT   gene            <195794..>197944
FT                   /locus_tag="KLTH0H02156g"
FT                   /old_locus_tag="KLTH-ORF2021"
FT   CDS_pept        195794..197944
FT                   /locus_tag="KLTH0H02156g"
FT                   /old_locus_tag="KLTH-ORF2021"
FT                   /product="KLTH0H02156p"
FT                   /note="similar to uniprot|P10870 Saccharomyces cerevisiae
FT                   YDL194W SNF3 glucose sensor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30111"
FT                   /db_xref="GOA:C5E250"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037792"
FT                   /db_xref="UniProtKB/TrEMBL:C5E250"
FT                   /protein_id="CAR30111.1"
FT                   /translation="MAKGKTLKSMHDHAGELEKRSVLDRNVREFSKKLSSLWFKRRLSD
FT                   KSPQEINMGTGIENEVTNDDGSTGSHLNFNNLESTLFLQPSRPQSSFMSILVGVFVAVG
FT                   GFLYGYDTGLINNITEMDYVKTHFASNKQQFTAKEMSILVSFLSLGTFVGALAAPFISD
FT                   TWGRKSTIIISTFLIFMVGNSLQVAANGTTLLVIGRVFSGVGVGFISAVVPLYQSEAAQ
FT                   KWVRGAIISTYQWAITWGLLVSSAVSQGTHNRQDASSYRIPIGLQFVWSCILGFGMLFL
FT                   PESPRYYVLKDQLDLAAKSLAFLRGVPEDDSGLLEELVEIKANYDYEMSFGSFSYLDCF
FT                   KSSKSRTKQKLRMFTGIAIQAFQQFSGINFIFYYGVNFFSKTGIGGSYLVSFITYAVNV
FT                   GFNIPGLFLVEYMGRRKVLIFGGILMTAANFVIAIVGCVEKSVIADKIVIAFVCLFIAS
FT                   FSATWGGCVWAISAELYPLGVRSKCTAICAASNWLVNFICALITPYLIDTGNHTSSLGT
FT                   KIFFIWGSLNAVGVVIVYVAVYETRGLTLEEIDLLYRLSPNSLASDSWNNRIRKAPGTI
FT                   QQIRNNESRFESEATTVDSHRQNQAPDLGHASQPSASGSSYEDPAPLKRAESPVHNYVD
FT                   LGNGLALTTYNRGPPSLLMDSSDDGESQIGAEGGSFSRDTDENSSSLNDYMIQWMNCQS
FT                   QRSCGSNAEKGSHNSHTQGPRT"
FT   gene            <198169..>199221
FT                   /locus_tag="KLTH0H02178g"
FT                   /old_locus_tag="KLTH-ORF2018"
FT   CDS_pept        198169..199221
FT                   /locus_tag="KLTH0H02178g"
FT                   /old_locus_tag="KLTH-ORF2018"
FT                   /product="KLTH0H02178p"
FT                   /note="similar to uniprot|Q12063 Saccharomyces cerevisiae
FT                   YDL193W NUS1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30112"
FT                   /db_xref="GOA:C5E251"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="InterPro:IPR038887"
FT                   /db_xref="UniProtKB/TrEMBL:C5E251"
FT                   /protein_id="CAR30112.1"
FT                   /translation="MSKIKERVLRAQDDECKTSHRDKQRVSVVTNATRKSGKPGVTDVK
FT                   GAVGSVLLTPPDSEAVRRKLESQKGVLGKSSGKIEFIFYKILLCVLYMLYACARYTQYH
FT                   YNRAKILILNLAYSPSNTPQLIRQDVLKLQKLPKRLAAIVEKKREGDVGGGVSGVLNDG
FT                   SDLVAWTISAGIKHLALYDFDGHLKRNVDEFRKSVFHKLTKYYDPSNVPKFAIRIPQWN
FT                   KVYFNAPGQEADDTTSKKVAIEISLLSNRDGRETIIELTRTMADLCAQNEMQLSDITMK
FT                   LIDSELTQLVGHEPDLLLYFGPNLDLQGFPPWHIRLTEFYWEQDNDQVTYSVFIRGLKK
FT                   YAACKINVGK"
FT   gene            <199831..>200376
FT                   /locus_tag="KLTH0H02200g"
FT                   /old_locus_tag="KLTH-ORF2016"
FT   CDS_pept        199831..200376
FT                   /locus_tag="KLTH0H02200g"
FT                   /old_locus_tag="KLTH-ORF2016"
FT                   /product="KLTH0H02200p"
FT                   /note="highly similar to uniprot|P11076 Saccharomyces
FT                   cerevisiae YDL192W ARF1 ADP-ribosylation factor GTPase of
FT                   the Ras superfamily involved in regulation of coated
FT                   formation vesicles in intracellular trafficking within the
FT                   Golgi functionally interchangeable with Arf2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30113"
FT                   /db_xref="GOA:C5E252"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E252"
FT                   /protein_id="CAR30113.1"
FT                   /translation="MGLYISKLFNSLVGSKEMRILMVGLDGAGKTTVLYKLKLGEVVTT
FT                   IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAR
FT                   EVLQRMLNEDEIRNAALLVFANKQDLPEAMSAAEITEKLGLHSIRQRPWFIQATCATSG
FT                   EGLYEGLEWLSNSLKNQN"
FT   gene            <201281..>201826
FT                   /locus_tag="KLTH0H02222g"
FT                   /old_locus_tag="KLTH-ORF2014"
FT   CDS_pept        201281..201826
FT                   /locus_tag="KLTH0H02222g"
FT                   /old_locus_tag="KLTH-ORF2014"
FT                   /product="KLTH0H02222p"
FT                   /note="highly similar to uniprot|P19146 Saccharomyces
FT                   cerevisiae YDL137W ARF2 ADP-ribosylation factor GTPase of
FT                   the Ras superfamily involved in regulation of coated
FT                   formation vesicles in intracellular trafficking within the
FT                   Golgi functionally interchangeable with Arf1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30114"
FT                   /db_xref="GOA:C5E253"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E253"
FT                   /protein_id="CAR30114.1"
FT                   /translation="MGTSFSKLFSSLFGHKEMRILMVGLDGAGKTTVLYKLKLGEVVTT
FT                   IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAR
FT                   EVLQRMLNEDEIRNAVLLVFANKQDLPEAMSAAEITEKLGLHSIRQRPWFIQATCATSG
FT                   EGLYEGLEWLSNNLKNQS"
FT   gene            <203853..>204632
FT                   /locus_tag="KLTH0H02244g"
FT                   /old_locus_tag="Klth0H.mRNA.311.p"
FT   CDS_pept        join(203853..203855,204273..204632)
FT                   /locus_tag="KLTH0H02244g"
FT                   /old_locus_tag="Klth0H.mRNA.311.p"
FT                   /product="KLTH0H02244p"
FT                   /note="highly similar to uniprot|P39741 Saccharomyces
FT                   cerevisiae YDL191W RPL35A and YDL136W RPL35B, proteins
FT                   component of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30115"
FT                   /db_xref="GOA:C5E254"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:C5E254"
FT                   /protein_id="CAR30115.1"
FT                   /translation="MAGIKAYELRTKSKEQLESQLLDLKKELAALKVQKLSRPSLPKIH
FT                   TVRKDIARVLTIVNENQRNAVKELYKGAKYQPKDMRAKKTRALRRALTKFEASRTTEKQ
FT                   RKKQIAFPQRKFAIKA"
FT   gene            complement(<204726..>207569)
FT                   /locus_tag="KLTH0H02266g"
FT                   /old_locus_tag="KLTH-ORF2003"
FT   CDS_pept        complement(204726..207569)
FT                   /locus_tag="KLTH0H02266g"
FT                   /old_locus_tag="KLTH-ORF2003"
FT                   /product="KLTH0H02266p"
FT                   /note="similar to uniprot|Q06096 Saccharomyces cerevisiae
FT                   YPR105C COG4 component of oligomeric Golgi complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30116"
FT                   /db_xref="GOA:C5E255"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019474"
FT                   /db_xref="UniProtKB/TrEMBL:C5E255"
FT                   /protein_id="CAR30116.1"
FT                   /translation="MASFEDILLVTKNPADPRGYAVLPEEFEEPLDANQVDAILLYQLV
FT                   ENPNLPLQPFVYLKDCFQKVQQQKRLLKKSQQDIEALQEIDRLVVGYGLILFQVEEFSH
FT                   GDGNFLTYMKGIVARVDDYTDFLTQLINRATQEDTLMEFIENFFVTLKKYIDSLGLFNL
FT                   NDSLNFSSVLTLFELFVSFKPVAASFTKISGFFAAYNAKPNDFEKVTLLGPILTLSPLN
FT                   ASVALQNYGDNLERSQQQTNMIHESLQTQHKMVLDRLFYIVDKIIRGSVESRTDVLTYF
FT                   AQIINKNHLRRGDHAQLNKLASNAFVSNIALLLVRFSQPFLDVSYRKIDKIDVNYFNNL
FT                   NLFLDLSSETRMNSDFKEADEFYDKNKKSEDNKPNFISDCFFLTLAYLHYGIGGTLLYD
FT                   EKVSPQIKRMREEVERITRATQSGDMFARFASMQLPALEKNLQTMQSIQQTLQGFFSHK
FT                   SLQLEVFEFISGACTFLVRVIDPNHQYPHKQIKLPLIPDQVGVENVDNADYLREHAPVP
FT                   FKYYPEFVIEGIINYAQYISKYSLNPMFGNPRLHSFVEMATVILRCPELVSNPHLKGKL
FT                   VQVLSIGAMPIRDNTPGFMMGIFENNELVRENLLYALLDFYVIVEKTGSSSQFYDKFNS
FT                   RYSISIILEEIYQFSEYRRQIIWQSQSNADFFVRFVARMLNDLTFLLDEGLSSLAEVHN
FT                   IQRELENRVRGSAPTREENDQELQSKLASAERQAKSSCGLAEKSITLFNIFSKDIPSAF
FT                   CTPEIVDRLAGMLDYNLASLVGPKCRELKVKNPKKYSFDAKSLLRSLCTVYTNLADQPE
FT                   FISAVAKDGRSFNKELFDRSVHILGNKTGLVNDEFCVKLLQFARDAQDQKVAEEEADLE
FT                   MGEAPDEFLDPLMFTLMKDPVILPASRVTIDRSTIKAHLLSDSTDPFNRMPLKLEDVIP
FT                   NEELKHRIEMFRRNKRE"
FT   gene            <207932..>208915
FT                   /locus_tag="KLTH0H02288g"
FT                   /old_locus_tag="KLTH-ORF2002"
FT   CDS_pept        207932..208915
FT                   /locus_tag="KLTH0H02288g"
FT                   /old_locus_tag="KLTH-ORF2002"
FT                   /product="KLTH0H02288p"
FT                   /note="some similarities with uniprot|Q870H2 Saccharomyces
FT                   cerevisiae YDL189W RBS1 Protein of unknown function
FT                   identified as a high copy suppressor of psk1 psk2 mutations
FT                   that confer temperature-sensitivity for galactose
FT                   utilization proposed to bind single-stranded nucleic acids
FT                   via its R3H domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30117"
FT                   /db_xref="GOA:C5E256"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:C5E256"
FT                   /protein_id="CAR30117.1"
FT                   /translation="MTSNNGMAIGKLTPALVAALFERAHDKQFIIQLENSMVEFMGSPA
FT                   EAYQLEPMNSYYRLLAHHVAEYHGLGHSLSRNNDACVVVFKGETFLRDKSIVLLQNLDP
FT                   SCVTNAVDTQRSESKQSASKSMIAQETRQVYNSAGLKPLAAVSEKEGTRTPETPSTPKK
FT                   PIPIEDDSPQPHQFETSRYRFRQQSEKPRRRKNYKGSTNRTAQPVYFPPPPAFPVPYML
FT                   YNPYPMMFVPPERQFSQFAPVAPVGQYPNPNPFIYGHPAHNKVEPYGPNGSSSTFSSMR
FT                   TYKTEDSESLESLSKDASEKQEPRMSRKDSETSVGKISDKMDKLGL"
FT   gene            complement(<209037..>209639)
FT                   /locus_tag="KLTH0H02310g"
FT                   /old_locus_tag="KLTH-ORF2001"
FT   CDS_pept        complement(209037..209639)
FT                   /locus_tag="KLTH0H02310g"
FT                   /old_locus_tag="KLTH-ORF2001"
FT                   /product="KLTH0H02310p"
FT                   /note="highly similar to uniprot|Q12434 Saccharomyces
FT                   cerevisiae YDL135C RDI1 Rho GDP dissociation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02310g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30118"
FT                   /db_xref="GOA:C5E257"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024792"
FT                   /db_xref="UniProtKB/TrEMBL:C5E257"
FT                   /protein_id="CAR30118.1"
FT                   /translation="MSDDTEFKEFQDENPDRYKVSAKKTLAEYQKLDAEDESLAKWKES
FT                   LGLSSDTLPLEFPGDKRKVVIQKIQLLVDTESQPITFDLTNDQTLKELASTRHKIKEKS
FT                   IYKLKITFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTTKKPFYEVELPESE
FT                   APSGFLARGSYSAISKFIDDDKTNHLTLNWGVEIVKK"
FT   gene            <209858..>210418
FT                   /locus_tag="KLTH0H02332g"
FT                   /old_locus_tag="KLTH-ORF1998"
FT   CDS_pept        209858..210418
FT                   /locus_tag="KLTH0H02332g"
FT                   /old_locus_tag="KLTH-ORF1998"
FT                   /product="KLTH0H02332p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02332g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30119"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:C5E258"
FT                   /protein_id="CAR30119.1"
FT                   /translation="MSLPEFNTFKAADTDFQTAVLETLFEKSNSLIKLTLEDEQFMNAV
FT                   GSSYSEFIEKVRERLVQLCESQGQQESEESRRSELSDIIAAHPKLGEPKKGLSVHSQNE
FT                   QRNLGNGDTLEVQQALKHLNEVYEQHYPGLRFVVFVNGRSRPEIIRVMEGRINSGNAWL
FT                   EEAGLACNEMCDIANDRVLKYVQ"
FT   gene            complement(<210576..>211646)
FT                   /locus_tag="KLTH0H02354g"
FT                   /old_locus_tag="KLTH-ORF1997"
FT   CDS_pept        complement(210576..211646)
FT                   /locus_tag="KLTH0H02354g"
FT                   /old_locus_tag="KLTH-ORF1997"
FT                   /product="KLTH0H02354p"
FT                   /note="highly similar to uniprot|P23594 Saccharomyces
FT                   cerevisiae YDL134C PPH21 Catalytic subunit of protein
FT                   phosphatase 2A functionally redundant with Pph22p
FT                   methylated at C terminus forms alternate complexes with
FT                   several regulatory subunits involved in signal transduction
FT                   and regulation of mitosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30120"
FT                   /db_xref="GOA:C5E259"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5E259"
FT                   /protein_id="CAR30120.1"
FT                   /translation="MEIDSDVPMQDATEETLDPTLDEDALSKAQEGPGSSGIADHKASK
FT                   PLQLDSGNIGQLDQWIEHLGKCQVLSEDDVSRLCKMAVDVLQFEENVQPVNVPVTICGD
FT                   VHGQFHDLIELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPKRITILRG
FT                   NHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKVFCLHGGLSPMIE
FT                   TIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDISEQFNHTNDL
FT                   SLIARAHQLVMEGYAWSHQQSVVTIFSAPNYCYRCGNQAAIMEMDENHNRQFLQYDPSM
FT                   RPGEPTVSRKTPDYFL"
FT   gene            <212454..>213176
FT                   /locus_tag="KLTH0H02376g"
FT                   /old_locus_tag="KLTH-ORF1994"
FT   CDS_pept        212454..213176
FT                   /locus_tag="KLTH0H02376g"
FT                   /old_locus_tag="KLTH-ORF1994"
FT                   /product="KLTH0H02376p"
FT                   /note="some similarities with uniprot|P48568 Saccharomyces
FT                   cerevisiae YDL186W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30121"
FT                   /db_xref="UniProtKB/TrEMBL:C5E260"
FT                   /protein_id="CAR30121.1"
FT                   /translation="MSVLERPLSHNSPVFVPSPECTARAYTLPANTTGVRQLVIRKQNG
FT                   RVVAAKSQLIDRMEDALVRWRPPASCHAGSTAALKGKHPYQQELDTDVDLTSVPLHASL
FT                   DSIRHYFDNLGHTISRPCSQRPPKTEQLAGSTQSPASSPASSASGMAVQIRQSVQSAGT
FT                   RGTTPRAMAYDADPDNIEARPASYSFPIPAYYLPHTDACPVGESTRENNEEAHGCWAQW
FT                   TTFWDELCDDLAALCSCN"
FT   gene            <214364..>216220
FT                   /locus_tag="KLTH0H02398g"
FT                   /old_locus_tag="KLTH-ORF1990"
FT   CDS_pept        214364..216220
FT                   /locus_tag="KLTH0H02398g"
FT                   /old_locus_tag="KLTH-ORF1990"
FT                   /product="KLTH0H02398p"
FT                   /note="uniprot|Q8J0L0 VMA1 Putative vacuolar membrane H-
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30122"
FT                   /db_xref="GOA:C5E261"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005725"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:C5E261"
FT                   /protein_id="CAR30122.1"
FT                   /translation="MAGAMENARKEIKRLSLEDHSESEYGSIYSVSGPVIVAENMIGCA
FT                   MYELVKVGHDNLVGEVIRIEADRATIQVYEETAGVTVGDPVLRTGKPLSVELGPGLMET
FT                   IYDGIQRPLKAIKDKAQSIYIPRGIDAPALSRDIKWQFKPSADKKVGDHIAGGDIFGSI
FT                   FENSLLEDHKILLPPRARGTITWIAPAGDYTIDEKVLEVEFDGVKYDYTMYHTWPVRVP
FT                   RPVTEKLSADYPLLTGQRVLDALFPCVQGGTTCIPGAFGCGKTVISQSLSKYSNSDAII
FT                   YVGCGERGNEMAEVLMEFPELFTERNGKKEPIMKRTTLVANTSNMPVAAREASIYTGIT
FT                   LAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQGFPAYLGAKLASFYERAGK
FT                   AVALGSPDRIGSVSIVAAVSPAGGDFSDPVTTSTLGITQVFWGLDKKLAQRKHFPSINT
FT                   SVSYSKYTNVLDKYYDEHYPEFPQLRNRIREILSNAEELEQVVQLVGKSALSDSDKITL
FT                   DVATLIKEDFLQQNGYSTYDAFCPVWKTYDMMKAFISYHEEAQKSIANGANWAKLADAT
FT                   GDVKHAVSSSKFFEPSRGEQEVHGEFEKLFSNIQERFAESTD"
FT   gene            complement(<217847..>218743)
FT                   /locus_tag="KLTH0H02420g"
FT                   /old_locus_tag="KLTH-ORF1985"
FT   CDS_pept        complement(217847..218743)
FT                   /locus_tag="KLTH0H02420g"
FT                   /old_locus_tag="KLTH-ORF1985"
FT                   /product="KLTH0H02420p"
FT                   /note="similar to uniprot|P48569 Saccharomyces cerevisiae
FT                   YDL183C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30123"
FT                   /db_xref="GOA:C5E262"
FT                   /db_xref="InterPro:IPR018786"
FT                   /db_xref="UniProtKB/TrEMBL:C5E262"
FT                   /protein_id="CAR30123.1"
FT                   /translation="MSTAGPSGLGKRLLSQGLPPQRATVQKYVLDPVKLIAIPITNKRI
FT                   FLYHKHSSEILNMNSRIVRYETRITEKARKIWSKLEKSPREINQKLVRMVNSQLDKTPW
FT                   TEDSLNTVPSEGYILKTVMENQESRNLTYQEWFKNVDKLDVRPVCMYYPQSVMSERAVR
FT                   EQLKSLWDHGLNYHKKQMWLSILGLPLTLPVVLVPVVPNVPGFYLLYRAYRNFKAFCGA
FT                   KHLKSLVENKSHKLVFTDLPQFSDILRSETEIPEEHLVLNEKNLERVLDMLQIHELRAP
FT                   LEKAVLQERKRLDGHRK"
FT   gene            <219117..>220556
FT                   /locus_tag="KLTH0H02442g"
FT                   /old_locus_tag="KLTH-ORF1982"
FT   CDS_pept        219117..220556
FT                   /locus_tag="KLTH0H02442g"
FT                   /old_locus_tag="KLTH-ORF1982"
FT                   /product="KLTH0H02442p"
FT                   /note="similar to uniprot|Q12516 Saccharomyces cerevisiae
FT                   YDL133W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30124"
FT                   /db_xref="GOA:C5E263"
FT                   /db_xref="InterPro:IPR037737"
FT                   /db_xref="UniProtKB/TrEMBL:C5E263"
FT                   /protein_id="CAR30124.1"
FT                   /translation="MSSSRPEGETSNGEKKYSHALDAEPSDFGGQNSRVSQGHSSTASG
FT                   SDSRDQDGSRSKFLNSYGLVATTVPPFALDEQLKQQNLRQVQTHSALVAEKELGRYCKD
FT                   PFLVSHNLRWGPFAENVGSNAAYFNKATKPATGSPGFTLYEDDAGPSSSAVSTKEEEDQ
FT                   DINKTAGESSSYEEDKSVSKQTRTEAPHDVFADLNGSWGGSERLNAIFNGPLLDSDKLT
FT                   SHKDRNDWSEYLESVKAFYYTNGPLNQDLEAGLRREGSSNLDDTEENKLHTFLEKQRSD
FT                   FKETRKHWRQLERQKKQKWVPTLRKLLLDSQYLPLSFRMFIVILSAIALGLAIRIFQNS
FT                   KGELEFSGSSVPQQASTIMAICVNSIAVLYLFYIAYDEFSGKPLGLRDPVGKLRLILLD
FT                   LLFIIFSSANLALTFNTLYDKQWVCTEGKYSEDELPKMEYICRKQRALASFLFVVLFMW
FT                   VVTFTVSILRVVEKMSSGSPR"
FT   gene            <220805..>223228
FT                   /locus_tag="KLTH0H02464g"
FT                   /old_locus_tag="KLTH-ORF1981"
FT   CDS_pept        220805..223228
FT                   /locus_tag="KLTH0H02464g"
FT                   /old_locus_tag="KLTH-ORF1981"
FT                   /product="KLTH0H02464p"
FT                   /note="similar to uniprot|Q12018 Saccharomyces cerevisiae
FT                   YDL132W CDC53 Cullin structural protein of SCF complexes
FT                   (which also contain Skp1p Cdc34p and an F-box protein)
FT                   involved in ubiquitination SCF promotes the G1-S transition
FT                   by targeting G1 cyclins and the Cln-CDK inhibitor Sic1p for
FT                   degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30125"
FT                   /db_xref="GOA:C5E264"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5E264"
FT                   /protein_id="CAR30125.1"
FT                   /translation="MSDTLPRADDLEATWNFVEPGIHQILGRDGTASSTLKRVDKVLSP
FT                   AMYMEVYTAIYNYCVNKSSSAGQFNTDSSRQNQSSLLVGGEIYQKLKDCLQNYLSGLQR
FT                   DANESFLQFYVRRWKRFTVGAVFLNHAFDYMNRYWVQKERSDGKRHIFDINTLCLMTWK
FT                   EVMFDKNVDLLVKEVLEQIELQRDGHVILQTDTTVAIRSFVALGIDPQDLKKLNLNVYI
FT                   QHFEKPFLESTRQYYRKLSREYLASHSVTEYIFEAQEKIKDEETKIVLYLDEHTKKLLS
FT                   EALNSVLITDHSEALENEFISLLDSRDENKIATLNSLMQRDILLLPKLAQAYEEYVKKT
FT                   GEQEISRLLAEHRAKLSENAEENAGSKKSAAGPAVPPNEYVKKLIEVYETFIKITRDCF
FT                   QNGSLFTKALDNACRAYINANELAIPPGSPKSVTSKTPEMLAKYSDQLLKRSAKATEGA
FT                   SELSADDIMTIFKFLTDKDAFETHYRRLFARRLIHGTSTSEEDEEMVIQRLQSENSMEY
FT                   TGKITKMLQDIRLSKQLEKEFESAIKIAPDYSRAKYPEFQPFVLAETMWPFSYQDVEFN
FT                   LPQELVPTHRGLEKLYTNKHNGRVLKWLWPLCRGEVVADIGKPGKPPFIFTVTLFQMAI
FT                   LLAFNDRSTFTLEEIQEHTSLSASNIASSIIPFIRWKLIQQQPPGLDALSRMDTQFKLS
FT                   TPYKALKTRINFAAGVKSEAPGSIGGKSGEPSELQKIEKELSTERQIFLEACIVRIMKA
FT                   RRKLPHATLVNECIAQSHQRFNAKVSLIKRAIDNLIAKEYLQRCDDGESYEYLA"
FT   gene            <223641..>224963
FT                   /locus_tag="KLTH0H02486g"
FT                   /old_locus_tag="KLTH-ORF1976"
FT   CDS_pept        223641..224963
FT                   /locus_tag="KLTH0H02486g"
FT                   /old_locus_tag="KLTH-ORF1976"
FT                   /product="KLTH0H02486p"
FT                   /note="highly similar to uniprot|Q12122 Saccharomyces
FT                   cerevisiae YDL131W LYS21 and to uniprot|P48570
FT                   Saccharomyces cerevisiae YDL182W LYS20 homocitrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30126"
FT                   /db_xref="GOA:C5E265"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5E265"
FT                   /protein_id="CAR30126.1"
FT                   /translation="MSNSGFQQVTESTTQVERPNPYGPNPADYLSNVANFQLIDSTLRE
FT                   GEQFANAFFTTEKKIEIAKALDDFGVDYIELTSPVASEQSRSDCEAICKLGLKAKILTH
FT                   IRCHMDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFVKSKGIEI
FT                   RFSSEDSFRSDLVDLLNIYKTVDSIGVNRVGIADTVGCANPRQVYELLRTLKTVVHCDV
FT                   ECHFHNDTGCAIANAYTALEGGARLIDVAVLGIGERNGITPLGGLMARMIVAAPEYVKS
FT                   KYKLHKIRDIENLVAEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPHD
FT                   FGLKRYIHFANRLTGWNAIKSRVDQLNLNMSDEQCKEVTMKIKKLGDIRPLSIDDVDSI
FT                   IKDFHSEITTPQLRNMDAQGSDDLNNLDISAPAAKKAKKSQ"
FT   gene            complement(<225069..>225998)
FT                   /locus_tag="KLTH0H02508g"
FT                   /old_locus_tag="KLTH-ORF1972"
FT   CDS_pept        complement(225069..225998)
FT                   /locus_tag="KLTH0H02508g"
FT                   /old_locus_tag="KLTH-ORF1972"
FT                   /product="KLTH0H02508p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30127"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E266"
FT                   /protein_id="CAR30127.1"
FT                   /translation="MPSAPAPLELASAHDHAVLACRLLRAGSLALSAGLDPHLSLWDLD
FT                   SGQNYTIDSYHHGNAAITALDALGDRCAVTGSSDTRLALCDLETGQLLRGLAGHRRVVN
FT                   QVRALGESRFASVGDDGALKVWDASGAKRPVWQAASEFPLFAVAQDPQNEHLVYASGLE
FT                   PVIRAYDLRRSADHAFSSWPAAHSDAVTSLDVSASGKLCTLAFDHQIHVSDAKLEPTRE
FT                   GSRLLASATLPASANPHKFLQRCKFVRQDRFVAAQGSLFDATSGRQVLDFASQVSARAF
FT                   DVIDMDYDSRSDKLLISTEQGSLYVCQV"
FT   gene            <226577..>226873
FT                   /locus_tag="KLTH0H02530g"
FT                   /old_locus_tag="KLTH-ORF1964"
FT   CDS_pept        226577..226873
FT                   /locus_tag="KLTH0H02530g"
FT                   /old_locus_tag="KLTH-ORF1964"
FT                   /product="KLTH0H02530p"
FT                   /note="some similarities with uniprot|P01097 Saccharomyces
FT                   cerevisiae YDL181W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30128"
FT                   /db_xref="GOA:C5E267"
FT                   /db_xref="InterPro:IPR007648"
FT                   /db_xref="UniProtKB/TrEMBL:C5E267"
FT                   /protein_id="CAR30128.1"
FT                   /translation="MLSQSARASLKKSLKLQLPAMPAMPAVGGRFYSEGSVGSPRGEGA
FT                   DDSFVRRERAQEDYFIRQHEKEQLEKLRQQVKQQQQKIEHLEGRLGDKLKEGQ"
FT   gene            <227237..>227523
FT                   /locus_tag="KLTH0H02552g"
FT                   /old_locus_tag="Klth0H.mRNA.360.p"
FT   CDS_pept        join(227237..227276,227330..227523)
FT                   /locus_tag="KLTH0H02552g"
FT                   /old_locus_tag="Klth0H.mRNA.360.p"
FT                   /product="KLTH0H02552p"
FT                   /note="similar to uniprot|Q3E7A9 Saccharomyces cerevisiae
FT                   YMR194C-B"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30129"
FT                   /db_xref="GOA:C5E268"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="InterPro:IPR027179"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E268"
FT                   /protein_id="CAR30129.1"
FT                   /translation="MTDPCKPQACAIQGCLTKTGFDESKCSHLIDSLYECCSKFYNERG
FT                   ADARTPCCPVPSLLRLKLEQRACGPLDAKRVR"
FT   gene            complement(<227944..>228507)
FT                   /locus_tag="KLTH0H02574g"
FT                   /old_locus_tag="KLTH-ORF1957"
FT   CDS_pept        complement(227944..228507)
FT                   /locus_tag="KLTH0H02574g"
FT                   /old_locus_tag="KLTH-ORF1957"
FT                   /product="KLTH0H02574p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30130"
FT                   /db_xref="UniProtKB/TrEMBL:C5E269"
FT                   /protein_id="CAR30130.1"
FT                   /translation="MLRSTRRYYSTPPTYFGSLGPRLAPATPAAPMAPFHAPREPARKP
FT                   FLELATLFSVLALSFFAVDNYRARLAAELRLEEQALKARQAQELIAKQMNAQRKKRELQ
FT                   ILNERKLVQTRQMKVALHVAMLRKQLLDVGLAPATIEDALQEFERSVRMENSISNVSGT
FT                   RLWVTDESPAKQFVPDVREYEARD"
FT   gene            complement(<228747..>229425)
FT                   /locus_tag="KLTH0H02596g"
FT                   /old_locus_tag="Klth0H.mRNA.5642.m"
FT   CDS_pept        complement(join(228747..229033,229410..229425))
FT                   /locus_tag="KLTH0H02596g"
FT                   /old_locus_tag="Klth0H.mRNA.5642.m"
FT                   /product="KLTH0H02596p"
FT                   /note="highly similar to uniprot|P05745 Saccharomyces
FT                   cerevisiae YMR194W RPL36A and to uniprot|O14455
FT                   Saccharomyces cerevisiae YPL249C-A RPL36B Proteins
FT                   component of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30131"
FT                   /db_xref="GOA:C5E270"
FT                   /db_xref="InterPro:IPR000509"
FT                   /db_xref="InterPro:IPR038097"
FT                   /db_xref="UniProtKB/TrEMBL:C5E270"
FT                   /protein_id="CAR30131.1"
FT                   /translation="MAVKSGIATGLNKGKKVTQMTPAPKISYRKGASSNRTKFVRSLVK
FT                   EVAGLAPYERRLIDLIRNAGEKRARKVAKKRLGTFGRAKAKVEEMNDIITASRRH"
FT   gene            complement(<229993..>230814)
FT                   /locus_tag="KLTH0H02618g"
FT                   /old_locus_tag="KLTH-ORF1951"
FT   CDS_pept        complement(229993..230814)
FT                   /locus_tag="KLTH0H02618g"
FT                   /old_locus_tag="KLTH-ORF1951"
FT                   /product="KLTH0H02618p"
FT                   /note="similar to uniprot|P36525 Saccharomyces cerevisiae
FT                   YMR193W MRPL24 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30132"
FT                   /db_xref="GOA:C5E271"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:C5E271"
FT                   /protein_id="CAR30132.1"
FT                   /translation="MLEHRHGDPRASDTTQAMSVNWPRLQRGFSTIPCLFREWRLVECR
FT                   NVAKKPDYKVGDARPIFVPKARKAFPDYEFGESQIFKQSNKGLYGGSFIQYGNNVAESK
FT                   TKTRRRWLPNVIKKGLWSEALSRNVSIRMTAKVLRTVTKEGGIDNYLTKEKSARIKELG
FT                   PTGWKLRYRVLQRQELRENPPHKDAAVVRGIDGAEHTVYFEEALDGETVRVTCGRRKLL
FT                   QLLYPLEKLEHRADGETLTYKQFLDAYAGTSVRDILAALSSYGFDLKTITV"
FT   gene            complement(<230918..>233359)
FT                   /locus_tag="KLTH0H02640g"
FT                   /old_locus_tag="KLTH-ORF1944"
FT   CDS_pept        complement(230918..233359)
FT                   /locus_tag="KLTH0H02640g"
FT                   /old_locus_tag="KLTH-ORF1944"
FT                   /product="KLTH0H02640p"
FT                   /note="weakly similar to uniprot|Q12344 Saccharomyces
FT                   cerevisiae YPL249C GYP5 GTPase-activating protein (GAP) for
FT                   yeast Rab family members Ypt1p is the preferred in vitro
FT                   substrate but also acts on Sec4p involved in ER to Golgi
FT                   trafficking interacts with the yeast amphiphysins Rvs161p
FT                   and Rvs167p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02640g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30133"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C5E272"
FT                   /protein_id="CAR30133.1"
FT                   /translation="MSDTQSTEVPSLKDVEAFDRNEEESGVTEEMRTEVSDAALMSPAA
FT                   EEAPANASQTESDLKPKITPATSDLTNQASLVESDLTEELQQKAPENADHSPQTLDSEQ
FT                   QDDSDRSSAHSELNFAAYEEDTGEDYNAETTNPSAINDDSGVGDEDQNHDLIHSSPEKL
FT                   DGPDHTVKQVDQETAPPPLLPDGSGARPLPALPPRSLNTSSPPLPPRGSAALPASTLKK
FT                   SQVHPVPPPLSEELKSEKFRKNAALTHAQPSPPSLPPRSGHKRSASADFDLVISRFNDY
FT                   EEEYLSKDGVTQESLQEGTRMLKSSYTAFLETISAEKEPSQDPEEHRELVEIDWPFWTR
FT                   LVNNYAEVAKKDSVKLEQEITGGIPPQIRGIIWQLMANTKSKGVEEIYGALEACESPHE
FT                   KAIQRDILRTNYIPDDKTDSLFNVLKAYSIYDDAVGYTQGMGFITTALILNVESEAEAF
FT                   GLLISLMKGYGLRDLFLPGMPGLHVKLYQFDRLLEENSPSLYYHLARQGVRSSMYASQW
FT                   FLTCFAYRFPLCFVLRIFDIILVEGVDAILKFAVVLMIRNEKTLLALQFDQLLEFLKDG
FT                   LFAYYLKDSVKERRRAKATKGDSGSTVSLLSRAIPKKESSPEITDEDYDIDAFVEDAMK
FT                   EVQITPITLKRYVAEYEEIHLLESQKEAQFEALRIKNKQLHNEVRKLEHDHTILNREHI
FT                   SIANELIENRLAMETLQDENRDLVAEVAHLKTQLKEEVRKRSLPNPDAELPTDLKADLQ
FT                   ETMARNLQVMSENQELQDKIAQLEQEVALLRQSPSHRCEPGAGQKPANLGNWKGLRKVW
FT                   K"
FT   gene            complement(<233610..>234716)
FT                   /locus_tag="KLTH0H02662g"
FT                   /old_locus_tag="KLTH-ORF1942"
FT   CDS_pept        complement(233610..234716)
FT                   /locus_tag="KLTH0H02662g"
FT                   /old_locus_tag="KLTH-ORF1942"
FT                   /product="KLTH0H02662p"
FT                   /note="weakly similar to uniprot|P42933 Saccharomyces
FT                   cerevisiae YMR191W SPG5 Protein required for survival at
FT                   high temperature during stationary phase not required for
FT                   growth on nonfermentable carbon sources"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30134"
FT                   /db_xref="GOA:C5E273"
FT                   /db_xref="InterPro:IPR038816"
FT                   /db_xref="UniProtKB/TrEMBL:C5E273"
FT                   /protein_id="CAR30134.1"
FT                   /translation="MSANSWRQWLKLTKRQLKQIRQTLDDEIQTVLERNIPRPQKSLVR
FT                   IPVSTRPSAGFRNGSRYIHTQTQNVARGTGNAQSVGYARSVQGGARGTRPVLSSFNGMY
FT                   RAPGGVPRGLFSNWNMTTSRFKSGRAYSTSAIKITHDAVQNLSISLRCFYNLWDDFLPA
FT                   NESADCQRVPLQACQAPKRSLGAREVSTVRAMEVFRMIQAHKQDLPPSILEELDAMGCV
FT                   VQFELPHLDMSTMPSMVFASDEALNEWRDKMVACHAKLRHIEESVRKIYEHYGALPLEF
FT                   GESFVRVRFPNITAPEAEILMRDLGLTLGLVLPEPQPSTEPSSSPECFEYCSNFSASYC
FT                   GSSRCASQFAPVLSTPSESSFSVLSSQG"
FT   gene            complement(<235527..>237776)
FT                   /locus_tag="KLTH0H02684g"
FT                   /old_locus_tag="KLTH-ORF1938"
FT   CDS_pept        complement(235527..237776)
FT                   /locus_tag="KLTH0H02684g"
FT                   /old_locus_tag="KLTH-ORF1938"
FT                   /product="KLTH0H02684p"
FT                   /note="weakly similar to uniprot|P04386 Saccharomyces
FT                   cerevisiae YPL248C GAL4 DNA-binding transcription factor
FT                   required for the activation of the GAL genes in response to
FT                   galactose repressed by Gal80p and activated by Gal3p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30135"
FT                   /db_xref="GOA:C5E274"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR005600"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E274"
FT                   /protein_id="CAR30135.1"
FT                   /translation="MFSLDEAEQACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKV
FT                   RSPLTRAHLTEVENRLHQLERLFGTLFPGYDWKDTSKDPSLSKLRHMLKNQKDQYERTL
FT                   PITTDNLHAPSNVPSHPSQRPPLDQLPRDPLFGFEWSEEEDSQFLQNDGMGVLNVNINN
FT                   KGYFGVGSNSVLLRALYVVDSLFTIQRVPSSSEDLSILSSKQIMDEYVEAYFGQFHAAF
FT                   PIVDESYFRLCYAKKIIPTSEKAWQTLLYAVLALGSWSVVGEDSNIDIEYYKSAKYHLC
FT                   SSVFETGSHSLLASLVLLSNYTQKRNKPNTSWNYLGLAASMAISLGLHREMRDSARTDN
FT                   SGLEIRRRMWWVLYGYDCSMAMTFGRPGQLPKLPDVDILLPSNLDKNGVEVDSPTEFSF
FT                   IIETAKLTKNAHKIISSSTGPYANLAETLKCHQKLDDLANKLPDYFSTGFARWHQKLGA
FT                   DNKWFPLNRFRLRWMYYNLTITIFRPLFLGILNGEKVRVDNHDFTKCLNLCHEAAGSTI
FT                   ESVSEFVSHYKLTTLSAWYATFFLVSATIIPAVGLVTEPGSSQAARWKLRVTTARNTFD
FT                   VLKEKNATAEKFIHVIDSVCGYLLDTSEALSSTPKSFSSILHTEKRPGVAGTSSQQPTK
FT                   DKSMTSISDLANILSPRDFTIPTDTVRSGSSETPDIAVQPENQDEDPFAWRSSSAQPLK
FT                   QDATVFPNWNDQSVQTLFNPGTSNMFNTTTMDDIFNYVFNDNELAPSISNSSNQS"
FT   gene            <238367..>242578
FT                   /locus_tag="KLTH0H02706g"
FT                   /old_locus_tag="KLTH-ORF1933"
FT   CDS_pept        238367..242578
FT                   /locus_tag="KLTH0H02706g"
FT                   /old_locus_tag="KLTH-ORF1933"
FT                   /product="KLTH0H02706p"
FT                   /note="similar to uniprot|P35187 Saccharomyces cerevisiae
FT                   YMR190C SGS1 Nucleolar DNA helicase of the RecQ family,
FT                   involved in maintenance of genome integrity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02706g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30136"
FT                   /db_xref="GOA:C5E275"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR022758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5E275"
FT                   /protein_id="CAR30136.1"
FT                   /translation="MQDNLRAQINWLKKEKAYQPKNEFLLRLLSSDVGGKKQKSQNGSE
FT                   AQSQPEMSVIDLTADSRTIKASSDLGSSARVWNASAVFSTIEGNSTQRPGISYSNPAVT
FT                   SRFGRTSESTQHSQKPASLPATSYVESGSLSANHISDQSSDAVRRTPNRQASLAELVPL
FT                   QDRVIELLKKQTGLLMHKCSIIESTSLSEDAKRVKIQSEVNPSLSTLESEIRTAGSLVE
FT                   AMKSEASHPVARTVGNLATTITHTPAISTVSIRTVANNSILRPPPRPQAPVVGVPQDLI
FT                   TVLDDDDDDDDDDVDVDGEEEPRVIAKVHTSAIGTEDRSSNPAKRSLRPHKEINYRIPE
FT                   LEDSLNYNMKPALAQSRQEDNAEEDTTMEAELEDSQFLLTAEEEHDEIHTSDHDFVADG
FT                   LENLLDETDDGEYHEAVSNADGINSSQGGTFPEGPTQGSTFAGELSNIEVIGSSPVRQI
FT                   SEHQEYSRPKTPELDLVGTGYADDPEFDPIVDSIQQTFPNSYAHRSPVTGSITDNNIGR
FT                   NQALQNSIDDTFTHSDSDDFEDFDAERENLTQKSGIRKLDDDLKIISEQKLDVSNARPS
FT                   NIKQEVINVESLLDEGVENFQGGALSLSSIGAAGHGNTGPQFEWTAEVYHRLHNVFKLP
FT                   GFRPNQLEAINASLEGKDVFVLMPTGGGKSLCYQLPAVVRSGKTSGTTVVISPLISLMQ
FT                   DQVEHLLAKNIKACMFSSKGTADQKRQTFNLFINGLLDLIYISPEMISASEQCKKAIGK
FT                   LYRDKKLARIVVDEAHCVSNWGHDFRPDYKELKYFKREYPDIPMIALTATASEQVRLDI
FT                   VHNLQLNNPVFLKQSFNRTNLYYEVLKKSKNVVFDICNAVKTRFKNQTGIIYCHSKNSC
FT                   EQTASLLQRNGINSAYYHAGMEPDERLEVQQAWQANRIRIICATVAFGMGIDKPDVRFV
FT                   YHLTIPRTLEGYYQETGRAGRDGKFSFCIMYYTFRDVRTMQTMIQKDKNLDRENKEKHL
FT                   TKLQQVMQYCENLADCRRQLVLSYFNENFDSALCRRNCDNCKNSINTTTEERDVTHEAL
FT                   NIVKLVSSVQGDKVTLIHCQDIYKGSRNSKIVQAGHDQLEYHGMGKALPKSDIERVFFR
FT                   LVTTQILQEYTVMNGRGFASNYLKVGPKATQLLNGNLKIVMQFAAAGESGSRQSSVPPA
FT                   PATRAASTEFRKGHTNARQTTSSGSLARKTSSLIPDLGGFVYDDNGAGASSAPKKVSRP
FT                   IVLGDKTNLLSHQEQLSVTSAYQELKERAISTARELRFNGFMSVISETALRKAAVVLPS
FT                   TEQQFRQLPGLTSTQAQHYHFFKDLFVRLNVLRKSLPKDSSQRLSQTQTTSPFFHGPGA
FT                   SENNEERERDEEILRQIRDSQAPSRTSAVGKAPGTKPAGSQSKARRGRKSKWHSKSWSK
FT                   R"
FT   gene            complement(<242682..>244436)
FT                   /locus_tag="KLTH0H02728g"
FT                   /old_locus_tag="KLTH-ORF1929"
FT   CDS_pept        complement(242682..244436)
FT                   /locus_tag="KLTH0H02728g"
FT                   /old_locus_tag="KLTH-ORF1929"
FT                   /product="KLTH0H02728p"
FT                   /note="similar to uniprot|P39709 Saccharomyces cerevisiae
FT                   YAL067C SEO1 Putative permease member of the allantoate
FT                   transporter subfamily of the major facilitator superfamily
FT                   mutation confers resistance to ethionine sulfoxide"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30137"
FT                   /db_xref="GOA:C5E276"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E276"
FT                   /protein_id="CAR30137.1"
FT                   /translation="MEVVKTSLTNFSKEWVVEPYARLKWGFIPVRRIVDENEVESEEEH
FT                   SEQVVEEAFSDKQVSDDRKTELEVEQKSSVSNSGGAGEMEYRDEANRKWWSFFNEQEYR
FT                   MPQKRANSAKWWQWFGSDVPAQEKKLLLKLDILLAFYSCMAYWVKYLDTANLNNAYVSG
FT                   LKEELNFKGNELVETQAMYTVGNIVFQLPFIFFLDKVPLNYVLPALDLCWSILTIGASQ
FT                   VDSVPHLKAIRFFIGVFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYLGQYAGILSASGI
FT                   QSAIYAAMDGKHGLSGWRWNFIVDGLISVVVGLIGFYSLPGDPHNCYSIFLTDDEIRLA
FT                   RKRLRENNTDKSDFSSKVLDKAVWKRIFTNWRIYVLTLWNIFCWNNNNGTSGAYLLWVK
FT                   SLKKYSVAKVNQLGMITPALGMVYLFGTGVFADKLHSRWGAIIVTQIFNFIGNVILAVW
FT                   AVPESAKWFAFMLQYFGWAMAPVLYSWQNDICRRDSQARAITLVVMNMLAQTTTAFMSV
FT                   LVWKTTEAPRYLKGYTWTAVCAFCLSAWTILVLWLYKRDEKQHAEENGIIIYNSKTGEN
FT                   YPPEKQNA"
FT   gene            complement(<245136..>248195)
FT                   /locus_tag="KLTH0H02750g"
FT                   /old_locus_tag="KLTH-ORF1923"
FT   CDS_pept        complement(245136..248195)
FT                   /locus_tag="KLTH0H02750g"
FT                   /old_locus_tag="KLTH-ORF1923"
FT                   /product="KLTH0H02750p"
FT                   /note="highly similar to uniprot|P49095 Saccharomyces
FT                   cerevisiae YMR189W GCV2 P subunit of the mitochondrial
FT                   glycine decarboxylase complex required for the catabolism
FT                   of glycine to 5 10-methylene-THF expression is regulated by
FT                   levels of levels of 5 10-methylene-THF in the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30138"
FT                   /db_xref="GOA:C5E277"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:C5E277"
FT                   /protein_id="CAR30138.1"
FT                   /translation="MLRSRLLTSTKFIARSLHSGRPSLYAASVANVSSNQYAKIYKPAA
FT                   RSLEPLDTFQRRHLGPNPDNVQDMLKTMGYEDLDKFIETLVPPQVLERRPLQLEAPQKG
FT                   FSEQEMLQHLQEIANKNKFQARNFIGKGYYGTVLPPVIQRNLLECPEWYTSYTPYQPEI
FT                   SQGRLESLLNFQTVVSDLTGLPVANASLLDEGTAAGEAMLLSFNTAKRKKSKFIVDKRL
FT                   HPQTKSVLKTRATPFNIELVEVDPLEVEANKTILADKAVFGGLIQYPATDGTIIPGEIV
FT                   KSIAESLHANKALLSVASDLMALTLLKPPSEFGADIALGSSQRFGVPFGYGGPHAAFFA
FT                   VTEKLNRKIPGRIVGVSKDRLGSPALRLALQTREQHIKRDKATSNICTAQALLANIAAN
FT                   YCVYHGPQGLKDIAGRIYGFTTVLANKISAETPHTVVNNTWFDTLTIKLAEGTSSERLL
FT                   KAAYEKYSINLFGVDENTVSVSLDETVTRKDLLNLLQVFGASEELPELLPEFPEELSRT
FT                   DSILSNEVFNQHHSETAMLRYLHRLQSRDLSLANSMIPLGSCTMKLNSTVEMMPVTWPQ
FT                   FANMHPFQPVEQAEGYLELIKSLEADLADITGFDNVSLQPNSGASGEYAGLRVIKSYLE
FT                   AQGQSHRNVCLIPISAHGTNPASAAMCGMKVVPVNCLSDGALDLQDLEAKAEKHKDDLA
FT                   AMMITYPSTYGLFGPGIRAAIDAVHKHGGQVYLDGANMNAQVGLTSPGDLGADVCHLNL
FT                   HKTFAIPHGGGGPGVGPICVKSHLGPFLPGHDLVNIATGAPSDLRISAVASAPYGSASI
FT                   LPISYAYIKMMGSTGLPFSSVVAILNANYMMSRLKPHYSILFAGDNSTTKHCGHEFIVD
FT                   LREFKAAGVEAIDVAKRLQDYGFHAPTLAFPVPGTLMVEPTESENLQELDRFVDALIAI
FT                   RREIDLYAAGDPKGAVLKNAPHSLTDLVCSTDWDARGYSREFAAFPLPFLKHNKFWPPV
FT                   ARLDDTYGDLNLICTCPSVEDVANDNAEHD"
FT   gene            complement(<248747..>250009)
FT                   /locus_tag="KLTH0H02772g"
FT                   /old_locus_tag="KLTH-ORF1917"
FT   CDS_pept        complement(248747..250009)
FT                   /locus_tag="KLTH0H02772g"
FT                   /old_locus_tag="KLTH-ORF1917"
FT                   /product="KLTH0H02772p"
FT                   /note="similar to uniprot|Q12523 Saccharomyces cerevisiae
FT                   YPL247C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30139"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E278"
FT                   /protein_id="CAR30139.1"
FT                   /translation="MDTYKAGKRSSISFGSYQRPVVSFNQNELPYYAPRQLYSAQQSAQ
FT                   QPDVVYPCRYEAHFPLYAMDWSNEDYVAVGSYKEDTFNKLQILHSSDLVSWEKAGEENC
FT                   VFPISRVQWCPNGNSQQLATCSDSLRLWDYSDFVLQERLNLSFCRYNKSGGQGTVAALG
FT                   QLPPVSSFHWNAVDPNLIISSSIDTTCTVWDLQATNYVKTQLIAHDSEVFDVKFLTQST
FT                   QLFASCGGDGSVRVFDLRSLAHSTIIYEPSSQPTAGSSGDSSAASGGSGSGSNSASSGS
FT                   NALLRLEPSPFDPNVVATFAHDSNSVLILDMRYPGAAILTLEGHVGAVNQIQWHPSRHN
FT                   VLLTCGDDCQALLWDLNTHLSTPASNTVSSKWNSSKVARCIDTPQEAYSDANYEINNIV
FT                   WRPQGNWFGCNLGRHFQSVRV"
FT   gene            <250363..>251052
FT                   /locus_tag="KLTH0H02794g"
FT                   /old_locus_tag="KLTH-ORF1912"
FT   CDS_pept        250363..251052
FT                   /locus_tag="KLTH0H02794g"
FT                   /old_locus_tag="KLTH-ORF1912"
FT                   /product="KLTH0H02794p"
FT                   /note="similar to uniprot|Q03246 Saccharomyces cerevisiae
FT                   YMR188C MRPS17 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02794g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30140"
FT                   /db_xref="GOA:C5E279"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5E279"
FT                   /protein_id="CAR30140.1"
FT                   /translation="MARQNFVGLVVSQGKMQKTVKVRVETKVFNKRINKELFHRKDYLV
FT                   HDEQGVSREGDLVRIEATRPLSRRKFFSVAEILKNKGQQFALFESQAKTQVMQEEAQKT
FT                   RDFLDRRRAHEADESVLLADVRTIQQALAQGQDAEELSEIKARYGIEHFTPDTLKQLLQ
FT                   LDVLALEQSVVAQKSKIDTVQARVSELLQNEQDGDLLLRQYGVEDPQMLKSNIKKNLLR
FT                   KYVMQEL"
FT   gene            complement(<251152..>252086)
FT                   /locus_tag="KLTH0H02816g"
FT                   /old_locus_tag="KLTH.mRNA.272AT.m"
FT   CDS_pept        complement(join(251152..251795,251876..252086))
FT                   /locus_tag="KLTH0H02816g"
FT                   /old_locus_tag="KLTH.mRNA.272AT.m"
FT                   /product="KLTH0H02816p"
FT                   /note="similar to uniprot|Q12270 Saccharomyces cerevisiae
FT                   YPL246C RBD2 Possible rhomboid protease, has similarity to
FT                   eukaryotic rhomboid proteases including Pcp1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02816g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30141"
FT                   /db_xref="GOA:C5E280"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C5E280"
FT                   /protein_id="CAR30141.1"
FT                   /translation="MNFRKFIIDKFTKAAMSTMNSLNLSLPDGKPPAALTTGLVIFMSL
FT                   IYLLSLVVDINGHISLKPNALFKLDLNRLSLYPLGHLSLTHLVLNSLSLFGPLTMFERS
FT                   HGTVHTGVVLNLLAVFTAIVYCLMGSLFFSKTEVLGSSGWCFSLFAYFSFKEATIRPQQ
FT                   RIFHSFSAPTKYMPVLILVLVTIFFPGSSFWGHFIGMGMGYVLAWKENFVGKLVPPSSL
FT                   IQKIESKLDSAIAMIPLGVKFYKEEAANREESYKSLFGDESVLPLHNQTSTNFQGEGRP
FT                   LGN"
FT   gene            <253022..>254389
FT                   /locus_tag="KLTH0H02838g"
FT                   /old_locus_tag="KLTH-ORF1908"
FT   CDS_pept        253022..254389
FT                   /locus_tag="KLTH0H02838g"
FT                   /old_locus_tag="KLTH-ORF1908"
FT                   /product="KLTH0H02838p"
FT                   /note="similar to uniprot|Q12179 Saccharomyces cerevisiae
FT                   YPL245W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30142"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E281"
FT                   /protein_id="CAR30142.1"
FT                   /translation="MNLKGCLRRTVFDEALANMTRTYKKPKVNDNRTQLEHDAIDKLSH
FT                   VKLSSEQAQLKTEVLQFVRDQLKRWESSKDGPAMLVIQGDAGTGKSVVLNSLFNELQRL
FT                   ACPSDAARDELTGTKNYLVVNHPEMLKLYHRISKNFPYIAKSSLERPTSLINKLEKSKS
FT                   IADVIVVDEAHLLSTSKDAFKRFYGENHLQSLMALGKVLVVVYDDKQSLRMGSYWEEST
FT                   NDGSSLAHFYEQLPEGHKQWRYLKQQFRVVAEPDVLEWIEQLSTKGKILPFPKSTTNGT
FT                   STFDLKIWEDCGAMYSKLKELNEEYGQCRMLATYDFPYRLDGKDYFVTCGDNFKLRWDR
FT                   YMPKSILPWSERPSSIDEVGSVYTVQGFDLNYAGVILGRSVGYDASNDCIKLMPEFYDD
FT                   HAGFTKKKNIKNADQVKLKIIMNSINVLMTRGVKGLYLYAYDPELRQRLLRCSGSA"
FT   gene            complement(<254461..>255453)
FT                   /locus_tag="KLTH0H02860g"
FT                   /old_locus_tag="KLTH-ORF1907"
FT   CDS_pept        complement(254461..255453)
FT                   /locus_tag="KLTH0H02860g"
FT                   /old_locus_tag="KLTH-ORF1907"
FT                   /product="KLTH0H02860p"
FT                   /note="similar to uniprot|Q12520 Saccharomyces cerevisiae
FT                   YPL244C HUT1 Protein with a role in UDP- galactose
FT                   transport to the Golgi lumen"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30143"
FT                   /db_xref="GOA:C5E282"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:C5E282"
FT                   /protein_id="CAR30143.1"
FT                   /translation="MGSQILLAVCVLGIYATFLTWSLVYEPLTTKVWPNSAEKFHVPCV
FT                   VSLVQASVAAFTGYAYLRREKTGYRTKEFMKDNYKDLLLISFTQSTSSPLATYSLQYVD
FT                   FLTYMLAKSCKLIPILAVHLLLYHTKITNNKKAVAIAVTFGVTLFNLGSAKRSSSTRGQ
FT                   NVSYVNGFAPLVLSLLLDGFTNATQDTLLKRNRTSNKKPITGGHLMLGLNMCIVFWNFF
FT                   YLLLIDPEQALKAKNMITEDPEIAYYLLTYAACGALGQICIFYTLQEYGSLVLVMVTVT
FT                   RKMFSMILSILVYGHHVTRMQWLGISIVFGGITAEALLKRRGASKLKTQ"
FT   gene            <255761..>257518
FT                   /locus_tag="KLTH0H02882g"
FT                   /old_locus_tag="KLTH-ORF1904"
FT   CDS_pept        255761..257518
FT                   /locus_tag="KLTH0H02882g"
FT                   /old_locus_tag="KLTH-ORF1904"
FT                   /product="KLTH0H02882p"
FT                   /note="similar to uniprot|P38687 Saccharomyces cerevisiae
FT                   YPL243W SRP68 Component of the signal recognition particle
FT                   (SRP) ribonucleoprotein (RNP) complex that functions in
FT                   protein targeting to the endoplasmic reticulum (ER)
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30144"
FT                   /db_xref="GOA:C5E283"
FT                   /db_xref="InterPro:IPR026258"
FT                   /db_xref="InterPro:IPR034652"
FT                   /db_xref="InterPro:IPR038253"
FT                   /db_xref="UniProtKB/TrEMBL:C5E283"
FT                   /protein_id="CAR30144.1"
FT                   /translation="MSYYSPLGATFGVRIDRFLETAEDFDKYHQKLNRKLQKLRHHCRL
FT                   TTKDTKRYSTKEKYSKITSDDYDKNKLFGTLMLLHAERDLALVESLKLKARLRGAMKKS
FT                   EKKVVMTRLRKACKTSEQLTVLTQNEGDDFTRAEYAIYHKLCIVSYFSMCKPSKTRYTN
FT                   KIAKELSLAIASLHYLQSKEKVSDEVASSIISQFEYLLRQHADAEVFTTSEVRNFIAKQ
FT                   VRQSSDDVLVQLITRSGYEAPIEDSVMGSEKSNLKEVQWRRFSAKVRDSKVAELISEAT
FT                   QIEPTDLAQFSNKLAKWQEAADAHSVFIAQKERDDEDEDVGEDDQILLTYIKYNSHFTT
FT                   IQRDDIVFQKLWAQWSKSANKSKNLKLTKFKEIERIVHNLATYLQEVMDLPGVYSDDAL
FT                   MANLKLATTYYQLHLTAGCLASFYQSKQKYLEALALYIDGHKTLEVAAGEAVLQEPLPG
FT                   NILTPEKVAALEDFIKVSWRGVISLAEYEKIASPGGKPSLEPSLIEKLGNPIVPRDVSL
FT                   TNLFPTRPIVRPVGSKPTLFDLAFNYIGSDSQTPQNEPLIPEESRSVPKSNDAQEAPKK
FT                   KGLFGLFGL"
FT   gene            <257821..>259587
FT                   /locus_tag="KLTH0H02904g"
FT                   /old_locus_tag="KLTH-ORF1901"
FT   CDS_pept        257821..259587
FT                   /locus_tag="KLTH0H02904g"
FT                   /old_locus_tag="KLTH-ORF1901"
FT                   /product="KLTH0H02904p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30145"
FT                   /db_xref="GOA:C5E284"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C5E284"
FT                   /protein_id="CAR30145.1"
FT                   /translation="MAEEQNKCWICLCSGDEYPPMGNSKDAHDWVHPCQCSLTAHRKCL
FT                   LEWVSRTNLDYRNEALNEFNGRRTNIGFESLNIADTYSSLHGRAQFHPFAWLRARSSFT
FT                   NNSSSRAPFDPGDISRIFAAHAEEAVIRNVTQAMAAGARESQPMASVPSSSRKLVINTV
FT                   CPQCHAPILLKTSRGVTVSLSSSVSHLLDWSAKTLIQVTAIGTLGSSILFSFGGILASW
FT                   GLRIMTTVAPESTLLKLLDLNSASTLSQAFQKNQIGFKQILLLGFAPLYLISFRCGNAF
FT                   LGWLKWFYPLAFLRPEEKLQSSVKRFLILQYPLAMLNDFFRMCVYNPVYFRWVHRVKPY
FT                   FIGDRMTVEQLKIYEAEQEYLETRFDALSRGNQPRSLLTKFKSFFRSASPEPMIQSISA
FT                   RRLVMSTRYDYSQALIETSIWEKIASTLLWPLAGKLISDTVLSKSKWFKRFVAQETATP
FT                   DDGLYLSNLIGCCAAVLLKDLVHLFVTWRRVKQLESMEVMSYMTPEWEYAINKKIGQVL
FT                   NDLSSLREDEESYVILEEHANNMLTKPYHDQWTNVGSNIPTILGKVGYFRFLVIKMSIE
FT                   RSLAYTKKAEHL"
FT   gene            complement(<259800..>264359)
FT                   /locus_tag="KLTH0H02926g"
FT                   /old_locus_tag="KLTH-ORF1900"
FT   CDS_pept        complement(259800..264359)
FT                   /locus_tag="KLTH0H02926g"
FT                   /old_locus_tag="KLTH-ORF1900"
FT                   /product="KLTH0H02926p"
FT                   /note="similar to uniprot|Q12280 Saccharomyces cerevisiae
FT                   YPL242C IQG1 Essential protein required for determination
FT                   of budding pattern promotes localization of axial markers
FT                   Bud4p and Cdc12p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30146"
FT                   /db_xref="GOA:C5E285"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:C5E285"
FT                   /protein_id="CAR30146.1"
FT                   /translation="MTSVNGSPSRGKNPFIERYMASLGEGTEAASKSVSPTKHYPPVGS
FT                   PARSKVVDKENVVDRKSKKSSLLRAAAESPLKPIPPSKQNSGTLAHSFNPKGTETPIKK
FT                   STAATIVSTTFDVTSLSKKDAKYYEFLCRVKEAKEWIEAIIEEKLPSELDLATGNSLRD
FT                   GVYLAKLTQKIEPGLARKIVPSGNTLQFTHTQNINSFFRLVESVGVPDLFRFELTDLYE
FT                   KKNIPQVFETLHALANVINSKWPGKAPEIQNLSGLCSFSNDDLKTCQRRLPMIHNFRSF
FT                   KSTKPSTASGTSELPSGLLAAPTISSVEDTPVKIPKLSVPSEEPKTPEKQCEISKTPSP
FT                   ASHKSEQQDHKTPSLANTLTDTAPLLKFDMRSSPAKSLSYYSPRIYRHLSYRTASPDIY
FT                   SSRLSTDPYDPDYYNTLKYTTPEYSPIRRKRMTELEFLDSVSSLQAICRGVNTRFGLTL
FT                   MQRKVDMVVKNLTLLQARARAGLVRSPFKQKLQSEASPGSKSSIGCLQATIRANQVREK
FT                   IFRLRVRLLRVEEEVTSIQSLARAAIVFRRAKATLERHSMITEPLIELQAYAKGLRQRD
FT                   ILRQTKESLSSHLPQIVFLQGLLRSRHLRKHRKLIYFSLNEQLNTIHTLQALARGTTKR
FT                   RAMQRLDNELELHSGSISKVTALLKGSFKRCSIKSLATAVRDSKDPVVSLQALSKGVLA
FT                   RFALELVADVVEANNLMEFQSLAKGSIIRRANRRLDAYYKGKLPEVVKVQSFIRSHQLR
FT                   VAYIEFMSSANPSLWAVRKFVHLLNKIYTSHKSQNKLEWLKSQIDQANKSRDKLQGNLN
FT                   LLQRKSEILEDYNIFVGNLNGKASVLQNSVSSSFPGYEKLIYLLQADPFYWKTVARLDQ
FT                   SFASKYLVKTFSSANGIMTQRENVFFVKLVADLMITDIENFNNVQDFLSAKPQGFWQDL
FT                   LVSYIHRQIPDLMKELFQPVLDFVSSDQVDFESIPAVIYRKIHPHGADLSSSQSIEDDT
FT                   TKRVFVQNLTSLWNAVEIVSDALTRNVDRISEDVKFLCTAAYKAVADRSPYESDALLAI
FT                   SKILIEVIVASFLKEPAKFGSRKVSIQAEKKISVLLDVLMTVYSFTEFQGYLTPLNQYA
FT                   DQIRTDLALSLKSMLTSPSFENFCDKLIYGDMCQETRASLSISKQYLVDIGDKLKSTLS
FT                   SFPHDDPIVQLYKDMSKSQERQALRASTNNIVDLRLNPSAYQLSSSDDRLMSVYNEIKR
FT                   GLVYMMQVEDVETNLYDLMTSSILMSDEPIFQELVHRTEAIKSDPLLKNLESLSYFNLK
FT                   QHVLERAYELKQMDSLTIEDGLQSILNDIANTIKSREYVAESTKNEAQTAQHTLKRIQD
FT                   STFQLQEAIRSLETAQKRALKSKQSSNTYAPSKKHGLGNKLKDVYKKVNHKSYGEKNCL
FT                   SLEWTTRHLHEIGVLNEVAGENLGKVALSFFGSNGPKFPDILFKISTSDGEVYAVEMND
FT                   ERKGDKTKRSGTDSFAFSKLVDTLAKDKAAKLELFSKKVEFNVPNLLNLVATSFLGRQ"
FT   gene            complement(<264580..>265505)
FT                   /locus_tag="KLTH0H02948g"
FT                   /old_locus_tag="Klth0H.mRNA.5607.m"
FT   CDS_pept        complement(join(264580..265364,265424..265505))
FT                   /locus_tag="KLTH0H02948g"
FT                   /old_locus_tag="Klth0H.mRNA.5607.m"
FT                   /product="KLTH0H02948p"
FT                   /note="weakly similar to uniprot|P46670 Saccharomyces
FT                   cerevisiae YPL241C CIN2 Tubulin folding factor C (putative)
FT                   involved in beta-tubulin (Tub2p) folding isolated as mutant
FT                   with increased chromosome loss and sensitivity to benomyl"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30147"
FT                   /db_xref="UniProtKB/TrEMBL:C5E286"
FT                   /protein_id="CAR30147.1"
FT                   /translation="MERLRPIDTFGWLNGPEKLSALQGACEELERELGACKNTNALKED
FT                   ISLFSSALNASSDQLPPYALEKFAKRLQALLKDLEARNRKGSLTRFKFRRKPTAPPTIG
FT                   TTPTKTPLSNRAKLSDSSGPTRDQTLVVTHAAASYENLVHCNISYNARDRQNDLNSLQS
FT                   GSSALSLRSLDSCIVKLLGVPFNRGSVYIENAIDSLVLIKIQSGADIQVRLFGLRNCKL
FT                   YIIQEGMRRQAVILENCQDCCFHTAMKEGADIQDFSNISKCLTDGGEHFHFEAFDTDDS
FT                   SIAALSN"
FT   gene            complement(<265781..>267895)
FT                   /locus_tag="KLTH0H02970g"
FT                   /old_locus_tag="KLTH-ORF1897"
FT   CDS_pept        complement(265781..267895)
FT                   /locus_tag="KLTH0H02970g"
FT                   /old_locus_tag="KLTH-ORF1897"
FT                   /product="KLTH0H02970p"
FT                   /note="highly similar to uniprot|P15108 Saccharomyces
FT                   cerevisiae YMR186W HSC82 Cytoplasmic chaperone of the Hsp90
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30148"
FT                   /db_xref="GOA:C5E287"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:C5E287"
FT                   /protein_id="CAR30148.1"
FT                   /translation="MSNGETYEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDK
FT                   IRYQALSDPKQLETEPELFIRITPRPEEKVLEIRDSGIGMTKADLINNLGTIAKSGTKA
FT                   FMEALSAGADVSMIGQFGVGFYSLFLVADKVQVISKHNDDDQYIWESNAGGSFTVTLDE
FT                   QNERLGRGSVLRLFLKDDQLEYLEEKRIKEVVKRHSEFVAYPIQLVVTKEIEKDVPVAE
FT                   EEKTEEKSEDDKKPKLEEVDEDEEGEKKSDTKKVKETVKELEELNKTKPLWTRNPSEVT
FT                   QEEYNAFYKSISNDWEDPLAVKHFSVEGQLEFRAILFVPKRAPMDLFESKKKKNNIKLY
FT                   VRRVFITDEAEELIPEWLSFVRGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIET
FT                   FNEIAEDSEQFDKFYSAFSKNLKLGIHEDTQNRTALAKLLRYNSTKSVDEMTSLTDYIT
FT                   RMPEHQKNIYFITGESLKAVEKSPFLDALKAKNFEVLFLVDPIDEYAFTQLKEFEGKPL
FT                   VDITKDFELEETEEEKAEREKEAKEFEKLAEALKEVLGERVEKVVVSHKLVDAPAAIRT
FT                   GQFGWSANMERIMKAQALRDSSMSSYMSSKKIFEISPKSPIIKELKKRVEDNGAQDRTV
FT                   KDLTNLLYETALLTSGFTLEEPASFATRINRLISLGLNIDEDEEEAAPEASTSAPVEEV
FT                   PAETEMEEVD"
FT   gene            complement(<268190..>271054)
FT                   /locus_tag="KLTH0H02992g"
FT                   /old_locus_tag="KLTH-ORF1894"
FT   CDS_pept        complement(268190..271054)
FT                   /locus_tag="KLTH0H02992g"
FT                   /old_locus_tag="KLTH-ORF1894"
FT                   /product="KLTH0H02992p"
FT                   /note="similar to uniprot|Q12751 Saccharomyces cerevisiae
FT                   YMR185W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30149"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019414"
FT                   /db_xref="InterPro:IPR019451"
FT                   /db_xref="InterPro:IPR039600"
FT                   /db_xref="UniProtKB/TrEMBL:C5E288"
FT                   /protein_id="CAR30149.1"
FT                   /translation="MSENPKTKSIESVLSKRPEFTNDTPLDRFFESLGEYFSRIKDDSG
FT                   SPLYEELGCASNAEFVAFLLGQLEVLKSILKENSSGKATNTLVPISLHDMKYFDLLVNL
FT                   IVVHGICANLPPGIGIPLDQRRIENFRQVDKRFEIHSRHTVSFDTLARVSDVLYGVLTF
FT                   APLKENTIGSLLLKGTGFADLITALIVLYHEVQSSRNKVSSMFERIENLQETYQLFSVY
FT                   TLLVHTTSKAEYRQFVLTKLSTLPIRRQNGVISLVDFVVGVREDEEIDVTKFKRVAEIL
FT                   VSKPKNMTSVTYFTELFSQIYEGLALINKPILVSCLNNVVTEFYFKNKRIVYDFLFKKI
FT                   AAVLYNTSLQEFSTKTLNDTMNVLISLSKNPSIEVTQELSTYGGEKFYLTLWIYCLFLK
FT                   KHQKLQPNDGSQQPSVAYYNVVLGMLKTYIIINSDYQALDDIVLNLVNFDHETWGYSID
FT                   LETQLPYVRLIGEKNIGDELTSIGSVNTDQKIKRVQEVFLDIDCAVLLFVELLKLLNEP
FT                   EVVKEIFLSVMNRWVVSTNKANKDNSQLPGDVQNSLLILVDLKLLEKMDESFKSDIIKK
FT                   PRDVLKLINDLLEFPSPDEEERDDQPDSDDEDEDGEEEADEEEAFQIEQAPSPNTYVTL
FT                   LKLLSAIIDTTPRKELHKSSDILESISKTLHGHGDDAQAQSIMGRIRDLQENNAGAGQP
FT                   LGDFSELDADNEFLQKAMANVNDALVPVRAHGLYELRQLIERRSPVIDLNYVLEVHARQ
FT                   LRDKEPFVYLNAIKGLTSLCEIEPERTLNYLLNLFRNRGSKNSLDNTLKVGEVLLNYIT
FT                   LQNELFGGESAGTLVAICLEKIQQHENLDNRLRMSAMSILGICLQTNPRGVRAQIPDIL
FT                   DCAFNILKLENGTQSSSSNLVRRSAIHLLHSLVSSSDLTLFPSQYGGSRLVSLLNYVKE
FT                   KDDDYLVCEQASALLTVVKVLQVS"
FT   gene            <271566..>272159
FT                   /locus_tag="KLTH0H03014g"
FT                   /old_locus_tag="KLTH-ORF1890"
FT   CDS_pept        271566..272159
FT                   /locus_tag="KLTH0H03014g"
FT                   /old_locus_tag="KLTH-ORF1890"
FT                   /product="KLTH0H03014p"
FT                   /note="similar to uniprot|P46683 Saccharomyces cerevisiae
FT                   YPL239W YAR1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03014g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30150"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C5E289"
FT                   /protein_id="CAR30150.1"
FT                   /translation="MSLHSDPLDQEDQDAIILDARCGDLESLKDIFTNLVDPKLIVTCR
FT                   DAVTQSTPLHMAAANGHKEVMQYLASLVTDGAELKKWVNSQNETGNTALHWASLNGSLE
FT                   CVKFLCEELGADPFIRNNFDHDAIFEAERGNKEEVENFYPQKYDVEPENDETAQAESVE
FT                   IKEGTEIEQVTKEATEALRLETDKLSLSEDRGQS"
FT   gene            <272447..>273298
FT                   /locus_tag="KLTH0H03036g"
FT                   /old_locus_tag="KLTH-ORF1886"
FT   CDS_pept        272447..273298
FT                   /locus_tag="KLTH0H03036g"
FT                   /old_locus_tag="KLTH-ORF1886"
FT                   /product="KLTH0H03036p"
FT                   /note="similar to uniprot|P09064 Saccharomyces cerevisiae
FT                   YPL237W SUI3 Beta subunit of the translation initiation
FT                   factor eIF2 involved in the identification of the start
FT                   codon"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03036g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30151"
FT                   /db_xref="GOA:C5E290"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:C5E290"
FT                   /protein_id="CAR30151.1"
FT                   /translation="MSDLANELGFDPNLKKKKKSKKVAPEDVETTVEGSNGDDLFAGLK
FT                   KKKKKSKEAKGTNDIDSVVDEVGEALGELKLKKKKKKSKEPSFDDFEKELEKAGVAPAT
FT                   QDNSRESSLVPGEDSAIQQNVGLPYTDLLSRFFQTLRTNNPELAGDRSGPKFRIPPPVC
FT                   QRDGKKTIFCNIQEISEKLQRNPEHLIQYLFAELGTSGSVDGQRRLVMKGKFMPKQMEN
FT                   VLRRYILEYVTCKTCKSINTDLRKEQSNRLFFLVCKSCGSTRSVSSIKTGFQAIVGKRR
FT                   RM"
FT   gene            complement(<273404..>273898)
FT                   /locus_tag="KLTH0H03058g"
FT                   /old_locus_tag="KLTH-ORF1882"
FT   CDS_pept        complement(273404..273898)
FT                   /locus_tag="KLTH0H03058g"
FT                   /old_locus_tag="KLTH-ORF1882"
FT                   /product="KLTH0H03058p"
FT                   /note="weakly similar to uniprot|Q03233 Saccharomyces
FT                   cerevisiae YMR184W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30152"
FT                   /db_xref="UniProtKB/TrEMBL:C5E291"
FT                   /protein_id="CAR30152.1"
FT                   /translation="MLNRTQSFQNCRETDVPGYNDCPNFIYPSKGASGARKARFSVEDT
FT                   CGNTKPAVAPPPPVRRVKSQQETATPLKGKSELLEELDRLFARNSNLPPAEFQYHKNKV
FT                   LTNIDQSLSHDHGCQVMSRAMTCIGEKEQLKKVIMEWMMSDTSTSKWCPSFLKIAGNVA
FT                   L"
FT   gene            complement(<274038..>275078)
FT                   /locus_tag="KLTH0H03080g"
FT                   /old_locus_tag="KLTH-ORF1881"
FT   CDS_pept        complement(274038..275078)
FT                   /locus_tag="KLTH0H03080g"
FT                   /old_locus_tag="KLTH-ORF1881"
FT                   /product="KLTH0H03080p"
FT                   /note="similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
FT                   YPL236C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30153"
FT                   /db_xref="GOA:C5E292"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E292"
FT                   /protein_id="CAR30153.1"
FT                   /translation="MTFIGTLCGCCGSSQPSYVSVNGHRYHIKRLLGEGGFSFVYLVES
FT                   RENGLMALKKIRCPFGSIGSISPAMKEVDNYQKFKSPYIAQIIDSQVVQERDGSKTVYI
FT                   LLPYFSKGSLQDEINRHLLDCTQVPELEVVRLALGVARGLLCIHDAAPADESDVTYSIV
FT                   SAPYAEDSSLLNDLELDTFGESHQAYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEI
FT                   NSRQALLQFQEWRSEHCTLTFMAPEILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFE
FT                   REEQISGASVTYSLTTGKYSIPSGTNYSSGLIDVVKKCLNVDPDGRPSVDELISLLMDL
FT                   QSQLVS"
FT   gene            <275767..>277179
FT                   /locus_tag="KLTH0H03102g"
FT                   /old_locus_tag="KLTH-ORF1880"
FT   CDS_pept        275767..277179
FT                   /locus_tag="KLTH0H03102g"
FT                   /old_locus_tag="KLTH-ORF1880"
FT                   /product="KLTH0H03102p"
FT                   /note="highly similar to uniprot|Q12464 Saccharomyces
FT                   cerevisiae YPL235W RVB2 RUVB-like protein TIP49b Homologue"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30154"
FT                   /db_xref="GOA:C5E293"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037942"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="InterPro:IPR042487"
FT                   /db_xref="UniProtKB/TrEMBL:C5E293"
FT                   /protein_id="CAR30154.1"
FT                   /translation="MSIQTSDSSSNDYGKALSLIAAHSHISGLGLDENLQPKATSQGMV
FT                   GQSQARRAAGVILKMVQSGTIAGRAVLIAGPPSTGKTALAMGLSQSLGQDVPFTAIAGS
FT                   EIFSLELSKTEALTQAFRKSIGVKIKEETELIEGEVVEIQIDKSITGGHKQGKLTIKTT
FT                   DMETIYELGSKMIEGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFV
FT                   QCPEGELQKRKSVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEWK
FT                   EEGKADIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVVMATNRGISRTRGTNYKSP
FT                   HGLPLDLLDRSIIITTHNYNEQEIKTILSIRAQEEEVEVAPDALDLMTKIGLESSLRYA
FT                   SNLISVSQQIALKRKSNTVEIADIKRAYLLFLDSSRSVKFLQEYQPQYIDDEGKVQIAS
FT                   NMTGTDAMDTTA"
FT   gene            complement(<277395..>277889)
FT                   /locus_tag="KLTH0H03124g"
FT                   /old_locus_tag="KLTH-ORF1877"
FT   CDS_pept        complement(277395..277889)
FT                   /locus_tag="KLTH0H03124g"
FT                   /old_locus_tag="KLTH-ORF1877"
FT                   /product="KLTH0H03124p"
FT                   /note="highly similar to uniprot|P32842 Saccharomyces
FT                   cerevisiae YPL234C TFP3 vacuolar ATPase V0 domain subunit
FT                   c'"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30155"
FT                   /db_xref="GOA:C5E294"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:C5E294"
FT                   /protein_id="CAR30155.1"
FT                   /translation="MSEILPVDEYSPFFAPFFGFAGCAFAMVLSCLGAAIGTAKSGIGI
FT                   AGIGTFKPELIMKSLIPVVMSGILAVYGLVVAVLIAGGLSPTEDYTLFNGFMHMSCGLC
FT                   VGFACLSSGYAIGIVGDVGVRKFMHQPRLFVGIVLVLIFAEVLGLYGMIIALILNTRSS
FT                   G"
FT   gene            <278598..>279245
FT                   /locus_tag="KLTH0H03146g"
FT                   /old_locus_tag="KLTH-ORF1875"
FT   CDS_pept        278598..279245
FT                   /locus_tag="KLTH0H03146g"
FT                   /old_locus_tag="KLTH-ORF1875"
FT                   /product="KLTH0H03146p"
FT                   /note="similar to uniprot|Q6B152 Saccharomyces cerevisiae
FT                   YPL233W NSL1 Essential component of the MIND kinetochore
FT                   complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
FT                   kinetochore subunits contacting DNA to those contacting
FT                   microtubules required for accurate chromosome segregation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30156"
FT                   /db_xref="GOA:C5E295"
FT                   /db_xref="InterPro:IPR013950"
FT                   /db_xref="UniProtKB/TrEMBL:C5E295"
FT                   /protein_id="CAR30156.1"
FT                   /translation="MSTQPSKLDVRVEQVRSIYGQFQSILDEKVALHLPQEQDSIKGEV
FT                   LLQLQKFLAEAMDMASDSLNVVNANERASLTELLAQSRQQFVDPFDLDLNEQVRKKYQE
FT                   WEDQTVKVAQLRREAPRKLRESYENEAQLALQEADTLINSFSQETPAEQNGAGQAKEEP
FT                   IELPNLPRLGEDYQEALKNLSAAKTQTPQNRAQIQKLEQLVAFLESELLAGS"
FT   gene            <279697..>280563
FT                   /locus_tag="KLTH0H03168g"
FT                   /old_locus_tag="KLTH-ORF1871"
FT   CDS_pept        279697..280563
FT                   /locus_tag="KLTH0H03168g"
FT                   /old_locus_tag="KLTH-ORF1871"
FT                   /product="KLTH0H03168p"
FT                   /note="highly similar to uniprot|P32867 Saccharomyces
FT                   cerevisiae YPL232W SSO1 encode syntaxin homolog act in late
FT                   stages of secretion post-Golgi t-SNARE"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30157"
FT                   /db_xref="GOA:C5E296"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:C5E296"
FT                   /protein_id="CAR30157.1"
FT                   /translation="MSYNNPYQNDNPYTENYAMQDSVGHAQSGGDFVTFMNGINQINVE
FT                   LDDYANLINQIDSSQRRLLTEVNEDQELAMRQHLDGLVSRASDLQYQLRNKIKSAQQQG
FT                   ASDPSKQAQAENSRQRFLKLIQDYRITEANYKEQNKDQAKRQYRIIQPEATDDEVEAAI
FT                   SDVGGQQIFSQALLNANRRGEAKTALAEVQARHQELLKLEKTMAELTQLFNDMEQLVIE
FT                   QQENIEVIDKNVEDAQQDVEQGVGHTNKAVKSARRARKNKIRCILILVVIVIVIVLAIA
FT                   LPLGLRK"
FT   gene            <281852..>287524
FT                   /locus_tag="KLTH0H03190g"
FT                   /old_locus_tag="KLTH-ORF1868"
FT   CDS_pept        281852..287524
FT                   /locus_tag="KLTH0H03190g"
FT                   /old_locus_tag="KLTH-ORF1868"
FT                   /product="KLTH0H03190p"
FT                   /note="highly similar to uniprot|P19097 Saccharomyces
FT                   cerevisiae YPL231W FAS2 Alpha subunit of fatty acid
FT                   synthetase which catalyzes the synthesis of long-chain
FT                   saturated fatty acids contains beta-ketoacyl reductase and
FT                   beta-ketoacyl synthase activities"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30158"
FT                   /db_xref="GOA:C5E297"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR026025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR040899"
FT                   /db_xref="InterPro:IPR041550"
FT                   /db_xref="UniProtKB/TrEMBL:C5E297"
FT                   /protein_id="CAR30158.1"
FT                   /translation="MTMKPEVEQELAHVLLTELLAYQFASPVRWIETQDVFLKDFNTER
FT                   VVEIGPSPTLAGMAQRTIKNKYESYDAALSLQRQVLCYSKDAKEIYYTPDPADLAPKEE
FT                   AAPEPAASAAATPAAAPASAAAPAAAPAAPAAAGPAAEIPDEPVNAALLLHVLVAQKLK
FT                   KTLDQVPMAKTIKDLVGGKSTVQNEILGDLGKEFGTTPEKPEETPLEELAESFQDTFNG
FT                   QLGKQSSSLISRLMSSKMPGGFTITSARKYLQTRWGLGAGRQDSVLLIALTQEPASRLG
FT                   SEADAKQFMDAIAQKYASVSGVDLSVATSAASSGAAAGSGGATIDAAAFDELNKDQKIL
FT                   ARQQLEVLARYLKMDLSSGEKKFLQEKNTTEQLQAQLDFLTNELGEYFVQGISTSFSRK
FT                   KARVFDSSWNWAKQSLLSLYFEIIHGVLKNVDRELVAEAINIMNRSNETLIKFMEYHIS
FT                   QTKVDEGENYQLAKSLGQQLIENCKQALELDPVYKDITKPTAPQTIVDKNGNINYKEVP
FT                   RPSVRKLSQYVEEMALGGPLTKVEQPTLQEDLTRVYKAINAQAAEHNISDSTKIEFEKL
FT                   YGELLKFLEASNEIDTSASSRYAGEVDDALDKDSTKEVASLPTKSEISNTVSSTIPRET
FT                   VPFLHLKKKLPSGDWIYDRQLSSLFLNGLERAAINGVTFKDKYVMITGAGQGSIGAEVL
FT                   QGLIQGGAKVIVTTSRFSKKVTDYYQSIYAKYGAKGSTLVVVPFNQGSKQDVEALVSYV
FT                   YDDEKNGGLGWDLDAIIPFAAIPENGIELENIDSKSEFAHRIMLTNILRMLGNVKKQKS
FT                   AQGIETRPAQVILPLSPNHGTFGGDGMYAESKLSLETLFNRWHSESWSNQLTICGAIIG
FT                   WTRGTGLMSANNIIAEGIEKLGVRTFSQREMAFNLLGLLIPEVVQLCQTSPVMADLNGG
FT                   FQFLPDLKEFTAKLRQDLTNTSEIRKAVSIETALEHKAVNGDNADAAYAKAEVQPRANI
FT                   QLNFPTLKPYESLKKIAPSELQGMLDLERVIVVTGFSEVGPWGSSRTRWEMEAKGEFSL
FT                   EGCVEMAWIMGLIKYHNGNLKGRPYTGWVDAKSNEPVDDKDIKAKYESHILDHAGIRLI
FT                   EPELFNGYDPKKKQMIQEVVIGEDLEPFEASKETAEQFKHEHGDKVDIFEIPDSGEYTI
FT                   RLLKGATLYIPKALRFDRLVAGQVPTGWDARTYGIPEDTISQVDPITLFVLVSVVEAFI
FT                   SSGITDPYEMYQYVHVSEVGNCSGSGMGGVSALRGMFKDRYKDMPVQNDILQESFINTM
FT                   SAWVNMLLISSSGPIKTPVGACATAVESLDVGVETILSGKAKICIVGGYDDFQEEGSYE
FT                   FGNMGATSNSYDEFDHGRTPAEMSRPTTTTRNGFMEAQGAGMQVIMNADLAIKMGVPIY
FT                   GILALTATATDKIGRSVPAPGKGILTTAREHQSDLKFPSPLLNIKYRKRQLDSRVSQIK
FT                   LWVENELEMLQYETEEIPEEDHAAFYAERTEEIHREAERQLKTAQNQWGNEFYKNDPRI
FT                   APLRGALATFGLTIDDLGVASFHGTSTKANDKNESATINEMMKHLGRSEGNPVLGVFQK
FT                   YLTGHPKGPAGAWMLNGGLQILNSGVVPGNRNADNVDKVLEQFEYILYPSRSIKTDGVK
FT                   AVSVTSFGFGQKGAQAIAVHPDYLYAALDESAYRAYAAKVSAREQAAHKYFHNGMIYNS
FT                   LFVAKEHPPYADELEQPVYLDPLARVSADKKTGAFVFDKKALTASTTYVSDANLKTSEV
FT                   VSKLAKQAAGDNKGASVGVDVELIKSINVDNDTFIERNFTAAEVAYCKSQPCVQSSFAG
FT                   TWSAKEAVFKSLGVKSQGGGASLKDIEITRKDGSAPQVELHGDAASAASAAGVKGVTVS
FT                   ISHDDFQSVAVAYSQK"
FT   gene            <288203..>288628
FT                   /locus_tag="KLTH0H03212g"
FT                   /old_locus_tag="KLTH-ORF1855"
FT   CDS_pept        288203..288628
FT                   /locus_tag="KLTH0H03212g"
FT                   /old_locus_tag="KLTH-ORF1855"
FT                   /product="KLTH0H03212p"
FT                   /note="some similarities with uniprot|Q99395 Saccharomyces
FT                   cerevisiae YPL229W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03212g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30159"
FT                   /db_xref="UniProtKB/TrEMBL:C5E298"
FT                   /protein_id="CAR30159.1"
FT                   /translation="MPFLTPPLSMAGLNQIAAPHNFVLETPNSQVGQPMHMVNGFESPE
FT                   MSLKTKNNICKSFEDDLFFCPRGLLSSQELSTCQQMDLLLLDQMRDISGLHAAQVTDVE
FT                   APDHAHSQPKFNPYTSQSFSPAPPPLESRPHLRESTL"
FT   gene            <288945..>290384
FT                   /locus_tag="KLTH0H03234g"
FT                   /old_locus_tag="KLTH-ORF1853"
FT   CDS_pept        288945..290384
FT                   /locus_tag="KLTH0H03234g"
FT                   /old_locus_tag="KLTH-ORF1853"
FT                   /product="KLTH0H03234p"
FT                   /note="highly similar to uniprot|O13297 Saccharomyces
FT                   cerevisiae YPL228W CET1 Interacts with Ceg1p the mRNA
FT                   capping enzyme alpha subunit removes gamma-phosphate from
FT                   triphosphate-terminated RNA mRNA capping enzyme beta
FT                   subunit RNA 5'-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03234g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30160"
FT                   /db_xref="GOA:C5E299"
FT                   /db_xref="InterPro:IPR004206"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR037009"
FT                   /db_xref="InterPro:IPR040343"
FT                   /db_xref="UniProtKB/TrEMBL:C5E299"
FT                   /protein_id="CAR30160.1"
FT                   /translation="MSSSKPNFSRGLSLEDLVNHDERSDAKAGQKSNPLPPAEVKHRMS
FT                   VDGLGSEQNGSASSSRVPREQRGPRRNADGDEETDTDEEVGGPGDIVFETGDFKFDYEK
FT                   QEGAGKNRDARAGREDTSSSSPSSKAKGGQDVKDIFQERASSQSKRNAIKKDLNVLSEI
FT                   AATAKPTRYNTAPIWAQKWKPTVKALQSIDTKDLNIDASFTNIIPDDDLTKSVQDWVYA
FT                   TLVSIPPDQRQYVEMEMKFGIIVEGSDSNRVSPPVSSQTVYTDMDAHLTPDVDERVFTE
FT                   INRYVKGISELSEYTGKFNIIESHTKDLLYRVGMSTQRPRFLRMSRDVKTGRVGEFIEK
FT                   RHVSQLLLFSPKDSYDVKISINLELPVPDNDPPEKYKDNTPVNTRTKQRISYIHNDSCT
FT                   RMDITKVANHNQGVKQRHTESTHEIELEVNTAALLTAFEHIGNNSKEYASILRTFLNNG
FT                   TIIRRKLTSLSYEIFEGQKKV"
FT   gene            complement(<290490..>291488)
FT                   /locus_tag="KLTH0H03256g"
FT                   /old_locus_tag="KLTH-ORF1849"
FT   CDS_pept        complement(290490..291488)
FT                   /locus_tag="KLTH0H03256g"
FT                   /old_locus_tag="KLTH-ORF1849"
FT                   /product="KLTH0H03256p"
FT                   /note="similar to uniprot|P40350 Saccharomyces cerevisiae
FT                   YPL227C ALG5 UDP-glucose:dolichyl-phosphate
FT                   glucosyltransferase involved in asparagine-linked
FT                   glycosylation in the endoplasmic reticulum"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30161"
FT                   /db_xref="GOA:C5E2A0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A0"
FT                   /protein_id="CAR30161.1"
FT                   /translation="MWDTFWSRVRELSVSTVLVTFAVAIACSLYLIVLLLSHSPRKPFD
FT                   EELIFKTNGPRGHIVSGKLDPVTKGSSNKDGIELSVVVPSYNEIGRILVGLTDAVTFLQ
FT                   EHLEDKWEILVVDDGSSDGTSKYCLDLAANHFKLKPGQLRVVKLTQNRGKGGAVRHGLL
FT                   HMRGKYGLFADADGASRFSDVAKLLDSIKKHEEKGHAAMAIGSRAHMVNTDAVVKRSFI
FT                   RNLLMYGLHTLVFIFGIRSIKDTQCGFKLFNRSATVQIFPYLHTEGWIFDVEILILALR
FT                   KKVPVEEVAISWHEVDGSKMDLARDSINMAKDLVIIRMAYLLGIYSDKVEC"
FT   gene            complement(<292114..>294105)
FT                   /locus_tag="KLTH0H03278g"
FT                   /old_locus_tag="KLTH-ORF1848"
FT   CDS_pept        complement(292114..294105)
FT                   /locus_tag="KLTH0H03278g"
FT                   /old_locus_tag="KLTH-ORF1848"
FT                   /product="KLTH0H03278p"
FT                   /note="weakly similar to uniprot|P35209 Saccharomyces
FT                   cerevisiae YMR179W SPT21 Protein required for normal
FT                   transcription at several loci including HTA2-HTB2 and HHF2-
FT                   HHT2 but not required at the other histone loci
FT                   functionally related to Spt10p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30162"
FT                   /db_xref="InterPro:IPR042403"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A1"
FT                   /protein_id="CAR30162.1"
FT                   /translation="MTTRMSLKVLYTVDKETNSYLTRSKAPVEARIESIPSPSNDGTQL
FT                   RVGIVLLNDVLEQVCASSPELFSYGMDNSVDYNVYCRDICELDEPLVSFGLLSKLRGAA
FT                   QQQSKNDVDDWPLVMGRVCSSFSAILRFQNIANTPPTQQTLEIKIRFSKVATANSSRRS
FT                   SVSGNNVHTLAKKAPTTTTSMLGSRGTSKAAGEMAKPEAVTKRQTNPMPAPKAARTQSL
FT                   PIWNQSKNNQFALPANSIAHKIYLADRAAKDTASSVKAREEKKPVVYQINSLQQDNTIQ
FT                   KTKVDDSVSKRFDFITKKKGKMAKPSIKKPVAKPKSSVKKVRRDSVVQASTPLPREAQT
FT                   SSMINKNDALEEFKLLNDDVLVQQLLDRQKLKPTDFFELDQEKGDDSENKENIPPRPVP
FT                   LSSRFEDLIGMDIPSFKTPSDSEKTGSVPRSDDTLEWFNDLFGSPIGNQKTVTPTKDPL
FT                   TCNTLPIEDDEQDPSKALTSDIDRTSPMDTLSMPLYELEHKKESKGSEPVPSCKEQLRR
FT                   LPILTKNSHSGHQDDVRDADSTTPVVLGYSTSPKSNNNELAAGQKRPAPVPSSPADDED
FT                   YMDEYMQERRRKRKTMPSSPTSMFPYREQDGEDEHSMTNDEFSIHERPCRDDANSTPAT
FT                   QYRSSDVENMKHGEESSAETKQNEFLHI"
FT   gene            <295271..>298801
FT                   /locus_tag="KLTH0H03300g"
FT                   /old_locus_tag="KLTH-ORF1839"
FT   CDS_pept        295271..298801
FT                   /locus_tag="KLTH0H03300g"
FT                   /old_locus_tag="KLTH-ORF1839"
FT                   /product="KLTH0H03300p"
FT                   /note="similar to uniprot|Q7LHP2 Saccharomyces cerevisiae
FT                   YPL226W NEW1 This gene encodes a protein with an Q/N-rich
FT                   amino terminal domain that acts as a prion termed [NU]"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30163"
FT                   /db_xref="GOA:C5E2A2"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A2"
FT                   /protein_id="CAR30163.1"
FT                   /translation="MPPKKFKSLDDFIGDQAPPKNQFQTPLENYYQNMSSGQSHPKTKG
FT                   SSYQAQRNWNDGSQYGNNSYNQNRGYQNYQGGYQNYQGGYQNNQSPQHSGRSTPSGSAT
FT                   PTPSTSTTSLTSLATSLANLGVTSISGILSTLPQCASLAECRQKIQLAVAEFNNEGRSA
FT                   QDIEDWDVPSIISKLIKPKNPALVQESAMLLISQLSINFSGKSPQEAFLLPLLPIALDT
FT                   VASKDSSVKRAAQHAIDSLFGLYPIEAQTSVLLPKVLEYLNSGVKWQCKLAALKLVDRI
FT                   REESPNDLLELTFKDTVPVLTDVATDFKPELAKQGHKTLLDFVSILDNLDLSPRFQLIV
FT                   DTLQDPSKVPNSVKSLSSVTFVAEVTEPALSILVPILNRSLNLSSSSQEQLRQTVIVIE
FT                   NLTRLVNNRSEIQHFIPQLMPGVQKVLDTASLPEVRELAGKAMKVLKDDSEDDGKFPGK
FT                   ITYEFGLQFVKEKIQLLAKNPLPELCKDNNTTALVYLSKIVTSDANVNDWKRLREYLLL
FT                   VFGEENAEAIDTHFIQELRNIFHQETATYDENEGIEIVNTDFSLAYGSRMLLNKTTLRL
FT                   LKGHRYGLCGRNGAGKSTLMRSIANGQLEGFPDKDTLRTCFVEHKLQGEEGDLDLVSFI
FT                   ALDPILKEVSRAEISAALESVGFDDERRSQTVGSLSGGWKMKLELARAMLQKADVLLLD
FT                   EPTNHLDVSNVKWLQDYLLENTEITSLIVSHDSGFLDAVCTDIIHYENKKLAYYKGNLA
FT                   DFVDQKPEAKAYYTLTDSNAQMRFPPPGILTGVKSNTRAVAKMTGVTFAYAGASKPQLT
FT                   DASCALSLSSRVAILGPNGAGKSTLIKLLTGELVPQEGKVEKHPNLRIGYIAQHALQHV
FT                   NLHKEKTANQYLQWRYQFGDDREVLLKESRKISEQEKEMMEKEIDIGDGRGKRAIEAIV
FT                   GRQKLRKSFQYEVKWKFWLPKYNSWVPKEVLLENGFDKLVQKFDDHEASREGLGYRELT
FT                   PTVITKHFEDVGLDSEIANHTPLGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRD
FT                   SLGALAVAIRDWSGGVVMISHNNEFVGALCPEQWIVENGKMVQKGVSQIDQSRFEDGGK
FT                   AGSASAAKAASPSVDDDDSPANIKVKQRKKRLTRNEKKVQVERRRLRYIEWLSSPKGTP
FT                   KPVDTDDEEE"
FT   gene            complement(<298885..>299754)
FT                   /locus_tag="KLTH0H03322g"
FT                   /old_locus_tag="KLTH-ORF1836"
FT   CDS_pept        complement(298885..299754)
FT                   /locus_tag="KLTH0H03322g"
FT                   /old_locus_tag="KLTH-ORF1836"
FT                   /product="KLTH0H03322p"
FT                   /note="similar to uniprot|Q03219 Saccharomyces cerevisiae
FT                   YMR178W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30164"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A3"
FT                   /protein_id="CAR30164.1"
FT                   /translation="MLPRFLATQTPKIARMPSVKGACVIIGDEVLNGKITDTNSRFFAK
FT                   YCYRLGIQLREIVTIGDQKEQIVQTIKRLSAENDFIVTSGGIGPTHDDITYESVASSFG
FT                   LPCELNYECQDRMRKISHPEKRHDPETLKDFYRMATLPAGPEVHSYYVLKEFWVPIVSI
FT                   QQKVYILPGIPQLFEKLLLAFEPSVKEIYSISEREPHNYERFFVKTPKSESQISSYLRE
FT                   LQTRCLQVSDEIKIGSYPHYGMGFNTVSILGLKKHEVFLKELVKEAIEKLDGTAITAEM
FT                   EEKYSDSR"
FT   repeat_region   300646..302622
FT                   /locus_tag="KLTH0H03344t"
FT                   /old_locus_tag="dnatranposon.4"
FT                   /note="DNA transposon of KLTH part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:degenerate
FT                   copy"
FT   gene            <303157..>303603
FT                   /locus_tag="KLTH0H03366g"
FT                   /old_locus_tag="KLTH-ORF1832"
FT   CDS_pept        303157..303603
FT                   /locus_tag="KLTH0H03366g"
FT                   /old_locus_tag="KLTH-ORF1832"
FT                   /product="KLTH0H03366p"
FT                   /note="similar to uniprot|Q08971 Saccharomyces cerevisiae
FT                   YPL225W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30165"
FT                   /db_xref="InterPro:IPR008476"
FT                   /db_xref="InterPro:IPR021148"
FT                   /db_xref="InterPro:IPR023139"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A4"
FT                   /protein_id="CAR30165.1"
FT                   /translation="MSAPNTFNAETAENLEDMEKQFAVLAVEQAETYWNLISKVPGSKL
FT                   RLTKFDDEIYEKFQEHFPEYKDLSRLAKFTEEELKTKEAKERWRKFIKLFEKKVDDFNF
FT                   GTLLRTDASAEYGQFTTCFVVRLQFYAFEIARNKSKLNDWAAGQ"
FT   gene            complement(<303810..>305315)
FT                   /locus_tag="KLTH0H03388g"
FT                   /old_locus_tag="KLTH-ORF1831"
FT   CDS_pept        complement(303810..305315)
FT                   /locus_tag="KLTH0H03388g"
FT                   /old_locus_tag="KLTH-ORF1831"
FT                   /product="KLTH0H03388p"
FT                   /note="similar to uniprot|Q03218 Saccharomyces cerevisiae
FT                   YMR177W MMT1 Putative metal transporter involved in
FT                   mitochondrial iron accumulation closely related to Mmt2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30166"
FT                   /db_xref="GOA:C5E2A5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A5"
FT                   /protein_id="CAR30166.1"
FT                   /translation="MIKPSAYPVGLQFYHNIGKSRCRQLVWNLCFHQRSIHNSSRRLIN
FT                   EGKKGGIGKTDAERRLEKQAKFQDLSDAFEESRHIHMKESETEQNDTLHLGSMLYREAG
FT                   HTHSHASSQSNPLLKMSRKEFKKNPGVRITWIGLWINVGLALGKFAGAIMFHSQALIAD
FT                   SVHALSDLVSDFLTLASVKLSSKQPTAEYPGGYGKIETLGSLSVSAILAFAGLSIGWSS
FT                   LCAIAAPLLPHAVLDVVSTFSHSHSHGGPTDVANINAAWIAGGSIIIKEWIFNATKKVA
FT                   IETNSNVLLANAWHHRVDSLTSLVALVTISSGYFFNIQSLDAVGGLLVSALVVKTGADG
FT                   MIGAMKELVDRAVAGDDPRYVTVKDNTQEILRKLISNNNAKKPYGLKNLTVLSSGPEMH
FT                   AKMTLEVPLQRWENVLTIKEFEIVTDHLRKTLRENIPTLRNIDIDYVEERPPLSPEQLK
FT                   EIENQKKLGQFPTPQNESASDGPLPSGHTHSHFGLGSGHTHKH"
FT   gene            complement(<305531..>309943)
FT                   /locus_tag="KLTH0H03410g"
FT                   /old_locus_tag="KLTH-ORF1829"
FT   CDS_pept        complement(305531..309943)
FT                   /locus_tag="KLTH0H03410g"
FT                   /old_locus_tag="KLTH-ORF1829"
FT                   /product="KLTH0H03410p"
FT                   /note="similar to uniprot|Q03214 Saccharomyces cerevisiae
FT                   YMR176W ECM5 Non-essential protein of unknown function
FT                   contains ATP/GTP-binding site motif A null mutant exhibits
FT                   cellular volume up to four times greater than wild-type
FT                   also large drooping buds with elongated necks"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30167"
FT                   /db_xref="GOA:C5E2A6"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013637"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR036431"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A6"
FT                   /protein_id="CAR30167.1"
FT                   /translation="MTLEPLPHMPPVGKWQPSTGSNAPLAAALPLAAGKTLPTTSRFKS
FT                   SLEATPSPLSLDQHSPHLYTQHRIRPNAPFDIAHIKSKRLVQTPEPACQTLKTDSGWSY
FT                   TLESGSVPCFRIPRSEIPDPITFYHQIEDVGRQYGAVKLQIIQSSPAPVTPFALNTELF
FT                   WFKARRQSLCSFQEETRRKLDLHRRLYKYHSSRKSDTGRQLFSKIPSIDKRPLDLYRLR
FT                   ECVQLRGGFQEVCHKKLWAQIGRELGYSGRIMSSLSTSLRSAYLKVFSEFDKEEERQRA
FT                   SASAATTTVPTKIHIILPSSTEDNHRDPSSKKRSLNEASISLENAVKKHKASKVQAYQV
FT                   AGSAAEFSRLRDILRYKGFFTNFENLTEPRKGLTKPSPSTLPGYQFTFWKSSSEIYDRS
FT                   AHETRNAPIYNLRQYYEKAQKHFDSVAALYQQRSSLVLEKSDSVNLRDFEKLFFDILSD
FT                   ESACCNVDTGINLPSSVHGSGFPTVSKSTTNGLDTTSAWNLNNIPLSSDSVLQFMDADF
FT                   GSHLDTRLDLGMLFSVKGWSIEDNFLPNIDYHHAGSSKLWYVVPPEDMKRFESLVETSK
FT                   KNQQSPGPEVSNDPVDKSFLNSEVYQCYLDTCPQHQVSTLPPRINTHTIGQFREVTACT
FT                   LPDDWQFHPEKLKANSIKVLRIVQDPGCYILKFPRTYSTSISCGFSISENALFAPASWL
FT                   ESALESEKWLSRNGLLPAIQTFQLLFNIVKESGDKKLASKARLLLTGLASEELAAREEL
FT                   ARRLSDRFTIESNVFDFISDQTLEPTGASKVLLTSAKDCFTLSLRQFLDNLTCKEEKLL
FT                   IFGRDLQQDGISISLHEFYSNEELEALLQEDHACTAAAAIFSEKDASQGQVEKPDRDVL
FT                   VSYDSLVNEELKGQRVPLAKINLFCEALSQESNSQAHQLRRSLKNARSTASRCNQMLAK
FT                   INKEKRGMKFQGFGRGFALKELAAAPFHYTVAELHNLYLELEGSSIAFPEMSKVFELCH
FT                   CVESFQLDAQNAIKINDLSRMKETYLQGWSLGIRSKYHDLLARKICEEMWLSTYEKTII
FT                   EHEIIKEDELGYYTPSYLLPYLKYGIKFVSDALHREKLEQVRNTILLSQETGYELGQLF
FT                   KKKSSKIPVDRLSSILDTLRQYPFLVEPRLRETLEAIMDTFGKHREGMSSSFDKLDVNH
FT                   EHYRLIAGSVNARPLFELNLIGKFDGSCDDKRLTLSEVPNRSIFSKHIKDCRLWLQKVN
FT                   KLVLRKPLWAKIHSSTQLCFANNGDKLTTKSQPDEEPVYCFCRQGDSGSKMVACEVCGE
FT                   WYHATCINKGKWSLVSNENTVFVCPICCPSNFPDFGLVDFSQIESMAMASLKLKVIPDR
FT                   RFFGQFFEIFKMSASFKHTMSCDLLKKDGALRGDLSMAQIKFYLRKLVGAGVRMPREIS
FT                   ALQRACQEHDANVMLKFAQRNIKVVTGYEATGSREASEAQPDQVVIKSEGAMVISPEIK
FT                   PEGNSDMMQ"
FT   gene            complement(<310426..>310851)
FT                   /locus_tag="KLTH0H03432g"
FT                   /old_locus_tag="KLTH-ORF1820"
FT   CDS_pept        complement(310426..310851)
FT                   /locus_tag="KLTH0H03432g"
FT                   /old_locus_tag="KLTH-ORF1820"
FT                   /product="KLTH0H03432p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03432g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30168"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A7"
FT                   /protein_id="CAR30168.1"
FT                   /translation="MSNIIHKMSEKITGHDHHDDERDERGNTLSSEQRQQREQGMPFTE
FT                   HNDPEQRAIPSQRVGGGMQSERSKLGGYQQQQHDLGGSGGDFGQTRSMPEEQMPGAVRG
FT                   GSDLNAEDWDDEDEADDEGRGTRRGGDYSDEFQKRYW"
FT   gene            <311863..>312234
FT                   /locus_tag="KLTH0H03454g"
FT                   /old_locus_tag="KLTH-ORF1814"
FT   CDS_pept        311863..312234
FT                   /locus_tag="KLTH0H03454g"
FT                   /old_locus_tag="KLTH-ORF1814"
FT                   /product="KLTH0H03454p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30169"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A8"
FT                   /protein_id="CAR30169.1"
FT                   /translation="MSDLFERARQRLSGSSSAVPEKLRDLYMSHGPRDASGGSGSMSRR
FT                   MTGADDGAGPGSSALSSGGDSSGDDSPGASSSDLASNGSRDLAHSHMVSHARGGSDNAA
FT                   ADAGAETGSGADPAANATN"
FT   gene            complement(<312577..>314055)
FT                   /locus_tag="KLTH0H03476g"
FT                   /old_locus_tag="KLTH-ORF1809"
FT   CDS_pept        complement(312577..314055)
FT                   /locus_tag="KLTH0H03476g"
FT                   /old_locus_tag="KLTH-ORF1809"
FT                   /product="KLTH0H03476p"
FT                   /note="weakly similar to uniprot|P18899 Saccharomyces
FT                   cerevisiae YMR173W DDR48 DNA damage-responsive protein
FT                   expression is increased in response to heat-shock stress or
FT                   treatments that produce DNA lesions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30170"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A9"
FT                   /protein_id="CAR30170.1"
FT                   /translation="MGFLDKVKDFAGNNNDDNGNSGSNDNNLFSKAERAIGQDNVDKIR
FT                   NKVGGDNYDKFEKTVRDKFSNTSINDDNNSSSYGNSNNDDSYGNNNNSSSYGNNNNDDS
FT                   YGNNNNDDSYGNNNNNNNNNSSSYGNSNDDDSYGNNNNSSSYGNNNNDDSYGNNNSSSY
FT                   GNGNNNSSSFGNKSSYGSNSYGDDNNDSYGSKKDKNDKKDNKSSYGSSSYGDDSNDTYG
FT                   SKKDNNTSSYGNSSYGDDNNDSYGSKKDNNSSSYGNSSYGDDNNDSYRSKKDKKDNKSS
FT                   YGSSSYGDDNTDTYGSKKENNSSSYGNSSYGDDSNDTYGSKKDKKDNNTSSYGNSSYGD
FT                   DSNDSYGSKKDKKDKKSSSYGNSSYGNDNSTSSYGNDNKSSSYGNDNSTSSYGNDNNTS
FT                   SYGKKSSYGNDNNTSSYGNSSYGNDNNTSSYGNDNKSSSYGNDSYGNNNSNNNNSNNNN
FT                   NSSYGNNTSSYGDDSYGGNSDSYGNNSNSYNNDY"
FT   gene            complement(<315060..>317054)
FT                   /locus_tag="KLTH0H03498g"
FT                   /old_locus_tag="KLTH-ORF1805"
FT   CDS_pept        complement(315060..317054)
FT                   /locus_tag="KLTH0H03498g"
FT                   /old_locus_tag="KLTH-ORF1805"
FT                   /product="KLTH0H03498p"
FT                   /note="weakly similar to uniprot|Q03213 Saccharomyces
FT                   cerevisiae YMR172W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30171"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B0"
FT                   /protein_id="CAR30171.1"
FT                   /translation="MGSSAPAMANGNQASEVRGSLSNDALNLGLNLALPADTHDTAKTV
FT                   GTVSGSSLADILGSNATPQAGGENGHASGTSNATPASALNEPTHAQIHSASPAQNAGIG
FT                   PQRYGIIQQVSGSSELGTGNSTTTSVQICQRMDEVSARMIAMEEMFNKLYFKINEQEAT
FT                   IQHLRLQSEAFLTSILSEVRQVNHNMPILDNPDDNEKDGFVTDLLNSITNVSSNYLKKV
FT                   NTKHSQKYKRQRQSMGGAGAASTDKPSKDAFGEAATSSSTRAINGTAGVAPNNGASAGQ
FT                   ANLAAQSSKRAAPDSEHSKTHNSSFAESGGQTGQQLVQESHSYPVSEASQLPLPHYLTQ
FT                   QSFTLNPNGIKRRRANTATKPSFSQSHQDISSLNGIGSMSLPNLTLENLTRKNQPHSLG
FT                   FNVNSDHNVSAGARLRHRNIEIQVGSDNVDSHELDLDSSEDEEGYQEDDEDRNSDRSAE
FT                   AADAGRSYGARGNVINAAEEAEDETESYGGLFEPRNRSPGQQIHQRREDRRNFDRGRPV
FT                   RAPGPTEQPLKATQVNAETKTAAAPRSGGPAADEHHTRLRERDLNYTLLKAPANVRAIW
FT                   QEYIEGIDGQPAVKFLEEVYGNKWRLKKNVKTFARRKRLYKFIINGIKHGRSADDMIKI
FT                   LEDKRIYKNEHGEVKKRTIGWLQQSLSGI"
FT   gene            <317431..>319425
FT                   /locus_tag="KLTH0H03520g"
FT                   /old_locus_tag="KLTH-ORF1802"
FT   CDS_pept        317431..319425
FT                   /locus_tag="KLTH0H03520g"
FT                   /old_locus_tag="KLTH-ORF1802"
FT                   /product="KLTH0H03520p"
FT                   /note="similar to uniprot|Q08968 Saccharomyces cerevisiae
FT                   YPL222W FMP40 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30172"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B1"
FT                   /protein_id="CAR30172.1"
FT                   /translation="MPEARTVLVALKESGTSRFVQKLLSDQLVPSVGKAIEIEERQDEE
FT                   EHRKVFHTPRLVSQRAHFAYTVPEKRPHYKPLLTSKKALDDLQLEMSQDLVAILTGQRI
FT                   YCDESEGIFPYSMAYAGFQFGQFAGQLGDGRVTNLFDLPDKHGSMQTLQLKGSGLTPFS
FT                   RFADGKAVLRSSLREFIISEALHHIGVPSTRALQLTALPQTKARRAMYEPCAMYCRYAP
FT                   SWIRLGNFDLCRWRQDHGSLVKLADFCINDVFEGGKEFPAHLDPESFKHDFFPDKEDEI
FT                   GTEPKEQERLESNTKYELFFRHVVNLNAESVAYWQTYGFLNGVLNTDNTSIMGLAMDFG
FT                   PFSIMDKFQPQYTPNHDDVESRYSYANQPTAIWWNLTKFAQSMTTLIGAGPAHVEKIVA
FT                   EGLAAVDEAMEKDIVSRANSVIASASNEYKFRFTVKYTDLMAKRLGIELNIPKVFTSAN
FT                   LGSIAEKVREFNNAILEPLLQVLYVTQVDYNNFFVKLQGYSGPFKTERGGGFELIEPDL
FT                   LEVFFSNAQIQKLEKHLAGRPDSDSGETRQLVECAEKLNTWIDDFVSLVPSESNSRSEI
FT                   AKKVNPLFTPRAYILEQVVDDLTENQKERLNDPQAEVDTSLLQKLYSMSVNPYDSDKWE
FT                   DNLRPEVVQDWTTHGDDDDKFMKQLTCSS"
FT   gene            <320024..>322993
FT                   /locus_tag="KLTH0H03542g"
FT                   /old_locus_tag="KLTH-ORF1795"
FT   CDS_pept        320024..322993
FT                   /locus_tag="KLTH0H03542g"
FT                   /old_locus_tag="KLTH-ORF1795"
FT                   /product="KLTH0H03542p"
FT                   /note="weakly similar to uniprot|P36775 Saccharomyces
FT                   cerevisiae YBL022C PIM1 Mitochondrial ATP-dependent
FT                   protease involved in intramitochondrial proteolysis
FT                   involved in degradation of misfolded proteins in
FT                   mitochondria required for bigenesis and maintenance of
FT                   mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30173"
FT                   /db_xref="GOA:C5E2B2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B2"
FT                   /protein_id="CAR30173.1"
FT                   /translation="MQFLSKRKEQTANYLELPCLLPQVTPSVVPLPGVRYRISIPKDKA
FT                   AAMLQDLQEFVDISSYELSKGKELLRGPKKNKQTSKSEVRSSFQCIDEKLKVSNRSQIY
FT                   ICLLPTVQTNYTRGCVSILEEILAEGELVTFCLKGVRRAIIKDPEINLQNRLWISKLLV
FT                   LDDGPYLTSLSPESCGKLVKQLQNNFTNITSAFDSFRATYRNAVRLQSGNSERFFLLSP
FT                   LSNTLFILLSKGSFSKSWKLLFELYQSLEVHKPGNQKDAIFSLIDMTVAVLPVTNKQRL
FT                   RCLELEDPLERAKELDATIHDLVALLASLRDGFKFFEAKVQDFSPGDKAAFVALQLSAL
FT                   RGFIEEPKKGSRFIRNPKSGPPSGARVGADKVEKENGDEDEDLKTIGAFIDNLEISEVH
FT                   PDGLKMLKKDFRRLERLTPQSSEYNVLRGYFDTIMDIPFKAKDVSKSNIDLEECKKKLD
FT                   NDHYGLLDVKKRLIEYLSVLKLNVDFKNEGSKAKPPIMLLVGPPGVGKTSIAKSIAGVL
FT                   NRRFHRISLGGIHNEAEIRGHRRTYVGSMCGLIINALRKSGSMAPFILLDEIDKVLSVQ
FT                   AGGNRGAGLNGDPGAALLEVLDPEQNSTFTDHYVGFPVDLSNVLFFCTANNLTGISAPL
FT                   LNRMEVIEIPGYTPKEKLNIGLKFLLPKQIQLNGLDKASIKVELTKEAWDDLVLEYTRE
FT                   PGVRGLERQIASIVRGKVVEYVQSHESEHKIVTSQELLKYIGFPLHPISRELVKKIKFA
FT                   DKCGVVNGLAYGSDGTGNVLVFEMVKMGKLQGNSSGPRIRTTGNLGKVLNESIEIATTL
FT                   VKSLSERKIIHGLPSQAFNDFLNSEWHIHVPMGAVSKDGPSAGVAIALALISAALNKPV
FT                   SPKLCLTGEITLRGKVLPIGGVREKLLGAQLFGMERVLLPLSNRPDVIEAVMKPEEYES
FT                   CLASSSMPELRRVQQKWQLEAFYIDDFYDVMTKCWPREIQLTDARILISPSDNSIRALL
FT                   "
FT   gene            <323465..>325921
FT                   /locus_tag="KLTH0H03564g"
FT                   /old_locus_tag="KLTH-ORF1793"
FT   CDS_pept        323465..325921
FT                   /locus_tag="KLTH0H03564g"
FT                   /old_locus_tag="KLTH-ORF1793"
FT                   /product="KLTH0H03564p"
FT                   /note="similar to uniprot|Q08967 Saccharomyces cerevisiae
FT                   YPL221W BOP1 Protein of unknown function overproduction
FT                   suppresses a pam1 slv3 double null mutation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30174"
FT                   /db_xref="GOA:C5E2B3"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="InterPro:IPR032800"
FT                   /db_xref="InterPro:IPR040241"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B3"
FT                   /protein_id="CAR30174.1"
FT                   /translation="MRIFSAILLALNIAHLVVAKRKLVASSLVACMQNSQLTASGFSVV
FT                   FDPDDRSLHYSLDMVTEINDYIYAEVDVYAYGFKIISRNIDLCSLSWKQFCPLRPGNVQ
FT                   VESIEYISESLAKQIPGIAYQVPDIDAFVRMNIYKSTDKSQTLACIQAFFSNGKTVSQT
FT                   GVKWATAVIAGIGLLCSAVLSTFGNSNAASHISANTMSLFLYFQSVAVVSMEHVHRMPP
FT                   IAAAWSENIIWSMGLIRISFMQRIFRWFVQSTGGNPSLYLTSKTISVLVQRSLEGIQRG
FT                   LESIRAPPVFKRNADTIIGNSNVMILRGIKRLAYTSNIENTSVVCTGFTFFVLCGYFLA
FT                   GFIIASKYAIDLCIKAGWIRNTRFWAFRHNWRVILKGSLLRYIYIGFTQLTLLSFWEFT
FT                   QNDSPALIVIAVLFLIQSLGLMLWAAYRTISFARLSVEQRKNPAAILYGDQRVLDKYGF
FT                   FYTMFSAKRYWWNCVILVYILLKSIFISFCQASGKTQALAIFIIDLAYFVVLIKFQPYF
FT                   DRPTNIVNILITTVTLVNSFLFLFFSDLFGQPGRVSSIMGWVFFIMNAAFSLILLILIL
FT                   IFVCMVIFSKNPDLRFKPAKDDRTSFQRVSDSHGKINKSVAAELMALGNTAKNHDENWE
FT                   EELYNQQKLQKEQSVSGLDYSDEKLTGSRSNSDDQEDATRLTLAEKLKRKLSFKRTKST
FT                   KSTSSRARKLANTDDAPVTSLSREPSTSSAPVVKRDYPGVHSRQQSESKNGLIGSNAVE
FT                   NSKLETLAQEDDAPLVDTDNYQAPHSGSVEFGRDESMDSVNVAATANATSSTDLFTNDG
FT                   SYYNRL"
FT   gene            complement(<326294..>327442)
FT                   /locus_tag="KLTH0H03586g"
FT                   /old_locus_tag="KLTH-ORF1789"
FT   CDS_pept        complement(326294..327442)
FT                   /locus_tag="KLTH0H03586g"
FT                   /old_locus_tag="KLTH-ORF1789"
FT                   /product="KLTH0H03586p"
FT                   /note="weakly similar to uniprot|P53122 Saccharomyces
FT                   cerevisiae YGL138C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30175"
FT                   /db_xref="GOA:C5E2B4"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B4"
FT                   /protein_id="CAR30175.1"
FT                   /translation="MLAITNVTNDSITLPSPLRRRFSLFVCIQLFILLLSVVKPVGGLV
FT                   VSSRLKKLELALATQDRICSMDHVETKTSYRELIGTLTDISFGATGHSSKIYTGFKVHR
FT                   IYHFGKMLSKAKPSLQLSFCEHGKVKWQTELEYRSDIDWDLPFCVYSQDIEGVGDQGHS
FT                   RIWGALKKGNRNQDTVKGPSLKELARQDTANFHCFKMARREKYTKRSTSIYLPNEWVGG
FT                   LFYCDLTPDGKSRLLDQMGDDLHIDATKSHGVCNRANAIPLQPLISDSYRRHWTSLKPG
FT                   TRIPFLRRITRTNMDKVIPFLHTPNSDSDFGNFTTKNDITVSKSSTKLRSNWLSAVNWL
FT                   FASKVEEHLWFNEVEVEESYGVMSAQNNLTNASYIDILKIKH"
FT   gene            <327747..>330550
FT                   /locus_tag="KLTH0H03608g"
FT                   /old_locus_tag="Klth0H.mRNA.461.p"
FT   CDS_pept        join(327747..327764,327941..330550)
FT                   /locus_tag="KLTH0H03608g"
FT                   /old_locus_tag="Klth0H.mRNA.461.p"
FT                   /product="KLTH0H03608p"
FT                   /note="similar to uniprot|P41811 Saccharomyces cerevisiae
FT                   YGL137W SEC27 Involved in beta'-subunit of yeast coatomer"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30176"
FT                   /db_xref="GOA:C5E2B5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016453"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B5"
FT                   /protein_id="CAR30176.1"
FT                   /translation="MKLDIKKAFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNFETQ
FT                   TEVKSITVTETPVRAGKFIARKNWIVVGSDDFKIRVFNYNTGEKIADFEAHPDYIRSIA
FT                   VHPTRPYVLSASDDLTMKFWNWEKNWSLEQTFEGHEHFVMGVAFNPKDPSTFASACLDH
FT                   TVKIWSLGQPTANFTLHAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCVA
FT                   TLEGHMANVSFAVFHPALPIIISGSEDGTLKVWNSNTYKLEKTLNLGLERSWCIATHPT
FT                   GKRNYVASGFDNGFTVLSFGNDDPKLSLDPVGKLVWCGGKNASATDVFTAAIRGTEGAD
FT                   DGEPLPLQTKELGNVDVFPQSLKHSPNGRFVTVVGDGEYIVYTALAWRNKAFGKCHDFV
FT                   WGPDSNSYALIDESGHVKFHKNFKELTSWSIPLEFGVEKLYAGALLGVKADGFVYFFDW
FT                   DSGSLVRRIDVDANDVVWSENGELLMIINNVDENNTEERAAYVLGFNREAYESFLASEE
FT                   EPSEDGIDEAFDVLYEVSDPIGSGKWVGDVFIFTTKTNRLNYFVGGKSYNLAHFDKEMY
FT                   MLGYLPRDNKVYLADRDIHIYSYEISIEVLEFQTLVLRGELEQAKTSVLPNIEGKENLL
FT                   KISRFLEGQEYHEDALEISPDNDQKFDLALKLSKLSLAHDIVAGDDNEFKWRKLGDKAL
FT                   EGFDFQLAIEAYDNAADLESLFLLYSSFKDQAGLVDVGDRAQRLGKYNLAFNAYWSAGD
FT                   VDRARDLLVSSGRYSEAAVLSKAYGGKLEDTNAIVAQWKESLIEVGKAGVASRIHELSK
FT                   ADQVSAEEPLIDIETEAGQGEKQPVGEPLEEAATDETPTDGTPTDETPPETHAEDEAAQ
FT                   NLQE"
FT   gene            complement(<330705..>331637)
FT                   /locus_tag="KLTH0H03630g"
FT                   /old_locus_tag="KLTH-ORF1785"
FT   CDS_pept        complement(330705..331637)
FT                   /locus_tag="KLTH0H03630g"
FT                   /old_locus_tag="KLTH-ORF1785"
FT                   /product="KLTH0H03630p"
FT                   /note="similar to uniprot|P53123 Saccharomyces cerevisiae
FT                   YGL136C MRM2 Mitochondrial 21S rRNA methyltransferase,
FT                   required for methylation of U(2791) in 21S rRNA; MRM2
FT                   deletion confers thermosensitive respiration and loss of
FT                   mitochondrial DNA; has similarity to Spb1p and Trm7p, and
FT                   to E. coli FtsJ/RrmJ"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30177"
FT                   /db_xref="GOA:C5E2B6"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B6"
FT                   /protein_id="CAR30177.1"
FT                   /translation="MTSPMLCALPKFLCQGQCLRWRVAVRFNSSAKSRWLDRQKGDSFT
FT                   REAKVQGLRSRAAFKLMHLDDKYHLFRKGSSQKVLDLGYAPGAWSQVALDRTGPNGVIL
FT                   GVDILPCAPPRGVSAIQGNILSKKTHELIRLFFSKHFQLYQEDQLHKDNGYFQHMLEQE
FT                   LEGLIPDGSKTGLQIDRSKVEKTPIDVIVSDMYEPWPQTTGFWNNITNSAYDRMANTTG
FT                   VAIKDHYMSMDLCDAALVTAIDLMKPGGSFVCKLYTGKEDKLLESRLKKAFENVHRFKP
FT                   SASRNESKELYFIGLKKKHKVDKLKVFSE"
FT   gene            <332634..>333287
FT                   /locus_tag="KLTH0H03652g"
FT                   /old_locus_tag="KLTH-ORF1781"
FT   CDS_pept        332634..333287
FT                   /locus_tag="KLTH0H03652g"
FT                   /old_locus_tag="KLTH-ORF1781"
FT                   /product="KLTH0H03652p"
FT                   /note="highly similar to uniprot|P53030 Saccharomyces
FT                   cerevisiae YPL220W RPL1A and to uniprot|P53030
FT                   Saccharomyces cerevisiae YPL220W RPL1B N-terminally
FT                   acetylated protein component of the large (60S) ribosomal
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30178"
FT                   /db_xref="GOA:C5E2B7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B7"
FT                   /protein_id="CAR30178.1"
FT                   /translation="MSKITSTQIRDNVKEVLKYSNETKKRNFLETVELQVGLKNYDPQR
FT                   DKRFSGALKLPQCPRPNLSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLA
FT                   KKYSAFVASEVLIKQVPRLLGPQLSKAGKFPTPVSHNEDLYAKVTDVKSTIKFQLKKVL
FT                   CLAVAVGNIEMDEDTLVNQILMAVNFLVSLLKKNWQNVGSLVIKSTMGPPFRLY"
FT   gene            <333755..>335209
FT                   /locus_tag="KLTH0H03674g"
FT                   /old_locus_tag="KLTH-ORF1779"
FT   CDS_pept        333755..335209
FT                   /locus_tag="KLTH0H03674g"
FT                   /old_locus_tag="KLTH-ORF1779"
FT                   /product="KLTH0H03674p"
FT                   /note="weakly similar to uniprot|P53124 Saccharomyces
FT                   cerevisiae YGL134W PCL10 Pho85p cyclin recruits activates
FT                   and targets Pho85p cyclin-dependent protein kinase to its
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03674g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30179"
FT                   /db_xref="GOA:C5E2B8"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B8"
FT                   /protein_id="CAR30179.1"
FT                   /translation="MSGLPSILDESLDRIARGETELDISESMNEDSLDLDDPVDDDTFE
FT                   LPLKPRRRVLHASNFADLEAEPALDKRVRFEAAGPPWSPLSVEKIAVPEKGIMNSKPPK
FT                   LNPASSAGARKPHIEDLIQHAHSLNRYLDQNLDRINTFQSHLFEQGLEAPQNTGQILAS
FT                   NVATAPTTPSGSASNFQLSEIGDSSESLDYEQDIHDESISAAALQADSERDDRKIKQIL
FT                   SRHQTSTYPLSENQSSVNLAGDDSRSEVSALDHFRDLAASTRTSVATSSEDLFNMPHSP
FT                   VIHDLKFIIPKIAAQRPSAISSLGAGDDAEPPDMDCEAALALYTTTITLLLMMSKQSED
FT                   PKQEALPSFATFVMESVPTLAYEDYLKRLHCKFSFAPIVYLTAAHLLQTLFLTRVDEEL
FT                   HCKHHLDPRQVHRLVIASIRLATKLLEDCVHSHSYFSRICGISKKLLTKLEVAFLECLN
FT                   FEGLKITNQSLLDAAQVQQELSALAA"
FT   gene            <335581..>336233
FT                   /locus_tag="KLTH0H03696g"
FT                   /old_locus_tag="Klth0H.mRNA.at.275.p"
FT   CDS_pept        join(335581..335602,335689..336233)
FT                   /locus_tag="KLTH0H03696g"
FT                   /old_locus_tag="Klth0H.mRNA.at.275.p"
FT                   /product="KLTH0H03696p"
FT                   /note="highly similar to uniprot|P20606 Saccharomyces
FT                   cerevisiae YPL218W SAR1 GTPase GTP-binding protein of the
FT                   ARF family component of COPII coat of vesicles required for
FT                   transport vesicle formation during ER to Golgi protein
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30180"
FT                   /db_xref="GOA:C5E2B9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B9"
FT                   /protein_id="CAR30180.1"
FT                   /translation="MWDLFGWFRDILSSLGLWNKHGKLLFLGLDNAGKTTLLHMLKNDR
FT                   LATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERL
FT                   NEARVELDALFNIAELKDVPFVILGNKIDSPNAVSETELRSALGLLNTTGGARIEGQRP
FT                   VEVFMCSVVMKNGYLEAFQWLSQYI"
FT   gene            complement(<336334..>339840)
FT                   /locus_tag="KLTH0H03718g"
FT                   /old_locus_tag="KLTH-ORF1774"
FT   CDS_pept        complement(336334..339840)
FT                   /locus_tag="KLTH0H03718g"
FT                   /old_locus_tag="KLTH-ORF1774"
FT                   /product="KLTH0H03718p"
FT                   /note="similar to uniprot|Q08965 Saccharomyces cerevisiae
FT                   YPL217C BMS1 Essential conserved nucleolar GTP-binding
FT                   protein required for synthesis of 40S ribosomal subunits
FT                   and for processing of the 35S pre-rRNA at sites A0, A1, and
FT                   A2; interacts with Rcl1p, has similarity to Tsr1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30181"
FT                   /db_xref="GOA:C5E2C0"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030387"
FT                   /db_xref="InterPro:IPR037875"
FT                   /db_xref="InterPro:IPR039761"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C0"
FT                   /protein_id="CAR30181.1"
FT                   /translation="MDQSNKEHRKKSEKATAKKKLHTQGHNAKAFAVAAPGRMARNMMR
FT                   SSDVNERKLHVPMVDRTPEDDPPPVIVTVVGPPGTGKTTLIKSLVRRMTKSTLSEVNGP
FT                   ITVVSGKRRRLTFIECPADDLNSMIDIAKVADLVLLMIDGNFGFEMETMEFLNLAQHHG
FT                   MPRVLGVATHLDLFKSQSTLRATKKRLKHRFWTEVYQGAKLFYLSGVINGRYPDREILN
FT                   LSRFISVMKFRPLKWRNEHPYLLADRITDITHPELLETQGKQIDRKVAIYGYLHGTPLP
FT                   STAGARVHLAGVGDYSISHVEKLPDPCPTPYFQQKLDEYERERVKEQGAGTTGAPRRRK
FT                   RLDDRQKLIYAPMSDVGGVLMDKDAVFIDVGGKKPGDGPSFVPGQEKGEGERLVTSLQS
FT                   VEKSISENFDGVGLQLFSNGQELHEADSDGENSVSEDEGDSNKDGGRKSLRKPKIYGKS
FT                   IQEEDEEIDNLESDEEMEAGASDDDRPRQRRLVEVDFDAGNDASVNAHTDSEFELSDHE
FT                   EELWNRSTASKLQGSKIRPRKWDIGKLIYMENIEPFDCIKRWKGELEDENEESGEQSEE
FT                   EDFFKQADKPENKNTEAEDDLEKFKPHFETFKKLAAKWSSFDSLKGRFAGRPNLEQSSA
FT                   DNDEDDEELYGDFEDLENGDQEAASEQDSHSSNEDGDDGSDGAGSDNSFADFEKEEKKD
FT                   LTTDQERERNAAKKESLRLQFEMEEGDNFKEDDPENEFDTWYELQKAKMAKQQEINNAE
FT                   LESMTPEQRQKIEGFKAGSYVRIVFDALPMEFVENFDARYPIIMGGLLPTELKFGILKA
FT                   RMRRHRWHKKILKTNDPLVLSLGWRRFQTLPIYTTTDSRTRNRMLKYTPEHSYCFASFY
FT                   GPLCSPNTTFCGVQVVANSDTTGNFRISATGIIEEIDASVEIVKKLKLVGYPYKIFRNT
FT                   AFIKDMFSSAMEVARFEGAQIKTVSGIRGEIKRALSKPEGHFRATFEDKILLSDIIILR
FT                   SWYPVHIKKFYNPVTSLLLKNKSEWKGLRLTGQIRASQGLETPTNADSAYKKVERVERR
FT                   FNGLKVPSSVQKTLPFKSQIHQMKPQKKKTYMAKRAVVLGGEEKKARSFMQKVFTISNA
FT                   KDEKKKAKKQDERKERLKKLAKIEETKTEKEKERKKKFFSEHGKKRQFDSSADGASSKK
FT                   RR"
FT   gene            <340497..>343829
FT                   /locus_tag="KLTH0H03740g"
FT                   /old_locus_tag="KLTH-ORF1768"
FT   CDS_pept        340497..343829
FT                   /locus_tag="KLTH0H03740g"
FT                   /old_locus_tag="KLTH-ORF1768"
FT                   /product="KLTH0H03740p"
FT                   /note="similar to uniprot|P53125 Saccharomyces cerevisiae
FT                   YGL133W ITC1 Component of the ATP-dependent Isw2p-Itc1p
FT                   chromatin remodeling complex required for repression of a-
FT                   specific genes repression of early meiotic genes during
FT                   mitotic growth and repression of INO1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30182"
FT                   /db_xref="GOA:C5E2C1"
FT                   /db_xref="InterPro:IPR013136"
FT                   /db_xref="InterPro:IPR018501"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C1"
FT                   /protein_id="CAR30182.1"
FT                   /translation="MVLYKRKPIILPPPRPLPSNINVRVWHINESGEWFTKYTEYLERM
FT                   DFYMRRQFTCEITGTSCLTFFEALNSEEMQFRAVEEKFPLKLREPVAKFLHFNETRRVD
FT                   LLVEQVYSRFKKDFYPGERVYLRKKIAAPHTPSPTGQAVEENDKHTPMPLQNLQRPYLV
FT                   KEKASFNAVVDFATKEEIRSAYSKYMITEEFGSKSLMVDEDEIFRDRCTFTKHLIKCFC
FT                   KITLRRASTKIGAPLCVKDEYLSMYGLTLDWPPSMLQYKVDTPAEPVVPSDALSSPSAY
FT                   HGYSYQEEKSGKRPNDQIEGELPGIKRSKSPSVFPTPYDVNEFRETKATYNGPNRALQH
FT                   AFCYSQNLNRVPLNKPGSRFGKMNKLLEVYQFFQTFSKVLYVSPFCLDAFVFSLKYTDV
FT                   REMEGVKIQAITNIPGVRENTPEIADTPISEMSEIEKWAEEQIPGICEFLESQKTPLVS
FT                   YVLRKSRDLNDNFLNDIYSNGTALIIECFVALERLFIDENGEWRCLVMDQWYDSEEEEQ
FT                   PSDSTKSAHDDAHKIDDEGKSIVEKEDEISNPEVDDLLEKCLNYRNVNWSERLSKRQFK
FT                   NGSWLIILLGIFQDCIHLPMYTEFIQKFVKAIVPPEPTTPNLNKVLWQNFCENLRLEDK
FT                   LEALWVLVDVASNFSQDIKVFIEDTMEVCVQIRSERLKISKRLKTETANLVDLNVKLKE
FT                   LESSSEKILEITNDEVQAHISAQQEKIDNINKDRETLNQKLIENDIRRLNSLGMDRNGN
FT                   KYYWQELCGVQRTRGGKDADFGSGRLWVQGTALGDAKRLLHLPSKGASLWKKLLCNSTA
FT                   GQVVDQLFPGEGPAGNELVPVEYQEDGMVQPNLKHLVEGFSTLSPIQRKILDESIQGLL
FT                   LGEHAWAYIETPIEINVLITWLTEGGSVDQTLSRQARSIKPALLDTLDQKEKVYKTEQI
FT                   PENQEALLKRFEESKINETDAQACQGRTVSDHIPDDEKELEAIAEEIMALDDTASKTRT
FT                   ALNRIKELEERRDFLLNKRTFESHATRVQSRAQHQKISQEIEKKLDAQEAALNECWQLP
FT                   LSSSRAEAMNWKNELALSAWGLSLYAGATGKVKNGNQLSVKQRMADIFSSLLSYGQNDH
FT                   DNA"
FT   gene            <344164..>345174
FT                   /locus_tag="KLTH0H03762g"
FT                   /old_locus_tag="KLTH-ORF1765"
FT   CDS_pept        344164..345174
FT                   /locus_tag="KLTH0H03762g"
FT                   /old_locus_tag="KLTH-ORF1765"
FT                   /product="KLTH0H03762p"
FT                   /note="similar to uniprot|P21560 Saccharomyces cerevisiae
FT                   YPL215W CBP3 protein required for assembly of ubiquinol
FT                   cytochrome-c reductase complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30183"
FT                   /db_xref="InterPro:IPR007129"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C2"
FT                   /protein_id="CAR30183.1"
FT                   /translation="MFRTLFVANKASSCSASTPLKAFRCLARAGYSVKANREEAKELES
FT                   PEELAQKSKLKAKPIDYSNNAPVNPKKKRPFLSGSKYESRVYQLPKWKEALGEIVIRSF
FT                   NLDMDKVRAGPVAGSYYYALCKEQGLQFENEPLSTTARFFYEDLKLPRTFSQWFQITIL
FT                   HEWILFVRMRAMPFKYGRNYQQKLVDRTFSDIELRLFDEMNVNSGRIADQYLKDFNSQL
FT                   RGAVFAYDEGLFTDDSTLAAAIWRNLFGGRKNVDMVHLEATVRYVRAQIYVLSKMSDRE
FT                   FAMGKFKFVSPDETVYRLTAQQEAEMKENVKRKYEEMDRNPDLLPSERSKLSYDN"
FT   gene            complement(<345221..>346837)
FT                   /locus_tag="KLTH0H03784g"
FT                   /old_locus_tag="KLTH-ORF1764"
FT   CDS_pept        complement(345221..346837)
FT                   /locus_tag="KLTH0H03784g"
FT                   /old_locus_tag="KLTH-ORF1764"
FT                   /product="KLTH0H03784p"
FT                   /note="similar to uniprot|P41835 Saccharomyces cerevisiae
FT                   YPL214C THI6 bifunctional enzyme with thiamine-phosphate
FT                   pyrophosphorylase and 4-methyl-5-beta-hydroxyethylthiazole
FT                   kinase activities"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03784g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30184"
FT                   /db_xref="GOA:C5E2C3"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C3"
FT                   /protein_id="CAR30184.1"
FT                   /translation="MFDKNKVDYSLYLVTDSTMLPPGTTLESQVEAALKNGVTLVQLRE
FT                   KETETKVFIEQALKVQKLCHKFQVPLIINDRVDVALAIDADGVHVGQDDMPIKMVRQLL
FT                   GPSKIIGWSVGYEHEVEQLAAMGPGAVDYIGLGMVYPTLTKKNPKKAPMGPRGVSKLLD
FT                   KLQSTNAEWCRTVAIGGLHPDNIPRVLYQIASSDGKRSLDGISVVSDIMASPEAGNAAQ
FT                   TLRALIDQSSFHYAQGLSPCRKDFSSELAKECVQQMTEASPLVQHITNKVHQNFGANVT
FT                   LALGSSPIMSEVEPEFEELSQISHATLLLNTGTVAPFNTLLQAMCAYNAAKRPIVFDPV
FT                   GYSATSTRLELNNQLLAYGQFACIKGNVGEILSLADLNKGKMRGVDAGSVGSDISLCVE
FT                   ATKIVAYRYRTIAVCTGQQDIVVDGTCGGTFELSEGSAARASDLPALIVEAGEIPVMGK
FT                   ITASGCSLGSTIACLVGGISDKQHLFHAVTTAVCLYKSAGKIASERCNGSGSFQVELID
FT                   ALDQLFTKNQPESWVAKVSRI"
FT   gene            <347049..>347747
FT                   /locus_tag="KLTH0H03806g"
FT                   /old_locus_tag="KLTH-ORF1763"
FT   CDS_pept        347049..347747
FT                   /locus_tag="KLTH0H03806g"
FT                   /old_locus_tag="KLTH-ORF1763"
FT                   /product="KLTH0H03806p"
FT                   /note="weakly similar to uniprot|Q08963 Saccharomyces
FT                   cerevisiae YPL213W LEA1 Component of U2 snRNP disruption
FT                   causes reduced U2 snRNP levels physically interacts with
FT                   Msl1p putative homolog of human U2A' snRNP protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30185"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C4"
FT                   /protein_id="CAR30185.1"
FT                   /translation="MKITPSVVLDAPTYYVSHFNGVYDTEKCVVIRDLGIECDDEAMPA
FT                   VLAKLPKPTHVLDLTNNELNQIPDLSAHDEITTLLLGRNRISKIDGRRLPRRLRRLVLS
FT                   NNGVEQLAALEGLRDAPKTLENLSLRGNSVCHLEDYRVFALSRAPQLKTLDFTKISDQE
FT                   RNAGCKFRSSPGKDIAPSRQKFKDKNEEIMDVIVGKMSDEVRNRLKDELAAASTLDEIE
FT                   RIESLLSGGV"
FT   gene            complement(<348388..>352851)
FT                   /locus_tag="KLTH0H03828g"
FT                   /old_locus_tag="KLTH-ORF1760"
FT   CDS_pept        complement(348388..352851)
FT                   /locus_tag="KLTH0H03828g"
FT                   /old_locus_tag="KLTH-ORF1760"
FT                   /product="KLTH0H03828p"
FT                   /note="similar to uniprot|P53127 Saccharomyces cerevisiae
FT                   YGL131C SNT2 22% sequence identity with S. pombe Snt2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30186"
FT                   /db_xref="GOA:C5E2C5"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR029617"
FT                   /db_xref="InterPro:IPR034732"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C5"
FT                   /protein_id="CAR30186.1"
FT                   /translation="MASESDASSRRRAVRKINYNEKDADADLVKRIQLMEKTRESVTSL
FT                   NKTKVSKNKYQSYLSSKSVTWNFIPSLPPSFRKHSRFSNILDLEDALIDVTTDTLSQDG
FT                   SALLKRNDHIYMVSEPPGEPYYIGRIVKFVAKPEFRSYIEESLEYVNTFPAKYFQVKMN
FT                   WYYRPRDVQDKIQNLNPRLLYASLHMDVCPIHSYRGKCNVVHRSALNISEESQNEQVWK
FT                   PNTFYFEQLFDRYTLKFYDIWSSRKQLLSLDPNSVYLISLANMYPFVFTEESFPIQKII
FT                   DKYVLGKETPDRETWDYKCGECGGWCEKTQRIKCDECQVYVHLFCLDPPLERKPIKGVI
FT                   WICSRCLHHDKESESLTEPHCQTLEFQTLQSRSGKKCALQSIPSNPENLWFHYLGSKVV
FT                   DFMDDILIPELVLPFPLKNSRIGPRYQWTGYEKEVEKGEPHNGPKNERGGDETSELLWK
FT                   FDSSRIGDKELNEYTHKCQKTFPPQLDVLPQTSNFLDMILKLLMSCNYNANEAFALCQK
FT                   LLSRETLQEPTFTTEEIKKFEEGVAEYGSELHPVCKHVGTQPMSMIVRFYYYWKKTPNG
FT                   RRIWGNYKGRRKNQKHANSASEHAVSSFGKKSRIRKPSKTLREDLSSSSKEWKHIDDSS
FT                   FDSEKISNVKTCFKCMFCEIDYSPLWYRVTGGCDDENIKTRMLTGVDEKTSTSHKLPHQ
FT                   SLKSKKSNENPSLEALCIRCARLWRRYAVKWISPLDVIRRLNGKYASSIRNALDELLAD
FT                   PADTTIKVAPNQLMEKCVEWELAQDAELILKQRFHMLDDTERYLKMKRNCISMHTQLNK
FT                   AVKKLVDKDPQADSKMQDELKEYVQSIMQEVRKKEKKAKAVKNKVKTSKAKENHKMIQT
FT                   SGEQRSFKNNLDTAAFKSSTTTLIDSNGEKNVEVKQERVLTSLNHTLPAGDHKLQVFVE
FT                   SGKKKIGEITVDSNFENLRLSEELYNYLLDLSSENASLQEKDSRTCDIVNVAKAESHIT
FT                   EESKKHYDPTCLQITNGSNVPILPGNDFSRVLETYHCHNPLHYEWSQGALPKVTNDFIQ
FT                   SVIRGVRPITQNNIGRKARNPAIAVEEPNCEGSLTPRNFCCVCLENFSHDYNEEITCSN
FT                   CGLNAHYFCYGFKPRVCRKSSKDEIKLKNLQWLCDTCSNDLNPICSTNYQCSLCNAKES
FT                   DYDGGKKRLSRSIPDALKITSNNTWCHVSCSLFNPDLSYNSLARLQIAGNIKSTLIKCG
FT                   GKACVICGVSGGGIVNCEECDFSCHVTCAQDYQKCSILFKKLYVDDDAQFYSVINDKGQ
FT                   KFQIKPIILCPKHQSYTKDTTALNYRNEKGTSFLEIYCNNNKCFEEMRSGTVKFRAMDN
FT                   RGGMALSQKFGSLFLGSQTSNPFGKVACKNCNKTSSIFWYNNVCHACHHHLSNSRSNLL
FT                   LNEASVVDEKATVNTVLTDYLLKGLESTKPSLPLGKKGIKRQNGSTALKGKKKFKSVEA
FT                   ETPSSGKPPLTMPVVVQNLSGKNMRV"
FT   gene            <352972..>354378
FT                   /locus_tag="KLTH0H03850g"
FT                   /old_locus_tag="KLTH-ORF1759"
FT   CDS_pept        352972..354378
FT                   /locus_tag="KLTH0H03850g"
FT                   /old_locus_tag="KLTH-ORF1759"
FT                   /product="KLTH0H03850p"
FT                   /note="similar to uniprot|Q01159 Saccharomyces cerevisiae
FT                   YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
FT                   enzyme), alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03850g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30187"
FT                   /db_xref="GOA:C5E2C6"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR017075"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C6"
FT                   /protein_id="CAR30187.1"
FT                   /translation="MDNRAAPEIPGIRQPANVTQDIRLLVCKLLNSPKPAKTFPGSQPI
FT                   SFHHSDIEEKLLQQDYYVCEKTDGLRGLMLIVINPVTKEQGCFIIDRENNYYQVNGFRF
FT                   PRLPKQSRKELLETFQDGTLIDGELVLQTNPVTKVKELRYLMFDCLAINGRCIVQSPTS
FT                   SRLAHLGKEFFKPYYDLRSLYPAQCATFPFKISMKHMSFSVDLVKVANSLDKLPHVSDG
FT                   LIFTPVTTPYVVGGKDSLLLKWKPETENTVDFKMILDIPKAEDTSLSKNDPNRFFYNYG
FT                   VKPSFHLYIWQGGADVNARLHDFEQPFSKKELEVLDRTYKKFADLDVSDSQWTELKSLG
FT                   EPLNGRIVECAKDQETGVWRMLRFRDDKLNGNYVSVVQKVLESISDSVKIEDLEEATAQ
FT                   MKSNWEKRQIEKKRGFQEVQDARRVTQPAPPTQPAPQNTEQPKYIDDDDEELWSDDDDE
FT                   SDTEAKRQKL"
FT   gene            complement(<354482..>355798)
FT                   /locus_tag="KLTH0H03872g"
FT                   /old_locus_tag="KLTH-ORF1757"
FT   CDS_pept        complement(354482..355798)
FT                   /locus_tag="KLTH0H03872g"
FT                   /old_locus_tag="KLTH-ORF1757"
FT                   /product="KLTH0H03872p"
FT                   /note="similar to uniprot|Q01163 Saccharomyces cerevisiae
FT                   YGL129C RSM23 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30188"
FT                   /db_xref="GOA:C5E2C7"
FT                   /db_xref="InterPro:IPR017082"
FT                   /db_xref="InterPro:IPR019368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C7"
FT                   /protein_id="CAR30188.1"
FT                   /translation="MSLIGVRNFSSSSLRAAAPTRGKAQGFAKKVSGAKTTGKKVSAGS
FT                   LYKPWQQTIATSNLNKNAFPVEVPTFKPSEISQCVDQVMSFSNAHYKYLYTLGSFKQNQ
FT                   FNELFPRPISMVRRNTTQKLFELLKNSPDRKFILTGESGIGKSVLLSQVHSLAFEENAL
FT                   VINISYPELFLNGTNDFFYDGASYVQPMYLKRLLNKILKANNKNLLSSIPISGNYKFAN
FT                   ADPKDSASRKFVQITGGKSTLLDLISVKTSPRNRGDLFQAVIQELSKQAKVPVVFTVDN
FT                   FSRITSEPKSAYKNSNNENIHVLELQLGKTIMEIVSGKVLFPHKLSAVVLATSGCDRTN
FT                   RTLPVGLQKQPHDPYVSRKHYDHDLACLLSKGNVREFPVNKLSKQELQNLLEFYYKAEI
FT                   ILSKDNNEKTIEQLVDEKYLLSGNGNPRELLKSLVLQFS"
FT   gene            complement(<356036..>357744)
FT                   /locus_tag="KLTH0H03894g"
FT                   /old_locus_tag="Klth0H.mRNA.cn.5.m"
FT   CDS_pept        complement(join(356036..357524,357593..357744))
FT                   /locus_tag="KLTH0H03894g"
FT                   /old_locus_tag="Klth0H.mRNA.cn.5.m"
FT                   /product="KLTH0H03894p"
FT                   /note="similar to uniprot|Q12211 Saccharomyces cerevisiae
FT                   YPL212C PUS1 Involved in tRNA biogenesis; intranuclear
FT                   protein which exhibits a nucleotide-specific intron-
FT                   dependent tRNA pseudouridine synthase activity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30189"
FT                   /db_xref="GOA:C5E2C8"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR041708"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C8"
FT                   /protein_id="CAR30189.1"
FT                   /translation="MSETNNLRPAYDDDQPGEEAYKRGNQYKWTKARKADYEETGDDTE
FT                   SSNKKAKIDPTAEVKISGNEEVKEKRLPKRKVAVMIGYCGTGYHGMQYNPPTPTIEAEL
FT                   FRAFVEAGAISQANSKDLKKSGFMRAARTDKGVHAGGNVVSLKLIIEDPDIIAKINSKL
FT                   PEGIRVWDIERVNKAFDCRKLCGSRWYEYLLPTYSLVGPKPGSALYNDIEASKKEIPGV
FT                   MPDDEESAKFWASFFEEIEQKFTPEELELIKSYTPPPRDEFDDDDPTYQLVKNYKLIEN
FT                   AHRRAYRISESRLEAFRAAMKQYLGPHNFFNFTLGKEFKDPSAIRFMKEIKVSDPFVIG
FT                   ERNTEWVSIKIHGQSFMLHQIRKMISMATLVTRCSCPVDRITDAYKPQKINIPKAPALG
FT                   LLLECPVYEGYNKRLKEFGYNPIDFSKYQDKMDEFKMKHIYDKIYQEEVSENVFNAFFS
FT                   YIDNFSQVTGAQSVDDGTANPASAQKSVFDFLTARGIVPSTEESPKKEAEEAPQTAAPG
FT                   AISTSPSEGEMEASTNNPSKPSSNEPNVV"
FT   gene            <359019..>359564
FT                   /locus_tag="KLTH0H03916g"
FT                   /old_locus_tag="KLTH-ORF1751"
FT   CDS_pept        359019..359564
FT                   /locus_tag="KLTH0H03916g"
FT                   /old_locus_tag="KLTH-ORF1751"
FT                   /product="KLTH0H03916p"
FT                   /note="highly similar to uniprot|Q08962 Saccharomyces
FT                   cerevisiae YPL211W NIP7 Nucleolar protein required for 60S
FT                   ribosome subunit biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30190"
FT                   /db_xref="GOA:C5E2C9"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016686"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR040598"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C9"
FT                   /protein_id="CAR30190.1"
FT                   /translation="MRQLTEDETKVVFEKLAGYIGRNIKFLVDNKDQPFVFRLQKDRVY
FT                   YVPEHIAKLATSVARPNLMSVGLCLGKFTKTGKFRLHITALTILAQHAKYKIWIKPNGE
FT                   MPFLYGNHVLKAHVGKMSEDIPEHAGVIVFSMHDVPLGFGVSSKSTSESRDVQPTGIVA
FT                   FRQADIGEYLRDEDTLFT"
FT   gene            complement(<359677..>361488)
FT                   /locus_tag="KLTH0H03938g"
FT                   /old_locus_tag="KLTH-ORF1750"
FT   CDS_pept        complement(359677..361488)
FT                   /locus_tag="KLTH0H03938g"
FT                   /old_locus_tag="KLTH-ORF1750"
FT                   /product="KLTH0H03938p"
FT                   /note="similar to uniprot|P38688 Saccharomyces cerevisiae
FT                   YPL210C SRP72 Component of the signal recognition particle
FT                   (SRP) ribonucleoprotein (RNP) complex that functions in
FT                   protein targeting to the endoplasmic reticulum (ER)
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30191"
FT                   /db_xref="GOA:C5E2D0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013699"
FT                   /db_xref="InterPro:IPR026270"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D0"
FT                   /protein_id="CAR30191.1"
FT                   /translation="MKDLTSLLSDLNVQYNSNKHFEAAKVCKELIEAGVEDKISVLGQW
FT                   LVSLIKSDCYKQGWDLLNQYDQELKGLYHLERLYIFYKLGYTKSFEKLYDELKDIEQAN
FT                   SFENRGLLHVRAQFCFKNGKFEEAVKIYQLLATHNEQQLDNETELACNERAAVGSTYQS
FT                   GYESLLVTSLNEDSYDLLFNESLIALRRGDLDLSLKYLNQASSLAAQEGSDDDQNAIEL
FT                   QKAYVLQASGEKSEAKDILNDLVSKTMAGSTMHLLAQNNLKSFHDFSKYTTNVSLLLRE
FT                   LDVAKLSGKVSSLGHEQQQIILNNVLFLNLFNGCGIQSKKSLVSKTLANYRKTIANVVL
FT                   EPYSTQAKKMFNRTMSAMSCGTGGSVFGSIVLTVQLQVLEKNFDGAIVLCESYLNKNSD
FT                   SVNYEHRVVCYILLQLYRESGRSSSSNRLLEHLFAIVKDNNVKEDPEFWRFVAFNLLAQ
FT                   GFGSKAEDMFAKLQRISPELQLFNSSSEQHDVLSSDLDSLVSSVDVESLKKLGAAPFEG
FT                   QRTRMRDTSLGKVAKKRRVHKNRKFPKDFDAEREPNPERWLPLKDRSDFRPKKKLAAKQ
FT                   TQGSAISRKSEQSLDISKKNRTKKGKK"
FT   gene            <361653..>363323
FT                   /locus_tag="KLTH0H03960g"
FT                   /old_locus_tag="KLTH-ORF1749"
FT   CDS_pept        361653..363323
FT                   /locus_tag="KLTH0H03960g"
FT                   /old_locus_tag="KLTH-ORF1749"
FT                   /product="KLTH0H03960p"
FT                   /note="similar to uniprot|P53166 Saccharomyces cerevisiae
FT                   YGL064C MRH4 Mitochondrial RNA helicase plays an essential
FT                   role in mitochondrial function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03960g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30192"
FT                   /db_xref="GOA:C5E2D1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D1"
FT                   /protein_id="CAR30192.1"
FT                   /translation="MNPLLRSMSHPVIRSLGSFRCSSTYARGAARIGGKNKSSRHSLVS
FT                   TIKKSPANRNKKDEPSSQIFHYGAFGGLKEINAQDSQKTAGILSKVTDFDQLKILPEVR
FT                   TAVKKVISRETIAKSPDLTEASEKDIKPSPVQVAVIQKLSKTLTNRQLQVHMVAAETGS
FT                   GKTMAYLTPLLDYLKRGEQDDPEGWDQIKDKAIVRSVILVPTHELVEQVYKTVKLNADL
FT                   LGLHAFRWNMDTSYNDFIEAVKARIDLLVTTPGKVLNMFKVRIINRPERLLSGVRFAVL
FT                   DEADTLMDRSWLEETHSAIKSFPNANHLIFCSATIPSEFSKTMDRLFPTSEAITTPKLH
FT                   KISQKIDFKLIDASLNPYKGSKLKALAQALYAIMKDGTEEGFEKRCLIFVNEKKDAKKV
FT                   AEQLTERYGHNCVSLTGEDAISERLDKISAFVNPPKRLNEAPSKLSDDSSKTVKREPTM
FT                   LPNSNIKLTTSSSNLHGKKNTSLKVLVTTDLMARGLNFQGVRNVILFDVPKTSIDLVHR
FT                   AGRTGRMMQGGRVFMIIDKKTKSWAKAVPKIVRNNKTLS"
FT   gene            complement(<363432..>364628)
FT                   /locus_tag="KLTH0H03982g"
FT                   /old_locus_tag="KLTH-ORF1747"
FT   CDS_pept        complement(363432..364628)
FT                   /locus_tag="KLTH0H03982g"
FT                   /old_locus_tag="KLTH-ORF1747"
FT                   /product="KLTH0H03982p"
FT                   /note="similar to uniprot|P38991 Saccharomyces cerevisiae
FT                   YPL209C IPL1 Aurora kinase involved in regulating
FT                   kinetochore-microtubule attachments associates with Sli5p
FT                   which stimulates Ipl1p kinase activity and promotes its
FT                   association with the mitotic spindle potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H03982g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30193"
FT                   /db_xref="GOA:C5E2D2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR030616"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D2"
FT                   /protein_id="CAR30193.1"
FT                   /translation="MTTDTRGTIFGKLLGVMNGKSTAGSEMRRNSLHQRNLLLSMRLNS
FT                   GPGRKSLGTSSRGTTSHRLTKENWRASFSSGSSRLGVAPTFSGQKSLQDSRSRVSSPVK
FT                   VGADDGRSSPAKVPLLSGTKADSSPARYKDFTLDDFEIGKKLGKGKFGKVYCVKHKQTG
FT                   FICALKAMKKKEIIQYNVEKQFRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVN
FT                   GELYKHLRSHGPFNDIVASHFVYQMADALDYMHSKHIIHRDIKPENILLGFQNTLKLTD
FT                   FGWSVTNLNNSRRRTLCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGTPPFLED
FT                   SKEMTYKRIKRRDLKFPDHISSQARDIISKLLEYEPNARIALRDVKKHPWILKNRPFW"
FT   gene            <365097..>366854
FT                   /locus_tag="KLTH0H04004g"
FT   CDS_pept        365097..366854
FT                   /locus_tag="KLTH0H04004g"
FT                   /product="KLTH0H04004p"
FT                   /note="similar to uniprot|Q08961 Saccharomyces cerevisiae
FT                   YPL208W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30194"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D3"
FT                   /protein_id="CAR30194.1"
FT                   /translation="MQAEKLKVLLDWGLDNGVKCPDDVEFVNVGGKGFACIAKSDITEA
FT                   EFIIPESLIIKSSLAVSFFKVNSNQTSWLKLLIAKLKFDKSSTTVDDENLKAKFAPYID
FT                   ALPDEIDSPLVWNPSELDLLGNTNLRSSLRIKLYSIFNEWKLIMETLKKHRNEVQAEIL
FT                   NIEETLGQSEDHVYRNITSKVFQHSSETDWWSFPAFLWSHMMFLSRAFPEYVINPSTDP
FT                   SNVVLLPIIDLLNHDYRSKVEWNQRDGAFGVRKLETVLRGEEIFNNYGGKGNEELLSGY
FT                   GFVLEENIFDTVALKIQLPLTTVSEITSTTHLFLPTLSDYTTSAFELSSGKETKQMLPK
FT                   KDSQYKDGVLYLLSKENDAPLRWLLDLFSFLEKSPDESCSSLRVRLQGLQNLRNAIETK
FT                   LSSTSSTSDRQAAGYDIKEYRARAARIYKSGQTKALKHAVNELKRTEKEWTSQHKGDLL
FT                   TAKRIMRFDPNFMESELPLLLRTNANSDITLDSYDTLIILWVACKAVFNTCPREAQWAM
FT                   DAFKAYSDCRENTMASSAEGQHLYQTFFPNGSSRLGQEQFINATEFLQHFSYTRLSNGE
FT                   VILVKDVNL"
FT   gene            <367008..>369362
FT                   /locus_tag="KLTH0H04026g"
FT                   /old_locus_tag="KLTH-ORF1743"
FT   CDS_pept        367008..369362
FT                   /locus_tag="KLTH0H04026g"
FT                   /old_locus_tag="KLTH-ORF1743"
FT                   /product="KLTH0H04026p"
FT                   /note="similar to uniprot|Q08960 Saccharomyces cerevisiae
FT                   YPL207W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30195"
FT                   /db_xref="GOA:C5E2D4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D4"
FT                   /protein_id="CAR30195.1"
FT                   /translation="MELSTKLTDHLVVCAVVAVYLISGGRLSIGISVAVLYALAIHDSG
FT                   RKVEVSEAGIIQAKSGVAGKPEKKTCCGGKGGSSCCSSGSGGKKGGCCGGSCASKKRAE
FT                   EKPASTGPVFESSASEPIAIDFTHAFKPARSSKPKSGAKKMPRFISRTAGSAKKDTGFF
FT                   KKALTVSNEKLSNSQIYVFYSSLQGAAERSAKTVLETLSGMPELKYEPKLLNLDELSDF
FT                   DDYFVNVPCSYALYILVLPSYDSDSPLDFFLQSLQENASDFRIDKYVLRKLVGYAVLGI
FT                   GDSESWPEKFCYQARQADLLLAKQGGRRVFPVGEICMKFGGDPKVSEWSKLLAETLCDD
FT                   EPILYEYDETLDDEEPQDPEDELTKEPLIDLEDVGKSSELQDVSSVKKMIVKDSPTFKN
FT                   LTKQGYTVVGSHSGVKICRWTKNDLRGRGSCYKHSLFNIVSSRCMELTPSLACSSKCIF
FT                   CWRHGTNPVSKTWRWEVDDPEYILENALQGHYAKIKQMRGVPGVIAERFAKAFKVRHCA
FT                   LSLVGEPIMYPFISKFVSLLHQKEISSFLVCNAQHPEPLRDLGKVTQLYVSIDAPTKNE
FT                   LKKVDRPLYRDFWERLMECLDILRTTQSHQRTVFRMTLVKGFNMADVSAYADLVQRGLP
FT                   CFIEVKGATFCGTSDGNGNPLTMQNIPFYEECAKFVKSLAAELQRRGLGYDVAAEHAHS
FT                   NCILIASTKFKINNEWYTHIDFDRFFELLNSGKDFNHMEYLQKTPEWALFGNGGFAPGN
FT                   TRFYKKKRGQEAQAKEEQGLQENVSTQPINA"
FT   gene            complement(<369508..>370734)
FT                   /locus_tag="KLTH0H04048g"
FT                   /old_locus_tag="KLTH-ORF1739"
FT   CDS_pept        complement(369508..370734)
FT                   /locus_tag="KLTH0H04048g"
FT                   /old_locus_tag="KLTH-ORF1739"
FT                   /product="KLTH0H04048p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30196"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D5"
FT                   /protein_id="CAR30196.1"
FT                   /translation="MIKRAFNTTVNRFENTQGDWGYLKQRLTQLKEEAAPDDNDALCGL
FT                   IKGVVKENPSIEKLYDELPRKEYEDRFRSQIQASKLKRFVNKESRETALSRPWTGEEHY
FT                   TDTSLRMIMDGVKNEGGSSGSSRNLGFSSTFQATKESNRYARRAVKTRLRLETAQDRII
FT                   DYKIDKDEHKSDDIEASEFRVLYAEKFTPIGSFEKLKSIADVRIEESMKKGEFDSVKKI
FT                   RGQKLSSTQPLPYVDRTEHHLNDILVRQNISPPWIEKQGSVNKDIMVFRDDLLRKFQSE
FT                   LIAALNLRGFFRTEVPSNSELNQHGKLNSVKESVFSDWKSTLKIGSRIKQLNDSLRSYN
FT                   LQAPLPAQKFYLQADRELQRVLKETDISRLYRDEFSRQKVLHNNAKAANESQATSNSQF
FT                   SWPKKWRIW"
FT   gene            <370823..>372388
FT                   /locus_tag="KLTH0H04070g"
FT                   /old_locus_tag="KLTH-ORF1738"
FT   CDS_pept        370823..372388
FT                   /locus_tag="KLTH0H04070g"
FT                   /old_locus_tag="KLTH-ORF1738"
FT                   /product="KLTH0H04070p"
FT                   /note="similar to uniprot|P43636 Saccharomyces cerevisiae
FT                   YGL065C ALG2 Mannosyltransferase mannosylates Man2GlcNAc2-
FT                   PP-Dol to form Man3GlcNAc2-PP-Dol which is a precursor
FT                   required for asparagine-linked protein glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30197"
FT                   /db_xref="GOA:C5E2D6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR027054"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D6"
FT                   /protein_id="CAR30197.1"
FT                   /translation="MQGKQEAMKRGNNEGSLPKLNIAFVHPDLGIGGAERLVIDAAVGL
FT                   QQQGHEVVIYTSHCDKNHCFEEVKSGEIKVEVFGDFLPTNLAGKLFIMFANLRQLYLTT
FT                   KLMSKGKIHHHDLFIVDQLSTCVPLLSAFGNRSRVLFYCHFPDQLLAQRTNLIKSLYRI
FT                   PFDLLEQLTMNAADCIVVNSNFTKSVYKRTFRLFSQKPNVVHPCVGLETELVQDKDFAL
FT                   YKKLFPPSTRFYLSVNRYERKKNIELAIKSFALSTESKRSNVKLVIAGGYDDKVLENKE
FT                   YLKELQNISKNSNLPYFTLHYAHWDQQLSDSGISGATDAKVLFLTSISSSLKDQLLRET
FT                   DLLLYTPSFEHFGIVPLEAMKLGKPVLAVNNGGPLETIVSLIPNTNENNSTGWLRPSDP
FT                   KEWADAIEESRDFIKEVDNIFKNNGPERVKKLFSRTAMTNQFEKNIQDISWKTDKKSWL
FT                   GYIMFISSVLSVIFPAALLMGCNSLSFCVLNATLVILFHSVPTLMCIVSAVLLTRLFEV
FT                   LIQK"
FT   gene            complement(<372453..>374153)
FT                   /locus_tag="KLTH0H04092g"
FT                   /old_locus_tag="KLTH-ORF1736"
FT   CDS_pept        complement(372453..374153)
FT                   /locus_tag="KLTH0H04092g"
FT                   /old_locus_tag="KLTH-ORF1736"
FT                   /product="KLTH0H04092p"
FT                   /note="some similarities with uniprot|P53165 Saccharomyces
FT                   cerevisiae YGL066W SGF73 SaGa associated Factor 73kDa
FT                   Probable 73KkDa Subunit of SAGA histone acetyltransferase
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30198"
FT                   /db_xref="GOA:C5E2D7"
FT                   /db_xref="InterPro:IPR013243"
FT                   /db_xref="InterPro:IPR037804"
FT                   /db_xref="InterPro:IPR041251"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D7"
FT                   /protein_id="CAR30198.1"
FT                   /translation="MTDIHSEIKGLRKDIQKDLEPRTASSTPNWKELISIAKSERSKSE
FT                   KPPSHSDYFRDSASIIKNPLDKPLDYRICDGCGKPVSLSAIVEHLQTYCKGLPEHPLPN
FT                   SVKVEEQEQPVDMSSSSIKKKNNPSNSKRSTPFGHDPDPESSPAIKKQRKTTATPASSK
FT                   AKRRIKQRNPTEKHLIDFDKQCGVELPEGGYCGRSLTCKSHSVGTKRAVEGRSEPFDVL
FT                   LSHYQKKNQLKTGNNTKLRAKPGQQSNSTNQGHSVHSGDGSMSTLTPEEETTQVLNGVS
FT                   RSFPLPLETNVLASSRSRTKYFRMREMFASSFSVRPGFSAPGYGAIHSRVGCIDLDRTT
FT                   DYTFRIRTPQLINQMNPNNLTPQQKQKLQQQRMLQAQMLAQQQQQQQQQQQQQQQQQQQ
FT                   QQQQQQHQQQQQQQQQQQQQLQNQSRQGSQTQHFNPVPQQYQNHPQSQQLSNGLVQPKN
FT                   YTSLSQGDLETGLTPQGIQKQQQRLRQQQVQQQRFEAAAFHLATATKLMQSGPKPQNTG
FT                   MVNGTASSVGSPVNMASNSRSNSSPLNQTTGQQLNSRVSNAEYDSGGAS"
FT   gene            complement(<374596..>375561)
FT                   /locus_tag="KLTH0H04114g"
FT                   /old_locus_tag="KLTH-ORF1731"
FT   CDS_pept        complement(374596..375561)
FT                   /locus_tag="KLTH0H04114g"
FT                   /old_locus_tag="KLTH-ORF1731"
FT                   /product="KLTH0H04114p"
FT                   /note="similar to uniprot|Q08959 Saccharomyces cerevisiae
FT                   YPL206C Endoplasmic reticulum protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30199"
FT                   /db_xref="GOA:C5E2D8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D8"
FT                   /protein_id="CAR30199.1"
FT                   /translation="MATAKIIGHRAYRGYYPENTILAFNKAKEANVDVIETDLQMSKDG
FT                   VVVINHDQDTQRCWDKNYVISETNWDALQSLNCKDARFQDQKMPSLKQVLRWIVDNPSM
FT                   KLMLDIKFTNDQEIMLKSVAEMLSTKEDLLFWRERVIWGLWTVDWFRYGMETGVIKDFQ
FT                   VACISLSLEVAKSFVEYSRELNSPHFRLSGVSMHFVSTWSKTFQKKWLHYFQQNNVEIF
FT                   VWTINHAVDFKYCNALPISGFVTDFPVEARGAIGQYERSKTTFKRPFFISREGFRFYGF
FT                   LVIYRLTIEFLFSPWAQYKVFGNFSFSLLFIKFMRIIHFL"
FT   gene            complement(<375792..>376874)
FT                   /locus_tag="KLTH0H04136g"
FT                   /old_locus_tag="KLTH-ORF1729"
FT   CDS_pept        complement(375792..376874)
FT                   /locus_tag="KLTH0H04136g"
FT                   /old_locus_tag="KLTH-ORF1729"
FT                   /product="KLTH0H04136p"
FT                   /note="similar to uniprot|P53164 Saccharomyces cerevisiae
FT                   YGL067W NPY1 NADH diphosphatase (pyrophosphatase)
FT                   hydrolyzes the pyrophosphate linkage in NADH and related
FT                   nucleotides localizes to peroxisomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30200"
FT                   /db_xref="GOA:C5E2D9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D9"
FT                   /protein_id="CAR30200.1"
FT                   /translation="MSTLATRPLTHSLHYSQEVLNRVSFLRKDPQFLEDALAHNETQFV
FT                   PFDNYLPYVNERTGFILKLKKAEVANLTSQGSISSNLVFLGLLLSQKSDFVYKSKYRGT
FT                   PTFAIDVSIQRLSDSSLLDSSKPYKKVESFRDLNKLTVEDSSIVSQARMYLQWLDTHKF
FT                   CSLCGSKTKPVYAGTQLKCDNDDCKSNKSVSNSCFPRTDAVVISAITNKDYSKILLCRS
FT                   GMPRNKERKLYSCVSGFVEPSETLEVAVAREIWEETGLDTQEVEIIASQPWPFPNNLMI
FT                   GCVAIADDTQTPDLTHDCELDEVRWVPCSALERILKLEDSESGFIQDESTGLNLPNDRS
FT                   IAHMLMGFVVKKSAELRKGP"
FT   gene            <378344..>379798
FT                   /locus_tag="KLTH0H04158g"
FT                   /old_locus_tag="KLTH-ORF1726"
FT   CDS_pept        378344..379798
FT                   /locus_tag="KLTH0H04158g"
FT                   /old_locus_tag="KLTH-ORF1726"
FT                   /product="KLTH0H04158p"
FT                   /note="similar to uniprot|P29295 Saccharomyces cerevisiae
FT                   YPL204W HRR25 Protein kinase involved in regulating diverse
FT                   events including vesicular trafficking gene expression DNA
FT                   repair and chromosome segregation binds the CTD of RNA pol
FT                   II homolog of mammalian casein kinase 1delta (CK1delta)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04158g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30201"
FT                   /db_xref="GOA:C5E2E0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E0"
FT                   /protein_id="CAR30201.1"
FT                   /translation="MDLRVGRKYRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSR
FT                   HPQLDYESRVYKYLSGGIGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKT
FT                   VIMLALQMICRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFSTHH
FT                   HIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKR
FT                   QKYDRIMEKKLCINVDQLCAGLPMEFVEYTRYCRNLRFDERPDYLYLARLFKDLGIKLD
FT                   YHNDHLFDWTMLRYTKAMIEKQRALGEQPQQPDEGKDEESKTESFNRVKQLAMKKFSTH
FT                   FHYCKPEDKHHPSPEEIKQQTAQNNNAASSIPQDLLSAIDKDMDSLKQNVVQAPEAVPQ
FT                   PSLQPQMQQQQYQPVQRQAPIAEPLLQRQQEQQQGQQERQLDALQSATNNASPYAPQQS
FT                   QARKPALNTTQYPPANAGPSGGDIWL"
FT   gene            <381111..>382172
FT                   /locus_tag="KLTH0H04180g"
FT                   /old_locus_tag="KLTH-ORF1721"
FT   CDS_pept        381111..382172
FT                   /locus_tag="KLTH0H04180g"
FT                   /old_locus_tag="KLTH-ORF1721"
FT                   /product="KLTH0H04180p"
FT                   /note="highly similar to uniprot|P06245 Saccharomyces
FT                   cerevisiae YPL203W TPK2 Involved in nutrient control of
FT                   cell growth and division cAMP-dependent protein kinase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04180g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30202"
FT                   /db_xref="GOA:C5E2E1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E1"
FT                   /protein_id="CAR30202.1"
FT                   /translation="MEYQNEGYGHSVVPDRPGMGERQRSLLPQRSAVSKGKYSLNDFQI
FT                   LRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTNDERRMLKLVDHPFLI
FT                   RMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHDII
FT                   YRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCGTPDYIAPEVIATKPYNKSVDWW
FT                   SLGILIFEMLAGYTPFYDATPMKTYEKILQGKVAYPPFFHPDVVDLLSKLITADLTRRL
FT                   GNLQSGPQDVKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQYPEEQLDYGS
FT                   QGDDPFMQYFIDF"
FT   gene            complement(<382391..>382903)
FT                   /locus_tag="KLTH0H04202g"
FT                   /old_locus_tag="KLTH-ORF1718"
FT   CDS_pept        complement(382391..382903)
FT                   /locus_tag="KLTH0H04202g"
FT                   /old_locus_tag="KLTH-ORF1718"
FT                   /product="KLTH0H04202p"
FT                   /note="similar to uniprot|P53163 Saccharomyces cerevisiae
FT                   YGL068W MNP1 Protein associated with the mitochondrial
FT                   nucleoid"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04202g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30203"
FT                   /db_xref="GOA:C5E2E2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E2"
FT                   /protein_id="CAR30203.1"
FT                   /translation="MLVRGTRRSALKLARLPAVRARACVRLNSTQAAASVDPKIEKIVQ
FT                   DISKLTLLETSALISELKTQLNIPDIAMPVAGAAPAGAAAPAAEEAKEEEVKEEKTIFA
FT                   IKLESFDAKSKPKVIKEVKNLLGLSLVEAKKFVEAAPKILKDNVAKEDADKIKASLEAL
FT                   GAKVALE"
FT   gene            <383808..>384176
FT                   /locus_tag="KLTH0H04224g"
FT                   /old_locus_tag="KLTH-ORF1713"
FT   CDS_pept        383808..384176
FT                   /locus_tag="KLTH0H04224g"
FT                   /old_locus_tag="KLTH-ORF1713"
FT                   /product="KLTH0H04224p"
FT                   /note="highly similar to uniprot|P27999 Saccharomyces
FT                   cerevisiae YGL070C RPB9 RNA polymerase II subunit B12.6
FT                   contacts DNA mutations affect transcription start site"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30204"
FT                   /db_xref="GOA:C5E2E3"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR034012"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E3"
FT                   /protein_id="CAR30204.1"
FT                   /translation="MTTFRFCRDCNNMLYPREDKDNQRLLFECRTCTYAEEAGTPMVYR
FT                   HELITNIGETAGVVQDIGSDPTLPRSDRECPRCHSHENVFFQSQQRRSDTSMVLFFVCL
FT                   GCSHIFTSDQKNKRTAFS"
FT   gene            complement(<384406..>385968)
FT                   /locus_tag="KLTH0H04246g"
FT                   /old_locus_tag="KLTH-ORF1711"
FT   CDS_pept        complement(384406..385968)
FT                   /locus_tag="KLTH0H04246g"
FT                   /old_locus_tag="KLTH-ORF1711"
FT                   /product="KLTH0H04246p"
FT                   /note="similar to uniprot|P22149 Saccharomyces cerevisiae
FT                   YGL071W RCS1 Transcription factor involved in iron
FT                   utilization and homeostasis binds the consensus site
FT                   PyPuCACCCPu and activates the expression of target genes in
FT                   response to changes in iron availability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30205"
FT                   /db_xref="GOA:C5E2E4"
FT                   /db_xref="InterPro:IPR014842"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E4"
FT                   /protein_id="CAR30205.1"
FT                   /translation="MDQSALDAFHGELIQTSPSLDFLLAEDSPLSTVDTVGTGTTSNTE
FT                   SSGPDFTNGTPSWNDTASLNNMLSENALESINRQRSQNKLIHLDPIPDFQDRNEIKPWL
FT                   QKIFYPQGIEIVIERSDNIKVVFKCKASKRGRASRKQAGCGSLPEEKENPESPLAVKRV
FT                   QQANKKKRSVSPYNTCPFRVRATYSLKRKKWNIVVMNNGHSHPLKFNADSDDYKKFKNY
FT                   LRENEDWDAVKKFDELECRTRFNLPTQPQPIPCDCGLTQEIESFNIVLPTSDSLANSTD
FT                   KTVSKPRHKSTRKGNKQMATALSRNSTPLGFLDKSPSQSARSGQEPQRIKQESTGAPQE
FT                   PHSGMTGLSPMQNFDTSMSGWDPNTLTSQSEEIDFTDLFLRPLPRTKQDPIFEKPQTLN
FT                   SPGRDQPWNASKNFMDDLQFQLAPVCEPSHTSNAHCILPSSTEAHMNCDAMDAGSQHEF
FT                   PHHRVQQQDPSMLHSSPANGMLSSDLGNMHLTGQQMQVPHPDPGLPWEPQHSNDPHGYS
FT                   NDF"
FT   gene            complement(<386347..>387456)
FT                   /locus_tag="KLTH0H04268g"
FT                   /old_locus_tag="KLTH-ORF1707"
FT   CDS_pept        complement(386347..387456)
FT                   /locus_tag="KLTH0H04268g"
FT                   /old_locus_tag="KLTH-ORF1707"
FT                   /product="KLTH0H04268p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04268g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30206"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E5"
FT                   /protein_id="CAR30206.1"
FT                   /translation="MGIPVTIFDGGLLWPNGGIKGFFESCQSEHVEHASRPGLAQRRSS
FT                   GWDLDSGPCWRLERAYTCEDTELTRLPSYKRVDGQFWCFWRPDGSKVGIVAADGNTVLS
FT                   NSMSLSLPSGISAMDIVNAHSVAFGTYDGVHGMYDLGTNRVVYANTSFSQPITHVWCRV
FT                   TADGGSVVTFSSHNTSISVVGLSGVRSETTFLRGGQPTLRPIESVDLNAAATKIAMCDA
FT                   RNVWVHELTSYTYQPVPGLFLQEGEFVVSLKFASTRDSLLVATSQRLLIYEPGTTYAVP
FT                   VCNMRHGAVFEFFEEDSRIMVEQQHLYGTHMACFALDEHTSQWSQVGYSDVRAQFGIRK
FT                   VHYFFALRSQLHVLSDSGNYSRFTSTEDY"
FT   gene            complement(<387890..>389599)
FT                   /locus_tag="KLTH0H04290g"
FT                   /old_locus_tag="KLTH-ORF1704"
FT   CDS_pept        complement(387890..389599)
FT                   /locus_tag="KLTH0H04290g"
FT                   /old_locus_tag="KLTH-ORF1704"
FT                   /product="KLTH0H04290p"
FT                   /note="similar to uniprot|P10961 Saccharomyces cerevisiae
FT                   YGL073W HSF1 Trimeric heat shock transcription factor
FT                   activates multiple genes in response to hyperthermia
FT                   recognizes variable heat shock elements"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04290g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30207"
FT                   /db_xref="GOA:C5E2E6"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR027725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E6"
FT                   /protein_id="CAR30207.1"
FT                   /translation="MQANNAHHSAGPALNEDEIENIINPSDPIVGGTHGTGLGADDGSH
FT                   SVVEDIVNPSWDPAMTMSPGQLDHPSQNIAPFSPFMANSPLAAPPDHNNVIRRGTPVGL
FT                   YQQQGSPSQPPAADSLLSDSILMPYRNRLLKQSRPKTSSPQPPPRRKLTTTKTRPAFVN
FT                   KLWSMVNDSANQKLIHWSADGKSFVITNREHFVHEILPKYFKHSNFASFVRQLNMYGWH
FT                   KVQDVRSGSIHGNSDERWQFENENFVRDCEDLLENIVRQKPSTNPSKDVLVGQNGEEMD
FT                   IGILLSELETVKFNQIAIAEDLKRMSKDNELLWKENMMARERHQAQQQALNKILHLLAS
FT                   LMGSNTQKLLGSDLVNELAQTNANLNDASNVAHGGWDLANMNGLTRPRLLLKNRTPATS
FT                   QHSSTGDLSSLHIGHSNSPIQEIDRSSIYPSNGSSSAGASTTPGGGRAPDTMLESNSPV
FT                   DTSFFNDLHSNIKKQGESIQELQDWITKMSPSQEELGSITPEGTVPQQLAQSPAKTQQP
FT                   NSKFDLQDYLSTSDPSALAPLLPEEPLVQEEKRSSDSDIEEISNPPKKQRTS"
FT   gene            <390454..>391614
FT                   /locus_tag="KLTH0H04312g"
FT                   /old_locus_tag="KLTH-ORF1700"
FT   CDS_pept        390454..391614
FT                   /locus_tag="KLTH0H04312g"
FT                   /old_locus_tag="KLTH-ORF1700"
FT                   /product="KLTH0H04312p"
FT                   /note="weakly similar to uniprot|P53159 Saccharomyces
FT                   cerevisiae YGL075C MPS2 Essential membrane protein
FT                   localized at the nuclear envelope and spindle pole body
FT                   (SPB) required for insertion of the newly duplicated SPB
FT                   into the nuclear envelope potentially phosphorylated by
FT                   Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30208"
FT                   /db_xref="GOA:C5E2E7"
FT                   /db_xref="InterPro:IPR031433"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E2E7"
FT                   /protein_id="CAR30208.1"
FT                   /translation="MDTERHATLLLDLVWPEVDEKAQGFIYAKDFPLVVSRMEEILNRG
FT                   KLERDRAQLVSETGREILRKFGSDQEFFKVYKEDFRELFDGLVGTSFKSAVKSCAGDGV
FT                   LDRLQDSQAVDGIQDEKTSSHALQEEVMRLREQVRVLSSKNDEKDREITARDEIIADLQ
FT                   GKDASPAGSPRSLQRMRTLQARVTSLEDELSFRDEVIREKDRELLNLTKRVGEFKDKYQ
FT                   FLEREFQFYKGHREQKSPDSIKEATRHEFIISELRRKITEQSEIIGQMRMQVEAKPGAL
FT                   HPQGIGSTAGLPLNLPLRLVLRLIIGAILAYLAFDIGIRSLKAVGGLFGSSSPATLTPK
FT                   SELSWWEQNTLLSKLLWFFKDLFDTYNLDAGRDEVVSANYDKLFGV"
FT   gene            complement(<391678..>392478)
FT                   /locus_tag="KLTH0H04334g"
FT                   /old_locus_tag="KLTH-ORF1698"
FT   CDS_pept        complement(391678..392478)
FT                   /locus_tag="KLTH0H04334g"
FT                   /old_locus_tag="KLTH-ORF1698"
FT                   /product="KLTH0H04334p"
FT                   /note="similar to uniprot|Q08954 Saccharomyces cerevisiae
FT                   YPL199C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30209"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR013899"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E8"
FT                   /protein_id="CAR30209.1"
FT                   /translation="MSAAAVASRGQPLSQERDYNHATDSEYKRLRDLADQAYKKRQQLS
FT                   QQSQNAYKNGDRSGAHTLSEQAKEQLQVAEKYNLQAAEFVFTQNNADSSSNEIDLHGLY
FT                   TKEAVWILQKRIAAAVSARESVLKVIVGKGLHSANGIAKIKPAVEDLCQQANLPNYVDS
FT                   KNAGVLVIELQNASVPASWSSTDYATYAHGVPSKPQASHQAQQHQYTGQQQPQYQQQQQ
FT                   SQYQQQQSNYQQQQQQQQSQSQAGNNDLLSTLLGLLCTCVRKNL"
FT   gene            <393543..>394142
FT                   /locus_tag="KLTH0H04356g"
FT                   /old_locus_tag="KLTH-ORF1692"
FT   CDS_pept        393543..394142
FT                   /locus_tag="KLTH0H04356g"
FT                   /old_locus_tag="KLTH-ORF1692"
FT                   /product="KLTH0H04356p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30210"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E9"
FT                   /protein_id="CAR30210.1"
FT                   /translation="MLQDPVRSYPRTKFWSAVSESVHVSAGLTRNSRQCRDRFNLLFSR
FT                   ALLTDGQDVGAGVGLGTDATLDAKLAQCTARFRFGNGRSLELKQRRSHVQAPTRVPQRG
FT                   CAVHELIHPPEHTPGPMPEPGPLPSPAPGPTPADLSLIHTQLREVHRVLEALTAEVVGI
FT                   QHQVRHLQQAFRELQDARQNQKPPVACDEDSVNRDK"
FT   gene            <394987..>395091
FT                   /gene="SNR39b"
FT                   /locus_tag="KLTH0H04378r"
FT                   /old_locus_tag="Klth0H_snoRNA_214"
FT   ncRNA           394987..395091
FT                   /gene="SNR39b"
FT                   /locus_tag="KLTH0H04378r"
FT                   /old_locus_tag="Klth0H_snoRNA_214"
FT                   /product="snR39b"
FT                   /note="C/D snoRNA monocistronic SNR39b"
FT                   /ncRNA_class="snoRNA"
FT   gene            <395550..>396923
FT                   /locus_tag="KLTH0H04400g"
FT                   /old_locus_tag="KLTH.mRNA.197AT.p"
FT   CDS_pept        join(395550..395560,395924..396017,396294..396923)
FT                   /locus_tag="KLTH0H04400g"
FT                   /old_locus_tag="KLTH.mRNA.197AT.p"
FT                   /product="KLTH0H04400p"
FT                   /note="highly similar to uniprot|P05737 Saccharomyces
FT                   cerevisiae YGL076C RPL7A and to uniprot|Q12213
FT                   Saccharomyces cerevisiae YPL198W RPL7B Proteins component
FT                   of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04400g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30211"
FT                   /db_xref="GOA:C5E2F0"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2F0"
FT                   /protein_id="CAR30211.1"
FT                   /translation="MAAEKVLVPESQLKKSKAQQKSAEQIAAERVARKAANKEKRAAIL
FT                   ERNAAYQQEYADAERAVIEAKREAKANGSFYVDAQPKLVFVVRIKGINKIAPKPRKIMQ
FT                   LLRLNQINTGVFVKVTKATSELLKLIEPYVAYGYPSYATVRKLVYKRGYGKINKQRVAL
FT                   SDNAIVEANLGKFGIISVDDLIHEIVTVGPHFKQASNFLWPFKLSNPSGGWGVPRKFKH
FT                   FIQGGSFGNREGFINKLVNSMN"
FT   gene            <396102..>396194
FT                   /gene="SNR39"
FT                   /locus_tag="KLTH0H04422r"
FT                   /old_locus_tag="Klth0H_snoRNA_252"
FT   ncRNA           396102..396194
FT                   /gene="SNR39"
FT                   /locus_tag="KLTH0H04422r"
FT                   /old_locus_tag="Klth0H_snoRNA_252"
FT                   /product="snR39"
FT                   /note="C/D snoRNA intronic SNR39/SNR59"
FT                   /ncRNA_class="snoRNA"
FT   gene            <397467..>399065
FT                   /locus_tag="KLTH0H04444g"
FT                   /old_locus_tag="KLTH-ORF1683"
FT   CDS_pept        397467..399065
FT                   /locus_tag="KLTH0H04444g"
FT                   /old_locus_tag="KLTH-ORF1683"
FT                   /product="KLTH0H04444p"
FT                   /note="similar to uniprot|P19807 Saccharomyces cerevisiae
FT                   YGL077C HNM1 Choline transporter (permease) that also
FT                   controls the uptake of nitrogen mustard expression is co-
FT                   regulated with phospholipid biosynthetic genes and
FT                   negatively regulated by choline and myo- inositol"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30212"
FT                   /db_xref="GOA:C5E2F1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004756"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2F1"
FT                   /protein_id="CAR30212.1"
FT                   /translation="MAQAASTAYEERSLNSGDNVRELRKEDDILVTESVSKNGEEHGEV
FT                   HLRKQFSLWSILGVGFGLTNSWFGISTSMITGIMSGGPMMVVYGIIIIALISICIAVSL
FT                   GELSSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSLAWAGSVFTSASTTLSVAAEIVGM
FT                   YALTHPEFEVKRWHTFVCFEVLHLFLMLFNCYGKALPLISSSSLYISLFSFITITITVL
FT                   ACSHGKYNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEVEKPER
FT                   VIPISILGTVAIGFVTSFCYVIAMFFSLQNLDKVVNSNTQVPILDIYYQALGSKAGAIV
FT                   LGCLLLFTSFGCVIACHTWQARLCWSFARDEGLPFSRYWARVSPELGVPLNAHLMSSFW
FT                   IVLLGCLYLASSTAFNSLITGCIMFLLLSYTIPVVCLLLKKRNIKHGPFWLGKFGCFSN
FT                   VVLLGWMLFSIVFFCFPSQMPVVKDNMNYASVVIVGYLLFSLLFWQFRGRHTFHALEEE
FT                   AGEDNMFPIENLETK"
FT   gene            <399689..>401350
FT                   /locus_tag="KLTH0H04466g"
FT                   /old_locus_tag="KLTH-ORF1677"
FT   CDS_pept        399689..401350
FT                   /locus_tag="KLTH0H04466g"
FT                   /old_locus_tag="KLTH-ORF1677"
FT                   /product="KLTH0H04466p"
FT                   /note="similar to uniprot|P20447 Saccharomyces cerevisiae
FT                   YGL078C DBP3 Putative ATP-dependent RNA helicase of the
FT                   DEAD-box family involved in ribosomal biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30213"
FT                   /db_xref="GOA:C5E2F2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2F2"
FT                   /protein_id="CAR30213.1"
FT                   /translation="MSSTLSEEESVKHIGRMSKDHAAERKRKHDDVDLAESTAVKKDKK
FT                   EKKSKKEKKDKKDKKEKKDKKDKKSKDKSKVDDAVASAKTKSEPLSTESATKEKSHGST
FT                   GYTESEKLSKVPQSQIDQFFQDNEVSVEDPAKLNLRPLLSFDQISLSSEIQEEISKFPK
FT                   PTPIQAVSWPYLLSGKDVVGVAETGSGKTFAFGVPAIHNLKTADAKSQGVQVLVISPTR
FT                   ELASQIYDNLILLTKKAGVNCCCVYGGVPKDEQRSQLKKSQVVVATPGRLLDLIEEGSA
FT                   RLSNVKYLVLDEADRMLEKGFEEDIKRIIGSTKATGRQTLMFTATWPKEVRELANTFMD
FT                   SPVKISIGNRDELSANKRITQIVEVIDPFKKDRKLLELLKKYQSGARKNDKVLIFALYK
FT                   KEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGESNMLLATDVAARGLDIPNV
FT                   KTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTLFTEQEKHLAGALVNVLNGANQPVPE
FT                   ELKKFGTHTKKKEHSAYGAFYKDVDTTKKPKKITFD"
FT   gene            <401548..>403272
FT                   /locus_tag="KLTH0H04488g"
FT                   /old_locus_tag="KLTH-ORF1674"
FT   CDS_pept        401548..403272
FT                   /locus_tag="KLTH0H04488g"
FT                   /old_locus_tag="KLTH-ORF1674"
FT                   /product="KLTH0H04488p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30214"
FT                   /db_xref="GOA:C5E2F3"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2F3"
FT                   /protein_id="CAR30214.1"
FT                   /translation="MTTILERSEIEERICRGQAIVIYDGNVLRLDKWIKYHPGGDKAIH
FT                   HMIGRDATDEMKAYHCDETVSTFLKWRIGRVSGRWHNFLPPIQGGVFKSREDQEGSGPS
FT                   CEPESEWRDVDTSDAFQDISKTKRMCGEPDVKIYPKIPQGVVPTLDLKLAFEKKVVTDP
FT                   QDITENYDNEQVKHDLLTLPSLDAETQDWLSQEYNEMHQEVIQAGLYKCNYFRYAKELL
FT                   RIGALFGLSYFLLFHKNQKFWSAVSMGAAWQQLVFIAHDAGHIGITHNYQADNIIGMVI
FT                   ASWIGGLSLGWWKRNHNVHHLVTNDPIHDPDIQHLPFFAVSTRLFNNIYSTYYERFLWF
FT                   DKFAQKVIPLQRFLYYPILAFGRFNLYRLSWMHVLLGQGPRRGKAAWFRYFELAGLIFF
FT                   NYWFFYLIVICRLHTGWERFQYIMVSHITTMLVHVQITLSHFAMSTSDLGVAEGFPMRQ
FT                   LRTSMDVDCPRWLDFLHGGLQFQVVHHLFPRLPRHNLRDAQPFVIKFCEKVGLTYSIYG
FT                   FKKGNGVVLGRLEEIAQQAKTMLKCAQTMEQEANSRPKPNISAPIDHTCSSKRHKLA"
FT   gene            <403524..>404264
FT                   /locus_tag="KLTH0H04510g"
FT                   /old_locus_tag="KLTH-ORF1673"
FT   CDS_pept        403524..404264
FT                   /locus_tag="KLTH0H04510g"
FT                   /old_locus_tag="KLTH-ORF1673"
FT                   /product="KLTH0H04510p"
FT                   /note="similar to uniprot|Q08952 Saccharomyces cerevisiae
FT                   YPL196W OXR1 Protein of unknown function required for
FT                   normal levels of resistance to oxidative damage null
FT                   mutants are sensitive to hydrogen peroxide"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04510g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30215"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2F4"
FT                   /protein_id="CAR30215.1"
FT                   /translation="MFKGRLSSLRRSFTSPEADSSSNETKEESGRSSFFDEEPLPEVSF
FT                   HGYAATTKHRLLTPEISDEVRNQMPTRIQLYPDWQLLYSLEQDGASLHSLYGKVAPDAK
FT                   NPGRVGYVLLIEDRKGGIFGAYTNEPFRPTERKRYYGNGECFLWKIEKAATINIGNAKA
FT                   SCSRSSDHHWRFRSYPFTGLNEFVIYCTSEFLSMGAGNGHYGLWCDSSLINGVSDPSLT
FT                   FGNDVLSREGNKFHIVNLEVWRVG"
FT   gene            complement(<404281..>404928)
FT                   /locus_tag="KLTH0H04532g"
FT                   /old_locus_tag="KLTH-ORF1672"
FT   CDS_pept        complement(404281..404928)
FT                   /locus_tag="KLTH0H04532g"
FT                   /old_locus_tag="KLTH-ORF1672"
FT                   /product="KLTH0H04532p"
FT                   /note="similar to uniprot|P53158 Saccharomyces cerevisiae
FT                   YGL079W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30216"
FT                   /db_xref="InterPro:IPR019371"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2F5"
FT                   /protein_id="CAR30216.1"
FT                   /translation="MNEWCKVPVGPVIFPEKVTNRCAMDEDGSGSVGLRTRTASVNSQM
FT                   YAIPEPEEIDIQLSEGSSRSEFEDSDYDAESDYDAESGGDAFLDQMVPETSNTFVMGQL
FT                   DTPMFDTSKYLFQSLSQALNAADFSEAIALQTRTSGLINSKSRELEKLSQEVQQKLRYF
FT                   ETRFAQGAQTSKRISRNLQHIAKQVDKIGSAFETRYPIEFNQAREEIFERKT"
FT   gene            <405046..>407877
FT                   /locus_tag="KLTH0H04554g"
FT                   /old_locus_tag="KLTH-ORF1671"
FT   CDS_pept        405046..407877
FT                   /locus_tag="KLTH0H04554g"
FT                   /old_locus_tag="KLTH-ORF1671"
FT                   /product="KLTH0H04554p"
FT                   /note="similar to uniprot|Q7LIB1 Saccharomyces cerevisiae
FT                   YPL195W APL5 Delta-like subunit of the yeast AP- 3 complex
FT                   which functions in transport of alkaline phosphatase to the
FT                   vacuole via the alternate pathway suppressor of loss of
FT                   casein kinase 1 function delta-like subunit of the yeast
FT                   AP-3 adaptin component of the membrane-associated clathrin
FT                   assembly complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30217"
FT                   /db_xref="GOA:C5E2F6"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017105"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2F6"
FT                   /protein_id="CAR30217.1"
FT                   /translation="MTSLYAPSADDVMRRLRPFGLFFEKSLKDLIKGIRSCGENSEELE
FT                   RFLSKTLSECRQEVESPDLDLKTNAVVKLTYLEMYGFDMSWANFYILEVMSSNRLQHKR
FT                   VGYLAASQSFHKDPDILMLATNLLKKDLKYDGNNDVLKMGVTLSGLSTMVTAPLARDIC
FT                   GDLFSMLGSSKPYIRKKAISALFKVFLQYPEALRDNFDKFVAKLEDEDMSVVSATVSVI
FT                   CELSKKNPHPFVQLSPLLYETLFTIDNNWIIIRLLKLFTNLSQVEPKLRVKVLPKILEL
FT                   MEVTSATSVIYESINCIVKGHMLEPDDYDTALSCLEELTKFCNSNDPNLRYISVVLFYK
FT                   IGKINTSFISEFNTLVIRLLKDVDISIRSRALELLEGITDDENIAQIVQILVKQFADKD
FT                   VVLANKLFKQTRQENIEIEVPNSYKIKMVSTILRICSLNNYANVPDFDWYLAVLSDLCV
FT                   ISQDLNDEAIGLQLGAELRNIMVKVPSMRETCISTIVGLVSNNDICRQLPMVLKECLWC
FT                   IGEYPSSISNGDDIIKLITRQRRLTPEVQQIAAQALIKIFSSWCNTNGNVPINDVKHTI
FT                   QELISFFESLSSSKSFEVQERCVEFLEFFKLCAESLEQNDEELPLLITEVLPSFFNAYE
FT                   LNPILHGTLKKVQNSLSIDLETPFLSEDEVKNLLEEESSKHEAESMLASDLDMDDEFEE
FT                   DDAIENPAHEDKLLGDRSRDDLAEEERRVLEEERRKEKLTNPFYLEGDYEDFAAKRENP
FT                   LIDFNDNQDQNYPESSSLIAGELKHVSETSKKTKKERKKKKKKAEVLIDEGVPEITSDV
FT                   AAIPEPQPAKSISSSKNSSRINLKMQTKLESFNFDQPQKYVEDSGAAGTEGQQEIDQLR
FT                   AKFAESSLGQDMDEEVVIVKRKKKKRSKDKKHSKKKDVEHHSAHGEPAKCDSGQNPQAE
FT                   NASAHDQTAHESL"
FT   gene            <408053..>409687
FT                   /locus_tag="KLTH0H04576g"
FT                   /old_locus_tag="KLTH-ORF1668"
FT   CDS_pept        408053..409687
FT                   /locus_tag="KLTH0H04576g"
FT                   /old_locus_tag="KLTH-ORF1668"
FT                   /product="KLTH0H04576p"
FT                   /note="similar to uniprot|Q08949 Saccharomyces cerevisiae
FT                   YPL194W DDC1 DNA damage checkpoint protein part of a PCNA-
FT                   like complex required for DNA damage response required for
FT                   pachytene checkpoint to inhibit cell cycle in response to
FT                   unrepaired recombination intermediates potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30218"
FT                   /db_xref="GOA:C5E2F7"
FT                   /db_xref="InterPro:IPR007268"
FT                   /db_xref="InterPro:IPR026217"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2F7"
FT                   /protein_id="CAR30218.1"
FT                   /translation="MIFKASIIKAENHSVWRRAVQMLSTLHEDIKLTITSSELIVWSMN
FT                   SADTSMSQIRFKRNFFDEYEFQPENTVFGEDGLQQVEDRALVVHKLYSFKTNGKHLSVL
FT                   FRKPENDNIKSLELAIHNGAACPESLANKLQITIHTENLMLKEYVPHIIPIKYDPIVIN
FT                   LRYKKRFLEVYGSSSETQEEQLDPRLLEIFRKFDRELSESYFNNDIVSNTKRSRDLVPE
FT                   DEINYLCCNIQLLKNFIDSCNTGATEEVKLEVSLSKLCLTAFTRGVYSKNNDILRNAMR
FT                   ASNTVGTSDLEHYCLFTTTGDDDQRRPPSKVVSFGMKDFRNFINTVAFWRNDQEIHMWF
FT                   CRPGDPVFLELDKDDLCLELVQVTSSNEDLVPSGNKIKTQTTSPLKEIVHIKLGSPRKS
FT                   PLKGLTPSKTPSSNETTSPLKPKTLFVKEKSFDADQQRWKNPVRGKRLPDSQEEIPKSL
FT                   HHAPNEPAFKAQRTQTTIEWGQSVPESANDAAATALDQRDLLKQEKRKFLQNIRNEREK
FT                   DVEKDEPTQGVDEFGPTQVDKPKGLFD"
FT   gene            <411070..>412059
FT                   /locus_tag="KLTH0H04598g"
FT                   /old_locus_tag="KLTH-ORF1666"
FT   CDS_pept        411070..412059
FT                   /locus_tag="KLTH0H04598g"
FT                   /old_locus_tag="KLTH-ORF1666"
FT                   /product="KLTH0H04598p"
FT                   /note="similar to uniprot|Q08932 Saccharomyces cerevisiae
FT                   YPL193W RSA1 RiboSome Assembly"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30219"
FT                   /db_xref="InterPro:IPR019496"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2F8"
FT                   /protein_id="CAR30219.1"
FT                   /translation="MNYNHGSNYNGGDQYYNRPNIPKPTSSGQLPNQHPHSNQRADANF
FT                   QPHQTSAYFQGHQTFGATQGYGQNYYGSYPQYYYPAQQAPYYAGGYQGYIANYASPAEP
FT                   PKEAVKNNSAERKSVISYDDTDTETNIISQDQNGGSKEKRHSEVGTPDDPKETIEAENK
FT                   EAKIIAIPGTSITLESEEDIKKWREERRKMWLVKISNQREKHKSDLGIEEEDVSRNEAF
FT                   QQVKRDKQFIQSIQNQINRSGPSPNLDLKLIQRTMAKENIKLLNFIKELGDAGLLQYEL
FT                   KEEEKQKLFGSNSRQPGARTNFNNKRPNTPHEGPSRYEGSKKRQHKPN"
FT   gene            complement(<412730..>413935)
FT                   /locus_tag="KLTH0H04620g"
FT                   /old_locus_tag="KLTH-ORF1662"
FT   CDS_pept        complement(412730..413935)
FT                   /locus_tag="KLTH0H04620g"
FT                   /old_locus_tag="KLTH-ORF1662"
FT                   /product="KLTH0H04620p"
FT                   /note="some similarities with uniprot|P53156 Saccharomyces
FT                   cerevisiae YGL081W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30220"
FT                   /db_xref="GOA:C5E2F9"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2F9"
FT                   /protein_id="CAR30220.1"
FT                   /translation="MSFAMFNARDQTGCRRVVFEVRKTEGQGLQFPIGRASLKDPERRD
FT                   REDNFMFCEKSLSKKHAILCIKRLVPSESDPFVPLLSQFRISVQDLGSTHGLVDLQSQD
FT                   ADASVIDLKNGERFGLIKLCQPVAPGQSRGAKLKFQVFIKTNESDDTHETLELVLRNVT
FT                   HEWSPYVSRPATAAEEELEMPLSPSSCSTSSSSSDLNYSEDIDLDLGKYGSNESTEQGS
FT                   QDEQAELSRMAEDCIETDSSHHTLFVSDEPACLADNAPTTYVRMPAPYEPLFAPRAECE
FT                   GAYNRDETEMFDDKNTPEGTPECFDCSKSINPYNEDELCDSVRDLAEEDYSLTSRKRSF
FT                   EPEKDQDVCLEKCKKAKTDIELDKGTEVGGSRRQVIIGSMMGFVAGSLGTLGLLVGIAN
FT                   MG"
FT   gene            complement(<414364..>415497)
FT                   /locus_tag="KLTH0H04642g"
FT                   /old_locus_tag="KLTH-ORF1659"
FT   CDS_pept        complement(414364..415497)
FT                   /locus_tag="KLTH0H04642g"
FT                   /old_locus_tag="KLTH-ORF1659"
FT                   /product="KLTH0H04642p"
FT                   /note="similar to uniprot|P53155 Saccharomyces cerevisiae
FT                   YGL082W and similar to uniprot|Q08930 Saccharomyces
FT                   cerevisiae YPL191C Hypothetical ORFs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30221"
FT                   /db_xref="GOA:C5E2G0"
FT                   /db_xref="InterPro:IPR007518"
FT                   /db_xref="InterPro:IPR033979"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2G0"
FT                   /protein_id="CAR30221.1"
FT                   /translation="MSLSFQVKAIEINGYPYRIVLQSDNGPCALIALCNVLLLSPQYAR
FT                   YVGALSRLVETRTDVGLDELITTLANIGMQMPRGAQSDVNRLLELLPQLHTGLTINPVF
FT                   NGSFEDGDEMALFRLFNVSIVHGWVADYAEDRGQYEHVSKYSYEGAQRALIDAYDIQHG
FT                   SEPAGAAGRDYDAQALLEDATYIKSFLARSATQLTDYGLHHLRELLLENSYAVLFRNDH
FT                   FSTIIKHNNELYALVTDLGFKDDEDIVWQSLKSVNGSQDTFYSGRFIPSTLQKSNTEVT
FT                   SATSGSRARNPFLDPTNSRADAQASSGPNTMTDEQYARQLQEQEDARVARSYNRQYNAA
FT                   RSQRRTTQDSADGGSRPGKKSSSMRKRDKLKKKCIIM"
FT   gene            complement(<415939..>418380)
FT                   /locus_tag="KLTH0H04664g"
FT                   /old_locus_tag="KLTH-ORF1654"
FT   CDS_pept        complement(415939..418380)
FT                   /locus_tag="KLTH0H04664g"
FT                   /old_locus_tag="KLTH-ORF1654"
FT                   /product="KLTH0H04664p"
FT                   /note="similar to uniprot|P38996 Saccharomyces cerevisiae
FT                   YPL190C NAB3 Single stranded DNA binding protein acidic
FT                   ribonucleoprotein required for termination of non-poly(A)
FT                   transcripts and efficient splicing interacts with Nrd1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04664g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30222"
FT                   /db_xref="GOA:C5E2G1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2G1"
FT                   /protein_id="CAR30222.1"
FT                   /translation="MSAEEPNSMDPTREDDLAPAALEGAPVEETNVLLADEVAGDDEEQ
FT                   EDDQESLYSHEEERDAAEKEDSATPEIQTATVQAENEGEVGAEGQDEEEDAQGGSDQVI
FT                   EAVEIGDVQERKEEEEAQGPESTLIEPDVVTVGQPVDASADELDAAEASDSRERAEDDA
FT                   EGSGQEAHPEEQTALVDFGSEDEKGQSVSSESGAQEQEASEDAGSDGDEKEQEQDADQP
FT                   NHEAAESSEQESSSGTQSVEPQPFDVARYDMSSENVDYGLLQKQATYIVSSNMLNTPGF
FT                   QQLVEPDKINAVLSFLNSNPETAFQAFAGQVAQPSNPQRASQHEPRPDLSQPMTAVERK
FT                   RYNEYLRGENRITEIQNIPPKSRLFIGNLPLKNVAKDDLFRIFSPYGHIYQINIKNAFG
FT                   FIQYDNPQSVKAAIAGESNELNFGKKLILEISSSNSRPQYDHGDHGTNSSSTFISSSKR
FT                   PFEEEEEEDMYSDSSYKRGKRRVPDCQIYVKRTADRSYANEVFNRFKQASGLETDMIFL
FT                   KPRMELRKMINDAAYDGVWGVVLVNKTRNVDIQTFYKGPQGETKFDEYASVSCEDAIAI
FT                   FNNLKSNRGDRMAAPVQHAPQQHAPQPHAPQQHAPQQQYYGGYGAAPAPQPPHQGQPYI
FT                   QQPPYGGAPQGPAPGYGGPPPMAQGYGAYPGAQAHVSPPPPVVAPPMAAGPQMDQQQLF
FT                   SAIQNLPPNVVSSLLAMAQQQPQQQQQLLGIIQSMQPQAQPHGAQHGGPSVPPAYQGYH
FT                   QMQSQPINSPPVQQHQQQPPAFAAKSPPAQNPIPQQSQAPASGNNNVQSLLDSLAQLQQ
FT                   K"
FT   gene            complement(<419384..>421726)
FT                   /locus_tag="KLTH0H04686g"
FT                   /old_locus_tag="KLTH-ORF1646"
FT   CDS_pept        complement(419384..421726)
FT                   /locus_tag="KLTH0H04686g"
FT                   /old_locus_tag="KLTH-ORF1646"
FT                   /product="KLTH0H04686p"
FT                   /note="similar to uniprot|P53009 Saccharomyces cerevisiae
FT                   YGL083W SCY1 Suppressor of GTPase mutant"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30223"
FT                   /db_xref="GOA:C5E2G2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2G2"
FT                   /protein_id="CAR30223.1"
FT                   /translation="MFWSSKSSISSNYSYSSSPTFTAEPWSVHAGRAKNGSSANTSARV
FT                   SVFIFDKRHFENFLLTSGAIKSKSSSKDKQFILSAYDILRAQVNQLAKLKHPNILALIE
FT                   PLEEHSKNFMFVSEYVTGNLESVFGDKVSDELDFLKQTRDSGSSDVVVQRGILQVAQGL
FT                   DFIHNRANSVLLDLRPASILVSENSDWKIAGLGHLAKLPSGSNTGQYTPDFNPRFPHFM
FT                   HIPLNYSAPEIIMENMLTPKNDFFSLGLLIYFLYYKKNLFSCQDYIGDYKEDYSKYERD
FT                   LVRLSFENVFSKVPQKLRFNLPKLMNRDVFSRFDNITEFLDIEFFQDPLVKTLAFLDDL
FT                   PTKDSQERSIYLQGLLDILPQFPSQILQKKFLTVLLELLDQMCSSEVIDSKCLNTLLTV
FT                   ISKIGMTLSQLSFQERVYPHFAAKNNFSKLLENATRSLIDNIDILQEKIKGDLFVEKVL
FT                   KPLCTYVFSKNNGEDAVQLQESLMGKLDVILKSFDFPTVKNFLFTLLSQLFVKTTSLTV
FT                   KNACVASFKKMIELKTLDKYTCVEDVLPLFKSMKTRDSRILMKSLELLQLFPSVVENED
FT                   VLVEQVLPLLWNFSMAMTLKPNQYLAYNTAINKISGDIQRVHLQKLKETTGHQMAGEEA
FT                   DFSKVIEKPVQKPRDPDAQASRSISVPAMMPKSTPSAQTPPITPRPRTKQPSKPLVLTK
FT                   GSASAASRLPSRSAPKKLPTPPPKTTAEPDPDDFDDFVTSPSSPVINTSAQSSPSFPPG
FT                   FSMAIQPQRKPSSLQSSSFVQDQSSLL"
FT   gene            complement(<421972..>422042)
FT                   /locus_tag="KLTH0H04708r"
FT                   /old_locus_tag="Klth0H.tGly_GCC_36"
FT   tRNA            complement(421972..422042)
FT                   /locus_tag="KLTH0H04708r"
FT                   /old_locus_tag="Klth0H.tGly_GCC_36"
FT                   /note="tRNA-Gly (GCC) cove score=62.63"
FT   gene            <422975..>424768
FT                   /locus_tag="KLTH0H04730g"
FT                   /old_locus_tag="KLTH-ORF1640"
FT   CDS_pept        422975..424768
FT                   /locus_tag="KLTH0H04730g"
FT                   /old_locus_tag="KLTH-ORF1640"
FT                   /product="KLTH0H04730p"
FT                   /note="similar to uniprot|P53154 Saccharomyces cerevisiae
FT                   YGL084C GUP1 Multimembrane-spanning protein and similar to
FT                   uniprot|Q08929 Saccharomyces cerevisiae YPL189W GUP2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04730g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30224"
FT                   /db_xref="GOA:C5E2G3"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2G3"
FT                   /protein_id="CAR30224.1"
FT                   /translation="MIVEIGNMLLQQILYFFSLKMLDSRLDPSTDAKRAQKVSMGASKS
FT                   RWRTFEFKVYYVMFILVVPLMIRTAISATSERNPNYARFEPLLSKGWILGRKVDNTDSQ
FT                   YRFFRDNMPLLAGLIVLHTGLKKAVLRTTNVRRVRFDLVFGLLFLFAAHGVSALRVLLH
FT                   LVINYAIAKTLRKNYRLATFLTWVYGISTLFFNNSYRKYPFGNVLSVLTPLDGAFKGII
FT                   ERWDVFFNFTLLRMISFNMDFLEKWEQVVTGKKNNSPSPSPSHVSNLKPELKRAASSAT
FT                   TLETICENGTTNVLLDERARMNAPHHIQDYLFANYLAYVTYTPLFIAGPIVTFNDYLYQ
FT                   CQQTLPSINTKRILYYAGRFVLCVLTMEFVLHYIYAVAVSKTKAWDGDTPFQISMIGLF
FT                   NLNIVWLKLLIPWRLFRLWAMIDGVDAPENMIRCVDNNFSALAFWRAWHRSFNKWVVRY
FT                   VYIPLGGSKNRILTSLAVFSFVAIWHDIELKLLLWGWLIVLFLLPEIFAQRYFAPYRKR
FT                   PWYRFVRAMGAILNIWMMMIANLYGFCLGYDGTVHLIKGLFFTWAGLRFLMGANVALFI
FT                   AVQVMFEQREHEKRNGVDVKC"
FT   gene            complement(<424818..>425618)
FT                   /locus_tag="KLTH0H04752g"
FT                   /old_locus_tag="KLTH-ORF1637"
FT   CDS_pept        complement(424818..425618)
FT                   /locus_tag="KLTH0H04752g"
FT                   /old_locus_tag="KLTH-ORF1637"
FT                   /product="KLTH0H04752p"
FT                   /note="similar to uniprot|P53153 Saccharomyces cerevisiae
FT                   YGL085W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30225"
FT                   /db_xref="GOA:C5E2G4"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E2G4"
FT                   /protein_id="CAR30225.1"
FT                   /translation="MSEDRAVRLSSQQILYTKAAILSAALTGSILTSYALFNRYLKQYT
FT                   RVTQIPLSAFRKNWLYGKVTSVGDGDNFHLFHTPGGILGGWGWARSAPKLDKVNNKRSD
FT                   SLKRLFFPRFLRRQKEQEKFQSLNVPFKGRRNLPTLSIRLCGVDAPERAHFGNAAQPFS
FT                   EEALIWLRHTLIGKFVWIKPLSLDQYGRCVAKVKFWSWTGWKNVSLEMVKNGIAVVYEG
FT                   KTGAEFDDERDIYIFHEQVARKERRGLWSLKKFETPGNYKKRVG"
FT   gene            complement(<426645..>428621)
FT                   /locus_tag="KLTH0H04774g"
FT                   /old_locus_tag="KLTH-ORF1635"
FT   CDS_pept        complement(426645..428621)
FT                   /locus_tag="KLTH0H04774g"
FT                   /old_locus_tag="KLTH-ORF1635"
FT                   /product="KLTH0H04774p"
FT                   /note="similar to uniprot|P40957 Saccharomyces cerevisiae
FT                   YGL086W MAD1 Coiled-coil protein involved in the spindle-
FT                   assembly checkpoint phosphorylated by Mps1p upon checkpoint
FT                   activation which leads to inhibition of the activity of the
FT                   anaphase promoting complex forms a complex with Mad2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30226"
FT                   /db_xref="GOA:C5E2G5"
FT                   /db_xref="InterPro:IPR008672"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2G5"
FT                   /protein_id="CAR30226.1"
FT                   /translation="MSDSTGSSPFLERPMSPDSTQRHAVSLKYRMNAMQNEFEIEKLSL
FT                   QRELSTLDKKYRTNLDELEKALGDTKYLYDTNTELESKVKALEEQLSELKTTQDTQSFI
FT                   LRQKLAEKERDIEQLRSESRSKVSELENKYQNSKIESESSKSLLKRYEEEIESQNRQLK
FT                   ELQSAVAQRDDEIASIKASRVVMAHHNYSTEELAELTTLNNLLEEQIKFSKTLEKANLE
FT                   QANELKKLRVSRDSYQFLLSENERLKTRQEQQGPLERQVQDLELENINLQSQLSFWNSF
FT                   STSKDEGTKTRPEEIVKEWTLLKHENLGLVNTNSKLQLDINNVKVLNDELALERNQLLE
FT                   INKNYETSILNLKKLNYEIEQQKLLSFEECKILRNQLDNLLPIEDNPEDHNKENAGSLG
FT                   DLVENYKNKTEDLTNELKRLNEELMTRGDAVSSFKKRKTSDDIALNYSQRLNELQLENV
FT                   DLNRKLTASLETIAMLETKVTKLRQLDQKKLRIMQLRDNPFSKDQLVKRKQLDLLLKEN
FT                   KDLLAGGAISHQHSVPRSLYDRLEFDVKQLENEIFKLNKKTTRLREVFNRKSLEFIEVV
FT                   NSLLGFKMEFQSDGKVKMISCYKPEKYLVADLHHNSLKSNLQSDIDSWDALLEEFVVKR
FT                   GQMPGFLASVTLQLWEKQQKSLD"
FT   gene            <428760..>429239
FT                   /locus_tag="KLTH0H04796g"
FT                   /old_locus_tag="Klth0H.mRNA.at.276.p"
FT   CDS_pept        join(428760..428770,428834..429239)
FT                   /locus_tag="KLTH0H04796g"
FT                   /old_locus_tag="Klth0H.mRNA.at.276.p"
FT                   /product="KLTH0H04796p"
FT                   /note="highly similar to uniprot|P53152 Saccharomyces
FT                   cerevisiae YGL087C MMS2 Protein involved in error-free
FT                   postreplication DNA repair forms a heteromeric complex with
FT                   Ubc13p that has a ubiquitin-conjugating activity cooperates
FT                   with chromatin-associated RING finger proteins Rad18p and
FT                   Rad5p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30227"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2G6"
FT                   /protein_id="CAR30227.1"
FT                   /translation="MSRVPRSFRLLEELEKGEKGMGPESCSYGLAHSDDITMTHWNGTI
FT                   LGPPHSNHENRIYSVAIECGEAYPDQPPKIRFLSKVNLPCVDQNTGEVKKEQFSTLRDW
FT                   KRSYTMETLLLDLRKEMALPSNKKLPQPAEGTTF"
FT   gene            <429493..>430752
FT                   /locus_tag="KLTH0H04818g"
FT                   /old_locus_tag="KLTH-ORF1632"
FT   CDS_pept        429493..430752
FT                   /locus_tag="KLTH0H04818g"
FT                   /old_locus_tag="KLTH-ORF1632"
FT                   /product="KLTH0H04818p"
FT                   /note="highly similar to uniprot|Q06892 Saccharomyces
FT                   cerevisiae YPL188W POS5 Mitochondrial NADH kinase
FT                   phosphorylates NADH also phosphorylates NAD( ) with lower
FT                   specificity required for the response to oxidative stress"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30228"
FT                   /db_xref="GOA:C5E2G7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2G7"
FT                   /protein_id="CAR30228.1"
FT                   /translation="MIRVLRPQCFFRRLHTVDPLNVKLRDTSQFVRVKPVSKLRSISSP
FT                   DFISSPNSKLQSLIWHRPLQNVFVTKKPWADNTRQAMVEFIAHLHDSYPEINVIVQPDV
FT                   AEEIAQDFVKNPQSNPGQPHILYTGEMKDIVDKVDLLVTLGGDGTILRAVSLFASMQVP
FT                   PVLAFSLGTLGFLLPFNFKEHKRVFEEVLNSRAKCLHRTRLECHVIRRGSNGKEGKSVA
FT                   HHAMNDIFLHRGNSPHLTNLDIFIDGEYLTRTTADGVTLATPTGSTAYSLSAGGSIVSP
FT                   LVPSILLTPICPRSLSFRPLLLPHSSHIKIKVGCKASQGPDNKLVRLSIDGVPLEDLNV
FT                   GDEIHVVNEVGTIYVNGSQLPSTTDAATIKRRGQDIKNAGVYCVAKTENDWTRGINELL
FT                   GFNSSFRFMSQREKEGENSK"
FT   gene            complement(<431325..>432656)
FT                   /locus_tag="KLTH0H04840g"
FT                   /old_locus_tag="KLTH-ORF1631"
FT   CDS_pept        complement(431325..432656)
FT                   /locus_tag="KLTH0H04840g"
FT                   /old_locus_tag="KLTH-ORF1631"
FT                   /product="KLTH0H04840p"
FT                   /note="similar to uniprot|P34163 Saccharomyces cerevisiae
FT                   YKL140W TGL1 Steryl ester hydrolase one of three gene
FT                   products (Yeh1p Yeh2p Tgl1p) responsible for steryl ester
FT                   hydrolase activity and involved in sterol homeostasis
FT                   localized to lipid particle membranes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30229"
FT                   /db_xref="GOA:C5E2G8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR025483"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2G8"
FT                   /protein_id="CAR30229.1"
FT                   /translation="MCGRMESLWNFCLSLCLRIPMWIYNHCILPLICVLPFFQKYKTFN
FT                   YSYHNRLVKEVVHANDILDIAMAHGFDVQEHLVRTQDGYLLTVHRVLGKKSEVYRSQAK
FT                   KPVVYFHHGLLTNSELFLLGQTSDKCLPFLLVERGYDVWLGNNRGNKYSRKHINLSSRS
FT                   AKFWDFSLDEYAIFDIPNTISYILNLTGLEKLTYIGFSQGSSQAFAAFSINPQLRDKIQ
FT                   LFVGLSPAMIPRSLSHPVAKFLVTCPPELLYFIFGTRAILPSVVFWQRLFGPINYMKIV
FT                   DWSLVYLFNWKSEHISSAQKQVGYTHMFSPSSVKSVAHWFQIIHNKRFQMFQEDISKIY
FT                   SSVPSLHRKLHRCAPFPVQVIENMPMMLLYGDQDILIDMETTKQNLVRNLSDLTLVELP
FT                   GYEHMDTLWAENVVEEVFNPILKKIDQIHAEKPYQNGLEVTASA"
FT   gene            <434269..>434814
FT                   /locus_tag="KLTH0H04862g"
FT                   /old_locus_tag="KLTH-ORF1626"
FT   CDS_pept        434269..434814
FT                   /locus_tag="KLTH0H04862g"
FT                   /old_locus_tag="KLTH-ORF1626"
FT                   /product="KLTH0H04862p"
FT                   /note="similar to uniprot|P01149 Saccharomyces cerevisiae
FT                   YPL187W MF(ALPHA)1 Mating pheromone alpha-factor made by
FT                   alpha cells interacts with mating type a cells to induce
FT                   cell cycle arrest and other responses leading to mating
FT                   also encoded by MF(ALPHA)2 although MF(ALPHA)1 produces
FT                   most alpha-factor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30230"
FT                   /db_xref="GOA:C5E2G9"
FT                   /db_xref="InterPro:IPR006742"
FT                   /db_xref="InterPro:IPR008675"
FT                   /db_xref="InterPro:IPR016326"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2G9"
FT                   /protein_id="CAR30230.1"
FT                   /translation="MLKSFSLFLAFALTSITVSAAPINITDSDPVIPRESICGFLDLTD
FT                   AEDLALLPVSNGTHSGILVVNTTILAQAFGSDDILTKRDANAEAEADPWRWLSLSRGQP
FT                   MYKRDANAEADAEPWRWLSLSRGQPMYKRDANAEADAEPWRWLSLSRGQPMYKRDANAE
FT                   ADAEPWRWLSLARGQPMY"
FT   gene            complement(<435202..>435855)
FT                   /locus_tag="KLTH0H04884g"
FT                   /old_locus_tag="KLTH-ORF1622"
FT   CDS_pept        complement(435202..435855)
FT                   /locus_tag="KLTH0H04884g"
FT                   /old_locus_tag="KLTH-ORF1622"
FT                   /product="KLTH0H04884p"
FT                   /note="some similarities with uniprot|Q08926 Saccharomyces
FT                   cerevisiae YPL186C UIP4 Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30231"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2H0"
FT                   /protein_id="CAR30231.1"
FT                   /translation="MSKIVFKHQQAGLGSLSLAGNFTKWEIKPMVFNGDEGQWEFEIEP
FT                   EMLGNCELQDGKAVTFFKFVDERGDWFTDDNFAKEADENGNENNALYLQVDGDAARSEN
FT                   QPSEVEHQTEGDQEAEPSTPDPTPVVQMKTPRANEREESPVMITESDLEEDFHDTNNQD
FT                   QGELTETRNHSADTSVSATQNPAEYKNFLQSIVFFFKNLFRRWFGMGTKQQESR"
FT   gene            complement(<436720..>438429)
FT                   /locus_tag="KLTH0H04906g"
FT                   /old_locus_tag="KLTH-ORF1618"
FT   CDS_pept        complement(436720..438429)
FT                   /locus_tag="KLTH0H04906g"
FT                   /old_locus_tag="KLTH-ORF1618"
FT                   /product="KLTH0H04906p"
FT                   /note="similar to uniprot|Q08925 Saccharomyces cerevisiae
FT                   YPL184C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04906g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30232"
FT                   /db_xref="GOA:C5E2H1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2H1"
FT                   /protein_id="CAR30232.1"
FT                   /translation="MSSHYHQQFMNTPMYAYDVPSAGLESIDDGLYRSLSPTSQVAYQN
FT                   DRQAVWPNAGYQSNGAGYLEQHQMGYPPQSGILEQQPTFGVIPNETDNASSQISTGSSS
FT                   YSSTPRNSKFVVAAAAAAAAANAPLSHKPLQLNNPRDFTSAPSRTVYLGNIPPNLEVRE
FT                   LLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKRLNIGGRDIKVGWGKPT
FT                   PIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADPRDLIATEEKLRADLDFYGEIE
FT                   SVKIIVEKGIAFVHFSSIFSAIKVVSSLATVNPYYSNKKIFYGKDRCAFVTKTQQHNAA
FT                   QFLGLQPGMEHLVQYTDRDFISNTLLQQSAAAAAIATAAGGANNLGNRTIYLGNLPKDV
FT                   KIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSLHGLTIHNKRCKIGW
FT                   GKHSGALSNALALAVSHGASRNIYLGNIDFKADSERDVPVFTEQNLRKLFEEYGEVEQI
FT                   NFLPERSCCFVNFTNISNAILAIDKIKSNEQFKDLKINFGKDRCGNVPRQYR"
FT   gene            complement(<439113..>440429)
FT                   /locus_tag="KLTH0H04928g"
FT                   /old_locus_tag="KLTH-ORF1611"
FT   CDS_pept        complement(439113..440429)
FT                   /locus_tag="KLTH0H04928g"
FT                   /old_locus_tag="KLTH-ORF1611"
FT                   /product="KLTH0H04928p"
FT                   /note="weakly similar to uniprot|P53150 Saccharomyces
FT                   cerevisiae YGL090W LIF1 Protein involved in DNA double-
FT                   strand break repair physically interacts with DNA ligase 4
FT                   (Lig4p) homologous to mammalian XRCC4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30233"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2H2"
FT                   /protein_id="CAR30233.1"
FT                   /translation="MRFISCVPVISEDDDTGVVLCQAQFSEDRCDNLKNLQHIYIKELI
FT                   ASEGSEIAAVKNVSFEKLHCFSHADALKSWYELLDLLSAGFFRLDMDRSWTEKAQWRFY
FT                   YVGNTWKLAFETQVRGLTKRFCELELVPAREKEVDLFEMSMKLYQNCVTGNQKIHRLEQ
FT                   RCKDLQNLVDESQKRQDEDHKMIKKRDERTRAFVINLLNEKKAMIRKLQRRLEENRAPE
FT                   DIPDGYLVNRFVSQPVSRMTSPRKRTSLRKSGTPSPKKSTIKSLVKEEEEDQWDDFGGN
FT                   DVEILGINRERTVSAPNLRLETPSLMKNPFLDETRDLNTVKEQDFASKEQLAPSAGSAP
FT                   GFTLDVSQKEESAIPEVAEMSSQKEEEVEQETGKAPEEGVREDTAQEIGKGTEKETEEE
FT                   TEEETEEETEEETEEETEGYTEQDTEKDTEEETEVETDA"
FT   gene            <440614..>441585
FT                   /locus_tag="KLTH0H04950g"
FT                   /old_locus_tag="KLTH-ORF1610"
FT   CDS_pept        440614..441585
FT                   /locus_tag="KLTH0H04950g"
FT                   /old_locus_tag="KLTH-ORF1610"
FT                   /product="KLTH0H04950p"
FT                   /note="highly similar to uniprot|P52920 Saccharomyces
FT                   cerevisiae YGL091C NBP35 Essential nuclear protein
FT                   evolutionarily conserved putative ATPase exhibits genetic
FT                   interaction with CDC2 encoding the catalytic subunit of DNA
FT                   polymerase delta"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30234"
FT                   /db_xref="GOA:C5E2H3"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028601"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2H3"
FT                   /protein_id="CAR30234.1"
FT                   /translation="MTEVSQILPPDYQLKEAEPEHCPGPESEKAGQGDACAGCANKEIC
FT                   ESLPKGPDPDIPLITENLSQIKHKVLVLSGKGGVGKSTFTTMLCWALSSDEDLQIGAMD
FT                   LDICGPSLPRMLGCVNETVHESNTGWTPVYVADNLATMSIQYMLPEDDSAIIWRGSKKN
FT                   ALIKKFLKDVDWDALDYLIVDTPPGTSDEHISINKFMKESGIDGALVVTTPQEVALLDV
FT                   RKEIDFCRKAGIKILGLVENMSGFVCPSCKGESQIFKPTTGGGEKLCEELNIPFLGSVP
FT                   LDPRVGKSCDEGQSFLDQHPESPASLAILDVVEKLRDAVGDI"
FT   gene            complement(<441659..>445576)
FT                   /locus_tag="KLTH0H04972g"
FT                   /old_locus_tag="KLTH-ORF1609"
FT   CDS_pept        complement(441659..445576)
FT                   /locus_tag="KLTH0H04972g"
FT                   /old_locus_tag="KLTH-ORF1609"
FT                   /product="KLTH0H04972p"
FT                   /note="similar to uniprot|P49687 Saccharomyces cerevisiae
FT                   YGL092W NUP145 Essential nucleoporin catalyzes its own
FT                   cleavage in vivo to generate a C-terminal fragment that
FT                   assembles into the Nup84p subcomplex of the nuclear pore
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30235"
FT                   /db_xref="GOA:C5E2H4"
FT                   /db_xref="InterPro:IPR007230"
FT                   /db_xref="InterPro:IPR021967"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="InterPro:IPR036903"
FT                   /db_xref="InterPro:IPR037665"
FT                   /db_xref="InterPro:IPR037672"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2H4"
FT                   /protein_id="CAR30235.1"
FT                   /translation="MFGSNSGGSSLFGGGLNTSTPTSKITQTDNAFQPRQKSASGSLFG
FT                   DVSTSRLNGASTPSPSGGLFGNKNNTSASQEAPNALFGGNANQDSNSGGLFGNNTNSSS
FT                   TPNTNSSAGVNTNAPTGGLFGSASQSANVGGLFNKPNANPSNSRPLFGGSTSNSLNANS
FT                   NGGIFGNSASASKPGQANAPGLFSATSSIPSSTGNFSNTTFSGGQGATSFGGNGVMLSS
FT                   GNQGSIQGSTAASNPYGLQFNAIAKSAGSMPESITTSLFKSNAHSNKDGGANNAQKTSG
FT                   SSSSPASSLKSNGTLIGKLSSRLRNTRSNELTQGLFSPVRKPIFRQEIVPTSSTTESNL
FT                   KDHSHFQRGLENSAKANRSEAADMRKLKIDTGRSAAKKMKLLSGQSTTTSTKILGSRDL
FT                   HQDLEEPRSVLQKRETTEPELTGKELNDKTVGYWCSPTIEQLSRLPIKQLCSVSNFVIG
FT                   RQGFGSISFDSDVDLSSYVSDLKTSLFGKIVIFHGNKTVEVYPDGTSKPPLGYGLNVPA
FT                   TITLEQIYAVGKNSRTPLKEHSAEEVQLLIKKLRRLKGMSFVSYNPLEGLWTFKVQHFS
FT                   IWGLIDEDGTEKKEQEPSSEADHKQRKIAVPKHRSIAAKSCQAFDKQAMDETSMHPRGG
FT                   LDIDGVAFGTLVQNEIESGDTEFNELVEEKQYEPSDVDPEDFEGMEVQTALGVANNWAT
FT                   QLELADDPYNSAFRSTNLQRTGNREASSLSQAFDETFNTNKSAKRTLRLSHIPKLAKFS
FT                   KDSKLLCNSKKDVSGCTLVDVLAWDNESRCRISQTLEKNYINAKVNMRGSNGYPMVKSF
FT                   SVTISEMEATLAVGEGHNIWKLFSILFDEKGISPKKDRKAELDELVKGKRYQLLCSWVV
FT                   QEVSKSVLNRIESTQNPNESIFYQLIIGDIIGATKAAIKLKNPHLSALITLLNTNNPNV
FT                   RFLASQQLRKWKALNRKVDLFVVKIYQLLSGQPFDQTCVVDLTRELSWLECLSVYLLFS
FT                   DMNASSLEEFVAQFLEAHPTSSKPVSYEVIFSVLKFFCSEVRDERMLKRMRVSKNVFDD
FT                   RAFWFLVQTLRFKKCCNFTSDQTDSITLQFQEQLEANELYGEALFTLLFVHSDVLAKQH
FT                   IDDLIRRHVHFFSGASGRDILKRFQVPDSLIFQAIALRHKFDENYLAEAENLLEGGLVE
FT                   DAVQTLLTNVAPEMILRSTTDKQSLKTLRDILDKVPSEFLDTSGRDLGVFSEYLNFALD
FT                   GHTDLATLEKLIHALPPFYATYGHVSKISICCSVMAYAVSLAYLMTENAEAAASSMKDR
FT                   LLELPLGEPEARYIRKNLKAP"
FT   gene            complement(<445934..>448648)
FT                   /locus_tag="KLTH0H04994g"
FT                   /old_locus_tag="KLTH-ORF1606"
FT   CDS_pept        complement(445934..448648)
FT                   /locus_tag="KLTH0H04994g"
FT                   /old_locus_tag="KLTH-ORF1606"
FT                   /product="KLTH0H04994p"
FT                   /note="weakly similar to uniprot|P53148 Saccharomyces
FT                   cerevisiae YGL093W SPC105"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30236"
FT                   /db_xref="InterPro:IPR013253"
FT                   /db_xref="InterPro:IPR033338"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2H5"
FT                   /protein_id="CAR30236.1"
FT                   /translation="MVVVYTSWATSFMNQEFGKTSKTSLDGKAQVKERSKSMVPGRSIL
FT                   KQKFLFNDGGSENLTLSNIPIFSSSQEHEDADGRNNTTSRLNTSKLQSKLDRRVSFAPD
FT                   VTLHRVDFVPQDRSTFREPRRKPAAEAFTDDFSKEHVQNSQERTYNEESMQLTNNYGGP
FT                   LVDNSMILNSEQGNQSTPYTPAYDKEVSMEITQLFSKHSAGPENNSEEIIGSRQSSAHQ
FT                   EEEDMEVTQLHKEGIQHEEEGESMVMTEVFQPPQKESYISQPDRSRNSPKNNGEETSDM
FT                   ETTEIVRANQAGMSKPNDASLTDEVSHATSLTVPMQAERDVFDIRSSQFVTSTQKDREE
FT                   QNFGAQKDRNIETSGRVFDENISRKKRRVSSAHGFDEDGASAAKIPHGAETDEDMEITM
FT                   MERLSPIAISINMSNSPKTSIPKENINASSAYDRNFPDVTVDKTREQASLKAFLHSVGI
FT                   SSLLSDTELELLPINRMSFVSSQKGRKWPVVEVYYGLYANMPILEIYAFCCKELLRRIL
FT                   KSRELFKELEEEIARNPAPALFKRYFESGTLEREKLSDQITLLRRFSRLEAEKVWLEWR
FT                   SRHLNGIKNVLQENLLLLKDEYNSIMDHVDKVNRAKRNILNTRQNILTEIRLAQSLTQS
FT                   KSPSPGIPDRLKLEALKAELVQEMQALKSSSEFEKRMKAVRSDIKNVKLEIERTRSAIN
FT                   SLRSEVKGSPAFAAHQAENLRATFDIVQKICGISFKSYRKSLLTVQLNDPPITATFDIK
FT                   RAQQVGDVDLAFPNSLKGIAKEIYARSVRTASSCESNVYQFIRALSHDSFNAHLLLTEY
FT                   KRLKLLLPCKVVEVSGSIDIEITCFDSKKKKFLLLELSLNEFVSAVKGLASSGPKLRVR
FT                   GLCSERLQPEDALKFLQTKASGVLPWLKEPTLI"
FT   gene            <448816..>449112
FT                   /locus_tag="KLTH0H05016g"
FT                   /old_locus_tag="Klth0H.mRNA.535.p"
FT   CDS_pept        join(448816..448965,449041..449112)
FT                   /locus_tag="KLTH0H05016g"
FT                   /old_locus_tag="Klth0H.mRNA.535.p"
FT                   /product="KLTH0H05016p"
FT                   /note="some similarities with uniprot|O14464 Saccharomyces
FT                   cerevisiae YPL183W-A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05016g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30237"
FT                   /db_xref="GOA:C5E2H6"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2H6"
FT                   /protein_id="CAR30237.1"
FT                   /translation="MFSLLRTNFSRLLPQTGAGFLKAPLGNSSPFLTRGFKVRTAIKKF
FT                   CSDCYMVRRKGRVYVYCKSNKKHKQRQG"
FT   gene            complement(<449230..>452217)
FT                   /locus_tag="KLTH0H05038g"
FT                   /old_locus_tag="KLTH-ORF1603"
FT   CDS_pept        complement(449230..452217)
FT                   /locus_tag="KLTH0H05038g"
FT                   /old_locus_tag="KLTH-ORF1603"
FT                   /product="KLTH0H05038p"
FT                   /note="similar to uniprot|Q08924 Saccharomyces cerevisiae
FT                   YPL183C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30238"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2H7"
FT                   /protein_id="CAR30238.1"
FT                   /translation="MSQLRQLSHTGPSVCVKFHGKYVLAGYGVFVHVYNYESGELVSIS
FT                   RVFHRNKVHGLAIREKSVLLYGGRSVSLLDIDYLWGNADNTRFEKLCHEWVVSGEHSMD
FT                   GSSVFLLTSYNKVLCCDLSFRVLQTKAVYGERSILYSGTITVLNQDKVLVNAGTVMDGV
FT                   LVWDLKTEKTIHHFTDHEGSIFYVAASIKGRYAASCSDDRSIKLWDLHSGHLVSTGWGH
FT                   TARIWNLKFYDNDSKLISVSEDCTCRVWEISERGTLIQKSIHELHQTKSIWGVDVNDEK
FT                   MIAVTSGNDGRIKITDLNARTKSDSDSRIFSLDDISKHGVKLRPNEIIKGFYWLRFGLL
FT                   AMTSEGQVLKFDQKAEMWTSVMTDSRFTSYSATSGVQEFDMVIFSNSRCELLILKFSED
FT                   GNEILENKQLQINELTKSTNCLVRGYNSKLFLVMESPNPKDPFFCLRMDASNLQHEERL
FT                   YFKKPKNFTASSFAFYENFAIFGSRFSTLAIFDLENCEREATVLRKILPGDTITSIDFV
FT                   EKNSESDCLFSVSDRDGFYCFISINFLKRSHKVLLQNRIPKGFLEGAHYNAQGDFITYG
FT                   FKSNLFYVFNETKQYEVFSELCGGAHRQWRYLPNFGLDEFIFIYIKASSINFRKIHKAA
FT                   YPEILRNGLHGREIRDLCVRTEPLHLGKTVFCSASEDTTIKLNVLNVKDGETKTVWTFR
FT                   KHTSGLQRCKFINNKFMISSAAREELYLWELTDTFMSNPYMTIICALPSSSEIPDLRIM
FT                   DFACKAIEGTEDFILTTVYSDSAIKVWLYSSDENTFKLLISDKYQTCCLLNVALVTLDT
FT                   ELILVVSPTDGHLVCWNLTKYIPYVIQNNKLVKVLEGFQPQIHLPDISERIAVHSAGIK
FT                   SFEFKIIAENRFFVYTGGDDNAVAISEFVLDKSHKTIQGCVRSFISAGAASTITSVKLI
FT                   RRDMTLLTASVDQVVRYYDVSAGDLVLKNKFYTTNADTGCIDTLSSATGSIALIGGVGF
FT                   SVWTLE"
FT   gene            <452490..>455876
FT                   /locus_tag="KLTH0H05060g"
FT                   /old_locus_tag="KLTH-ORF1600"
FT   CDS_pept        452490..455876
FT                   /locus_tag="KLTH0H05060g"
FT                   /old_locus_tag="KLTH-ORF1600"
FT                   /product="KLTH0H05060p"
FT                   /note="similar to uniprot|P53010 Saccharomyces cerevisiae
FT                   YGL094C PAN2 Essential subunit of the Pan2p-Pan3p poly(A)-
FT                   ribonuclease complex which acts to control poly(A) tail
FT                   length and regulate the stoichiometry and activity of
FT                   postreplication repair complexes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30239"
FT                   /db_xref="GOA:C5E2H8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028881"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR030843"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2H8"
FT                   /protein_id="CAR30239.1"
FT                   /translation="MNNWQLTFQSPVDLTEHLRKPYLLYDERDKNVTRTMFDEHANLVW
FT                   AGDTYGRISSYDPSYSLYTRYAGHIGGLPVVDMLSHPGGVMSLSADSIHFASRQGVTRL
FT                   NLTSADIAQLCEMKAMCFSSIAGNHVYCAGSNSGSGIIDIDLQKGALFNNIDYASKVKM
FT                   MRSDNKTILIGKQTGTIDLLDQSSNQLIRSFAAHSATISDMDLRDNTLVTVGKSRRFNQ
FT                   MCSDPFVNVYDLRMMRQLTPVAFSHNQNIGSSGSAGADFVRLHPVLPTVMTVASTSGAF
FT                   DFIDLADPTLRSQYCHPCHSISQFQLSPSGDYIAVLEHDNTISTWSRSGGMSGFTNSSA
FT                   ILEYPDYPDDGPPGNVSVNDESYPLSSVGMPYYSEKLLSSWPHVIFRSGGTLPRKMQDS
FT                   GGLIQTPSSRLFQLSTHNSQTYSLVPYNTAKYGRRNVMRPYKSLRERKKKLLITDEDGT
FT                   DKRELMRYKALNDYEVPPAYTKLQMVYGKYGVEDFDFKAFNKTQLSGLECDIENSYTNA
FT                   ILQLYRFVPEFYNFVVSCLREEPGPENSILAELGYLYDMMDKAKGVVCRSANFQKLLTS
FT                   LPSAKDLGLLRDSLATELSDSLAGLDIDYHGNAMEAENKIAVPGTDVPQAFNKFLLSKL
FT                   IAEEVQKKINTTHSIALEELVGIRLSTETRSISSCGSYERGTSIVPSLDVTSPATNNTK
FT                   YSNKKLSNQTVLPYIESSMNRIRHKRALCEKCQKLENIEQEQTVRNLPPLLSLNICLSS
FT                   SEWDIAKTVKNWLAKDFYATLSKDRPILKLHPTDLKTNSAIFKYDLNAYVARVTDDMSE
FT                   PHLVTYAKVFDPKTKQDKWFMFNDYLVIEVDEDEALDITPWWKTPEILIYSDAEELRKP
FT                   FVPVSSFRIDDSVLYRDYFANGIREGVKKEYQHLTASEAPQPGSLVAMDAEFVILADEE
FT                   VEISCRGQRTLIKPKKTALARISVLRGDDGDDFGVPFIDDYVVNTNHIENYLTRYSGIE
FT                   PGDLDPETSNKTLVPRQMVYRKIWLLLQMGCVFVGHGLYNDFRNISIYVPPEQIRDTAL
FT                   YFLQGKRYLALRFLAHALLDADVQSGNHDSIEDAYTALVIYKKYLQLESSNLFENTLNQ
FT                   LYEEGRACGFKVPGDRSVAPM"
FT   gene            complement(<456119..>458281)
FT                   /locus_tag="KLTH0H05082g"
FT                   /old_locus_tag="KLTH-ORF1595"
FT   CDS_pept        complement(456119..458281)
FT                   /locus_tag="KLTH0H05082g"
FT                   /old_locus_tag="KLTH-ORF1595"
FT                   /product="KLTH0H05082p"
FT                   /note="weakly similar to uniprot|Q08921 Saccharomyces
FT                   cerevisiae YPL180W TCO89 Tor Complex One"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30240"
FT                   /db_xref="GOA:C5E2H9"
FT                   /db_xref="InterPro:IPR018857"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2H9"
FT                   /protein_id="CAR30240.1"
FT                   /translation="MSVAQSRGRSLRLDSEFASAMNNKHTASNSGKKLRQFTTNSRSKS
FT                   AASFKGLNKLRRVLSHDGALEIEDYAKERPDFMKKSKSSDSLSRKRAISGLSMTALGKV
FT                   RSHPGHSSASDANGGSGSNSGQHHVGLRPHRGNSVKSVLALQGGDDELYEDHSTTDEEV
FT                   EYFTDEEHEGQNGGQSLRARQQPRSRSRQKQNTSSNRVYDELQRSASRSSREDQTLRGS
FT                   VKELSSSLGQGTVDTELLREDSNKTLGNNQLHYGVPSNLRDQDEDHIDNGDHINAGDHI
FT                   NNEDHINNEDHIGNGDHIDAGDHINNEDHIDQGNPDEDTINANSNIEIIANSLKRHGPS
FT                   TRNDELIYGNDANTENATQNHSLQSTGRFSPVMILSQSTGVEKRFDRPANIAEDPTSQR
FT                   FNSKDQDSENKVQSNNFNYINSDFTASYASSSISERQPQNVSKPDFSTSISSLSSHLHK
FT                   PAQVTADNRTTSILHQRAPQASLPTNNGNSSRLEGHSSSANRLDPLSNFNNFSQFLQSE
FT                   TSGAVSRTQQKLWLQRESSIMDLSANNSGADTIFLASNIEVKREFERISREYTNVRRFS
FT                   NPLNASLNRVVPRSKIEVKKHRSPFSQGDELSKVFKNEFSKDAKTFKEFCRENLNQKLD
FT                   IDRVLARIWNQESEDFNKESELLGDNEPEGASSMPAGQRTHNRHSLRNNGPNSNTNHLR
FT                   TVSSLQPTTRAVHRRMESALGQQQRL"
FT   gene            <458594..>460333
FT                   /locus_tag="KLTH0H05104g"
FT                   /old_locus_tag="KLTH-ORF1592"
FT   CDS_pept        458594..460333
FT                   /locus_tag="KLTH0H05104g"
FT                   /old_locus_tag="KLTH-ORF1592"
FT                   /product="KLTH0H05104p"
FT                   /note="similar to uniprot|P38932 Saccharomyces cerevisiae
FT                   YGL095C VPS45 Protein of the Sec1p family essential for
FT                   vacuolar protein sorting required for the function of both
FT                   Pep12p and the early endosome/late Golgi SNARE Tlg2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30241"
FT                   /db_xref="GOA:C5E2I0"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="InterPro:IPR027482"
FT                   /db_xref="InterPro:IPR036045"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2I0"
FT                   /protein_id="CAR30241.1"
FT                   /translation="MNLFQVSDFYIDRIVNSKSKSVLNGSLDKPRIKALLLDKDTTGTI
FT                   SMCTTQSELLEHEVYLIDTLENQNRDVMRHLKCLVYAKPTDETIEHLVKELQDPKYGEY
FT                   QIFFNNTVAKTQLERLAESDDLEVVSKVEEVFQDYQVLNQDLFSLDVRSSKLFSHQMIW
FT                   EPSGLADTTHSLISLLLSLKVKPLIRYEAGSRLTSKLAKEVMQEIHKNERALFDFPVMD
FT                   SPPQLLILDRHQDPLTPLLQPWTYQSMINEYIGIKRNVVDLSKVPDIDDSLEQVVLSSK
FT                   QDPFFHDTMYLNFGELGDKVKQYVSSYKDKTKSNAQINTIEDIKQFIGKFPEFKKLSGN
FT                   VSKHMAIVSELDRQLQVQHIWDVSEVEQNISAHMGDSQVYQDLKGVLSDERVSGFHKLK
FT                   LACIYSLRNATSPHMNEISATLAANVSPEELNFFHHFNSVFQTRTKSANTGKEREDLIS
FT                   ELAKKFNQKGQHKSDNVFMQHVPDLSAILSDLSKNKLPEDRFPFLEKPGARTFCQDVII
FT                   FHVGGTTFEEARIVHEFNSGMAGDGGGKIRTILGGTTILNTREFLNDCREVGQGSTELT
FT                   DLL"
FT   gene            complement(<460360..>461550)
FT                   /locus_tag="KLTH0H05126g"
FT                   /old_locus_tag="KLTH-ORF1589"
FT   CDS_pept        complement(460360..461550)
FT                   /locus_tag="KLTH0H05126g"
FT                   /old_locus_tag="KLTH-ORF1589"
FT                   /product="KLTH0H05126p"
FT                   /note="similar to uniprot|Q6B1X3 Saccharomyces cerevisiae
FT                   YPL181W CTI6 Protein that relieves transcriptional
FT                   repression by binding to the Cyc8p-Tup1p corepressor and
FT                   recruiting the SAGA complex to the repressed promoter
FT                   contains a PHD finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30242"
FT                   /db_xref="GOA:C5E2I1"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2I1"
FT                   /protein_id="CAR30242.1"
FT                   /translation="MTKVQDPAKQDEVAAPQEVKAEDVPKADEEDEEEEGETRCVCGEV
FT                   DPPDDSGLYIQCEECSVWQHGFCVGITEGEDSAPDKYWCERCRPDLHHLYDTDLGEHRS
FT                   AYQPVQQNKRQNRRLRREDVPSVESGVEDEEAVKSESSKTSLPAEAPKPRKRHQRRKDS
FT                   ASGLPTTIQGGRRDSNEDRRSLDRRRATSSAREEKQYQLMLEKALKESRRTSQHGDESD
FT                   VPVLPDGIHGKHEADEEAVIETEASEPPKKRSKLNTPSGTPPTSSEDETRRRGKRGPQR
FT                   KLKSRSNSRPSSNDNNCNGSDIGINKPIKPRIPTQRTSINEMRRRVSAILEFISRTQVE
FT                   LSQDQIEKQQLTEFVENEDFIKKVDSIYSNYDESLKMMDDLTRKLLLWEKKYALDQ"
FT   gene            <462699..>464246
FT                   /locus_tag="KLTH0H05148g"
FT                   /old_locus_tag="KLTH-ORF1582"
FT   CDS_pept        462699..464246
FT                   /locus_tag="KLTH0H05148g"
FT                   /old_locus_tag="KLTH-ORF1582"
FT                   /product="KLTH0H05148p"
FT                   /note="similar to uniprot|P32945 Saccharomyces cerevisiae
FT                   YPL179W PPQ1 Putative protein serine/threonine phosphatase
FT                   null mutation enhances efficiency of translational
FT                   suppressors"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30243"
FT                   /db_xref="GOA:C5E2I2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2I2"
FT                   /protein_id="CAR30243.1"
FT                   /translation="MGNSPSKSNYAIPSTKTASATTQGLTTTGDDLNSNEPNDPDDSRS
FT                   LPTQVIKIHKVAPGEPKNNVIPSAAASGRGARRKSPAAYDLEIDMSFAKALSATTSSQG
FT                   SSSGSSSGSSSGSHDSNMTPPSYSTDSSFLNYSFPDEPQTPGSANGAPVAASLPPIKEE
FT                   MAVTASLVRRNRLQQRGHPHIPHDRNAAPPVILKRYAHDLQSTEHLDIDDVIEKLLKIG
FT                   ETRYYQAKEFPFSSWKVQLICARARELFLEQPSLLRLQAPIKIVGDVHGQFTDLMRILK
FT                   LSGVPPNTSYLFLGDYVDRGKQSLETMLLLLCYKIKFPDRFFMLRGNHESANVTKMYGF
FT                   YDECKRRLSTKCWKMFVDVFNTLPLAAVVQDKIFCVHGGISPDLKDLGQIERIARPTDI
FT                   PEEGLFTDLLWSDPDPQVSDWSVNDRGVSVTFGKRNVLDFCSRFNFDLIIRGHMVVEDG
FT                   YEFFARKKFVTVFSAPNYCGEFQNWGAVMSVTTGLMCSFELLKPHGAKGGAAHKHKG"
FT   gene            complement(<464733..>464804)
FT                   /locus_tag="KLTH0H05192r"
FT                   /old_locus_tag="Klth0H.tGlu_TTC_34"
FT   tRNA            complement(464733..464804)
FT                   /locus_tag="KLTH0H05192r"
FT                   /old_locus_tag="Klth0H.tGlu_TTC_34"
FT                   /note="tRNA-Glu (TTC) cove score=62.09"
FT   gene            <465108..>465710
FT                   /locus_tag="KLTH0H05214g"
FT                   /old_locus_tag="KLTH-ORF1578"
FT   CDS_pept        465108..465710
FT                   /locus_tag="KLTH0H05214g"
FT                   /old_locus_tag="KLTH-ORF1578"
FT                   /product="KLTH0H05214p"
FT                   /note="highly similar to uniprot|Q08920 Saccharomyces
FT                   cerevisiae YPL178W CBC2 Small subunit of the heterodimeric
FT                   cap binding complex that also contains Sto1p component of
FT                   the spliceosomal commitment complex interacts with Npl3p
FT                   possibly to package mRNA for export from the nucleus
FT                   contains an RNA-binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05214g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30244"
FT                   /db_xref="GOA:C5E2I3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR027157"
FT                   /db_xref="InterPro:IPR034148"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2I3"
FT                   /protein_id="CAR30244.1"
FT                   /translation="MSLAEFDEINYDHSASRLDVPSNYLMKKARRNPNGLEDLRRSMRS
FT                   ATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALDAV
FT                   KYLSGTKLDDRNISLDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASRGGFTVPLVDRI
FT                   GFSNTHNFGARRVRDTYVPEEPEDDEEEPDTYVPGED"
FT   gene            complement(<465998..>466702)
FT                   /locus_tag="KLTH0H05236g"
FT                   /old_locus_tag="KLTH-ORF1573"
FT   CDS_pept        complement(465998..466702)
FT                   /locus_tag="KLTH0H05236g"
FT                   /old_locus_tag="KLTH-ORF1573"
FT                   /product="KLTH0H05236p"
FT                   /note="some similarities with uniprot|P41817 Saccharomyces
FT                   cerevisiae YPL177C CUP9 Homeodomain-containing
FT                   transcriptional repressor of PTR2 which encodes a major
FT                   peptide transporter imported peptides activate ubiquitin-
FT                   dependent proteolysis resulting in degradation of Cup9p and
FT                   de-repression of PTR2 transcription"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30245"
FT                   /db_xref="GOA:C5E2I4"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2I4"
FT                   /protein_id="CAR30245.1"
FT                   /translation="MNSNAQCFAQLEQGVKLPSIRSLLDSIGAEQEGGAETRRPLPALA
FT                   LPALASTLPERQQQPDNQLSQPRNQQPGQQPNNLQLSHPHNQQPSQQAPSAARRAAAPP
FT                   RRNNLPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRRKVFS
FT                   DYYQMSRARRAGAPDEATDAVGAAGAPTATDADLELRFQAAPLTRRKKLIDRLDELKKA
FT                   SQDSARQCRGPY"
FT   gene            <467504..>469522
FT                   /locus_tag="KLTH0H05258g"
FT                   /old_locus_tag="KLTH-ORF1565"
FT   CDS_pept        467504..469522
FT                   /locus_tag="KLTH0H05258g"
FT                   /old_locus_tag="KLTH-ORF1565"
FT                   /product="KLTH0H05258p"
FT                   /note="weakly similar to uniprot|P33757 Saccharomyces
FT                   cerevisiae YBR250W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30246"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2I5"
FT                   /protein_id="CAR30246.1"
FT                   /translation="MFSATWPRSCVSRGPCPLSLCHGLACVAPHGHALSGPAASLFPPR
FT                   SQCSSGKTLYMTNSAKRGGSRAGYRCTAETHIVRAYRSTDDSLAILTKAKTLFFRARVC
FT                   KQAPSCSATFHSGGTTSAGSGDESFAQYGSAFVTLDSVYKGGAQGRYRRRGAARRDTHT
FT                   PKRACHKMNSSTPSTATQISLPRDSGCAPAPPSYTAAAGEAARQPRRLELSSLAARGTL
FT                   LKHPEPTPPSFGYNAFDRGKNPCITSHDSSLLHVTLVPDRDCFYMAALEPQLLSRRDAA
FT                   DHAPAFEGRGVVSGTLRVVVKGPDALLLENVHVRLSGFCSEFARCASAGSATHSMRMVS
FT                   ATNCGTTPFVQDFIRFGTPASAGAANAASGPSAGLVLLPPGEYEYRFEFVVDAATFPAS
FT                   IETAYGSTIYRLEALVSMPKRKRRFGNKYESVFLTSAVTLKKALQHRYAALYQGFTAVT
FT                   SLREEMLACDIFLSSRVVEFDAPLQVSLQMVKRDAQECQVLFTDVLVQQTLSIPCVDTA
FT                   TGVLEPTNFHQVQTVRLGNMDFCDEQQQCLNAAFPELRVPSTLKTVERNRSFFPHYEEP
FT                   SLAARGLEPVRSRLRVAHELKIVIGVHINQPGDQQRPKSVRLTIKFPIALVDPDMGCCV
FT                   NLPRYEPKSLIPLPSGLCKLDSDSAPSTPPEYSDAEL"
FT   gene            complement(<469755..>471596)
FT                   /locus_tag="KLTH0H05280g"
FT                   /old_locus_tag="KLTH-ORF1556"
FT   CDS_pept        complement(469755..471596)
FT                   /locus_tag="KLTH0H05280g"
FT                   /old_locus_tag="KLTH-ORF1556"
FT                   /product="KLTH0H05280p"
FT                   /note="similar to uniprot|P38156 Saccharomyces cerevisiae
FT                   YBR298C MAL31 Maltose permease high-affinity maltose
FT                   transporter (alpha-glucoside transporter) encoded in the
FT                   MAL3 complex locus member of the 12 transmembrane domain
FT                   superfamily of sugar transporters functional in genomic
FT                   reference strain S288C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30247"
FT                   /db_xref="GOA:C5E2I6"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2I6"
FT                   /protein_id="CAR30247.1"
FT                   /translation="MSNNFDKNKLVHVETTVSSQTNMAESSLDLPYSASKKTDTQHLEF
FT                   AGQEVEETGYATTAVGSDTIAKFLGLSEDARQADGAEKQMPLLQAIRQYPKAAMWSVVL
FT                   SSALIMEGYDTALLSSLYALPAFAKRYGSYNPANGIYEIDAKWQTALSMCINVGEVIGL
FT                   QFAGIAADRVGYRWTLIASLIAVFGFIFILFFAVSCPMLAVGEILCGIPWGCFQTLTVS
FT                   YATEVCPLALRYYLTTYVNICWILGQIMASGVLKNSQENLANSSLAYRLPFALQWIWPL
FT                   PIAVGIYLAPESPWWLVKKGRMNEAGRSLSRLISGLKSGEKAAVIDAMLKKIQLTTQKE
FT                   DAMTRDTTYWDCFRGPDGRRTRIACLTWVTQNACGSAMMGYSTYFYTKAGLSESYAFSF
FT                   SIIQYCLGLVGTVLSWFFSKKYGRFTIFAGGLAVQSLLLIAIGASGFSHSDGAKWAAGS
FT                   LLLIFVFVYDVGVGPVTYCLVPELPSNKLRTKTVILARNFYNLMGIINAIWTPYMLNSE
FT                   KWNWGAKTGLFWGGISLVMLTWAILDLPETKGRTFGEIDELFLQGVPARKFKSTEVNPY
FT                   DSAKLMAELNDEQIEHIVRTDERQKADPMTTIMEDSE"
FT   gene            <472845..>474605
FT                   /locus_tag="KLTH0H05324g"
FT                   /old_locus_tag="KLTH-ORF1547"
FT   CDS_pept        472845..474605
FT                   /locus_tag="KLTH0H05324g"
FT                   /old_locus_tag="KLTH-ORF1547"
FT                   /product="KLTH0H05324p"
FT                   /note="similar to uniprot|P53051 Saccharomyces cerevisiae
FT                   YGR287C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05324g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30248"
FT                   /db_xref="GOA:C5E2I7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2I7"
FT                   /protein_id="CAR30248.1"
FT                   /translation="MSAVDKWWKEAAVYQIYPASFYDSNGDGWGDLPGITAKLPYLRQL
FT                   GVDALWICPFYDSPQQDMGYDISDYEKVWPRYGTNEDCYQLIREAHAAGIRVVVDLVIN
FT                   HCSSEHAWFRESRSSKTSAKRDWFIWRPAKGFTADGKPIPPNNWQSFFGGSAWEWDERT
FT                   QEFYLRLFASGQPDFNWELSEVRKAIYESAAGFWLDHGVDGFRIDTAGLYSKIGGLPDA
FT                   EVRDATNEHQHPGHNTQNGPRIHEFHKEMRAFFDKRTAGRANEIFTVGEVGRCDLAGLL
FT                   QYTSEQEREMSQLFNFAHTECGVGTHLRYHAQPFTLKEWKLGIAASFLFANRTDSWSTV
FT                   YLENHDQPRSVTRFGDDSPAWRQVSAKLLAILEVALTGTLYVYQGQELGQINNHGWTLD
FT                   QYQDVDMITNRDIIAKRYGKNSVEMAKFAQGVALLSRDHSRTPFPWTSREPDASFSAVC
FT                   QSGVKPWISMNDSFRDGINAEDELKDPNSVFHFWRAALRLRKQHKDILVYGQGFEFFDL
FT                   DNPDLFMFTKKSRDGAKTLFAALNFSSEDREFPLPDEDAAYKAFFGNYDLESAQERTLR
FT                   PWEGRLFYVE"
FT   gene            <475454..>476554
FT                   /locus_tag="KLTH0H05346g"
FT                   /old_locus_tag="KLTH-ORF1541"
FT   CDS_pept        475454..476554
FT                   /locus_tag="KLTH0H05346g"
FT                   /old_locus_tag="KLTH-ORF1541"
FT                   /product="KLTH0H05346p"
FT                   /note="highly similar to uniprot|P32449 Saccharomyces
FT                   cerevisiae YBR249C ARO4 3-deoxy-D-arabino-heptulosonate-7-
FT                   phosphate (DAHP) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30249"
FT                   /db_xref="GOA:C5E2I8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2I8"
FT                   /protein_id="CAR30249.1"
FT                   /translation="MSGQAPSPAALEKAEDVRILGLDPLVSPALLQSQIPATSECLKTV
FT                   QKGRVGASKIITGEDDRLLVIVGPCSIHDLDIAQEYARRLKKLSDELEGELCIIMRAYL
FT                   EKPRTTVGWKGLINDPDVDNSFNINKGLQSARQLFVNLTSAGVPIGSEMLDTISPQYLA
FT                   DMLSFGAIGARTTESQLHRELASGLSFPVGFKNGTDGTLGVAIDAMLAASHSHHFMGVT
FT                   KHGFAAIITTKGNEHCFVILRGGKKGTNYDAKSVAEAKAQLPPGGTLMIDCSHGNSNKD
FT                   YRNQPKVNDVVCEQVANGEDKIIGVMIESHINEGKQNIPPEGKQGLKYGVSITDGCIGW
FT                   ETTDQVLRKLADAVKQRRALKKKSSA"
FT   gene            <477523..>479175
FT                   /locus_tag="KLTH0H05368g"
FT                   /old_locus_tag="KLTH-ORF1537"
FT   CDS_pept        477523..479175
FT                   /locus_tag="KLTH0H05368g"
FT                   /old_locus_tag="KLTH-ORF1537"
FT                   /product="KLTH0H05368p"
FT                   /note="highly similar to uniprot|P33734 Saccharomyces
FT                   cerevisiae YBR248C HIS7 Imidazole glycerol phosphate
FT                   synthase (glutamine amidotransferase:cyclase) catalyzes the
FT                   fifth and sixth steps of histidine biosynthesis and also
FT                   produces 5-aminoimidazole-4-carboxamide ribotide (AICAR) a
FT                   purine precursor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30250"
FT                   /db_xref="GOA:C5E2I9"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014640"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2I9"
FT                   /protein_id="CAR30250.1"
FT                   /translation="MSTVHIIDVESGNLKSLRNAVEFLGFNVKIVKSADDIELSKAERL
FT                   ILPGVGNFGHFVDNLTLKNFEKPIREYIASGKPIMGICVGLQCLFLGSEESPKSTGLKY
FT                   LDLQLTKFDTSEKPVPEIGWNTCTPQDNLFGLDPCNRYYFVHSYAAIIDAEDKARLSEA
FT                   GWNIAAAKYGSQEYIAAVARDNIFATQFHPEKSGHAGLEILKNFINQTHPTIKHTDREK
FT                   AALQNDYSNYGLTRRIIACLDVRTNDQGDLVVTKGDQYDVREKQEGGNVRNLGKPVELA
FT                   QKYYEQGADEVTFLNITSFRDCPLKDTPMLEVLKQAAKTVFVPLTVGGGIKDIVDVDGT
FT                   HIPALQVAALYFASGADKVSIGSDAVYAAEKYYELGERGDGASPIETISKSYGAQAVVI
FT                   SVDPKRVYVDGPESVKHKTFETKFPNEKGQTWCWYQCTIKGGRESRDMGVWELTRACEA
FT                   LGAGEVLLNCIDKDGSNSGYDLELINHAKEAVKIPVIASSGAGEPKHFKEAFESTGADA
FT                   CLGAGMFHRGEYTVNDVKQYLLDSGFKVRMESQ"
FT   gene            complement(<479388..>480833)
FT                   /locus_tag="KLTH0H05390g"
FT                   /old_locus_tag="KLTH-ORF1535"
FT   CDS_pept        complement(479388..480833)
FT                   /locus_tag="KLTH0H05390g"
FT                   /old_locus_tag="KLTH-ORF1535"
FT                   /product="KLTH0H05390p"
FT                   /note="similar to uniprot|P21827 Saccharomyces cerevisiae
FT                   YGL097W SRM1 Nucleotide exchange factor for Gsp1p localizes
FT                   to the nucleus required for nucleocytoplasmic trafficking
FT                   of macromolecules potentially phosphorylated by Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30251"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2J0"
FT                   /protein_id="CAR30251.1"
FT                   /translation="MSKRSASPPLTPGKRARKHLVSTIHKHYELINSQDDYKYMYLSLQ
FT                   PLDIFCWGTGSMCELGLGPSAKNKEVKRPRLNPYLPRDQAKIVSFAVGGMHVLALDQDN
FT                   HVWSWGTNDSGALGRDTSHANEQLKDMDADDSSDDEDGDLNDQESTPIKLPDESLPLKD
FT                   HKVVQLAATDNLSCVLLDNGEVYAWGTFRCNEGILGFYKDTIKIQNTPWKVPSFTTSKV
FT                   VQMAAGKDHILFLDEGGVVYAWGNGQQYQLGRKIMERSRLRTLDPRAFGLDKVKYIATG
FT                   ENHSFALTRDGRLYSWGLNQFGQCGVSEEVDDGALVTVPTEVLLPEGTRVKMVSAGEHH
FT                   SMVLTEEGELYTFGRLDMFEIGIPKAKLPEQTYIDAHGKPRAVPVPTKLVEVPRFKNIA
FT                   AGSHHSLAISEDGVVFSWGFGETYAVGLGPSGDDIEVPTRIKNTATQDHDIIFVGGGGQ
FT                   FSVSGGIKLNDQDAEKRADKYDD"
FT   gene            <481190..>482041
FT                   /locus_tag="KLTH0H05412g"
FT                   /old_locus_tag="KLTH-ORF1534"
FT   CDS_pept        481190..482041
FT                   /locus_tag="KLTH0H05412g"
FT                   /old_locus_tag="KLTH-ORF1534"
FT                   /product="KLTH0H05412p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30252"
FT                   /db_xref="GOA:C5E2J1"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2J1"
FT                   /protein_id="CAR30252.1"
FT                   /translation="MKIQTLFCVGLLLAFATSSASFWEGLSQLTHKKTSFLKWDFNVDR
FT                   LANNVGRLTGDTHFLAVTDAVVRNAERQMLNLFIQNPAVGITKDVNRLCREIESSSARL
FT                   VISLDHPAWEPARQQVTQYLEGRSREFGLRLASHIRGDARSPSAGLVDLLASFSKSLQN
FT                   AVSLVENPSKSSDAFEEFTFASRMDDLTVGRIVGEGIAEKIRDKVVGGDTHAALTDIAN
FT                   IFCDFGTLMTAYVTGLAICTAGLGAALCGVSIIICGGGTIIYICRLLQNLDKVFKTLGV
FT                   GL"
FT   gene            <482267..>483655
FT                   /locus_tag="KLTH0H05434g"
FT                   /old_locus_tag="KLTH-ORF1532"
FT   CDS_pept        482267..483655
FT                   /locus_tag="KLTH0H05434g"
FT                   /old_locus_tag="KLTH-ORF1532"
FT                   /product="KLTH0H05434p"
FT                   /note="similar to uniprot|P38333 Saccharomyces cerevisiae
FT                   YBR247C ENP1 Protein associated with U3 and U14 snoRNAs
FT                   required for pre-rRNA processing and 40S ribosomal subunit
FT                   synthesis localized in the nucleus and concentrated in the
FT                   nucleolus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30253"
FT                   /db_xref="InterPro:IPR007955"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2J2"
FT                   /protein_id="CAR30253.1"
FT                   /translation="MGRVASSKSRKQRHDPLLKDLDSAQGNLRKAPKKREDQKDEDDQE
FT                   EYVDAASSRRILQLAKEQQQELEEEQENEKNGGNNFARFRLAGNYEEDEEEDEDQEREE
FT                   NISDFEPEYDEEQEEEEVVEIDEEDAAMFEQYFKRSTDYNSDFQSYNLADKIMASIREK
FT                   EMELNAGSASARDETQPEGVALPPKVIRAYSTVGVILKTWTHGKLPKLFKVIPSLNNWQ
FT                   DVLYVTNPADWSPHVVYEATKLFVSNLPAKEAQKFINAVLLDRFRDNIETAEDHSLNYH
FT                   IYRALKKSLYKPSAYFKGFLFPLLEMGCNIREATIAGSVLAKVSVPALHSAAALSYLLR
FT                   LPFSPATTVFIKILLEKKYALPYQTVDDCVYYFMRFRILSDGSNGEDSSRTLPVVWHKA
FT                   FLSFAQRYKNDITQDQRDFLLETVRQRGHKDIGPEIRRELMAGESREFVNNLESKDDLM
FT                   LDVQ"
FT   gene            <484160..>485866
FT                   /locus_tag="KLTH0H05456g"
FT                   /old_locus_tag="KLTH-ORF1527"
FT   CDS_pept        484160..485866
FT                   /locus_tag="KLTH0H05456g"
FT                   /old_locus_tag="KLTH-ORF1527"
FT                   /product="KLTH0H05456p"
FT                   /note="similar to uniprot|Q04301 Saccharomyces cerevisiae
FT                   YMR088C VBA1 Permease of basic amino acids in the vacuolar
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30254"
FT                   /db_xref="GOA:C5E2J3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2J3"
FT                   /protein_id="CAR30254.1"
FT                   /translation="MGEEEGRPGSIELDEIHSSKGESTVPSFPDTGEEEDLEKDFRDPN
FT                   TFPYILLSLWLNTSICAVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYG
FT                   KTSDLLGRKKCLLFAEVVFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSD
FT                   LAPLSQRSIYWGWGSVIWGFSQSVGGPLGGLLLNWFGVRGLFVVQIPFCLFSLSLTVKY
FT                   IHDLSNQTQGTWRDIDFAGSFCLITGISAFIFLCSSSGDVTDDSAVSLFKVGCFLITVL
FT                   SVSGFIYVEKNVAAKSILPAEVLKGSLGVISFIYGLASMLSYVGLFVVPLYLQLVWGVS
FT                   VAGSGGYIMYAVISTSIGSFGSGWLLRKYGAPDKDATLLNSGMMLIGSTLINTLGFFVM
FT                   FKNILEIKPAFEGVKSPSPDQKFWFLLGFAIMGLSAGFQSVSVMLYTVAKVGRKGQASS
FT                   TSVTFLFRSLGNVLSVSISLSVFVASLKGKLKSYFQGQQSDLYRKLLKENAFLRSGEVP
FT                   SDQLKDLLQVFKSAIVKAFWPSVVCCFLSVTFAGVLFVMIRRSRRFAGLSA"
FT   gene            complement(<485876..>486706)
FT                   /locus_tag="KLTH0H05478g"
FT                   /old_locus_tag="KLTH-ORF1524"
FT   CDS_pept        complement(485876..486706)
FT                   /locus_tag="KLTH0H05478g"
FT                   /old_locus_tag="KLTH-ORF1524"
FT                   /product="KLTH0H05478p"
FT                   /note="similar to uniprot|P53146 Saccharomyces cerevisiae
FT                   YGL098W USE1 Use1p is a SNARE and forms a complex with the
FT                   SNAREs Sec22p Sec20p and Ufe1p. The protein is localized to
FT                   the ER and use1 mutants show defects in retrograde traffic
FT                   from the Golgi to the ER Protein required for cell
FT                   viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05478g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30255"
FT                   /db_xref="GOA:C5E2J4"
FT                   /db_xref="InterPro:IPR019150"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2J4"
FT                   /protein_id="CAR30255.1"
FT                   /translation="MVMSVLPQLQTHKAMYGGPFDNWKRALEPVIAEELSFSDDPVLQD
FT                   IISTKALANLALLRKSAVESQLRAPKHGSSELDDYRNAFEELECSALMTRHSSRAKLTA
FT                   EHEHLMESMKSKRYSVDFDSEDTGRQEEDFENIEKAAGPEGEEEESLGQLRSRLLGNRR
FT                   GSSSGADQSANTEKQMQVHNNLQEELISDMSQLVSGLKMGAEAFQNALEEDSTVLKATE
FT                   LGLQATSRSLTNLGGKLKKYHNSKVGLLFYLGCILFMFLSLLLTYMIVKIFPKM"
FT   gene            <487381..>489102
FT                   /locus_tag="KLTH0H05500g"
FT                   /old_locus_tag="KLTH-ORF1523"
FT   CDS_pept        487381..489102
FT                   /locus_tag="KLTH0H05500g"
FT                   /old_locus_tag="KLTH-ORF1523"
FT                   /product="KLTH0H05500p"
FT                   /note="similar to uniprot|P27614 Saccharomyces cerevisiae
FT                   YJL172W CPS1 Vacuolar carboxypeptidase yscS expression is
FT                   induced under low-nitrogen conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30256"
FT                   /db_xref="GOA:C5E2J5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2J5"
FT                   /protein_id="CAR30256.1"
FT                   /translation="MSDYLPIGGSKPRGIFERRRLLATVVLGACALLSVILLAGHTVNS
FT                   PNNKDSICSECAGFKALRPAFNKSLNHILYNQDYKMSVIEKLAGAVKIPTEIFDFTPSP
FT                   SDDPEAWVHFQELHEYLETQFPYVYEKAQVEKIDGFGLLFTWQGSKPDLKPLLLMAHQD
FT                   VVPVEPNTVDMWTHPPFSGFYNSSEDLIYGRGTADIKQLVVSHLEAVERLMLDGFKPQR
FT                   TIMISFGCDEEASGSCAAKIAQHIEKRYGANSIYAILDEGGQVGEVDGVYFAEPVTSEK
FT                   GYLDAEITVFTPGGHSSVPPDHTSIGILGELIVDLEKDPYDILIEENNPALETIKCFIK
FT                   FGAIKDEEIAKHLSKNNLKKLGTALDNRLALKYLFKTSQALDIVSGGIKANALPESATV
FT                   LVNNRIGMHSSVNETLGHIMKHVQSKAETYNLGIKVLAGRYSKEETAEVIKPVTESGRF
FT                   VIRLLDPLEPAPFSPTSGSQVWDIISGTTVSTYKQKLFGGEDAKVYITPALSTGNTDTK
FT                   SFWNLTRNIYRYSGSLQYKESNEHTVDEKNSGLSLLSGVAFMYQYIPNVDAYATDA"
FT   gene            complement(<489992..>491911)
FT                   /locus_tag="KLTH0H05522g"
FT                   /old_locus_tag="KLTH-ORF1521"
FT   CDS_pept        complement(489992..491911)
FT                   /locus_tag="KLTH0H05522g"
FT                   /old_locus_tag="KLTH-ORF1521"
FT                   /product="KLTH0H05522p"
FT                   /note="highly similar to uniprot|P53145 Saccharomyces
FT                   cerevisiae YGL099W LSG1 Putative GTPase involved in 60S
FT                   ribosomal subunit biogenesis localized to the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30257"
FT                   /db_xref="GOA:C5E2J6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2J6"
FT                   /protein_id="CAR30257.1"
FT                   /translation="MPPKEPPKKWKAPKGPKPIQRKNKNTIGLGRAIRTARQKENEVQI
FT                   LPDGEMRFTTDKHEANWVKLRSVTQESALDEFLNTAELADKDFAADRHSNVKIIRMDAG
FT                   SDARSQGVTLSNAQKQQLNEKQRSQARNLIVPRRPAWNESMTRFQLERQEKDAFLEWRR
FT                   KLATLQESNEDLLLTPFERNIEVWRQLWRVIERSDLVVQIVDARDPLLFRSVDLELYVK
FT                   ELNEGKQNLLLVNKADLLTRKQRIIWAKYFISRNISFTFFSAARANEILEKQNELGEDY
FT                   VHKEIEEEEISEIDGEKVDQEVLDKIQILKIDQLEELFLSKAPNHPLISPLPGQEPLIQ
FT                   IGLVGYPNVGKSSTINALVGSKKVSVSSTPGKTKHFQTIKLSERVMLCDCPGLVFPNFA
FT                   YNKGELVCNGVLPIDQLRDYIGPCSLVAERVPKYFLEAIYGIHIQTKSADEGGTGKPTA
FT                   QELLVSYARARGYMTQGFGAADESRASRYILKDYVNGKLLYINPPPHLEDDTPYTREEC
FT                   EEFNEDIYTFDKLPQTRQEQLADAVKSKNLEDFDLARDLGKLTFSAHIGKEGDSKEARS
FT                   VNHGGKQAALYNAAEDLDNEFFKMSSVKGQLTNPFHKTQAESSGGKKHNKKNKKGKTRA
FT                   KFSD"
FT   gene            complement(<492106..>493374)
FT                   /locus_tag="KLTH0H05544g"
FT                   /old_locus_tag="KLTH-ORF1518"
FT   CDS_pept        complement(492106..493374)
FT                   /locus_tag="KLTH0H05544g"
FT                   /old_locus_tag="KLTH-ORF1518"
FT                   /product="KLTH0H05544p"
FT                   /note="similar to uniprot|P38332 Saccharomyces cerevisiae
FT                   YBR246W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30258"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2J7"
FT                   /protein_id="CAR30258.1"
FT                   /translation="MDLPVRDTNQHEKFTIFWNHKRRPQVNAGELNALKVPALSLLSYM
FT                   TAPESEAKAVSHTNKPPCCLRIFRDDFIILGTYDLDKPSGARTGSIDVLDKNLGPLGTY
FT                   DTYGAVLDLKLSPFDDTLMASAHSTGNVELWRIEYESIASDRTLKLLRIANLQVFDADT
FT                   LITSLHFSPRTPENLLVTATNGETRVLDLKHESEVFTSQALSTQYSKLETNLLDVQGRQ
FT                   ASVLNVDSVTLDYQHALECWTAEYGCLAPFENVVFTGGDDSAIAAHDLRTLETVWSNSR
FT                   IHEAGVVAIKCSSSTFRANKPTSILTGSYDDHIRSLELRMMGDSIYPGVNVPVANSSSS
FT                   NLGGGVWRFAESPQNAQDSESNKLLVCCMYDGAKILRVDGDDFIIETYTKKNHESMCYG
FT                   GDWGHKFVATCSFYDKVVQLWDE"
FT   gene            <493448..>496768
FT                   /locus_tag="KLTH0H05566g"
FT                   /old_locus_tag="KLTH-ORF1517"
FT   CDS_pept        493448..496768
FT                   /locus_tag="KLTH0H05566g"
FT                   /old_locus_tag="KLTH-ORF1517"
FT                   /product="KLTH0H05566p"
FT                   /note="highly similar to uniprot|P38144 Saccharomyces
FT                   cerevisiae YBR245C ISW1 Member of the imitation-switch
FT                   (ISWI) class of ATP-dependent chromatin remodeling
FT                   complexes ATPase that forms a complex with Ioc2p and Ioc4p
FT                   to regulate transcription elongation and a complex with
FT                   Ioc3p to repress transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30259"
FT                   /db_xref="GOA:C5E2J8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR015194"
FT                   /db_xref="InterPro:IPR015195"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036306"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2J8"
FT                   /protein_id="CAR30259.1"
FT                   /translation="MDDQEYLEKLKPFQEGLPPSDPESNKKRYLIKGQQKSEFDLEGTI
FT                   KRFQHLLNLSGLFRHFIERKAAKDEKFQKVLNILDNPSGRKGSKGSSHQDKRRRKTETE
FT                   EDQELLKDEEGEEQDQVGYQFRESPPFVNGQLRPYQIQGLNWLVSLHQSNLAGILADEM
FT                   GLGKTLQTISFIGYMRYVEKKRGPFVVIAPKSTLNNWLREINRWTPEVNAFILQGDKEE
FT                   RAKLVSNKLMACDFDIVVASYEIIIKEKSSFKKIDWEYIIIDEAHRIKNEESMLSQVLR
FT                   EFTSRNRLLITGTPLQNNLHELWALLNFLLPDVFSDSQAFDDWFSSESSEEDKGTIVKQ
FT                   LHTVLQPFLLRRLKNEVETSLLPKKELNLYIGMSAMQKRWYKQILEKDLDAVNGANGSK
FT                   ESKTRLLNIMMQLRKCCNHPYLFDGAEPGPPYTTDEHLVYNSAKLKVLDKLLRKFKEEG
FT                   SRVLIFSQMSRLLDILEDYCFFRNYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLT
FT                   TRAGGLGINLTTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKI
FT                   LERATQKLRLDQLVIQQSRNGVANKEAKKGDSKDALLSMIQHGAADVFSSNSGDSSTKG
FT                   TPQPGSTDDVDGDIDLDNLLANSEDKTQSLNQKYEALGLDDLQKFNQDSAYEWNGQDFK
FT                   KRANKDIISTAWINPSKRERKENYNIDGYYKDVLNPGRSTTPAQPKMPRPQPFHSHQLL
FT                   SPQLKVLYEKERMWNTKKNNYVPTLEDVKTTYGEIEDEEEKQAKLNMLLLAVANAQPLT
FT                   EEEEKQKAQLESEGYTNWNKNDFRKFIAACGKYGRNSIKAIAFEFAPHKTEEEVRDYAK
FT                   AFWTNIQRVEDYERYLKNIEAEEDRIRRTKLQQEALRRKIAQCSNPLFDLTLKHPPSNS
FT                   NKRVFSEEEDRFLLLMLFKYGIDRENVYELVRDEIRDSPLFELDFFFQSRTPIELNRRA
FT                   ITLLQCLEKEFNAGVVLDDGMKRRLAEEDENAKNMAEEVKEGAAEAGSEAAPGPGGADV
FT                   AGKAMEPAPANGELNGKRPREEEDTAATAVAAAMTSTEPGPADKPSVNGDAKKPKTEQ"
FT   gene            complement(<496922..>497407)
FT                   /locus_tag="KLTH0H05588g"
FT                   /old_locus_tag="KLTH-ORF1508"
FT   CDS_pept        complement(496922..497407)
FT                   /locus_tag="KLTH0H05588g"
FT                   /old_locus_tag="KLTH-ORF1508"
FT                   /product="KLTH0H05588p"
FT                   /note="highly similar to uniprot|P40581 Saccharomyces
FT                   cerevisiae YIR037W HYR1 Thiol peroxidase that functions as
FT                   a hydroperoxide receptor to sense intracellular
FT                   hydroperoxide levels and transduce a redox signal to the
FT                   Yap1p transcription factor or similar to YBR244W
FT                   uniprot|P38143 Saccharomyces cerevisiae YBR244W GPX2
FT                   Phospholipid hydroperoxide glutathione peroxidase induced
FT                   by glucose starvation that protects cells from phospholipid
FT                   hydroperoxides and nonphospholipid peroxides during
FT                   oxidative stress"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30260"
FT                   /db_xref="GOA:C5E2J9"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2J9"
FT                   /protein_id="CAR30260.1"
FT                   /translation="MSKFYDLAPLDRTGKPFPFKQLEGKVVLIVNVASKCGFTPQYEEL
FT                   QELYKRYHDKGFEIIGFPCNQFGHQESGTDEEIGQFCKLNYGVTFPVMKKVHVNGDNAD
FT                   PVYEYLKNEKAGMLGFKGIKWNFEKFLIDKHGNVYERYSSLTKPANLDAKVQKLLGA"
FT   gene            complement(<498715..>499734)
FT                   /locus_tag="KLTH0H05610g"
FT                   /old_locus_tag="KLTH-ORF1500"
FT   CDS_pept        complement(498715..499734)
FT                   /locus_tag="KLTH0H05610g"
FT                   /old_locus_tag="KLTH-ORF1500"
FT                   /product="KLTH0H05610p"
FT                   /note="highly similar to uniprot|P53011 Saccharomyces
FT                   cerevisiae YGL100W SEH1 Nuclear pore protein homologous to
FT                   Sec13p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30261"
FT                   /db_xref="GOA:C5E2K0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037363"
FT                   /db_xref="InterPro:IPR037597"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2K0"
FT                   /protein_id="CAR30261.1"
FT                   /translation="MKPFITGHEDLVHDVVYDFYGRHVATCSSDQHIKVFRLDRETNEW
FT                   QLSDSWKAHDSSVVGLDWASPEYGRIIASVSYDKLVNLWEEEPDAEECSGRRWTKLCTL
FT                   NDATGPLFSVKFAPGHLGLKLGAIGNDGTLRIYEAMEPSDLRSWTLTSEVKVLPSPPAS
FT                   HLQSDFCLTWCPSRFSPEKLLVCALDQALIYQKDKAGKPYVAAKLEGHTALIRSVSWAP
FT                   SVGRWYQLIATACKDGKVRIFKLTETLGASEDAMSVDQDEDADADAGSADTSADTPPEL
FT                   KVELVSESDDHHGEVWSVSWNLTGTILSSAGDDGKVRLWKASYSNEFKCMSVISAEQK"
FT   gene            <499881..>501227
FT                   /locus_tag="KLTH0H05632g"
FT                   /old_locus_tag="KLTH-ORF1496"
FT   CDS_pept        499881..501227
FT                   /locus_tag="KLTH0H05632g"
FT                   /old_locus_tag="KLTH-ORF1496"
FT                   /product="KLTH0H05632p"
FT                   /note="similar to uniprot|P07286 Saccharomyces cerevisiae
FT                   YBR243C ALG7 UDP-N-acetyl-glucosamine-1-P transferase
FT                   transfers Glc-Nac-P from UDP-GlcNac to Dol-P in the ER in
FT                   the first step of the dolichol pathway of protein
FT                   asparagine-linked glycosylation inhibited by tunicamycin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30262"
FT                   /db_xref="GOA:C5E2K1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR033895"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2K1"
FT                   /protein_id="CAR30262.1"
FT                   /translation="MHQALLLVVAIAAIYVSRYYSPLLAALGFAIIGFLASDALIPRVS
FT                   QSFIKIGCFGKDLSKPGRPVIPESIGAISATVYLFIMFFYIPFLFYKYLVVITPGGGHR
FT                   DASIMQSPVSDEYRFPHGKMSEYLSAVLCLQSTVLLGIADDLFDLRWRHKFFLPAVAAI
FT                   PLLVVYYVDFGVTHVLIPDVIQRWLGTSKTIFNLGALYYVYMASMAIFCPNSINILAGV
FT                   NGLEVGQSIVLGVIFLINDSLYLLLGNEASKEAHLFSAILIIPFLGVAFSLWKWNKWPA
FT                   KVFVGDTFCYFAGMIFSVVGILGHFSKTTLIFFIPQTFNFAYSCPQLFGLVPCPRHRMP
FT                   RFNEADGLLYPSRANLVEKPPKKVFVPVLKLLSSLKLIDLEVDPQTGALKSCSNMTLIN
FT                   LVLVWFGPTREDKLCNRILAIQFTVGLCAIVARHSIGSIIFGHDNIQFL"
FT   gene            complement(<501335..>502036)
FT                   /locus_tag="KLTH0H05654g"
FT                   /old_locus_tag="KLTH-ORF1494"
FT   CDS_pept        complement(501335..502036)
FT                   /locus_tag="KLTH0H05654g"
FT                   /old_locus_tag="KLTH-ORF1494"
FT                   /product="KLTH0H05654p"
FT                   /note="similar to uniprot|P38331 Saccharomyces cerevisiae
FT                   YBR242W Hypothetical ORF or YGL101W uniprot|P53144
FT                   Saccharomyces cerevisiae YGL101W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30263"
FT                   /db_xref="GOA:C5E2K2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2K2"
FT                   /protein_id="CAR30263.1"
FT                   /translation="MNKFIGSTVFNRLLTRNTRMTAPVWKPQDHVPQEVKDLLQSSGDN
FT                   HVLAFLHIVQLLKVQRRTGWLDHNISPCESIADHMYRMGITAMLIRDPKINRDKCVRIA
FT                   LVHDIAEALVGDITPLDPVGKEEKHRREWETIQYLCEDLVKPYNAQAAQEIMDDWLAYE
FT                   NIASPEARYVKDIDKFEMLVQCFEYEKLHNGKRDLDQFWGAMSSIKTEEVKGWAQDLLQ
FT                   KREQFYNSLKK"
FT   gene            complement(<502254..>502989)
FT                   /locus_tag="KLTH0H05676g"
FT                   /old_locus_tag="Klth0H.mRNA.5400.m"
FT   CDS_pept        complement(join(502254..502654,502941..502989))
FT                   /locus_tag="KLTH0H05676g"
FT                   /old_locus_tag="Klth0H.mRNA.5400.m"
FT                   /product="KLTH0H05676p"
FT                   /note="highly similar to uniprot|P02406 Saccharomyces
FT                   cerevisiae YGL103W RPL28 Ribosomal protein L29 of the large
FT                   (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30264"
FT                   /db_xref="GOA:C5E2K3"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2K3"
FT                   /protein_id="CAR30264.1"
FT                   /translation="MPTRFTKTRKHRGHVSAGHGRIGKHRKHPGGRGMAGGQHHHRTNL
FT                   DKYHPGYFGKVGMRYFHRQQNRFWKPVLNLDKLWTLVPAEKRDEYMSSASKSAAPVIDT
FT                   LAAGYGKILGKGRIPDVPVIVKARFVSKLAEEKIRAAGGVVELIA"
FT   gene            <503691..>505202
FT                   /locus_tag="KLTH0H05698g"
FT                   /old_locus_tag="KLTH-ORF1490"
FT   CDS_pept        503691..505202
FT                   /locus_tag="KLTH0H05698g"
FT                   /old_locus_tag="KLTH-ORF1490"
FT                   /product="KLTH0H05698p"
FT                   /note="similar to uniprot|P53142 Saccharomyces cerevisiae
FT                   YGL104C VPS73 Mitochondrial protein involved in vacuolar
FT                   protein sorting"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30265"
FT                   /db_xref="GOA:C5E2K4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2K4"
FT                   /protein_id="CAR30265.1"
FT                   /translation="MSENQALLGPKPKVTSSLVFATIVVCFGSIQYGYHMAELNAPGQV
FT                   LSCTEFIEPWPEAGPYADTWFGKHGFQQCLPLTEEQMGFATSIFSIGGLVGSLYAGRVA
FT                   DRYGRKKYSFTNCVIGIIGSLLLFRANSYAQLIAGRFIAGISCGSCIVVTPLFINEISP
FT                   KELRGSLGSMNQVCINVGILLTQLLALKYADSYRWRWLMLAGAILALIQFLLLFKIDES
FT                   PLWLASRGDLDGAEHVLRGLRGGDRRRSRGEVDEWLQSRGSSRPATGSADYTQMNSHAS
FT                   QQSASPESVTSSSSQQDVSVKNYFTDPRYSKSRWAITVILVSQQFCGIGSIIFYGVKLV
FT                   SGQLPQYAVLVNFGISILNVVVTLGASSLVDHWGRKPLLTASAGAISISSIFLSTGIVT
FT                   NNAAMLVASTFMYIAVFAIGLGPIPFLVISELSPPEASGIAQSYGTTCNWIGTFIVGYG
FT                   FPILNEWLHGYSFLVFAAYAAAFTLYIHLKVPETKGKQDYDLVWN"
FT   gene            <505672..>507006
FT                   /locus_tag="KLTH0H05720g"
FT                   /old_locus_tag="KLTH-ORF1487"
FT   CDS_pept        505672..507006
FT                   /locus_tag="KLTH0H05720g"
FT                   /old_locus_tag="KLTH-ORF1487"
FT                   /product="KLTH0H05720p"
FT                   /note="similar to uniprot|P38141 Saccharomyces cerevisiae
FT                   YBR240C THI2 Zinc finger protein of the Zn(II)2Cys6 type
FT                   probable transcriptional activator of thiamine biosynthetic
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30266"
FT                   /db_xref="GOA:C5E2K5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2K5"
FT                   /protein_id="CAR30266.1"
FT                   /translation="MSNCNKTKARSFTGCWACRFKKRRCDENKPFCSLCLRHGDQCSYD
FT                   IRLVWQNENIFSVNENKELVSWKKLRNLCKQPNRNRISRRRFQQMTQFRQISPPNSDDE
FT                   DSDKKDAAHDDGESDEDRDEENDSSKKNTFTISVRRLKIYDNALDCVHGQTDKNFDQRF
FT                   VDQQLGQLLTKLESSSQVAGDDRSGPFCVFKVDSFKKRNDSEKPVISRTSHETHNELSS
FT                   LPNTPISETNSFLAMRLSTAEATSKFLSHHWPNLLLANDTNFCLQQPAYVKWLTTHIGS
FT                   MGHLLHPDFLEELMNGSVDSSKWLSMIPHFSMECQALYLVLLVMAEREKDMVDFVSRWV
FT                   LSQTQVSYLSFPLIAHSLKSCNKIAFLFHCHELLADATLQDLFQYELTSMLKINTVRLI
FT                   LQYWSNLMMDQICQCQDTTNSEMQLKFWEMQLQCNEEFYRDICLV"
FT   gene            complement(<507109..>508227)
FT                   /locus_tag="KLTH0H05742g"
FT                   /old_locus_tag="KLTH-ORF1485"
FT   CDS_pept        complement(507109..508227)
FT                   /locus_tag="KLTH0H05742g"
FT                   /old_locus_tag="KLTH-ORF1485"
FT                   /product="KLTH0H05742p"
FT                   /note="similar to uniprot|P46672 Saccharomyces cerevisiae
FT                   YGL105W ARC1 Protein that binds tRNA and methionyl- and
FT                   glutamyl-tRNA synthetases (Mes1p and Gus1p) delivering tRNA
FT                   to them stimulating catalysis and ensuring their
FT                   localization to the cytoplasm also binds quadruplex nucleic
FT                   acids"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05742g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30267"
FT                   /db_xref="GOA:C5E2K6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2K6"
FT                   /protein_id="CAR30267.1"
FT                   /translation="MSVLIEKFKSLSLSTELNKEQLAQAAQWESVVKSGQIQGHIDELN
FT                   LRLRDHSFILGTLVPTETDTVVFESVFPLIKDLIASSKDVKGHYAKFRHILRWIAYLQE
FT                   LLEIPNNEQLEINFDLELPREVIEKKKKEDAKKPAEAAEGKKKEASAPKEGADKGKQPR
FT                   GKPDEETLKKLREEAKAKKAAKKAANAQAQPQDQQPQKPKPSAIDFRVGFIQKAVKHPD
FT                   ADSLYVSTIDVGDEEGPRTVCSGLVKYFPLEAMQERYVVAVCNLKPVNMRGVKSTAMVL
FT                   CGSDENNVEFVQPPEGSKAGDKVFFEGFGDEEPAKQLNPKKKIWEQLQPHFSTNENLEV
FT                   YFNDEDEKKARKLTNAKGESFKVASIANANVR"
FT   gene            <508783..>510153
FT                   /locus_tag="KLTH0H05764g"
FT                   /old_locus_tag="KLTH-ORF1482"
FT   CDS_pept        508783..510153
FT                   /locus_tag="KLTH0H05764g"
FT                   /old_locus_tag="KLTH-ORF1482"
FT                   /product="KLTH0H05764p"
FT                   /note="similar to uniprot|P38140 Saccharomyces cerevisiae
FT                   YBR239C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30268"
FT                   /db_xref="GOA:C5E2K7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E2K7"
FT                   /protein_id="CAR30268.1"
FT                   /translation="MSSRRQKTSVACINCSKSHVTCQAERPCSRCVKKGLEATCVDAPR
FT                   KRRKYLADVPDEQLPVAVKRGNIHEEQQLSNENRYIAHKPRFMSNAADLEYSILSDIIQ
FT                   QDTLLSKIPMDLLYSRDGAKDEESQYNTPNSASSVPSLGAQGRPPSARRTGSPVDSQRV
FT                   KYATLLGPRGRQALKTEVDLFTTHFPLLPQEVNNSRFRRRIHFDANVRQYYLNDKTTFP
FT                   EILDQIEPKPKSISLALDISSPDARAVQNFPDVPHSLRYATPMEIYTLISKPFSHTSGF
FT                   HSLLQYLRSRFNREDIVEMCRSLAEFRPTFIAIAVTLTEEDMIFMEQCYQRTLLEYDQF
FT                   ISQMGTPTCVWRRNGQVSYVNDEFSLLTGWTRADLLFKMTFIVELMDDESVREYFKTFN
FT                   RVAYRDFKGSERMKTCKLLTPFRGREVECCCIWTLKRDVFGLPLMIIGNFMPIIGQS"
FT   gene            complement(<510256..>510687)
FT                   /locus_tag="KLTH0H05786g"
FT                   /old_locus_tag="KLTH-ORF1480"
FT   CDS_pept        complement(510256..510687)
FT                   /locus_tag="KLTH0H05786g"
FT                   /old_locus_tag="KLTH-ORF1480"
FT                   /product="KLTH0H05786p"
FT                   /note="similar to uniprot|P53141 Saccharomyces cerevisiae
FT                   YGL106W MLC1 Essential light chain for myosin Myo2p may
FT                   stabilize Myo2p by binding to the neck region may interact
FT                   with Myo1p Iqg1p and Myo2p to coordinate formation and
FT                   contraction of the actomyosin ring with targeted membrane
FT                   deposition"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30269"
FT                   /db_xref="GOA:C5E2K8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2K8"
FT                   /protein_id="CAR30269.1"
FT                   /translation="MSEKTQKDIFTLFDRQAKGTISKQQLGDYLRAIGFNPTNALVEEV
FT                   GADAADALTLEETTALVTQHRDALEKTTQGKVDDFIKAFQVFDKENKGKVSVGDIRYML
FT                   TGLGERLSDAEVDELLKGVEVDSDGGVDYRKFIEDILRQ"
FT   gene            <511833..>513776
FT                   /locus_tag="KLTH0H05808g"
FT                   /old_locus_tag="KLTH-ORF1477"
FT   CDS_pept        511833..513776
FT                   /locus_tag="KLTH0H05808g"
FT                   /old_locus_tag="KLTH-ORF1477"
FT                   /product="KLTH0H05808p"
FT                   /note="similar to uniprot|P38330 Saccharomyces cerevisiae
FT                   YBR238C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30270"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2K9"
FT                   /protein_id="CAR30270.1"
FT                   /translation="MLRFVQQSHVLKSRVSNQFVSASARSPFHHSLRFNSAVAMDRTPS
FT                   QEAAAVAPAPPNVAKAVDKVRAMRKNIKINKQLSATPDSPWFHKVCAFEDCVAQTLYMS
FT                   QTPRRRNNNNNNNGRRGQQQPLAASNTNPLFWDSIGRAMGLYRELLGTPELNSDRVSKL
FT                   VHLLHNGLRANRNQLTRMNKKPDYDSQSFHKEMTNYLCESLREISQDVLSAKVELNEYG
FT                   AMHLITAFKELLLFEEAVSIWRSAINGNSNYTANIFLNPRVVGVVLPILYDNGVTYAEI
FT                   QELYEKSSAMINYFHPNLSVGMIRASLSAGENEMALTLFQKLCEESSEMKYGYLIETHL
FT                   SFIGECKDLNISQAFFDKALNNEMPYKIDLQVSYVKSFLKNIWSQTHDFQKVYDIWYKS
FT                   SVHYGRDVNHGISSSLNDTFFDIFFEHYSQDKIIGLQQLQEMISIYNNIKPIDEPFFNI
FT                   ILTKCTVWRDRQIIESIDKAYDLYQIPRTIVAYRILLKSMGSVHVTNEEIFQRWCNLVK
FT                   KSDEIGQSFIANADWAALRDATVTWTQLYSQPDDLYSDGFNAAMQAANASGAFDDIPQQ
FT                   TQQQQPNDRLELYMKIVKRYSPFCRDSRQLSRLTSGTAVKYPVLQQALSKFNDLDVSDV
FT                   YIPQFHNLVAQN"
FT   gene            <513953..>514327
FT                   /locus_tag="KLTH0H05830g"
FT                   /old_locus_tag="KLTH-ORF1471"
FT   CDS_pept        513953..514327
FT                   /locus_tag="KLTH0H05830g"
FT                   /old_locus_tag="KLTH-ORF1471"
FT                   /product="KLTH0H05830p"
FT                   /note="similar to uniprot|P53139 Saccharomyces cerevisiae
FT                   YGL108C Protein of unknown function green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cell
FT                   periphery"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30271"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2L0"
FT                   /protein_id="CAR30271.1"
FT                   /translation="MGLCASKEDRSQGKGAHTSVQRSKPKQSARGSAQGDSKPQTSRLH
FT                   KKSGSGKALSDSGETDKDVSAKRAAGQAAAERFEKSQKQLDKGELGKKLAEERAKTLQT
FT                   HLRETAEIRQLEKDQRLVYD"
FT   gene            complement(<514352..>516787)
FT                   /locus_tag="KLTH0H05852g"
FT                   /old_locus_tag="KLTH-ORF1470"
FT   CDS_pept        complement(514352..516787)
FT                   /locus_tag="KLTH0H05852g"
FT                   /old_locus_tag="KLTH-ORF1470"
FT                   /product="KLTH0H05852p"
FT                   /note="similar to uniprot|P21372 Saccharomyces cerevisiae
FT                   YBR237W PRP5 RNA helicase in the DEAD-box family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30272"
FT                   /db_xref="GOA:C5E2L1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2L1"
FT                   /protein_id="CAR30272.1"
FT                   /translation="MSTVSAEEKKRLLLERRNKWKQKKAEFDALKVRQETNKESRVESS
FT                   GTLSKIENGTQKALNRNEESSKPVGKRSSKVKKRAFEESDEEEEPAKVELFRPDEHPDV
FT                   NSPLNLDAGTTVVDEDPLDLFMQRLNTDNNDKDRGILDADVLDDALSEEEAVHEIDGVE
FT                   AEFMRLKKLKSKKRVKRLNTQTQKLEPFVKDFYIEPEEIKNMSETEIDELRLGLDNVKI
FT                   KGQGCPRPIVKWSQLGLTTDIMDLITKEFAFVSPTPIQAQAIPAIMAGRDVIGISKTGS
FT                   GKTVSFLLPLLRQIKALRPLTSGETGPMGLILAPTRELAVQIHEETEKFLNPVSKLRSI
FT                   CCTGGSELKQQIKELKKGVEIVVATPGRFIDLLTLNSGKLLNTERVTFVVMDEADRLFD
FT                   LGFEPQITEIMKTIRPDKQCVLFSATFPTKLKSFASRILDRPISITINSKSLINENIEQ
FT                   QLRIYDNDESKFEGLLDILRKQTQMSSDDERDEKIIVFLSSQQICDLIYYRLQEQNYTT
FT                   YAIHAGKPYNERASSLEKFKNTKNGILLCTEVLSRGLNVPEVSLVIIYNAVKTFAQYVH
FT                   TTGRTARGDKHGTAVTLLLSDELAASYILNKSLRDTEIELLDEGTIEKLKAMANKFDSG
FT                   MKTGKYRLTKGFGGKGLEHMEKLNDEKHNQELKQYNVPEQSKGSEKEDDNHPEADQVIV
FT                   PKLEYVFLQNKNPNGRITYSAEVNVNDLPQLVRWEATKNTTLSFIKHETACSITNRGRF
FT                   YPEGSGPKSASDEPKLYLLIEAHEEKDVRLAIELLEDKVKEGVKKVSINEAKSSKFSL"
FT   gene            <516956..>518197
FT                   /locus_tag="KLTH0H05874g"
FT                   /old_locus_tag="KLTH-ORF1465"
FT   CDS_pept        516956..518197
FT                   /locus_tag="KLTH0H05874g"
FT                   /old_locus_tag="KLTH-ORF1465"
FT                   /product="KLTH0H05874p"
FT                   /note="highly similar to uniprot|P32783 Saccharomyces
FT                   cerevisiae YBR236C ABD1 Methyltransferase catalyzes the
FT                   transfer of a methyl group from S-adenosylmethionine to the
FT                   GpppN terminus of capped mRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30273"
FT                   /db_xref="GOA:C5E2L2"
FT                   /db_xref="InterPro:IPR004971"
FT                   /db_xref="InterPro:IPR016899"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039753"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2L2"
FT                   /protein_id="CAR30273.1"
FT                   /translation="MNVRPEKPVWMSQEQYDKQYGSPNETIVKKPTPKPAEEEQSKVEE
FT                   VEQEGDDDKKELEKPVFKIQKRKHQRYDSEERRKKHQLHKMREEQIKRHEIDMTANKVV
FT                   NVDQIIRKHYNERTFVAKRRRRHLSPIIKLRNFNNAIKYMLIDKFTFPGNVVLEMGCGK
FT                   GGDLRKYGAAGISQFIGIDISNASIVEAQKRFSSMGNLDYQVILITGDCFGESLGVAVE
FT                   PFPECRFPCDVVSAQFCLHYAFESEEKARRTLLNVTKSLKIGGYFIGTIPDSEFIRYKL
FT                   NKITKDVDKPSWGNAIYKVTFENSDYQKNNNEFTSPFGQMYTYWLEDAIDNVPEYVIPF
FT                   ETLRSLADEYGLELELQMPFNAFFVQEIPKWINKFSPKMQEGLQRSDGKYGVEGDEKEA
FT                   ASYFYTVFAFKKVK"
FT   gene            complement(<518252..>521623)
FT                   /locus_tag="KLTH0H05896g"
FT                   /old_locus_tag="KLTH-ORF1464"
FT   CDS_pept        complement(518252..521623)
FT                   /locus_tag="KLTH0H05896g"
FT                   /old_locus_tag="KLTH-ORF1464"
FT                   /product="KLTH0H05896p"
FT                   /note="similar to uniprot|P38329 Saccharomyces cerevisiae
FT                   YBR235W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05896g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30274"
FT                   /db_xref="GOA:C5E2L3"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR018491"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2L3"
FT                   /protein_id="CAR30274.1"
FT                   /translation="MSKFFEIPGSHKPTKKGEEQALSRPQNESLSYFNYGSTKRVPKTS
FT                   SKLDPDNPNKSKLGTFDGVFVPTTLNVLSILMFLRFGFIIGQMGVLGTLFLLLLSYGIN
FT                   LLTTLSISAISTNGTVRGGGAYYMISRCLGPEFGGSIGLIFFLGQMLNSGMNVVGIIEP
FT                   IMYNFGTSIDSETPALYPLLRRGYWWEFGYASFILLICLIISMVGSAMVSRAGKVLFWL
FT                   LLFSTFSIPLSALLVAPFNDGEVNYTGLSSETLKMNLYPQFTKHAAGSLLKGKETFNDL
FT                   FGIFFPATAGIFAGAGMSSELRKPSKSIPKGTLWGLALTFACYLLVIVTIGSCVPRDSL
FT                   HKDVQIIQTVSASQIVILVGELSTSIFSIIVGIVGAAYVLEAIAKDSIFPGISIFEKKP
FT                   LYSVLFSWFLTQLCLFSDVNKIATIITMAFLMTFLVMNLACFLLEISSAPNFRPSFNYF
FT                   DRYTAFIGGSLSLIAMFIVDMISAAVVILTISTIFVVIHFFSPPKPWGDVSQNIIYHQV
FT                   RKYLLRLRQDNVKYWRPQILLLVDNPRTSWNLIKFCNHLKKGGLYVLGHVTVSKTFQGE
FT                   YEEMRRQTKAWVKIRDMANIKAFVQVGTGPTLPWGVRNVFLGSGLGGMKPNITVIGFFD
FT                   LKNYHETRNKASDALERGKYSKNFQGLRAARRDDGSVAVEIPDNVGLLPTDDCKNERKI
FT                   KVQQWVQIIEDLSLMHSNIAVARGFLDLSLPSKGDHSKKKRFIDLYPIQMSAKVILEEN
FT                   SSEGILATNFDTYTLILQLGAILVTVPSWKKTHQLRVVVFVESESERHDENKRITNLLG
FT                   ILRIEAEVVVLSLDQFRVYNTIIKGDPIQVQEVSDVLKDDPWWAELVDARTTHKTRRRF
FT                   SAGAHPMAEIPKNARRTTPKYNVSQLQRLGVSMTMTSNFLKANLSITDLSDDEDTYMDQ
FT                   DSEVLGDSSSKINSDREDNNQRPATNSSRDNLRPKTSRVSDERSVRSLMPVFSSDAIPK
FT                   TKVIEDASGDEPSLVPVVEGAELHPPAFDKRTTKNRVQTPLSPCQSSESLLADLRGLTF
FT                   NDVPSRAQHLILNDVMSQVSKDSDLIFSTLPIPPLNTHKSEEGSLEYVENLHVWLAGLP
FT                   PTMLINSKSTTVTTAL"
FT   gene            <521968..>523767
FT                   /locus_tag="KLTH0H05918g"
FT                   /old_locus_tag="KLTH-ORF1461"
FT   CDS_pept        521968..523767
FT                   /locus_tag="KLTH0H05918g"
FT                   /old_locus_tag="KLTH-ORF1461"
FT                   /product="KLTH0H05918p"
FT                   /note="similar to uniprot|P53137 Saccharomyces cerevisiae
FT                   YGL110C CUE3 Protein of unknown function has a CUE domain
FT                   that binds ubiquitin which may facilitate intramolecular
FT                   monoubiquitination"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30275"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR041808"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2L4"
FT                   /protein_id="CAR30275.1"
FT                   /translation="MNLNRYQRVIEINGGDKISLPIVKFPPFKLRAAMVEKDPVIWLHL
FT                   LETYNQYFTYLMSEGHLEQLEDSTYENLCMFIKSYLKELSNEEGKLLSLGMNTNVCEQL
FT                   QVLRSWVLTVIKTCGLLHLQISCDVLWDFVRLYVKENPGTVRLLIDGSLKPAINTQKAQ
FT                   INRIYQLHQHLKQLIETSKFTRVDLKALENLLSAGDIHTKPFTNQFLTTKWAEILESWF
FT                   SSDLKPLRDIAKKIGILSYLTASEDRIVELISESNVFDLESLHFHPLMGSLLINEQFQA
FT                   HFSGLKAKLPFLRALLTKNNNKAPTISVEDVQTIIEVFPHLTVGQVERRLQAHDGDVER
FT                   TINSFFESPTETDKAPLIDEVTRNKQEEMKNTNFESELGKADRFSKPDEVTTRDHVPDE
FT                   VRNKTLTRALALLYQADEDEKDDTYDDAEVQRDALGNLDSDDRQSANGNNYDKIEGHLW
FT                   ELLKENKELFDRSNRNSKARKELKTSTSWSDEQIEGWARMLERSPKRAQILEERYMFRG
FT                   NVRTGKRAFVQNKNESAAAQNKTERNNSVREAKGNSVAPKSTQQNGASDKKKQNARKEK
FT                   HKSARANHNRKSGHDKKISRVSP"
FT   gene            complement(<523846..>525180)
FT                   /locus_tag="KLTH0H05940g"
FT                   /old_locus_tag="KLTH-ORF1459"
FT   CDS_pept        complement(523846..525180)
FT                   /locus_tag="KLTH0H05940g"
FT                   /old_locus_tag="KLTH-ORF1459"
FT                   /product="KLTH0H05940p"
FT                   /note="similar to uniprot|P53136 Saccharomyces cerevisiae
FT                   YGL111W NSA1 Constituent of 66S pre-ribosomal particles
FT                   involved in 60S ribosomal subunit biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05940g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30276"
FT                   /db_xref="GOA:C5E2L5"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037379"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2L5"
FT                   /protein_id="CAR30276.1"
FT                   /translation="MRLLIACDDSGSIKELICNKNTNTSVQTAPQPFHLGAHLPEGFGS
FT                   RVEIMKMIGPQHLLVARANGSIQLIELKRVDRDVSVKDPAKEPIFQVSEMHAASTISGL
FT                   FDEARLLSIHKSSKKRSRPRDGFVALELVPQTSDRVFSATKSGLVHVLSIENGELKLIS
FT                   SNSVKAPLEFAQVYDLVAAQKTRQKKRASAKLTFAYGGEENLVKIAQFTSSYKTIEQIW
FT                   EAKNVSNDRLDLKVPVWPMKLKFLEPASAAVDEGKVNYQFVTINRLGLFREYRTLTGRK
FT                   PMLSKALLPKNEFATQLQVINSDVTPAGNIRSNSFENLQFVTSDLKKNVFSFNAASGSL
FT                   GKYGNGDITGHASFLNIEKKYLLQGGLDRYVRVFDAESRAVICKCYTGSKISSVVLVDE
FT                   EEIDVPQLNENKKRRPKHKDDKAEAEDDEKLWSTLESSAKKLKKS"
FT   gene            <525898..>527019
FT                   /locus_tag="KLTH0H05962g"
FT                   /old_locus_tag="KLTH-ORF1457"
FT   CDS_pept        525898..527019
FT                   /locus_tag="KLTH0H05962g"
FT                   /old_locus_tag="KLTH-ORF1457"
FT                   /product="KLTH0H05962p"
FT                   /note="highly similar to uniprot|P38328 Saccharomyces
FT                   cerevisiae YBR234C ARC40 Essential subunit of the ARP2/3
FT                   complex which is required for the motility and integrity of
FT                   cortical actin patches"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30277"
FT                   /db_xref="GOA:C5E2L6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017383"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2L6"
FT                   /protein_id="CAR30277.1"
FT                   /translation="MSNSIVANLKLAKAPIYSHCFSQDRSLVAVTLNSDCLVFKLTPGG
FT                   KPALVATLPDHDKTVTAVDISIHGRIVTCSQDRNAIVWEPLSDGTYKPTLVLLRINRAA
FT                   TCVQWAPSGYKFAVGSSARIIAVCYYEQENDWWVSKHIKKPIKSTINCVSWHDNGIMLA
FT                   CGGTDGYVRAFSGFVKGLDSRDQVANSPWAEKFPFGALIREWYHGAWIHDVQWRSSQEK
FT                   LAYVAHDGSFNVVDPSDHVSTTFSPEGLPLMALVWINDHEALCGGFSCHPVLFGEGASG
FT                   WQFSKNIDKDIAPSTPASASTGDDDDEGNAPFGMSALKKFKELDLKGKVSAQVQESTHE
FT                   NAIVELAPYSVTAGNVTEVSSCGLDGKIVIYRV"
FT   gene            complement(<527082..>527327)
FT                   /locus_tag="KLTH0H05984g"
FT                   /old_locus_tag="KLTH-ORF1454"
FT   CDS_pept        complement(527082..527327)
FT                   /locus_tag="KLTH0H05984g"
FT                   /old_locus_tag="KLTH-ORF1454"
FT                   /product="KLTH0H05984p"
FT                   /note="similar to uniprot|P69850 Saccharomyces cerevisiae
FT                   YBR233W-A DAD3 Essential protein component of the DASH
FT                   complex involved in spindle integrity and kinetochore
FT                   function interacts with Duo1p and Dam1p localizes to
FT                   intranuclear spindles and kinetochore"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30278"
FT                   /db_xref="GOA:C5E2L7"
FT                   /db_xref="InterPro:IPR013965"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2L7"
FT                   /protein_id="CAR30278.1"
FT                   /translation="MDELTPLQRSILSKYETLADSLHNLDETIKDLSRRDVPESPEEVL
FT                   RQLREIEIKIALVGTLLKGSVYSLVLQRRGLKQGEA"
FT   gene            <527432..>528967
FT                   /locus_tag="KLTH0H06006g"
FT                   /old_locus_tag="KLTH-ORF1453"
FT   CDS_pept        527432..528967
FT                   /locus_tag="KLTH0H06006g"
FT                   /old_locus_tag="KLTH-ORF1453"
FT                   /product="KLTH0H06006p"
FT                   /note="highly similar to uniprot|P53040 Saccharomyces
FT                   cerevisiae YGL112C TAF6 Subunit (60 kDa) of TFIID and SAGA
FT                   complexes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30279"
FT                   /db_xref="GOA:C5E2L8"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR011442"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR037796"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2L8"
FT                   /protein_id="CAR30279.1"
FT                   /translation="MASQQQSYTIWSPQDTVKDVADSLGITNISDDVLRSLAMDVEYRI
FT                   LEIVEQAVKFKRHAKREVLTTEDIARALRVLNVEPLYGYQDGSARAKDASFSKVNAPGG
FT                   QTLYYLNDEEVDFDKLINEPLPKVPRLPTFTTHWLAIEGVQPTIPQNPSLNDIRMSQPP
FT                   IVRGAIVTTINDTSFQTSASDEKETQHISLIKPGQANEVKPLVKHVLSKELQIYFDKVV
FT                   GALISKDRDDKAHHLRAAALTSLRSDTGLHQLVPYFIQFIAEQITHNLSDLDLLTTMLE
FT                   MIYSLLSNTHVFLDPYIHSLMPSILTLLLAKKLGDNPPPNSSKEQREASEKVSKDTGTE
FT                   FLEKTNALRDFAASLLDHVLRKFPQVYKSLKPRVMRTLLKTFLDTNRSFGTYYGCIKGV
FT                   AVLGPESVRFFLGNLQSWANLVFEEHTTKENDKDEGGHTGRFTEQETKLLCDVIIESLV
FT                   VLKSDLPPGQKYDEEITQSQKENLVKRCGSTIADRLLERSDASELVAAIFFGE"
FT   gene            complement(<529035..>531251)
FT                   /locus_tag="KLTH0H06028g"
FT                   /old_locus_tag="KLTH-ORF1451"
FT   CDS_pept        complement(529035..531251)
FT                   /locus_tag="KLTH0H06028g"
FT                   /old_locus_tag="KLTH-ORF1451"
FT                   /product="KLTH0H06028p"
FT                   /note="weakly similar to uniprot|P53135 Saccharomyces
FT                   cerevisiae YGL113W SLD3 Protein that interacts with Cdc45p
FT                   in initiation of DNA replication gene exhibits synthetic
FT                   lethality with dpb11-1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30280"
FT                   /db_xref="GOA:C5E2L9"
FT                   /db_xref="InterPro:IPR013948"
FT                   /db_xref="InterPro:IPR041393"
FT                   /db_xref="InterPro:IPR042511"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2L9"
FT                   /protein_id="CAR30280.1"
FT                   /translation="MSVNGADEEYVGGRDSTKNQKPNELTFQGNEKQSIKYIGACSEVP
FT                   ISWLDHSQEPVLLVETDLRKEFLYILEQSSDHEKHVFELCESGYTKTFVFERYFNKSWV
FT                   RWHLGTIDPSSLKLKQSDNCSQSKRPPPKSRMANTKKWVETNLLNLLELWKEERVLVPG
FT                   SEEVKTTAFLEMKPPLPVSGEGKLTGSVQHKHPTIDPGTYLRRKYYEALFTFRIPLAYF
FT                   AKSNLVRARNMSNTSTNEVISYQMHLADLLLEIHDFDQRHDNGGKGILTYELSPDDISD
FT                   IRDSSLGRFEDLKKRYSSQCLGDLRLLIKVREIKLQMMLLLELIAINQMDIKLKDFEEK
FT                   YKTKLKKRAKRVARKNMSSRTALKRGKAEFANPSLDFCEKLDIYADKLCIIDTMLLSSV
FT                   PPQKDSQVESSSSASLVTKISEYKKNLTNSGKESSTIGFMTYVLIPYFTRKTPHAVKFI
FT                   SRKFKGLRLNNSTRPEKPNTLGLVSSLNDPSNERATVEIPSSPPSEDSSKTASVCTNIT
FT                   SPPMQQPPKAFKRVSFPNRPLPSNIRSKSQLSEFLELESGLSKKLTSATRANSDLLLDK
FT                   LQKRQMPATEFSLHNTNSLTRESSFMQKQVQSTRNSSSVMFQRVGKRLKEQKRASLETA
FT                   NYLNVQVEATPHGKKSDSNALPKFDSAIIESPLATTEKPSHPSGVPVKAGAPLRTPSRQ
FT                   FGSPTGDVQVPASGAKELANTTDVIASPQIVKTRRVRRRLFAPD"
FT   gene            complement(<531454..>532632)
FT                   /locus_tag="KLTH0H06050g"
FT                   /old_locus_tag="KLTH-ORF1448"
FT   CDS_pept        complement(531454..532632)
FT                   /locus_tag="KLTH0H06050g"
FT                   /old_locus_tag="KLTH-ORF1448"
FT                   /product="KLTH0H06050p"
FT                   /note="similar to uniprot|P38151 Saccharomyces cerevisiae
FT                   YBR233W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30281"
FT                   /db_xref="GOA:C5E2M0"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2M0"
FT                   /protein_id="CAR30281.1"
FT                   /translation="MGTSEKNEELPNSPNVLKRKKEDCQEELLEAEIKRVALDDTEETN
FT                   DPGNEINKDYIHLRMLCLVKQASMIVGPGGEKISRMKEETNTRINVSDNIRGVPERVIF
FT                   IRGRCEDVAKVFGMVVRAINGETDGESSEQSATLTLNILIPHHMMGCVIGRQGSRLREI
FT                   EELSAAKLMAGPQTLPMSNDRILCVSGVADAIHIATYYVGQTILNHKATFASKKCIFYL
FT                   PSLLHSVLVNSYGVSLQHQQQHQYRPGENGKKRLHRYSASPDFGYAYPGVPSAPHMAVH
FT                   NVRVADTLAAATIPPALAPQLSLIQQEVYIDDNYVGNVIGKGGKHINSIKETTGCSIQI
FT                   DDHVEGCSERKILIRGTPIGSQTAILLINNKIEMDRRNKQSIGDKLENPLSS"
FT   gene            <533185..>534087
FT                   /locus_tag="KLTH0H06072g"
FT   CDS_pept        533185..534087
FT                   /locus_tag="KLTH0H06072g"
FT                   /product="KLTH0H06072p"
FT                   /note="similar to uniprot|P38326 Saccharomyces cerevisiae
FT                   YBR231C SWC5 Protein of unknown function, component of the
FT                   Swr1p complex that incorporates Htz1p into chromatin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06072g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30282"
FT                   /db_xref="InterPro:IPR011421"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2M1"
FT                   /protein_id="CAR30282.1"
FT                   /translation="MPNYLSQKLLRSTAMSKDNEEVQDTKGVLFNDEEDYNEEEDLDFD
FT                   PSKEEGAQPNESDNDADGDTGDDDKNYEETNPDYSNIESGQGGLVRTRRARELEDELAR
FT                   RQKYEHIKQEGISQEAKSVWDELQQESTKRLHKSTSIMSQTKDSLGEGLTEELILIDRK
FT                   YEFAGEVMHEKKWVPKSSAEAQEFLQSTKFTKNPDPSTKTKSAVNDQGLKLRRPLKRPA
FT                   ILEQIIAGALKPKLTTLEKSKLDWATYVDKENLNEELILHNKDGYLAKQDFLNRVETFK
FT                   DDKYREMRKIQLQQRISDT"
FT   gene            complement(<534093..>536276)
FT                   /locus_tag="KLTH0H06094g"
FT                   /old_locus_tag="KLTH-ORF1443"
FT   CDS_pept        complement(534093..536276)
FT                   /locus_tag="KLTH0H06094g"
FT                   /old_locus_tag="KLTH-ORF1443"
FT                   /product="KLTH0H06094p"
FT                   /note="similar to uniprot|P53134 Saccharomyces cerevisiae
FT                   YGL114W Putative member of the oligopeptide transporter
FT                   (OPT) family of membrane transporters"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06094g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30283"
FT                   /db_xref="GOA:C5E2M2"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2M2"
FT                   /protein_id="CAR30283.1"
FT                   /translation="MSEVPFEHKALTRQVSLRATIAGLAIGSLVLISNFQFGLQTGWVS
FT                   MMSLPSALLACAIFKQVVPLFYPNAAVFTDVENVYVQSLAVAVGTGPLAYGFVGVIPAI
FT                   ENFLTAEESGYTRELGQRFSFQQLLLWSLALAFFGIFFAVPLRKQVIVREKLPFPSGSA
FT                   TATLIAVLNGSEILQEISPKELEEMRARRLREYSDVLANDEQTPLVEERVGNSAVEESE
FT                   ESNGGSSRTCLDFGCPAYEATPEPAPTAHCGSYERNISILSKTFLVSSSYTILSYFLPF
FT                   MKAIPVFGQHLSKTYLWNLQPSPAYIGQGIIMGLPTVSYMVFGCVLGWAVLAPLARHKK
FT                   WVDPKADINDWENGVQGWILWSSLAVMVVDSVVGFIVFTTKSLVQFCLRNDKRHLLESM
FT                   IDDSVQSMLLEEERIINKGNGAGRRRVSTVKLVRTDMDHEVDHRQLVKFTTVVSGLVVS
FT                   SIICIVCTLYLFGTEIVPLSSVIIALFVALFLSILAVRALGETDLNPVSGIGKLSQLIF
FT                   TILMPHKKGAILLNLVAGGIAEAGAQQAGDLMQDLKTGHLLGASPKAQFFAQLIGASWS
FT                   IVFSSVMHIFYNRIYEIPSSQFRVPTAVIWIDCARLVTGKGLPDKALECTIILGSIFAI
FT                   LSLIKNLYRDRGHKWLLWIPSGVAVGVGIYNAPSFTLARFIGGCTAQYWLRTHGSDSSA
FT                   KTCMIVFSSGLVLGEGICSIFNMIFTSYNVPHL"
FT   gene            complement(<536730..>537692)
FT                   /locus_tag="KLTH0H06116g"
FT                   /old_locus_tag="KLTH-ORF1439"
FT   CDS_pept        complement(536730..537692)
FT                   /locus_tag="KLTH0H06116g"
FT                   /old_locus_tag="KLTH-ORF1439"
FT                   /product="KLTH0H06116p"
FT                   /note="highly similar to uniprot|P12904 Saccharomyces
FT                   cerevisiae YGL115W SNF4 involved in release from glucose
FT                   repression invertase expression and sporulation associates
FT                   with Snf1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30284"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2M3"
FT                   /protein_id="CAR30284.1"
FT                   /translation="MSMAATDSVLIEQQLAVQSIRRFLKSKTSYDVLPVSYRLIVMDTS
FT                   LLVKKSLNILLQNNIVSAPLWDSNTSKFAGLLTSSDFINVIQYYFSNPDKFELVDKLQL
FT                   DGLKDIERAIGVRPLDTGSIHPFKPLYDACCKMIESRSRRIPLIDQDEETHREIVVSVL
FT                   TQYRILKFVALNCRETRHLRRPIGELGIITEGKLLSCNMHTPVIDVIQLLTQGGVSSVP
FT                   IVDEQGHLVNVYEAVDVLGLIKGGMYNDLSLSVGEALMRRPDDFEGVYTCTKNDKLFTI
FT                   MDTIRKSRVHRFFVVDEQGLLTGVLTLSDILKYILFEEN"
FT   gene            <538093..>538207
FT                   /gene="SNR20"
FT                   /locus_tag="KLTH0H06138r"
FT                   /old_locus_tag="Klth0H_ncRNA_211"
FT   ncRNA           538093..538207
FT                   /gene="SNR20"
FT                   /locus_tag="KLTH0H06138r"
FT                   /old_locus_tag="Klth0H_ncRNA_211"
FT                   /product="U2 RNA"
FT                   /note="LSR1 SNR20 (U2 RNA)"
FT                   /ncRNA_class="snRNA"
FT   gene            complement(<538741..>540465)
FT                   /locus_tag="KLTH0H06160g"
FT                   /old_locus_tag="KLTH-ORF1437"
FT   CDS_pept        complement(538741..540465)
FT                   /locus_tag="KLTH0H06160g"
FT                   /old_locus_tag="KLTH-ORF1437"
FT                   /product="KLTH0H06160p"
FT                   /note="similar to uniprot|P26309 Saccharomyces cerevisiae
FT                   YGL116W CDC20 Cell-cycle regulated activator of anaphase-
FT                   promoting complex/cyclosome (APC/C) which is required for
FT                   metaphase/anaphase transition directs ubiquitination of
FT                   mitotic cyclins Pds1p and other anaphase inhibitors
FT                   potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06160g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30285"
FT                   /db_xref="GOA:C5E2M4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR033010"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2M4"
FT                   /protein_id="CAR30285.1"
FT                   /translation="MADNRRNKLDFANNASKSVLSLTSPAKLNVVSSDWSKMTSKRPSG
FT                   KISKRQASSGGTLSNVTNIPTNSKSSGSRPTLQYVPPLLRRSSSLYKEDLESGERKTIK
FT                   SQDSEEGFLNTDRFIPLRKENSFSHSKIDPMNLEEEVPPPNASPSTHLKAQTKRVFKQN
FT                   VAEACGLEMNQRILQYLPKPPAASHRKQTYSMGSRSHYSYSAVQNPGSSQELAKLRKIN
FT                   SNPERILDAPGFQDDFYLNLVSWSNKNVLAIALDSALYLWNGSSGDVSLLVDFEQPGSI
FT                   TSVTWSDDDCHISIGKLEGNTEIWDIETMSHVRTMRSGLGVRIGSQSWLETLIATGAKS
FT                   GEIHINDVRIKNHIVSTWEEHRGEVCGISYRPDGLQVASGSNDNTVVIWDTRTSLPQHI
FT                   KRQHTAAVKALAWSPDINNLLATGGGQTDKHIHFWNTTTGARTGSINTGSQVSSLHWGQ
FT                   SYNANTIQREIVATGGNPENAVSVYNYDTKFKVAEIVHAHEARICSSQLSPDGTVLATV
FT                   GGDENLKFYKVFEPRRKRPQGVCDGESLLGLLNVGEACDDDPTRSPNRRKTSEFLIR"
FT   gene            complement(<542052..>543836)
FT                   /locus_tag="KLTH0H06182g"
FT                   /old_locus_tag="KLTH.mRNA.101CN.m"
FT   CDS_pept        complement(join(542052..543392,543465..543836))
FT                   /locus_tag="KLTH0H06182g"
FT                   /old_locus_tag="KLTH.mRNA.101CN.m"
FT                   /product="KLTH0H06182p"
FT                   /note="similar to uniprot|P27697 Saccharomyces cerevisiae
FT                   YGL119W ABC1 Protein required for ubiquinone (coenzyme Q)
FT                   biosynthesis, which in turn is required for respiratory
FT                   growth; has similarity to prokaryotic proteins involved in
FT                   early steps of ubiquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06182g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30286"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2M5"
FT                   /protein_id="CAR30286.1"
FT                   /translation="MSSRKALYHAFCVASSFKELAKGSLSISKESLRSWFETSSLTRPA
FT                   LSNYQWFYDKEWEKARKLSERVRSDYEKSEHATKHGTRTKASGPKKTVRHYSTRAKQSS
FT                   HQLQSRQSEKTDAAVQNTQETSEDTPRKLQSSSIPSSRISRLFHYGSLAAGVGFSAATD
FT                   GLSQAVRGQSPNFKSLLLSDANIERIVKKFSKMRGAALKIGQMMSFQDESVLPKELYIV
FT                   LSRVQNGANYMPQRQLDRLMTRELGKGWKDKFAHFDLVPMAAASIGQVHDAVLPSGEEV
FT                   VVKVQYPGVKDSIDSDLNNVLMFLTASRLLPRGLFLDKTVANARTELRWECDYKREAAA
FT                   LQKFEQLLKNEPDLVTPRVYEDLTTDSIITMSKMHGKEIMKLPLTVSQETRNFISETIM
FT                   RLCLREIAEFQFMQTDPNWANFLYNGSTQKLELLDFGASRNFPEEFIYKYRRMLTAGTQ
FT                   RDREKVAHFSKELGYLTGLESKAMVDAHVDSVMVLAEPFCGDTESYFDFSEQTVTDRIR
FT                   GNIGLMLKERLCPPPEETYSLHRKFSGVFLLCARMRAQVPMAKLFQEHFALYE"
FT   gene            <544108..>546423
FT                   /locus_tag="KLTH0H06204g"
FT                   /old_locus_tag="KLTH-ORF1430"
FT   CDS_pept        544108..546423
FT                   /locus_tag="KLTH0H06204g"
FT                   /old_locus_tag="KLTH-ORF1430"
FT                   /product="KLTH0H06204p"
FT                   /note="highly similar to uniprot|P53131 Saccharomyces
FT                   cerevisiae YGL120C PRP43 RNA helicase in the DEAH-box
FT                   family involved in release of the lariat-intron from the
FT                   spliceosome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30287"
FT                   /db_xref="GOA:C5E2M6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2M6"
FT                   /protein_id="CAR30287.1"
FT                   /translation="MTSKRRHSSHSEHKSAVESSIPEHAAEVAEELSKKQRVPSKEPLT
FT                   HHDAGEFHDLVRHKTTAAQAEVLESGAKNPFTGQVFSPRYFDILKVRRDLPVHAQREEF
FT                   LKIYQKNQVMVFVGETGSGKTTQIPQFVLFDEMPHLLNTQVACTQPRRVAAMSVAQRVA
FT                   EEMDVKLGEEVGYSIRFENKTSDKTILKYMTDGMLLREAMEDHDMKRYSCIILDEAHER
FT                   TLATDILMGLLKQVVVRRPDLKIIIMSATLDAEKFQKYFLDAPLLAVPGRTFPVELYYT
FT                   PEFQRDYLDSAIRTVLQIHATEEPGDILLFLTGEDEIEDAVRKISLEGDQLIREQNCGP
FT                   LSVYPLYGSLPPHQQQRIFEPAPEPFNGRPGRKVVVSTNIAETSLTIDGIVYVVDPGFS
FT                   KQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCYRLYTEEAFKKELIEQSYPE
FT                   ILRSNLSSTVLELKKLGVDDLVHFDFMDPPAPETMMRALEELNYLACLDDDGNLTPLGR
FT                   LASQFPLDPMLAVMLIGSPEFHCAQEILSIVAMLSVPSVFIRPVKDKKRADDAKAIFAH
FT                   PDGDHITLLNVYHAFKSDEAYEYGINKWCRDNFLNYRALSAADNIRSQLERLMVRYNLV
FT                   LNSTEYEDPRYFDNIRKALAAGFFMQVAKKRSGGKGYITVKDDQDVLIHPSTVLGHDAE
FT                   WVIYNEFVLTSKNYIRTVTSVRPEWLIDLAPAYYDLDNFRKGDVKLSLERVKQKVDRIN
FT                   ELNEEKSKKKKKSKKDKS"
FT   gene            <546809..>548341
FT                   /locus_tag="KLTH0H06226g"
FT                   /old_locus_tag="KLTH-ORF1427"
FT   CDS_pept        546809..548341
FT                   /locus_tag="KLTH0H06226g"
FT                   /old_locus_tag="KLTH-ORF1427"
FT                   /product="KLTH0H06226p"
FT                   /note="some similarities with uniprot|P32505 Saccharomyces
FT                   cerevisiae YGL122C NAB2 Nuclear polyadenylated RNA-binding
FT                   protein related to human hnRNPs has a nuclear localization
FT                   signal sequence that binds to Kap104p required for both
FT                   poly(A) tail length control and nuclear export of mRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30288"
FT                   /db_xref="GOA:C5E2M7"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR021083"
FT                   /db_xref="InterPro:IPR040366"
FT                   /db_xref="InterPro:IPR041044"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2M7"
FT                   /protein_id="CAR30288.1"
FT                   /translation="MSDPKEEIFNNLKVVIAENLKTLPNFNEDVNYVAEYIVLLMSNGG
FT                   NLESVVQELTSLFDTVPPEAFHNVVQNAYKVLGYLQGGDSLEVAVSKLTGGSNAPAGQE
FT                   QHNQQAMFSQEQQQQQQSQQQPQHQAHQQQPQQQAAVPSIFQTAPPATAAQPQSAFAGL
FT                   VEFSPAPSGDISKSGGAQRGGGVGKASTRGGRNERPGRGGKNGVGKRNNYQNNNALAMA
FT                   LGMDDPNTNVVQKKQGRCKLFPRCPLGRQCPHAHPTQACREYPNCPNPPGTCNYLHPNE
FT                   DVELMKEIEKTREEFREKRAAVAASRAKPINTGIVLCKFGNLCSNPQCPFGHPTPANED
FT                   AKVITFAWCPENLKCENPTCDRAHSSHSKIKEVAPIAARKPSRPPVEKSLEQCKFGQNC
FT                   TNKRCKFRHARSHIMCREGANCTRIDCLFGHPINEDCKFGVECRNIYCLYRHPEGRQLP
FT                   DKSQQAQSNSNNTWVNPNLGTGNSSSNERPFAVPENQVIEAAPAQEQDAMMN"
FT   gene            complement(<548756..>549532)
FT                   /locus_tag="KLTH0H06248g"
FT                   /old_locus_tag="KLTH-ORF1421"
FT   CDS_pept        complement(548756..549532)
FT                   /locus_tag="KLTH0H06248g"
FT                   /old_locus_tag="KLTH-ORF1421"
FT                   /product="KLTH0H06248p"
FT                   /note="highly similar to uniprot|P25443 Saccharomyces
FT                   cerevisiae YGL123W RPS2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30289"
FT                   /db_xref="GOA:C5E2M8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2M8"
FT                   /protein_id="CAR30289.1"
FT                   /translation="MSAPAPAPAQGDQRRGGFGGRNKGRQQRRGRRDQEEKGWTPVTKL
FT                   GRLVKAGKITSVEEIFLHSLPVKEFQIVDTLLPTLKDEVMNIKPVQKQTRAGQRTRFKA
FT                   VVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGNNLGQPHSLATKTS
FT                   GKCGSVTVRLIPAPRGKGIVASPAVKKLLELAGVEDVYTSSNGSTRTLENTLKATFVAI
FT                   GNTYGFLTPNLWAAQPLPVSPLDIYSDEASAEKKRY"
FT   gene            <550420..>551015
FT                   /locus_tag="KLTH0H06270g"
FT                   /old_locus_tag="Klth0H.mRNA.628.p"
FT   CDS_pept        join(550420..550427,550541..551015)
FT                   /locus_tag="KLTH0H06270g"
FT                   /old_locus_tag="Klth0H.mRNA.628.p"
FT                   /product="KLTH0H06270p"
FT                   /note="some similarities with uniprot|P38325 Saccharomyces
FT                   cerevisiae YBR230C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30290"
FT                   /db_xref="GOA:C5E2M9"
FT                   /db_xref="InterPro:IPR039454"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2M9"
FT                   /protein_id="CAR30290.1"
FT                   /translation="MPNGQNEVDSSNIPDAAKRAAQELREEAQDLREEANKEFEELERN
FT                   GTIDKYKDNAAGILKNVANRASAAASYVATRVKTVSQRVAYELRNPVVIVNAALGVGLV
FT                   STLLKGYTKNQRYLKGKSDSVILSTVVGATAAVALDVYLSGKYYQKFDQKSNKKRL"
FT   gene            <551263..>553176
FT                   /locus_tag="KLTH0H06292g"
FT                   /old_locus_tag="KLTH-ORF1415"
FT   CDS_pept        551263..553176
FT                   /locus_tag="KLTH0H06292g"
FT                   /old_locus_tag="KLTH-ORF1415"
FT                   /product="KLTH0H06292p"
FT                   /note="similar to uniprot|P53129 Saccharomyces cerevisiae
FT                   YGL124C MON1 Protein required for fusion of cvt- vesicles
FT                   and autophagosomes with the vacuole associates as a complex
FT                   with Ccz1p with a perivacuolar compartment potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06292g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30291"
FT                   /db_xref="GOA:C5E2N0"
FT                   /db_xref="InterPro:IPR004353"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2N0"
FT                   /protein_id="CAR30291.1"
FT                   /translation="MVGEPHEDYLDAPKSRAKSPVPARLSPFASGVTEPTTSVDFASSF
FT                   PAPPRPFFEEPRPSSSSVYLDLASERQSVRTTHQDLEHELLQSMRSLDLMPKKHAVSNE
FT                   IPSIFEGCAPETKPLPLHHDKQFFIMSSAGKPIYTMHGQDELVMGLMGIIHTVINYFKL
FT                   HDTKVHSIVNSSGSSVKQRFVFLDKSPIILMAMSAREESTNDLLQQLDFLYSYLISTLS
FT                   RKQLTRLFSKRENFDLRRFLTDSDFQNLNHICDSISRGFNPEFLLGALRCLPLRKSTRQ
FT                   IIDNTMLAQIQDPGTNVGRGTLLYGLIVAPGGQLCSVLRPRGHTLHTTDLHLLFSLVFN
FT                   QFQGLQDDQELWLPICFPKFNSSGFLHCYIRLLPHHASKPRPADARSTVSHSQEPLDSL
FT                   SQIRNRTDLSSTRLRPALVLISAQKESFFALKKIGQGIIDELDRQGITNQISMASDSGF
FT                   TMADIPAKFVHHFIYKSKRHVQYVMPHLGPLADLSFPIIDDDSRSTFSVEGNQDNRSEE
FT                   NGPGAASSNDKTRQKLYLQKLMSYYTHIRNNAVSDNGKSFNNSTLTFIKWSNDQPSLEG
FT                   LPSGEPINVLCLAWLTPTFELLLICNNGVSDRNTALKSAKNIVDWCRKNEHRLFVSNGA
FT                   IF"
FT   gene            complement(<553271..>554539)
FT                   /locus_tag="KLTH0H06314g"
FT                   /old_locus_tag="KLTH-ORF1413"
FT   CDS_pept        complement(553271..554539)
FT                   /locus_tag="KLTH0H06314g"
FT                   /old_locus_tag="KLTH-ORF1413"
FT                   /product="KLTH0H06314p"
FT                   /note="some similarities with uniprot|P40209 Saccharomyces
FT                   cerevisiae YMR136W GAT2 Protein containing GATA family zinc
FT                   finger motifs; similar to Gln3p and Dal80p; expression
FT                   repressed by leucine"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06314g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30292"
FT                   /db_xref="GOA:C5E2N1"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2N1"
FT                   /protein_id="CAR30292.1"
FT                   /translation="MHTDALFRSDRFQELRSATDQPTIKVLQKSPKATPSLPGIRQLLH
FT                   NICAHTIERTTVINDFTNREIKAQMGFLSTNNEEYPSFKLGQLGQLGSPKQSHSGRRHE
FT                   KLPFHSSPTRFEHPQLVKFYTGDTAPRQLLRVGKIQKPSGDLLRLANLVEASPKMHEVH
FT                   ITGNSIKDEVISSNGEYQLKVAEILTSSRCVFENLQEWPLSVHSQDTSGDDGMYFLTEF
FT                   INMESLDITISMAKKVHESLQAIKLWKSKHIELKMNRRPENTIATSGKGMIGGISLPRM
FT                   DLGQKLSKDEPRKASCRLGTASGHAKGGNAAIFSEAVASHNTGRHNIDTQLSTKAIGEP
FT                   KGRVMRNALQCAHCSSTKTPEWRKGPCGRRSLCNACGLFYKKLVRKFGDGQASMIMKHR
FT                   KSISSKNRKVPHVFDVPHSFVQI"
FT   gene            <555685..>558462
FT                   /locus_tag="KLTH0H06336g"
FT                   /old_locus_tag="KLTH-ORF1412"
FT   CDS_pept        555685..558462
FT                   /locus_tag="KLTH0H06336g"
FT                   /old_locus_tag="KLTH-ORF1412"
FT                   /product="KLTH0H06336p"
FT                   /note="similar to uniprot|P38138 Saccharomyces cerevisiae
FT                   YBR229C ROT2 Glucosidase II catalytic subunit required for
FT                   normal cell wall synthesis mutations in rot2 suppress tor2
FT                   mutations and are synthetically lethal with rot1 mutations"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06336g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30293"
FT                   /db_xref="GOA:C5E2N2"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2N2"
FT                   /protein_id="CAR30293.1"
FT                   /translation="MPRVCRKLQLALILVSIGQVLGFTDYLLKSCSQSGFCQRNRHYAS
FT                   EIERAQESPYSLDPASIQISNSNHTFQATIQKSIPDLLSFNETLIVELPVFVDVLDGGK
FT                   VRFRIDERRETNNTYVPEILNPKRYDEASLWAFQKDAKTQPVEVGIEKSLWSRKTSVTF
FT                   IAPDSQVKIRVFLKQFRIEFYFEENLVLVVNDRLLLNVEHLRTPEENTLQKLPEELTFN
FT                   DFEDDFEYSKKDTLPFGPESVALDFTFVGVTDVFGIPEHADSLKLKDTRDGEPYRLFNA
FT                   DVFEYSLGARTPMYGAIPFMIGSTPDFSAGIFWVNAADTWVDINYSESSTGTHWMSEAG
FT                   TIDVIIFLAKTPQEVTSAYTEITGRPQLPLSSSIGYHQCRWNYNDERDVLTVDSQMDKA
FT                   GIPYDYIWLDLEYTDDKKFFTWKPDAFPDPRRMLKKLHTLGRNLVTLIDPHLKVDYSAS
FT                   NTVEKSGASVRNSLGASYHGHCWPGESIWIDTIGKNARKVWGKLMSNFLQDYNNLHIWN
FT                   DMNEPSVFSGPETTAPKDLIHDGGFEERSIHNLYGLTVHEATYNAMRENYGEKNRRPFI
FT                   LSRSFFAGSQRTAATWTGDNVANWEYLKISIPMCLSNNVAGFPFIGADIAGFSGNPTTE
FT                   LLARWYQAGMWYPFFRGHAHIDAARREPYLFEEPLKSIVKDAILLRYSLMPTFYTAFYE
FT                   SSTKGSPIMNPVFFVHPELHECYGIDDQFYIGSSGLLVKPVTEQGATEVQVFFPAGQFY
FT                   EFDSLKAFSVQEPSYLTIDAPIDKQPISIEGGHILFKKERYRRSSKLMEHDPYTLVIAP
FT                   DVNGKAEGTLYIDDGETFAFQDGEYMKVAVKLENDVLESTVTHMPTKFPNLSTHVERII
FT                   VGGGQYSSGPNRVTLKKDKTEWILETKISKNGHHAIIENPHLDLSKPWSLEVHR"
FT   gene            complement(<558459..>559403)
FT                   /locus_tag="KLTH0H06358g"
FT                   /old_locus_tag="KLTH-ORF1410"
FT   CDS_pept        complement(558459..559403)
FT                   /locus_tag="KLTH0H06358g"
FT                   /old_locus_tag="KLTH-ORF1410"
FT                   /product="KLTH0H06358p"
FT                   /note="similar to uniprot|P38324 Saccharomyces cerevisiae
FT                   YBR228W SLX1 Subunit of a complex with Slx4p that
FT                   hydrolyzes 5' branches from duplex DNA in response to
FT                   stalled or converging replication forks function overlaps
FT                   with that of Sgs1p-Top3p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06358g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30294"
FT                   /db_xref="GOA:C5E2N3"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR027520"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2N3"
FT                   /protein_id="CAR30294.1"
FT                   /translation="MKSRSKTKQHAIPDFYCCYLLRSVPKKQSFYIGSTPNPVRRLRQH
FT                   NGTLANGSAYRTKKTGFRPWRMIACVYGFTSKIAALQFEHAWQHSNLTHFIDDDQRIVT
FT                   KKAGGRTIHHKLGNIRLLIKNEFFSYMNLKVHLFCAEAVDAWSQNKFLIDCDIPNVTES
FT                   LEPPASKEELQKRGANEFASENLVLVEKLYKSVLRADDERVRVYQEALYHGCITCPICH
FT                   KDFNYMSDEDSPKPLVAFCPTDNCQFLSHLSCLHRIFVDDEQALTGVRKLLPHSGSCPS
FT                   CDKKIFWTKVVKYSTRLRETSGPQQDSVPSSQC"
FT   gene            <559500..>561026
FT                   /locus_tag="KLTH0H06380g"
FT                   /old_locus_tag="KLTH-ORF1409"
FT   CDS_pept        559500..561026
FT                   /locus_tag="KLTH0H06380g"
FT                   /old_locus_tag="KLTH-ORF1409"
FT                   /product="KLTH0H06380p"
FT                   /note="similar to uniprot|P38323 Saccharomyces cerevisiae
FT                   YBR227C MCX1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06380g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30295"
FT                   /db_xref="GOA:C5E2N4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2N4"
FT                   /protein_id="CAR30295.1"
FT                   /translation="MIKTGLKSFQSFHRLSSLAGKVQENQLRNLPSPKELRKFLDNYVV
FT                   GQTTGKKVLSVAVYNHYLRVNDKQKRIDAKLQRELLEKQQQEDDKDEPIYTGSNEAKVG
FT                   FQNLQTQLARGMDPKDDDLELSKSNVLVVGPSGSGKTLLASTLARVLDVPIAITDCTQL
FT                   TQAGYIGEDVEVCIERLLINADYDVAKAERGIIVLDELDKLAKPAASIGTKDVSGEGVQ
FT                   QALLKILEGHSIEVTVKRPINKKKDGQNNNQVSAKKDETFVVDTSNILFMLMGAFVGLD
FT                   KHVVKRINRLKAISNGETIEDKSEDSKRLRFSNTIEKVELSNGKKVSALNLATPTDLVA
FT                   YGLIPELIGRVPIITALEPLERTDLYHILREPKNALLNQYEYIFKQFGVKLCVTEKALM
FT                   KVAHFALDEGTGARGLRGIMERLLLNVNYECPGSGISYVLVNEDTVKSLQLSEHSLSTH
FT                   VNAKYYSRGERDKFIEDVHKEDSKQGRELDRLYGRTATLVREGNVDQCPE"
FT   gene            complement(<561071..>563329)
FT                   /locus_tag="KLTH0H06402g"
FT                   /old_locus_tag="KLTH-ORF1407"
FT   CDS_pept        complement(561071..563329)
FT                   /locus_tag="KLTH0H06402g"
FT                   /old_locus_tag="KLTH-ORF1407"
FT                   /product="KLTH0H06402p"
FT                   /note="weakly similar to uniprot|P38321 Saccharomyces
FT                   cerevisiae YBR225W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06402g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30296"
FT                   /db_xref="GOA:C5E2N5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2N5"
FT                   /protein_id="CAR30296.1"
FT                   /translation="MEGKKKQHSKGELECTDGSRRNSGFVPGVGKALGVSDSSKNTKSP
FT                   SWTSSISTITEELPAPKVSEAMTRVPSAASAVSYPYCSSVPEEPGAKPCPTRARWWNTL
FT                   PKIGETVHSHKHSLNAVVLNVNGTPREIIYDPRYNPLFSKLEIFYMFNAQTPLSDCYTY
FT                   AKTRLASFVKFLEVYHSSRQYASACLPFNVSVAANATAGGYPSYTAGVDYHEIGEIVQL
FT                   WYLQSLEFMIDNNSFLFSNEIVDYLVNYEPQKNASIKRELSCSGPPPSALQETIIRADI
FT                   LLIRCTFEEELGWQLALDEPNWNIVDLFVDLSFLGRLTTEDEGEDSSGNATSTTADVDG
FT                   DTTLSPPSSASSSPATSATTSSSDVSYGKVSESVMREPVRSGNDIFVDPQTDVPETSSA
FT                   RACHVIVQDCVGRDLDKLAAEMRAKGINETCRPSISQNSSQESFSSQKQGQSGKKDQST
FT                   KSAKSSTGLGISNFFRRKNSHASGDKGDNPLSSKRAPQSDSVKMNLTIQNSYLDDYYAS
FT                   TLANFRKLVLPSHCMFTRREAPKPFKRENGASKKQEANSYQKEFLQIKIPLKDESFPVI
FT                   ICPDVWFSLEFKKWKGLINELFRCIRPGGFLETSACNLTNVNDGYDIEKSSKEFPTLLE
FT                   MKALNDVISMEAVKAGLQVFPMRHLVGALKAAGFVNIKHSVFSLKRGDLRHNMGFLFEF
FT                   LAIRNYDYQLRNDLLSSEVKPPGTNPASFPLRYVEEHMGKADEDAGVVRLVLITAQKP"
FT   repeat_region   complement(565752..566169)
FT                   /locus_tag="KLTH0H06424t"
FT                   /old_locus_tag="Klth0H.LTR.2"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            complement(<567521..>569320)
FT                   /locus_tag="KLTH0H06446g"
FT                   /old_locus_tag="KLTH-ORF1400"
FT   CDS_pept        complement(567521..569320)
FT                   /locus_tag="KLTH0H06446g"
FT                   /old_locus_tag="KLTH-ORF1400"
FT                   /product="KLTH0H06446p"
FT                   /note="highly similar to uniprot|P53128 Saccharomyces
FT                   cerevisiae YGL125W MET13 Isozyme of
FT                   methylenetetrahydrofolate reductase catalyzes the reduction
FT                   of 5 10-methylenetetrahydrofolate to 5-
FT                   methyltetrahydrofolate in the methionine biosynthesis
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30297"
FT                   /db_xref="GOA:C5E2N6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2N6"
FT                   /protein_id="CAR30297.1"
FT                   /translation="MRVSEKLQKNREANGTSKATFSFEFFVPKTSQGVQNLYDRMDRMY
FT                   QTHPQFIDITWNAGGRLSQLSTELVSTSQSVLGLETCMHLTCTNMPRQLIDDALQKAYE
FT                   SGCQNILALRGDAPITSSEWKPCEGGFTYAKDLVRYIREKYGDHFDIGVAGYPEGHPEE
FT                   EASPKLVQYLKEKVDAGADFIITQMFYDADNFIEWCRQVRAAGIEVPIIPGIMPITTYA
FT                   AFLRRSSWCQINVPEAFMAKLDPVKDDDQAVREVGTELVAQMCQKLLDSGYVTHLHMYT
FT                   MNLEKACIMVLDRLGLLSEDEDIFRDEVVPMPWRKSLHPQRRNESVRPIFWQKRPYSYV
FT                   ARTSQWTADEFPNGRFGDSSSPAFGDLDLLGSTSIRQSPQRALELWSTPTKFSDIAALV
FT                   IDYLHGKLKCLPWCDVALNHEVDTTMPQLLDLNKHMILTLNSQPRVNGASSADKIVGWG
FT                   PNNGYVYQKQYLEFLLPKSKLSQLRDFVNDMPSLTYFAVDSADELHSNHPDDTAANAVT
FT                   WGIFPGREVLQPTIVEKVSFLAWKEEFFDILDEWKRIMGENNHSESVALLESVISDYLL
FT                   VNIVDNDYVSDGDRIYDMLQRLY"
FT   gene            <570533..>572245
FT                   /locus_tag="KLTH0H06468g"
FT                   /old_locus_tag="KLTH-ORF1393"
FT   CDS_pept        570533..572245
FT                   /locus_tag="KLTH0H06468g"
FT                   /old_locus_tag="KLTH-ORF1393"
FT                   /product="KLTH0H06468p"
FT                   /note="similar to uniprot|P38319 Saccharomyces cerevisiae
FT                   YBR223C TDP1 Tyrosine-DNA Phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06468g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30298"
FT                   /db_xref="GOA:C5E2N7"
FT                   /db_xref="InterPro:IPR010347"
FT                   /db_xref="InterPro:IPR027415"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2N7"
FT                   /protein_id="CAR30298.1"
FT                   /translation="MSGTEAESAARKRVRERWCQVEYNTKREEQADEVVPKRAKIGGTP
FT                   EVIDLTSDQEDTTSWEASETDIPVLGEAPTNGESSSGATREHGRVNYPFKLVRSEFYDE
FT                   GHVSEHFITLQEIFSESKLTRAWLFSFQYELDFILPMFNESTQITIIAQKGTILPPTRI
FT                   SSKTSKILSKMKTIELQMPPFACHHSKMIVNEYRDGSCCIYIPSNNFTHAETNLPQQIV
FT                   WCSPRLRRCSEAVKESEFRKSLVKYLNAYPVSLKPLIEFLGTLDFTSLDQLGVEFIFSC
FT                   PKPFESILSGIPLLHKALSSRQHAAGGNTGRERHRYLSQVSTIGAPLKTGLEYPGNLFS
FT                   HLMIPLLSGLLVGPRDRKRAYEIPNLHKVFEDYNIEPYIVYPTPEEIRQSPMGYLTGGW
FT                   FHFHWLRNQATKTVYNTLKKWGVLHKQQPQDCPRRGRTPSHTKFYMKSTTLLDNQAPFS
FT                   EVDWFLFTTANLSLNAWGTTTRKPQNYEVGVLFKSQDRRRITVKSVSDLVYSKFRSTGQ
FT                   ILGSSKVHSNANICVMVPFDINPVPYQPGDDAFCVSRSYEAPDIHGKLHQAQN"
FT   gene            <572398..>574017
FT                   /locus_tag="KLTH0H06490g"
FT                   /old_locus_tag="KLTH-ORF1391"
FT   CDS_pept        572398..574017
FT                   /locus_tag="KLTH0H06490g"
FT                   /old_locus_tag="KLTH-ORF1391"
FT                   /product="KLTH0H06490p"
FT                   /note="highly similar to uniprot|P38137 Saccharomyces
FT                   cerevisiae YBR222C PCS60"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06490g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30299"
FT                   /db_xref="GOA:C5E2N8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2N8"
FT                   /protein_id="CAR30299.1"
FT                   /translation="MTQDTRGVASFNESFKVTDNVALVVPETGTQVTYRDLSHMTGHFQ
FT                   TLFQSPDSPLYKLIGRQSAIAISMANGLEFVTAFLGITTDSKIAAPLNPNYKAEELNFY
FT                   LNDLKTKVICVPQGTVQAGSNAEILKSASKFGCFIVELYFDKERFRVEYDVYSPQESYK
FT                   RKVYSSINHAVFHNHSDKFPGFARSSDVALILHTSGTTSAPKTVPLLHLNIARSMRNIA
FT                   ATYKLSPADRSYVVMPLFHVHGLIGVLLSTFWAQGSVVVPPRFSVKKFWNDFITWNCNW
FT                   FSCVPTISMIMLNSPKPNPLPHIRFIRSCSSALAPSTFAKLESEFQAPVLEAYAMTEAS
FT                   HQMTSNNLPPGKRKPGTVGQPQGVEVFILDDKDNVLPQGQQGEVSIRGENVTLGYAHNE
FT                   KANRENFTKRENYFRTGDQGYFDPEGFLVLTGRIKELINRGGEKISPIELDGVMLSHPK
FT                   VDEAVAFGVSDEKYGQIVNAAVVLKLGQKLDYKELTDYMRSKVASFKVPTKIFFVDKLP
FT                   KTATGKIQRRIIAEVFAGKSKL"
FT   gene            <574323..>575420
FT                   /locus_tag="KLTH0H06512g"
FT                   /old_locus_tag="KLTH-ORF1389"
FT   CDS_pept        574323..575420
FT                   /locus_tag="KLTH0H06512g"
FT                   /old_locus_tag="KLTH-ORF1389"
FT                   /product="KLTH0H06512p"
FT                   /note="highly similar to uniprot|P32473 Saccharomyces
FT                   cerevisiae YBR221C PDB1 E1 beta subunit of the pyruvate
FT                   dehydrogenase (PDH) complex which is an evolutionarily-
FT                   conserved multi-protein complex found in mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30300"
FT                   /db_xref="GOA:C5E2N9"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2N9"
FT                   /protein_id="CAR30300.1"
FT                   /translation="MAFRLSTGVFGGVRQAFLSGRAGAAAPLARRMASTKTMTVRDALN
FT                   SAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLSVGA
FT                   ALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQH
FT                   SQDFSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEEAL
FT                   STDFTLPYTAKVEREGTDISIITYTRNVQFSLQAAEILDKQYGVSAEVINLRAIRPMDV
FT                   NAIIKTVKKTNHLITVESTFPNFGVGSEIVAQIMESEAFDYLDAPVKRVTGADVPTPYA
FT                   KELEDFAFPDPDVIVNAVKSVLSIE"
FT   gene            <576000..>577634
FT                   /locus_tag="KLTH0H06534g"
FT                   /old_locus_tag="KLTH-ORF1385"
FT   CDS_pept        576000..577634
FT                   /locus_tag="KLTH0H06534g"
FT                   /old_locus_tag="KLTH-ORF1385"
FT                   /product="KLTH0H06534p"
FT                   /note="similar to uniprot|P38318 Saccharomyces cerevisiae
FT                   YBR220C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30301"
FT                   /db_xref="GOA:C5E2P0"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2P0"
FT                   /protein_id="CAR30301.1"
FT                   /translation="MSGVPHQLARHDYKAFFLLVVLYFLQGIPVGLAFGTVPFLLKSGA
FT                   RETTFTQLGVFALATYPYSLKIIWSPIVDSIYSKKTGRRRSWIIPVQLASGIILWAIGF
FT                   CVSNNLVFAGIDDSYSTGNAPVKQGVRPTDITTLTICFLLLVFLCATQDIAVDGWALEI
FT                   LSKQSLSYASTAQTVGLNTGYFLSFTIFLTFNSSDFMNRYIRSEPLEYGLISFGGYLKF
FT                   AGTVYLAVTFYIMFFTNERPSNCSVLPSTAKKSDEKQVIDYNVETGASSISLKNVYLLF
FT                   FKVLKLPSVRSLMLIHLVSKFAFQCNEGATNLKLLERGFKREDLAVTVLVDFPFEIIFG
FT                   YYVAKWSSSATFGPRKFERSNFFARMLVGEAGILTPWLWGFLGRLLSAFLAGILVAKFP
FT                   SDGIVTRSYFLMVIFQHLLGSFMTTVQFVAICAFHTRIADSAIGGTYMTLLNTFSNLGG
FT                   TWPRLLVMTMIDRLTKHECVGTGAQPLDATDEGLCKAAGGTWMIVRDGYFVSNFCCITV
FT                   GIVLYFTFIRKRAQRLQLLPESAWHCS"
FT   gene            complement(<577648..>578739)
FT                   /locus_tag="KLTH0H06556g"
FT                   /old_locus_tag="KLTH-ORF1383"
FT   CDS_pept        complement(577648..578739)
FT                   /locus_tag="KLTH0H06556g"
FT                   /old_locus_tag="KLTH-ORF1383"
FT                   /product="KLTH0H06556p"
FT                   /note="weakly similar to uniprot|P53012 Saccharomyces
FT                   cerevisiae YGL126W SCS3 Protein required for inositol
FT                   prototrophy"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30302"
FT                   /db_xref="GOA:C5E2P1"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2P1"
FT                   /protein_id="CAR30302.1"
FT                   /translation="MELSLYKIFLFSLCPLTLLVGQLVSFRVHLEVDKDGWLNTYFVKQ
FT                   GWFWTSLVGWWCMIRYGGFGPRGTWKRTLLRYAILTVWWFVFTQSLWSEAAPLMDLVFT
FT                   ATGGRCSFEVFDLSDSPTWGINEKFHDTFSRRQSSLQKLYNALKKGAQNPPSLLQNAVS
FT                   EIEYWISEGKGHLRGEDVTPSQLNSLIDSALHSWKKINSSNLCRSMGGYWIGGHDPSGH
FT                   IFLITLMCMFLLGELQAIGKRALRVLKTHNKYWQQLREHGTSVLTLGGLWNLVAHPPAT
FT                   KKQLFKQLGLIPLDISQHLTQLFGATAKFIVWENPVVLLVLFTFLWWWSLLITTIAFHT
FT                   LWEQLSGLLCAYIVAGFVYWKLV"
FT   gene            <579003..>579392
FT                   /locus_tag="KLTH0H06578g"
FT                   /old_locus_tag="KLTH-ORF1379"
FT   CDS_pept        579003..579392
FT                   /locus_tag="KLTH0H06578g"
FT                   /old_locus_tag="KLTH-ORF1379"
FT                   /product="KLTH0H06578p"
FT                   /note="similar to uniprot|P38633 Saccharomyces cerevisiae
FT                   YGL127C SOH1 Subunit of the RNA polymerase II mediator
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30303"
FT                   /db_xref="GOA:C5E2P2"
FT                   /db_xref="InterPro:IPR008831"
FT                   /db_xref="InterPro:IPR038089"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2P2"
FT                   /protein_id="CAR30303.1"
FT                   /translation="MEDGGIPENNGVEQPVPEDIPPTRFEVELEFVQCLANVPYVIFLL
FT                   SQQHIWRDPKFRAYLKYLEYWCKPPYAQCIVYPNCLFMLKLLNGFMEAAEVNEDGLLEG
FT                   LEDLPKVLQSQGAQWMNEMVERWSS"
FT   gene            <580087..>583611
FT                   /locus_tag="KLTH0H06600g"
FT                   /old_locus_tag="KLTH-ORF1377"
FT   CDS_pept        580087..583611
FT                   /locus_tag="KLTH0H06600g"
FT                   /old_locus_tag="KLTH-ORF1377"
FT                   /product="KLTH0H06600p"
FT                   /note="highly similar to uniprot|P11154 Saccharomyces
FT                   cerevisiae YGL062W PYC1 and to YBR218C uniprot|P32327
FT                   Saccharomyces cerevisiae YBR218C PYC2 converts pyruvate to
FT                   oxaloacetate pyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30304"
FT                   /db_xref="GOA:C5E2P3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2P3"
FT                   /protein_id="CAR30304.1"
FT                   /translation="MSKLAGLRDSSNLLGEKNKLLVANRGEIPIRIFRSAHELSMKTVA
FT                   IYSHEDRLSMHRLKADEAYMIGKEGKYTPVGAYLAIDEILKIAKEHNVDFIHPGYGFLS
FT                   ENSEFAQKVEAAGITWIGPSAEVIESVGDKVSARNLAAKADVPVVPGTPGPIDSVEEAQ
FT                   AFVEEYGYPVIIKAAYGGGGRGMRVVREGDDIADAFQRATSEAKTAFGNGTCFIERFLN
FT                   KPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLA
FT                   KVAGYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLQ
FT                   ELGLLQDKIITRGFAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSI
FT                   ISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGSY
FT                   WTTFIDDTPELFKMVSSQNRAQKLLHYLADLAVNGSSIKGQMGLPKLHTQPSVPTLHDS
FT                   NGEVIDVLTTPPPSGWRQVLLEQGPAQFAKAVRHYKGTLLMDTTWRDAHQSLLATRVRT
FT                   YDLAAIAPTTAHALSGAFALECWGGATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLL
FT                   RGANGVAYSSLPDNAIDHFVEQAKENGVDIFRVFDALNDLEQLKVGVDAVKKANGVVEA
FT                   TICYSGDMLQPGKKYNLDYYLEITDKIVQMGTHILGIKDMAGTLKPSAAKLLIGSIRAK
FT                   YPDLPIHVHTHDSAGTAVASMAACAFAGADVVDVATNSMSGMTSQPSINALLASLDGEI
FT                   DTGVNVNMVRELDAYWAQMRLLYSCFEADLKGPDPEVYEHEIPGGQLTNLLFQAQQLGL
FT                   GEKWAETKRAYRDANYLLGDLVKVTPTSKVVGDLAQFMVSNKLTPDDVRRLASSLDFPD
FT                   SVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRKLTCRPGLELAPFDLAGIKEDLQDRFGD
FT                   IDECDVASYNMYPKVYEDFRKMRETYGDLSVLPTKNFLSPPTVGEEIVVTIEKGKTLII
FT                   KPQAIGELNKETGLREVYFDLNGELRKVSVIDKSQKVDTLSKPKADAHDPFQIGAPMAG
FT                   VIIEVKVHKGSLVKKGQPIAVLSAMKMEMVISSPTDGQVKDVLVKDGENVDASDLLVFL
FT                   EESVPPKE"
FT   gene            complement(<583819..>584490)
FT                   /locus_tag="KLTH0H06622g"
FT                   /old_locus_tag="KLTH-ORF1370"
FT   CDS_pept        complement(583819..584490)
FT                   /locus_tag="KLTH0H06622g"
FT                   /old_locus_tag="KLTH-ORF1370"
FT                   /product="KLTH0H06622p"
FT                   /note="similar to uniprot|P53168 Saccharomyces cerevisiae
FT                   YGL061C DUO1 Essential mitotic spindle protein required to
FT                   maintain spindle integrity and kinetochore function part of
FT                   the multisubunit DASH complex which binds microtubules and
FT                   is transferred to the kinetochore prior to mitosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30305"
FT                   /db_xref="GOA:C5E2P4"
FT                   /db_xref="InterPro:IPR013960"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2P4"
FT                   /protein_id="CAR30305.1"
FT                   /translation="MSEHAEEDSNINKLIPEIFDQMRSNLSLAPLAGGIKPFVSSKSSS
FT                   NLTTQSLLEENKCLDKIIPVIQKLNSSLSSSGPQHLKRIKETCESSNKILDAWIKIQSQ
FT                   AGYVHELMSDHSYLEYVSATQENEALTAEAFVQRKEAQVASLKRTLEEKQQLRESVKKE
FT                   QEVRSSSDVPSLPRGRRAINPRREVRGGMKKPTGIPRSSTRVSKPPLSRPPHSSVKKPS
FT                   R"
FT   gene            complement(<584893..>585477)
FT                   /locus_tag="KLTH0H06644g"
FT                   /old_locus_tag="KLTH-ORF1368"
FT   CDS_pept        complement(584893..585477)
FT                   /locus_tag="KLTH0H06644g"
FT                   /old_locus_tag="KLTH-ORF1368"
FT                   /product="KLTH0H06644p"
FT                   /note="similar to uniprot|P38316 Saccharomyces cerevisiae
FT                   YBR217W ATG12 Protein that becomes conjugated to Atg5p by
FT                   the E1 enzyme Atg7p a step that is essential for autophagy"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06644g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30306"
FT                   /db_xref="GOA:C5E2P5"
FT                   /db_xref="InterPro:IPR007242"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2P5"
FT                   /protein_id="CAR30306.1"
FT                   /translation="MSQLLESESDAASTSSTGESSRFGKASYSVQDGLEQYSKRLSFLG
FT                   LGSSDDVPALEDNSSGADASSGNIKAEPAPKRSAPVSTSAVLTHLTPAGDQAIKRFTEK
FT                   EGILPEKVQIKFQPIGSVSQVLPQSARISASQPFSVLVTFLRKKLKMNSVYCYVNNSFS
FT                   PAPQQSVGDLWRHFRVNDELVVSYCGGVAFG"
FT   gene            <586283..>588313
FT                   /locus_tag="KLTH0H06666g"
FT                   /old_locus_tag="KLTH-ORF1366"
FT   CDS_pept        586283..588313
FT                   /locus_tag="KLTH0H06666g"
FT                   /old_locus_tag="KLTH-ORF1366"
FT                   /product="KLTH0H06666p"
FT                   /note="similar to uniprot|P38315 Saccharomyces cerevisiae
FT                   YBR216C YBP1 and to uniprot|P53169 Saccharomyces cerevisiae
FT                   YGL060W YBP2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30307"
FT                   /db_xref="GOA:C5E2P6"
FT                   /db_xref="InterPro:IPR013877"
FT                   /db_xref="InterPro:IPR040347"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2P6"
FT                   /protein_id="CAR30307.1"
FT                   /translation="MEETPLFQEKLEQAFEDCKDDSISLATIMDLYAMQVSKEGAYEEQ
FT                   AKFLEAVLTNIQKDKHLIDQIGWDLPKILMRFITIQNIDLRVPLLQNRIIATTLKCFNE
FT                   IALFGNSKECFLTGCELLGSLKMNPDEQTEEEEVGEKSDVEKTGDEASAPEISLKKQEA
FT                   QIAPEVLAENIHNHNRSPEEVSLEVKFHALLELVGTTLRRIDTCYPSKFLAMAVSAIFN
FT                   FVRLNASFVDDCVFVLRRIYAFARNYMPPQPSSEALKGMSTEELVKNLDDENALQRKLL
FT                   RCLLTFSLGQMTRLKIMSSAIEYFLKLKGDFSNNLDYEQRIFMKNVISRFYQLALSFDI
FT                   DLKESFLDLCVKESKAIYKSLPSDSEIVNEAARNGITQLVYRLAYSYELQKKINEKNLS
FT                   LDPSGILVLASYHYQETGKVLCPELKIDGAIYMFLRFITPEMCGLSPKSLYIADCCNFW
FT                   LWSAVTNSSCKESRMTLQKMPSYLNMTFLQILLLRSFREPQEQLRMVSFTLLTRLLCLM
FT                   PENTSFEFAKDTLLSCPFNDLKCCILGILKDLMLNNSSGDDITAKLSKLKVSNAPEDKS
FT                   VPPLPARSFVQINDDRMATIHSLAMMSFEDSKETTDKSCLRLLLTYLNFFTGLRFKWDR
FT                   YLLKDFSKQVSEFLGSVKLEDQPEYGFIEIANQNLASFLSQ"
FT   gene            complement(<588350..>589987)
FT                   /locus_tag="KLTH0H06688g"
FT                   /old_locus_tag="KLTH-ORF1365"
FT   CDS_pept        complement(588350..589987)
FT                   /locus_tag="KLTH0H06688g"
FT                   /old_locus_tag="KLTH-ORF1365"
FT                   /product="KLTH0H06688p"
FT                   /note="some similarities with uniprot|Q01448 Saccharomyces
FT                   cerevisiae YBR215W HPC2 Highly charged basic protein
FT                   required for normal cell-cycle regulation of histone gene
FT                   transcription mutants display strong synthetic defects with
FT                   subunits of FACT a complex that allows RNA Pol II to
FT                   elongate through nucleosomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30308"
FT                   /db_xref="InterPro:IPR014840"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2P7"
FT                   /protein_id="CAR30308.1"
FT                   /translation="MELAKNRTSVRNHSPSPHGGSSIPLLSLLSGDSAIVKSDPETCQA
FT                   ALLNSARVRVSSLLSSDNSIEQERITAPKIILPTQKVATNTTTEPDTPGFLFARTSSPV
FT                   TGLLKLSNSSLNRSQSTLGPSTPPKPAPVAVKTTSLPVANSKSTTKKPASKRNTESTKK
FT                   AKTDADNKKNTPSSDAKLQKAAPARRSNKAKESKTKANEKEAKPNNIIIEDMQKLNTTP
FT                   EASKDNKSPEQENTAKAGSTQKEEKPLEPKKETKPNESKKDVKSAGPKKALKSNEPKKE
FT                   PKVSEVKKEVDAKGPPKDTKSKDSKSNAKDETKKEAKPSKRSSTATKKKDPTPQPQKKS
FT                   NDAKASQNTPKVLLPPPPLKSPSVLDPLDKGKNPDNQEEPVILIDVPLYSVESNSYMDE
FT                   NGQVVFNFCKLVHDEFGQSSKAKRNLASELQGGEEEDEDAIEVEDDDGVEEDDDDEMDL
FT                   DDKAPPSAASVASPKKKSHPMKGRSLIGKYDIEDPFIDDSELLWEEQRVATKDGFFVYF
FT                   GPLIEKGQYASFERVNGTMKRGGIKYSK"
FT   gene            <590346..>591830
FT                   /locus_tag="KLTH0H06710g"
FT                   /old_locus_tag="KLTH-ORF1363"
FT   CDS_pept        590346..591830
FT                   /locus_tag="KLTH0H06710g"
FT                   /old_locus_tag="KLTH-ORF1363"
FT                   /product="KLTH0H06710p"
FT                   /note="similar to uniprot|P53170 Saccharomyces cerevisiae
FT                   YGL059W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30309"
FT                   /db_xref="GOA:C5E2P8"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="InterPro:IPR036784"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039028"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2P8"
FT                   /protein_id="CAR30309.1"
FT                   /translation="MYKVKSKSTSGLKVKLAHRWKSQSQTQSSHISQIPEFSKYSPTKS
FT                   ISELAPYVSPTLCAYPLRSKYVNQQHYYQNQNILEKHYLTKKPHPVSLMQLAQYFDDST
FT                   ALTKQKIVNSGNFVKQELVTRIAHKIHMLQMLPFDVVNNFHFCQVYESYYNIFERFRRY
FT                   PAIKTIEDNEKFAEFLHTILSDFNSLNLPHLIMGALECRILDLYPPEKMDEVISSLLRA
FT                   RISRRLIVEEHLSITSNYHSGKKENTLVLGDIFQECSAKEFLLGAKSMCERFIQDMYFK
FT                   GIKLPAFNIDGNTELKFLFLPLHLKYLLGEVLRNSYEATMLEYIRLGLQEPEPITVTIV
FT                   SNESSFIFRISDRAGGIPHDEKTIWSFGKSKELARQSLSNFHKLPGLQTISLYDSVNGK
FT                   GLTRSVDHPYKYTSLEPINASNLPSGLHKFEKPLLGLLERSSRYKLGIGLAMCKVYAEY
FT                   WNGTLTVHSIPGYGTDTILKLGNLMYHTGKLQLDKV"
FT   gene            <592074..>592641
FT                   /locus_tag="KLTH0H06732g"
FT                   /old_locus_tag="Klth0H.mRNA.gf.445.p"
FT   CDS_pept        join(592074..592115,592201..592641)
FT                   /locus_tag="KLTH0H06732g"
FT                   /old_locus_tag="Klth0H.mRNA.gf.445.p"
FT                   /product="KLTH0H06732p"
FT                   /note="highly similar to uniprot|P06104 Saccharomyces
FT                   cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme (E2)
FT                   involved in postreplication repair (with Rad18p)
FT                   sporulation telomere silencing and ubiquitin-mediated N-
FT                   end rule protein degradation (with Ubr1p)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30310"
FT                   /db_xref="GOA:C5E2P9"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2P9"
FT                   /protein_id="CAR30310.1"
FT                   /translation="MSTPARRRLMRDFKDAPPGVSASPLPDNVMVWNAMIIGPAETPYE
FT                   DGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTS
FT                   IQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVEKSWEDDLEDMDDEDEDDE"
FT   gene            complement(<592757..>593665)
FT                   /locus_tag="KLTH0H06754g"
FT                   /old_locus_tag="KLTH-ORF1361"
FT   CDS_pept        complement(592757..593665)
FT                   /locus_tag="KLTH0H06754g"
FT                   /old_locus_tag="KLTH-ORF1361"
FT                   /product="KLTH0H06754p"
FT                   /note="some similarities with uniprot|P53171 Saccharomyces
FT                   cerevisiae YGL057C Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30311"
FT                   /db_xref="GOA:C5E2Q0"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E2Q0"
FT                   /protein_id="CAR30311.1"
FT                   /translation="MLSQYLRKHHLLSRRHQFMRCASQSRSPPRSLLQRQAKRRGEAEA
FT                   VAPSQLIVTSLKDIFSTFQPSGFTQEDDELEAVKQREDAMQRLENGELRELLLHKFGAR
FT                   RIPSTTETGNSVGDLRIPPRNINQAFHNLTTQERELIEVFQSLGTPSMNWRDVPLVSKQ
FT                   LQFYISFGSYGPREGITFLGSKPEDFIWSKTSRRLLPGQTVRKLPKDATTNTWTCIPSR
FT                   KANFERMKKGLDPGTRIIAWLGILIVMIASVRDYKQRRDSEATVKVSEFTEQETSEPQA
FT                   AQQDTAPISKTPKSWYQFWKS"
FT   gene            complement(<594214..>595629)
FT                   /locus_tag="KLTH0H06776g"
FT                   /old_locus_tag="KLTH-ORF1360"
FT   CDS_pept        complement(594214..595629)
FT                   /locus_tag="KLTH0H06776g"
FT                   /old_locus_tag="KLTH-ORF1360"
FT                   /product="KLTH0H06776p"
FT                   /note="similar to uniprot|P53172 Saccharomyces cerevisiae
FT                   YGL056C SDS23 Spindle pole body protein and similar to
FT                   YBR214W uniprot|P38314 Saccharomyces cerevisiae YBR214W
FT                   SDS24 Nuclear protein with similarity to S. pombe Sds23,
FT                   suppresses dis2 mutations"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30312"
FT                   /db_xref="GOA:C5E2Q1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR016711"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Q1"
FT                   /protein_id="CAR30312.1"
FT                   /translation="MKDISSQPPSNSNNSRHASIVEMLSTPPAIPQQPPSNVELEAISL
FT                   SRTGSSASLDSQMSATTSCLTKVHTQKWQHIPLSQLIEQNKLIFVDAAISVEEAFNTLV
FT                   RHNLTSVPVEQFPGDMNCFTFDYNDLNSYLLLVLNKIQVNDPQVARDCQMGKPVPVGKI
FT                   VKLTPKNQFHKLREVDNLTTAMSLLGSGVHRVAITDPASTQIRGVLSQRRLTKYLWDNA
FT                   RQFSNLQPLLNSSLKELGIGVLNSHTAPTSRQSRVISIQGEEQLIMALFKMHTERISSI
FT                   AVVDHQGNLLGNISVTDVKHVTRTSQYPLLHNTCRHFISVILNSRGLEMGKDSFPIFHV
FT                   YPSSSLARTLAKLVATKAHRLWIVQPENSGSSASSSSLAAPSPQSIPISTQASSSSDHE
FT                   NSGRSGSPISVKSLEESSPTTSTPLFEKEYRTGKLIGVVSLTDILGLLARRQTEHTQVD
FT                   PQAARRQRGSVGV"
FT   gene            <596966..>598432
FT                   /locus_tag="KLTH0H06798g"
FT                   /old_locus_tag="KLTH-ORF1354"
FT   CDS_pept        596966..598432
FT                   /locus_tag="KLTH0H06798g"
FT                   /old_locus_tag="KLTH-ORF1354"
FT                   /product="KLTH0H06798p"
FT                   /note="uniprot|P79047 Delta 9-fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30313"
FT                   /db_xref="GOA:C5E2Q2"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001522"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Q2"
FT                   /protein_id="CAR30313.1"
FT                   /translation="MADTKADKMEQVDLVKANILAAGANKESVRVVNGLGSLMGSKNMV
FT                   NVDFDKDSNMDYLLRKDQEEKDRYKNSKHISEQPWTIHNWHQHLNWLNMVLVVGIPLAG
FT                   WYFALSGKVPLHMNVLLFSIAYYVLGGVSITAGYHRLWSHRAYSARWPLRLFFAIFGAA
FT                   SVEGSIKWWGHSHRIHHRYTDTVRDPYDARRGLWYSHMGWMLLQPNPKYRARADIADLT
FT                   DDWIVRFQHRHYIPIMAFSAFILPALLCKYLFNDFIGGLVYGGVLRVFAIQQATFCINS
FT                   LAHYLGDQPFDDRRTPRDNWITALVTFGEGYHNFHHEFPTDYRNAIKWYQYDPTKVFIF
FT                   LSSLVGLSFNLKKFSQNAIQQGLVQQQQKKIDRQRSHLNWGTPLTQLPVWDKQQFMENI
FT                   KTNPGLVIISGIVHDVSNYITEHPGGETLIQAALGKDATKAFNGGVYLHSNAAHNVLAT
FT                   MRVAVVKEGVDAAAKFAARRGESLEGKKLI"
FT   gene            complement(<598604..>599494)
FT                   /locus_tag="KLTH0H06820g"
FT                   /old_locus_tag="KLTH-ORF1350"
FT   CDS_pept        complement(598604..599494)
FT                   /locus_tag="KLTH0H06820g"
FT                   /old_locus_tag="KLTH-ORF1350"
FT                   /product="KLTH0H06820p"
FT                   /note="similar to uniprot|P15807 Saccharomyces cerevisiae
FT                   YBR213W MET8 Bifunctional dehydrogenase and ferrochelatase
FT                   involved in the biosynthesis of siroheme also involved in
FT                   the expression of PAPS reductase and sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30314"
FT                   /db_xref="GOA:C5E2Q3"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028162"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Q3"
FT                   /protein_id="CAR30314.1"
FT                   /translation="MLSLQLAHQLSGKHILLVGAGEVAMTRIPKLLPTGCKLTVIAPEI
FT                   HGDMWKHFDVPEDNDTVEHTDEHWSPEKNKIFQIFRRGFRNTDIVLHGNGLTDNADAQS
FT                   FLNGELDPIESYDHNKASGWHMIMTCIPDPVLSEKIYRGAKLVLGQHVLCNVADNPPLC
FT                   DFYFGSNVTLGKGGKPIQIMLSSNGNSPRFTALLKNEIERQFGDLPIGESVAKLGQLRA
FT                   RIRKISEERCPASLSKPELIKYRMEWIRNCTDAFGVSHCHEINVDKTVTLFEDMFASMS
FT                   LEQPDNEKYMKEYLE"
FT   gene            complement(<600623..>602266)
FT                   /locus_tag="KLTH0H06842g"
FT                   /old_locus_tag="KLTH-ORF1345"
FT   CDS_pept        complement(600623..602266)
FT                   /locus_tag="KLTH0H06842g"
FT                   /old_locus_tag="KLTH-ORF1345"
FT                   /product="KLTH0H06842p"
FT                   /note="some similarities with uniprot|P32831 Saccharomyces
FT                   cerevisiae YBR212W NGR1 negative growth regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30315"
FT                   /db_xref="GOA:C5E2Q4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Q4"
FT                   /protein_id="CAR30315.1"
FT                   /translation="MGDLDPSFDEATIQRIWAHLGKRVSVKLIRAKKNLLIPCSTSSTF
FT                   SDTQPQAPAPEGSGALRAPDADGAGRKIHINGVSFIDPNTTQLHHAGYCFVEFESLADA
FT                   QWALTLNSTPLPDITCPGPAAADMASPAGSPAAGPDASSPLRTNPTGLRNFRLNWASGA
FT                   TLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFV
FT                   RFGDEQERRRALVEMNGVWCQGRNLRVAYATPRNNVMWQLTQPQHQQRQPQHHQHQHQH
FT                   QQQQQQQQQQQQQLHHQQHQQHQQHHHIQNHLSQYHQHYQSMSQNNFQLASPEYTQAPL
FT                   LMRTASSLVGNNLINFPATDFVSGSDAPYMGVPSMPPSLAHASAAASGAASAPAPGRSP
FT                   FTNPNNTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAYRIDAEAAI
FT                   QGMQGFIVGGNPIRLSWGRTSTDTSRHPAMQDMPSSLRNVASQRGPQVWNSATAPTPTT
FT                   AVSMFASPHIQRQDSVTQAGSVPPVHPSLL"
FT   gene            <604465..>605523
FT                   /locus_tag="KLTH0H06864g"
FT                   /old_locus_tag="KLTH-ORF1328"
FT   CDS_pept        604465..605523
FT                   /locus_tag="KLTH0H06864g"
FT                   /old_locus_tag="KLTH-ORF1328"
FT                   /product="KLTH0H06864p"
FT                   /note="some similarities with uniprot|P38313 Saccharomyces
FT                   cerevisiae YBR211C AME1 associated with microtubules and
FT                   essential regulator of microtubule stability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30316"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Q5"
FT                   /protein_id="CAR30316.1"
FT                   /translation="MSTKRISPFHKRARSGAMLMDRDVKLLYRQRGSALRRTGQSIVIS
FT                   QAKRPKHSGRAVRERERDVAAAPGPAVGEQPSSPPPLISDGFLGSPAHELTREPTQLPH
FT                   SPPAPLSPSPLVPLPALDADLDADLGAGLDEDLNADLGASPGVAGHAEAAPLLPAPQFS
FT                   FSDVPLSRLHSNTVSLSSIEVVASLINSLFEEQLVPQCFAEFDTAATPEDRLMHKLDIK
FT                   LYSTFVQAVLADLRDLLDINVSNNELLTQLKQTIKRKSALTQTLLDVRHETADWEANAG
FT                   ADEQLEELRQKSAVNAKLQALAQDVRTASADASAPPDADHALDDLTAVLDPYNGVLAQL
FT                   QTFNQSLEKLLE"
FT   gene            complement(<605628..>606035)
FT                   /locus_tag="KLTH0H06886g"
FT                   /old_locus_tag="KLTH-ORF1322"
FT   CDS_pept        complement(605628..606035)
FT                   /locus_tag="KLTH0H06886g"
FT                   /old_locus_tag="KLTH-ORF1322"
FT                   /product="KLTH0H06886p"
FT                   /note="similar to uniprot|P53173 Saccharomyces cerevisiae
FT                   YGL054C ERV14 Protein localized to COPII-coated vesicles
FT                   involved in vesicle formation and incorporation of specific
FT                   secretory cargo required for the delivery of bud- site
FT                   selection protein Axl2p to cell surface related to
FT                   Drosophila cornichon"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30317"
FT                   /db_xref="GOA:C5E2Q6"
FT                   /db_xref="InterPro:IPR003377"
FT                   /db_xref="InterPro:IPR033466"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Q6"
FT                   /protein_id="CAR30317.1"
FT                   /translation="MAVWLFVLALVLNCINLFAQVHFTILYADLEADYINPIELCSKVN
FT                   KLITPEAALHAFISISCLLTGHWFVFLINLPLLAFNANKHYKKMQLLDATEIFRTLGKH
FT                   KKESFLKLGFYLLMFFFYLYRMIMALIAEAD"
FT   gene            complement(<606394..>606465)
FT                   /locus_tag="KLTH0H06908r"
FT                   /old_locus_tag="Klth0H.tGlu_TTC_33"
FT   tRNA            complement(606394..606465)
FT                   /locus_tag="KLTH0H06908r"
FT                   /old_locus_tag="Klth0H.tGlu_TTC_33"
FT                   /note="tRNA-Glu (TTC) cove score=62.09"
FT   gene            complement(<608218..>609003)
FT                   /locus_tag="KLTH0H06930g"
FT                   /old_locus_tag="KLTH-ORF1318"
FT   CDS_pept        complement(608218..609003)
FT                   /locus_tag="KLTH0H06930g"
FT                   /old_locus_tag="KLTH-ORF1318"
FT                   /product="KLTH0H06930p"
FT                   /note="similar to uniprot|Q05905 Saccharomyces cerevisiae
FT                   YLR301W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30318"
FT                   /db_xref="GOA:C5E2Q7"
FT                   /db_xref="InterPro:IPR031818"
FT                   /db_xref="InterPro:IPR038744"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E2Q7"
FT                   /protein_id="CAR30318.1"
FT                   /translation="MCSEHPLAVKWQSKIIAMVSLNKRCTFQVGENPADERTLTLSSAS
FT                   NGGYYISLRPFVEPKGSESELPYEWAFAGSPKSLEAKKVDELRDDINFNFDFDTNVHLN
FT                   AENTHRGVVETHWKKWESGLVEERGQVFPFGPDKQAVSFFELWQPIDATRDEFVHISEK
FT                   SVDQSAARSVVLALDDDNYRGLVITVGKWTQGILFKKAEHTAKGINFLRACESADGKIT
FT                   TLLKYGVDFDRFPSTFVGQKDAELQGAAGAFWKVVESNL"
FT   gene            complement(<609143..>613222)
FT                   /locus_tag="KLTH0H06952g"
FT                   /old_locus_tag="KLTH-ORF1316"
FT   CDS_pept        complement(609143..613222)
FT                   /locus_tag="KLTH0H06952g"
FT                   /old_locus_tag="KLTH-ORF1316"
FT                   /product="KLTH0H06952p"
FT                   /note="weakly similar to uniprot|Q08562 Saccharomyces
FT                   cerevisiae YOR191W RIS1 Member of the SWI/SNF family of
FT                   DNA-dependent ATPases plays a role in antagonizing
FT                   silencing during mating-type switching contains an N-
FT                   terminal domain that interacts with Sir4p and a C-terminal
FT                   SNF2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30319"
FT                   /db_xref="GOA:C5E2Q8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Q8"
FT                   /protein_id="CAR30319.1"
FT                   /translation="MEDQHAEVQTSVRPVPSIDLTQDDSNPNEATLENIENHESQASPR
FT                   AAVQRSIRLQSLDSSPLKFTGQNFTTQPTTGKQGFFVPLNKTGNSNGTHSDPLNVDHKK
FT                   PSRFTSASREASLQSPAFESGGDSVIPEKGSLSGAGNLLSEHSFKKRKIEEDEGRPDTS
FT                   LQNIRDFIDPSKSRYFPGKALNEGGSLASPENTPGDQHNSQGPEIYNGPPTFKQPSSDF
FT                   SHDEDAFFSFDDKSNADQKPATPPSLTHNSDLKDNKPMDGALSPPLGQNHEINHNQNAP
FT                   IIILSDEEEDAISHKSTELVSTKAESSRKVSNEDVKHFRSLHERNMKEQAETEKHMLSL
FT                   RNTCRDTKVILKRKLQKRDALINEVQSKLDILSRTSSVSGEEDVALLQEELSSLKERRS
FT                   QTMVKLRKVENKESLIVDQHAKFVARLEPKLRESYTNLQNAINNYRQTRMVEKRAVLMS
FT                   EKSQLDSLFSNGNIDPSEYQQRLRFLNNALNDLHSTQSAPNTEPHVSDIFFKSIGVARD
FT                   LILKNTVRSDQNKMLMNKYLDVVENFKRSCDKGVRYNLHTKMQVEKAITDLFRHGVKMP
FT                   AVSKSLKSMGFIVNPEDYDAVRSSAHQRSNDDFMEVSHGKGEDDDILEIVRSQEEQSLA
FT                   HSNPLHLSNIYNMHDNDSLHDLLEGLKTAETEIEGEELTPPELTVNLMKHQRQGLHWLL
FT                   SVEKSQKKGGLLADDMGLGKTVQAIALMLANKSNTDKCKTNLVVAPVAVLRVWQAEVRT
FT                   KVKKTCGLKVLIYGGSNGAKVENYRSLLRHDVVLVSYQTLASELKKHWPAKLEQDAEGG
FT                   NIADIPDIKAMNSLKERKEYWSPFFCDESVFYRIILDEAQNIKNKKTQSAKACCALNST
FT                   YRWALSGTPMQNNIMELYSLLRFLKISPYNREQKFKLDIGNPLGRSSNDYDSHDRKQAI
FT                   KKVQVLLRAIMLRRTKDSKIDGKPILELPDKIIKPMEETLQGLELTFYTELEAKNQKKA
FT                   EKLMKNRSKGSYSNILTLLLRLRQACCHPELVILGEHKSESSKVANGKNFQNDWLRLFE
FT                   LARNMPAAGKETVAEGLENMICPYCMEQMELESSVVITPCGHMLCEGCSQQYFEDARGQ
FT                   QNARKVVNSGYLVPCLVCERYVNDSEIITYKLYDQAVNQNLTAEGLKREFRSEMEAQKD
FT                   RLKNGYKINFETLEPSQKIKQCLDIVRNVFANSRDEKIIIFSQFTTFFDLLQHFIRKEL
FT                   GVQYLRYDGSMDAQSRAATIEGFYRNNERRLLLISMKAGNAGLTLTCANHVILVDPFWN
FT                   PFVEEQAMDRCYRISQTREVQVHRLLIKDSVEDRILELQKKKRELVESAMDPNKIQEVN
FT                   RLGRQELGFLFGLNSL"
FT   gene            complement(<613530..>614858)
FT                   /locus_tag="KLTH0H06974g"
FT                   /old_locus_tag="KLTH-ORF1313"
FT   CDS_pept        complement(613530..614858)
FT                   /locus_tag="KLTH0H06974g"
FT                   /old_locus_tag="KLTH-ORF1313"
FT                   /product="KLTH0H06974p"
FT                   /note="highly similar to uniprot|P23776 YLR300W
FT                   Saccharomyces cerevisiae EXG1 Major exo-1 3-beta-glucanase
FT                   of the cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30320"
FT                   /db_xref="GOA:C5E2Q9"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Q9"
FT                   /protein_id="CAR30320.1"
FT                   /translation="MLALTWVYTLSVAVCAALAQPVPAKGPHSVQFMHEQNKKRFYDYS
FT                   SATIRGVNIGGWFVLEPFITPSLFEVFRTIDNNDEGIPADEYHYCQALGQEVAASRLEQ
FT                   HWSSWFTEKDFANIADSGLNFVRIPIGYWAFKTLESDPYVTGKQEYYLDQAIGWARNNG
FT                   LKVWVDLHGAAGSQNGFDNSGLRDSYAFLEDSNLALTKEVLQYLLEKYSRDEYLDTVIG
FT                   VELINEPLGPVLDMDKLKEYYQFGYDYLRNELGRDQIVIIHDAFEPYNYWDDTLVYNQG
FT                   AWGVVVDHHHYQVFSNKELLRSIDEHVSVACEWGSGTLSEAHWTVCGEWSAALTDCAKW
FT                   LNGVGYGHRYDGTFHKGDDTSSYIGSCENNEDINSWSDERKADTRKYVEAQLDAFELRG
FT                   GWVIWTYKTETSLEWDLQRLMFNGLFPQPVTDRQYPNQCGFSN"
FT   gene            complement(<616972..>617355)
FT                   /locus_tag="KLTH0H06996g"
FT                   /old_locus_tag="KLTH-ORF1306"
FT   CDS_pept        complement(616972..617355)
FT                   /locus_tag="KLTH0H06996g"
FT                   /old_locus_tag="KLTH-ORF1306"
FT                   /product="KLTH0H06996p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30321"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2R0"
FT                   /protein_id="CAR30321.1"
FT                   /translation="MSQETQESKLDSKQLPKEEPEPEVPVNYPALQWQKVESSIPVHTF
FT                   TNYKLKLNGYVRKDKMRVEEPEDEPTSTTNNAEGHDVEHTSEHESESEAKNDDVRDHNT
FT                   EERAGSADGEPETKSEEAQKESA"
FT   gene            complement(<618189..>621167)
FT                   /locus_tag="KLTH0H07018g"
FT                   /old_locus_tag="KLTH-ORF1305"
FT   CDS_pept        complement(618189..621167)
FT                   /locus_tag="KLTH0H07018g"
FT                   /old_locus_tag="KLTH-ORF1305"
FT                   /product="KLTH0H07018p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2R1"
FT                   /protein_id="CAR30322.1"
FT                   /translation="MQHETLESGSPPISYLKDLKNGNEVLIVEGDIVHLYRTKDSSFDT
FT                   SRVTELKNSALHLSFRLVNPKSDFFLVLAFDLSITVFDIPGFKKVAKKRLKINEQDVDP
FT                   RKTLRFLDSDSEQLYFSLSEKQLVSINKSDLLSESPFAKFISVHDTPYRIENAFCLNPN
FT                   KGFFCLAKRDLIQNVLAFEVIHANTFRHRNNHSRYDRLLQEYTAAMDCGSSGELGTLVE
FT                   MITLEVPKTVVFLFSRGVIIFNNKVCVFENKYDENTRESLCLDGLIPGASLYQGEEGLR
FT                   LSILSTKGETISTTIDLRKPKSLQWNSVTLNSFLKKPLDSMLCYKCLGHGQILLISKRE
FT                   GMVFADYQKERILYISRYKRPTYLDALPLDFGFAQVTTVVACGGYNSTLGFVSFFQKSV
FT                   SANTFKVIEFKHFGTTRAIRDFWFTTKGIVSASSIRGSDKFLLHVSFHNKTLTRPSTRC
FT                   ALQLKNVGDEYIILDNELDLYLVKGKTTFKLASMAKFSSWNVCYMSAFQGSGSSSSLFI
FT                   AISDGKDVYMLENGVIVAEYSFEDANINDICLKDCSSSKGTVLIVTNRAGCVTILNFSF
FT                   ETHSLSISLQVCLGENRAFRLCDIKMVESGTTEHQDSAFFVYSSSKVFVFNLSRRCFYK
FT                   WIPKFDIKLIKYQGNSKYVVLTMDDSFVTLTYSGALSAEWTTEELVSKDWVYTKMVQLR
FT                   NPRYILLASQTTNFKSKVSIFDTESLNTIDEYILPDQGVIKGVITLEKPYAQEILISFA
FT                   GCSPESDCLLVLSALRNKLFKSGTYKTRGASAALTQRGETIACLGTTVLLFKLQRCLKK
FT                   RVWDFKLLMRPFEGSGPWSVDCAFVSEEILCVLDRAKGICFFDLATKTPSLKCSIQSLA
FT                   PDFANDRGHFDLLFSTLIEDTKQSEFYKINGPRTAKIRPLLDPIEKTARQLSIVVACGS
FT                   QLLVYPCHPRYFKNSQNHSKCKLPCASGRIPFEDVVMSTRRTDANQFLVCTTGRLLITS
FT                   LNT"
FT   gene            complement(<621645..>625103)
FT                   /locus_tag="KLTH0H07040g"
FT                   /old_locus_tag="KLTH-ORF1303"
FT   CDS_pept        complement(621645..625103)
FT                   /locus_tag="KLTH0H07040g"
FT                   /old_locus_tag="KLTH-ORF1303"
FT                   /product="KLTH0H07040p"
FT                   /note="similar to uniprot|P21339 Saccharomyces cerevisiae
FT                   YOR188W MSB1 Protein involved in positive regulation of
FT                   both 1 3-beta-glucan synthesis and the Pkc1p- MAPK pathway
FT                   potential Cdc28p substrate multicopy suppressor of
FT                   temperature-sensitive mutations in CDC24 and CDC42 and of
FT                   mutations in BEM4"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30323"
FT                   /db_xref="InterPro:IPR012965"
FT                   /db_xref="InterPro:IPR037508"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2R2"
FT                   /protein_id="CAR30323.1"
FT                   /translation="MESLKPLPSPPSNPKAAEPTGRKGRLHSAADEDEEFEFFHEFSRD
FT                   KVKGLIHLITQELKTNAIGIEFLFLPFRPEQSNEKLLRFLNQVFPLGNGVPVNETKQSR
FT                   IISKTEPWTLFQALKYVWCRLPEGQVITWKAYEAFRVREQSDGYRSRSFLELMPKCLSS
FT                   PDHASIVYDFFDLIVTASSNSKHNKMSARKISKMFGIWAFRSKVENSPYDFGEPTPEIE
FT                   KKNSFSEGIEQWIPASDAMFHLLLAFIRSFISNDLKDANIPTSLKTILFNSTYPPKGST
FT                   AYDSETILTVPIVSLKTTEFSKKPWQLIERCNELFDFSNYDAFEAREDYALLKSLFKRK
FT                   KNIDGISHKMSKESRRIMKEISTKHSTFQAGWASQKCVPSDDGMKRLETHLEMGRVDID
FT                   DYFIWAWLSTLSHEQTSDKKKLFGRSLILEFEFDGFKKWVIIEECDLSLELKKHEKVDS
FT                   LEYLKPRDNRDQVHEHQNRSITPAYEKFQHNVENESIPQNKDPLVPFLQSDKLKAEEGI
FT                   SPPHVQDRRHQRSVPKWNPLKSIRKKSSGSSSSNSPLPQAASEQNKASKGYKNKELPPS
FT                   PPHEQASTRGSRNDSRVLSQFSMLNPENYKLPAIEHDDFKIEIPDIEEDSIALDPEDEA
FT                   HHTAPIQKDNISLPSTNNGIEDLNEMVDELSKQVRNLRTKGNQSPKSLATNAETFETLT
FT                   MFERYRDLPKNSTDTLAGSTNSSTVPPLQLDSPRTEKLPGTFPTESPIRRSPQQSFDSH
FT                   KELKSYQLNQASQVTQADEPNQANQVHQVSPIVFPIDYSQVARAEVSPIRSRGNSPVRK
FT                   APYPQQEFGVNNAKFEKPIPETRSPTPPPSQSYIHYEKHMPTNESRGEVNRDFAHRAAN
FT                   RIENKDNIKYSSHEASSYPAPTQVQTPEGAQVAFSGHNAHGYHSQPFAHYPDQSAVPIE
FT                   GYTNLPVSRPEHSNNQAKALNGGPPLSSNGNRYSYYQAPYGYPQVAHHSGTTASYEIQE
FT                   SSHPPHYPYNPANVAGSQPHRLVTQRPSHPAQQTFSKAYNNQHQSPSSNIHPRFPPQHA
FT                   RQHPHTRVIPQAGASPQPPQVMRSYASPQMAYAPTAQGPAPTSFVASPGTNPAYYGPVH
FT                   SPPGPQSAPFIPGVPVGGKLHGAYAKKREDRKKLHDTIKNGTFGI"
FT   gene            complement(<625250..>627079)
FT                   /locus_tag="KLTH0H07062g"
FT                   /old_locus_tag="KLTH-ORF1300"
FT   CDS_pept        complement(625250..627079)
FT                   /locus_tag="KLTH0H07062g"
FT                   /old_locus_tag="KLTH-ORF1300"
FT                   /product="KLTH0H07062p"
FT                   /note="similar to uniprot|Q05902 Saccharomyces cerevisiae
FT                   YLR299W ECM38 Gamma-glutamyltranspeptidase major
FT                   glutathione-degrading enzyme expression induced mainly by
FT                   nitrogen starvation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30324"
FT                   /db_xref="GOA:C5E2R3"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2R3"
FT                   /protein_id="CAR30324.1"
FT                   /translation="MRLAAVLTLLLETAVCMQHFFVESPDHNIDIKPLPRHPTLSPNSS
FT                   QVLRTGRYGAASSDSEHCNKIAVEQVLKKFDGANAADAAVSVALCLGMKNFFSSGIGGG
FT                   GYAVFVGKDQMSGETDSLFIDFREQAPALAHKNMFSQSPNASQIGGLAIAVPGELRGIY
FT                   ELFVKKGSGKVEWRDLLQPIIELGSNGWEVDEITAACLKIYEPYFVQHKKDWAFVLNEG
FT                   QSRVLKTGESIKRPALSDTLKELASNGTVAPFYDPNHRIGRSMLRKIKESGGIITGNDL
FT                   KSYYVNTSKPLYTKIRSGWQYFPNNDLEVFTSGGSSSGAALLSALKILDEFPAKKGGDF
FT                   QPEQVYVLVECMKWMSSARSRLGGFSDPHELPQRILEVLDSNWTQNSVRLINDHLPGLK
FT                   TLSNWTEYNPAYALTDPHGTTHFGVVDKFGNAVSFTSTVNLLCGSLVHDIETGVIFNNQ
FT                   MDDFSQPGRSNAFELAPSIYNFIEPGKRPLSSASPVVILDELGKPDLVIGASGGSRITP
FT                   SIFQVITRLYWYEMPLLEAIAYPRVHHQLLPDVLEVESFPMLGKDTLEALKSMGHNLLE
FT                   QAPKSVVNGIKRHRGEWHAVSDYWRKRGLSVAY"
FT   gene            complement(<627335..>628615)
FT                   /locus_tag="KLTH0H07084g"
FT                   /old_locus_tag="KLTH-ORF1299"
FT   CDS_pept        complement(627335..628615)
FT                   /locus_tag="KLTH0H07084g"
FT                   /old_locus_tag="KLTH-ORF1299"
FT                   /product="KLTH0H07084p"
FT                   /note="highly similar to uniprot|P02992 Saccharomyces
FT                   cerevisiae YOR187W TUF1 Mitochondrial translation
FT                   elongation factor Tu comprises both GTPase and guanine
FT                   nucleotide exchange factor activities while these
FT                   activities are found in separate proteins in S. pombe and
FT                   humans"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30325"
FT                   /db_xref="GOA:C5E2R4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2R4"
FT                   /protein_id="CAR30325.1"
FT                   /translation="MFLVPRAFSLIARPATRSFASTALRSYAAAFDRTKPHLNIGTIGH
FT                   VDHGKTTLTAAITKTLAVKGGADFLDYAAIDKAPEERARGITISTAHVEYETDKRHYSH
FT                   VDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQDIVVFVNKV
FT                   DTVDDEEMLELVEMEMRELLTQYGFDGDNTPVVMGSALCALEGKRPEIGEQAIMKLLDA
FT                   VDEHIPTPQRDLEKPFLMPVEDIFSISGRGTVVTGRVERGNFKKGEEVEIVGHNAQPLK
FT                   TTVTGIEMFRKELDKAMAGDNAGILLRGVRRDQLKRGMVLAKPGTVKAHTKFLASLYIL
FT                   SKEEGGRHSGFGENYRPQMFVRTADVTVVLKFPEAVEDHSMQVMPGDNVEMECELVHPT
FT                   PLEAGQRFNIREGGKTVGTGLVTRIIE"
FT   gene            <628865..>629506
FT                   /locus_tag="KLTH0H07106g"
FT                   /old_locus_tag="KLTH-ORF1296"
FT   CDS_pept        628865..629506
FT                   /locus_tag="KLTH0H07106g"
FT                   /old_locus_tag="KLTH-ORF1296"
FT                   /product="KLTH0H07106p"
FT                   /note="some similarities with uniprot|Q05900 Saccharomyces
FT                   cerevisiae YLR298C YHC1 U1 snRNP protein required for pre-
FT                   mRNA splicing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30326"
FT                   /db_xref="GOA:C5E2R5"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013085"
FT                   /db_xref="InterPro:IPR017340"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2R5"
FT                   /protein_id="CAR30326.1"
FT                   /translation="MPRFCDYCHSYLTHDTPSVRKSHLLGKNHVKLAADYYCNKARQTE
FT                   KPIFEKSRSAKKNRKRARSPRGQEPERRWTLHCDTNRQKRQSHRAALAQQDLAPISVLE
FT                   KLYRHSPAYAKVFVSECRLDTGQSVRLERLPQRANKRPQRTAAADPQKPTRDTLYKPDY
FT                   SDAGKIPSAVLLPPPPSLARWPACPPLQLASDRAATATVQHVTRKLEARR"
FT   gene            complement(<630668..>632062)
FT                   /locus_tag="KLTH0H07128g"
FT                   /old_locus_tag="KLTH-ORF1286"
FT   CDS_pept        complement(630668..632062)
FT                   /locus_tag="KLTH0H07128g"
FT                   /old_locus_tag="KLTH-ORF1286"
FT                   /product="KLTH0H07128p"
FT                   /note="some similarities with uniprot|P38960 Saccharomyces
FT                   cerevisiae YDR082W STN1 Protein involved in telomere length
FT                   regulation functions in telomere metabolism during late S
FT                   phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30327"
FT                   /db_xref="GOA:C5E2R6"
FT                   /db_xref="InterPro:IPR018856"
FT                   /db_xref="InterPro:IPR024263"
FT                   /db_xref="InterPro:IPR038240"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2R6"
FT                   /protein_id="CAR30327.1"
FT                   /translation="MANWDHVVYRNKDVDYYVPSLFHLSPTFQTTVPCLVCDLSYHFKR
FT                   SKIITQKYYAGEPDAWLYGNYPIGSVEVLGCVAGWKWKLIGECDNAMFKLDDSTREPRG
FT                   PPTLLSVKCSKGVVLRSGLPLGDLSGWTLKLAGQMNRFGELDVQSVRICSELQDEIEFW
FT                   KRAMKWRRELSVPWTVEKAVLDRVCAPAGNAPPSSYNFIQWLEQQHYQREMKIADDYSE
FT                   GPREIVLPFKHVSQDMVLGDQEAESEPHTGRHEQTQARSPEMHERSRAPELVETIDQAA
FT                   GPRASVHDYVRHVLDHLLTQNRVEVSTLNTFRSPGPLRVLRRVAAQRARRQARPVDEVA
FT                   SSLFADVLQRLARAGLISVFAQGRILNLRVLKNCDDYVTQRIAALVELRSYTGKIDFRR
FT                   ACDLLGLARSAPLERLLVDLHKRALRRLAAASDTPLQSWWIELAGPAAAFVHFEYHHDP
FT                   SSLAPG"
FT   gene            <632257..>632700
FT                   /locus_tag="KLTH0H07150g"
FT                   /old_locus_tag="KLTH-ORF1283"
FT   CDS_pept        632257..632700
FT                   /locus_tag="KLTH0H07150g"
FT                   /old_locus_tag="KLTH-ORF1283"
FT                   /product="KLTH0H07150p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30328"
FT                   /db_xref="GOA:C5E2R7"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2R7"
FT                   /protein_id="CAR30328.1"
FT                   /translation="MSNSKPPVTCHILDTTSGKPAQDVTCSIYFVRTTAESFGFEVSET
FT                   QPFAAARTNEDGRIGAWIFAPEPSKRPFLKELGIYEENSTLVWKSLVPGTYKIRFQTSR
FT                   YFERQKKTCFFPFVEIFFEVSDSRHYHIPLLLSNYAYSTYRGS"
FT   gene            <633266..>635656
FT                   /locus_tag="KLTH0H07172g"
FT                   /old_locus_tag="KLTH-ORF1281"
FT   CDS_pept        633266..635656
FT                   /locus_tag="KLTH0H07172g"
FT                   /old_locus_tag="KLTH-ORF1281"
FT                   /product="KLTH0H07172p"
FT                   /note="some similarities with uniprot|P32896 Saccharomyces
FT                   cerevisiae YDR081C PDC2 Transcription factor required for
FT                   the synthesis of the glycolytic enzyme pyruvate
FT                   decarboxylase required for high level expression of both
FT                   the THI and the PDC genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30329"
FT                   /db_xref="GOA:C5E2R8"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2R8"
FT                   /protein_id="CAR30329.1"
FT                   /translation="MGLLSVEQKYNIILMAERHPKWTQLELARWAYEAYQLSSCPSQGT
FT                   ISRLLARKSVFMNSKEHEKDANRLRKPNNILVRRILQEWVSQSIWNGIPISPPIIQDTA
FT                   QSVWHRIPAEHREGNGSFSYKWITHFLSKMDVNVSSLDEEPPKPPKVWTFEERGTLKEF
FT                   LCKIPARNLFTLDETFLAYNLPLDYAQYETNQVQRRIEVVTVMLCANLDGSEKMNPLVI
FT                   GKYENYRSFRNHFSSEPPEGASQLSLGNKMAKKFSLTYYNNRKSWLTSNLFHDWLVWWD
FT                   KRLVVDNRKIYIVLDDSCSHRIINLRLKNIKLIYTSANSRFLPFNWGVLDEFKTHYRVQ
FT                   QYEALTELQEKIEKKTGQKKILTYDQSLLKMSNAFKLIKVAWDAIPADTIKANWKSSGI
FT                   LPQHMIQLDESVSMAFKKNEALEKKLYEVSERFHCMKQWDYDMLLDLNIENKNTNFLSS
FT                   EELVQSAIVDEWEPEEKQVSLEDDYGTNGFSLEAFAQVGEVGNDTFGHVEHLSHNPTET
FT                   LEKNLLVSDVIDRPSEFFPSSVLPINDDQHIENVTGPPRSNSTQIYPAVSAPPAATGYL
FT                   DDVFSTLPHEPSSANPATSINTHVSSTLPATDSPSPNGIPAADILGIETPALNLGNEFD
FT                   LDSVNDYLGQSSSNPHEPTFGNQRLVILTTLQTNIDIAKSMGNILKHAEFREVGLSDRS
FT                   LNELRFSYNNCLKKIRKAKQALSGADKRLRQQRLERQIINQEQSIVSTAASPSSKIHRP
FT                   VGISPSLEIENSNFFTNFPSNASLDIPPHIQSGTENSSTRRSS"
FT   gene            complement(<635744..>638542)
FT                   /locus_tag="KLTH0H07194g"
FT                   /old_locus_tag="KLTH-ORF1280"
FT   CDS_pept        complement(635744..638542)
FT                   /locus_tag="KLTH0H07194g"
FT                   /old_locus_tag="KLTH-ORF1280"
FT                   /product="KLTH0H07194p"
FT                   /note="similar to uniprot|P38959 Saccharomyces cerevisiae
FT                   YDR080W VPS41 vacuolar protein sorting component of
FT                   vacuolar membrane protein complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30330"
FT                   /db_xref="GOA:C5E2R9"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016902"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2R9"
FT                   /protein_id="CAR30330.1"
FT                   /translation="MMTQSDAKLSLIQESSEEHNPVGLGGQAEKGPLSQDNKKDDLDVS
FT                   SNSKEGNMDETKSIDRTEIRDGFASRLEGAEVSGNKDKNNAESEAVSGSDVESEDQSEE
FT                   EEEDEEEEEEEEDEEPPLLNYTRITKLPKNFFTRDSISACQFHEKVFAFATHAGFLHFT
FT                   ETDFTTIRTFRCHRASITSIFTDGDIFATSSIDGSVVIGSVRDSAGMLACDFKRPVHAV
FT                   VLDDKYKTSKTFVSGGMAGEVILSQRNWLGNRLDIILDRDNGPVVGIYTVDDVLFWMND
FT                   SGITFYSISSKTKLLQVPFPRDEQGTRPDLYWPSVHFPETDRIIVVWANHIWTFKISLT
FT                   KLPQHGNHLGSILSSAASSLRAAPDKKIDQEHYLYVNTVLAGVVSFKNDQLLCLEVPPS
FT                   KTVKNKSELPRFKVIDMFSGLEIHSDEVVSKSYQNLTVKDYHLGKHIGKGATEYYMISA
FT                   KDAVAAHELSLKERFDWFSNTGHDYEAWKIGLYAVDKSARLEAGKRHINKTVSQENWKE
FT                   AAKSITEVFSEAHDDRKDDYFEAHVIKDWGNYILLLLEREQANVIVDLIPTEPPLDNQV
FT                   YDATLNYYLKANQISNFSKYLRLWPKKLFSLGAFCEKLEEVIEQDPENSADYRKDLVFL
FT                   LIENGNDVKAIPHLIKLKDQRALDIIRRRKLLSMFSNQLVEILLLPFNGSAKELSSLDL
FT                   RDAVKVFQKPVELLVEGAHMIGVNSIIPKLSSPRELRLLLFLFFRKASSVNSLMIAPYE
FT                   DDMLELYYEYDKTHLLDFLRSKNDYNIDKAIDLCASDENCFNELIYLWGKVGETRKALS
FT                   LIIDKKNDPQLAIEFVKGSGDSELWEYLVTYSMNKPSFIEKLLDPRADIGTAYPEVVKR
FT                   VPEKMDITGLKVSLENVTKENFLSLNVGTGVFKIIDDETNQLAHEFLNLRDMGKPFEVN
FT                   NA"
FT   gene            complement(<638924..>641187)
FT                   /locus_tag="KLTH0H07216g"
FT                   /old_locus_tag="Klth0H.mRNA.5277.m"
FT   CDS_pept        complement(join(638924..641053,641119..641187))
FT                   /locus_tag="KLTH0H07216g"
FT                   /old_locus_tag="Klth0H.mRNA.5277.m"
FT                   /product="KLTH0H07216p"
FT                   /note="similar to uniprot|P40094 Saccharomyces cerevisiae
FT                   YER157W COG3 Essential component of the conserved
FT                   oligomeric Golgi complex (Cog1p through Cog8p) a cytosolic
FT                   tethering complex that functions in protein trafficking to
FT                   mediate fusion of transport vesicles to Golgi compartments"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07216g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30331"
FT                   /db_xref="GOA:C5E2S0"
FT                   /db_xref="InterPro:IPR007265"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2S0"
FT                   /protein_id="CAR30331.1"
FT                   /translation="MTRSRGNSLVQSIATHAPSGKYLSPSLQDDELLGKLRRIGTSYKQ
FT                   IEVRAQPEARCKENKYSKYDQYVTGVDVKVSEYQTVIDQAEKINKQLALTVDKFCAISS
FT                   ETRDFTESTYELFEKFRNLDDLHKSIREYLSYFEALDPIVRGLHHFSSPNIVRKNSFKS
FT                   KLSKIDESLQFLCEHKEFKDAEAYRIKFKQCMVRCCSLMATYLSNCLRSMFEEVVKSLE
FT                   GISQSATRDALLYNKFSSIAADFYSVSRELSSRYSSKHHQTYHEELNSILQDCYNEYFR
FT                   IRIKLLGPLISSQLENKEAQQKNFSLVKDIQDNLLFFTQLCEDEYSLIVQFFPEKEGKK
FT                   SFNEWLFHLCEPLHDHVREKVLRESDVASLCDAVTLLNKYYQFEENSEEYDAQFRSVQL
FT                   DKIFEPLLQDVQYRLIFRAQIYVETSIIAYRPTRDAFSINHRKGGLSKIEKGDGIVKSF
FT                   LDSISESKDEVEEMHSCYPPVTRAIALLSKIYQMVNSSIFDTLAHHIVHDCVESLRAAL
FT                   RLVRESEDNLDVNLSYLKNLLMLRKQVQNFDIQYVCNETYVDFSGLRDFLRSLAHGGLS
FT                   AASNSVFSLAREGAPKVVKNMVDARSELSVELRNAIKELTETAAHEIVGGCLNCSGVLI
FT                   SDNTQLRKNVEVILPRIYNQMCIFIKDHEVRIHLIDAIQDLVIRAYADYYEDVTQQAEN
FT                   GKIAKEDVSEIMYVDVFADLFNNVASQLEKGGASNSIV"
FT   gene            complement(<641736..>642056)
FT                   /locus_tag="KLTH0H07238g"
FT                   /old_locus_tag="KLTH-ORF1275"
FT   CDS_pept        complement(641736..642056)
FT                   /locus_tag="KLTH0H07238g"
FT                   /old_locus_tag="KLTH-ORF1275"
FT                   /product="KLTH0H07238p"
FT                   /note="similar to uniprot|P38958 Saccharomyces cerevisiae
FT                   YDR079W PET100 Chaperone that specifically facilitates the
FT                   assembly of cytochrome c oxidase located in the
FT                   mitochondrial inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30332"
FT                   /db_xref="GOA:C5E2S1"
FT                   /db_xref="InterPro:IPR018625"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2S1"
FT                   /protein_id="CAR30332.1"
FT                   /translation="MKLPFRYTRSQLEVFRFAFCLLSPVAIMYWIGIDTDKKLNVPGFW
FT                   PDPETLNKIPKEPYEIKAELARMKKERLEKRLRLEKKIAEEYGIDIEAEKARIKEEMNS
FT                   GR"
FT   gene            <642294..>643298
FT                   /locus_tag="KLTH0H07260g"
FT                   /old_locus_tag="KLTH-ORF1274"
FT   CDS_pept        642294..643298
FT                   /locus_tag="KLTH0H07260g"
FT                   /old_locus_tag="KLTH-ORF1274"
FT                   /product="KLTH0H07260p"
FT                   /note="highly similar to uniprot|P40093 Saccharomyces
FT                   cerevisiae YER156C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30333"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2S2"
FT                   /protein_id="CAR30333.1"
FT                   /translation="MSVHKRAKVNMTKQICTHSGSFHADEALAVYMLRVLPEFKDAKVV
FT                   RSRDPAKWEESDIVVDVSGKYDVEKRLFDHHQREFFETFSEKYKTKLSSAGLVYKHFGQ
FT                   DIIKTLQPQLDESDVEFLYEKVYKDFVESLDANDNGISNFDAEDLGVKPKFSDKNITIP
FT                   GIISGMNPNWNGDCSDASFDKCFFKASDFIGEVFVNLVKGYGESWMPAKALVRDAVQNR
FT                   LQEDPSGKIIVLKQFCPWKEHLYNIEKELGIVGEILFVLFEDSSSKWRVSTVPVSATSF
FT                   KFREGLPEPLRGLRDNELSEKSGLPGCIFIHAAGFIGGADSKDTVLKLAQMSL"
FT   gene            <644732..>650635
FT                   /locus_tag="KLTH0H07282g"
FT                   /old_locus_tag="KLTH-ORF1269"
FT   CDS_pept        644732..650635
FT                   /locus_tag="KLTH0H07282g"
FT                   /old_locus_tag="KLTH-ORF1269"
FT                   /product="KLTH0H07282p"
FT                   /note="similar to uniprot|P39960 Saccharomyces cerevisiae
FT                   YER155C BEM2 Rho GTPase activating protein (RhoGAP)
FT                   involved in the control of cytoskeleton organization and
FT                   cellular morphogenesis required for bud emergence"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07282g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30334"
FT                   /db_xref="GOA:C5E2S3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR036964"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2S3"
FT                   /protein_id="CAR30334.1"
FT                   /translation="MKSLRWSGRGKKSSSSSSSDDRHSEHSSQGQASPAQHWNKPEGSS
FT                   HSTNSQALQKKPTVFGKHMTSSPSIYLSETSNRSNRSLSSSRASITGEDLKHEDTHTNS
FT                   TVADDRTTMVTSFSAETNGTSRQQVPLPSLNNDNYDNTTFKVGWVNKAAPFQAANNRDS
FT                   RVYGNSSASLDPQSGSKRGSNFRLHRAALRGCVLSLYKSGIGNVKYFDPNLPPPAHLME
FT                   QQYHETFSPAQPAQKAEEPLAVVEKQQNDLSYLSEEYPHPELKLDKDGRLLSGSNESIC
FT                   HMILFCPYNNDENTRKIIDVLLILPLIDKFGVFLNIFQLFGVTFTRHRVKLVNSARQHH
FT                   QISAKADTLMTERLALVVKAILDVFSGFLLDDKLFSQIVDLVDIISLHDDEISTNLKVS
FT                   IVERQNRLSTLCSFTKQRSSPEEIGMLVDVEQFMKLDLDDVARSVHQINHKFIREWSPQ
FT                   IDYSLLYESKFNEKHIYMNPMVFRNSENVHFLGRLLTTHLFVSNGAFTPHQRATVLSTW
FT                   VQLGCKFEKLGDMVSWLAIATIICSVPVLRLASTWQFVPEQTLRVIFKDWVPTIVQLDR
FT                   RQISSKSTNSVFILAPPNLNDSRIRESVIPFFGDLAINANDLPPDTKFKYLEKKIHRTK
FT                   NAFYKWHQRIEQAKKFDNETERSALAIPVDDGKITNTIFRYWKYHLDQEQMNIDAIMDL
FT                   SLALEPPKICQKQYSATSTRRSALLTGSYLPMLFNDMFPNYSIFPRDSLIGAAGVSGNE
FT                   TKRRPVSTQKVGAPQKLIQDYDQGSITGVERIDEPVAKEISSKVSNKQKLLKLIRDAFN
FT                   IDMDMFHISDDIIFKAADDVDGRSRPASVVIETPKRMSQHSSITAARDSQDINRLSSAM
FT                   ESLDFFSNIGKSTGSINESFIQVVLKCATLDKLFDVLVLTTSVFSKVVDTEDLEKYFYH
FT                   ERKRQNGRAQSSDSASVGPLDYAFVRLLMDNDIFTETFFNTYRSFTTTTIVLENLAKRF
FT                   IGAVSGAVSISRVVNSGKQRYSGSVNSSRFSGFVDATSSNSRFPAWDIKVTEEDEVNLT
FT                   YMAKIQIGAMEALLHLVNLHYSDFTDCLVNNTTFLDILKIMDQEVNEEWKKRVELFSKS
FT                   KLEQPEFREEVAELEQLQTTLKLLFKKLKSCYQKQLYRPLGVSKTQRLTQSYLKDFTTI
FT                   PLRDLSIHMNDPVLEDKFVASFNRLSFDDYSELPKWVYGLNELVCDKLALVSNQDWVDV
FT                   SQILELFSNESLVSLYQYPLHTISHSIIQSAGSQLDDLEILNVFTWLTTLSVGENEMLF
FT                   DKLAPSVQMIIKLHISITQFFILQIAHPDHTIETRANICTIILQLLNFTRWKNSSMDLF
FT                   HDGKQDKCTTAISPHVPSFLETCLTNAIVAPESRYYEMLWKNAHKKLAGPNAAEVKDVS
FT                   NILDGIDAQIRFFVEYDESQISKPKSLSPCPGWLITRLLEISQFVPNMSIENSRMINFD
FT                   KRRFVNNIIINFREMVPYVGGHSEDGSSTNFDSDLKNSILFHEIVDIGKAFRKLAKEKA
FT                   AEEARKSKYQASGLFNSIIVAEVDKIKRDQKKKMELTIQDNDSKRKNMLEHAVKHKNRL
FT                   SSSPSLLSLGQSPARGPPVDPEFPGAGKRSSLATTGTRSSIISNSSTHSNGSMGKKLGG
FT                   FFKRPFSIGGFSSSSSTHGLNAILLSGVQPNGSISPFELPDITSSVFKDTKPVYSIRTF
FT                   EIKSCIPVSGINKLPQTDHSFKIVMENGVEHIVQGTSYIDMMEWIRLINISRRYSFHSQ
FT                   KYKGKTSNKIFGVPIEDVCERECSIIPNIVVKLLEEIELRGLDEMGLYRVPGSVGSINA
FT                   LKNAFDEEGAVSNSFTLEDDRWFEINTIAGCFKLYLRELPDSLFTKEKLPLFVSLALSY
FT                   KSNEIDYEQFQAGMKDALKSLPLYNFHMMKRTFEHLHRVDEHVENNRMDATNLAIVFSM
FT                   SFIDQDDLASSMGPTLGALQTILQSFIRNPADFF"
FT   gene            complement(<650870..>652111)
FT                   /locus_tag="KLTH0H07304g"
FT                   /old_locus_tag="Klth0H.mRNA.5270.m"
FT   CDS_pept        complement(join(650870..651985,652076..652111))
FT                   /locus_tag="KLTH0H07304g"
FT                   /old_locus_tag="Klth0H.mRNA.5270.m"
FT                   /product="KLTH0H07304p"
FT                   /note="similar to uniprot|P39952 Saccharomyces cerevisiae
FT                   YER154W OXA1 Translocase of the mitochondrial inner
FT                   membrane mediates the insertion of both mitochondrial- and
FT                   nuclear-encoded proteins from the matrix into the inner
FT                   membrane interacts with mitochondrial ribosomes null is
FT                   respiratory deficient"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07304g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30335"
FT                   /db_xref="GOA:C5E2S4"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2S4"
FT                   /protein_id="CAR30335.1"
FT                   /translation="MFRNCVTRSARLAARSSSITWQPRLSGPSFIRFKSSVPQPGLNTE
FT                   IQTQLPSLDEISGATDAAASLADQASQVVGEASNHIGYLSSIGLAKSWWWPPDLIQNIM
FT                   EQIHVYTGLPWWGTIVTTTVIVRLLMFPLYVKSSDTIARNSKIKPELDAINSELMGTTD
FT                   MVEAQRVALRRKKLMAENGIKNRYLAAPMLQVPVALGFFSGIRQMANYPVDGFTNQGLA
FT                   WFQDLSLADPYLGLQVITASVFISFTRLGGETGAQQFSPAMKNFFTVMPLLSIPATMNL
FT                   ASGVVLYFAVNGACSVLQTLVLRNKWIRKKLDIADVVKRPASTTGPAKGIIETFKENMN
FT                   KAREQAERRQLMQDNEKKLQEAAKEQKSNSAIKIVRKSDLKRK"
FT   gene            <652347..>653213
FT                   /locus_tag="KLTH0H07326g"
FT                   /old_locus_tag="KLTH-ORF1263"
FT   CDS_pept        652347..653213
FT                   /locus_tag="KLTH0H07326g"
FT                   /old_locus_tag="KLTH-ORF1263"
FT                   /product="KLTH0H07326p"
FT                   /note="weakly similar to uniprot|P10355 Saccharomyces
FT                   cerevisiae YER153C PET122 Specific translational activator
FT                   for the COX3 mRNA that acts together with Pet54p and
FT                   Pet494p located in the mitochondrial inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30336"
FT                   /db_xref="GOA:C5E2S5"
FT                   /db_xref="InterPro:IPR008732"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2S5"
FT                   /protein_id="CAR30336.1"
FT                   /translation="MKKSLVLYGPSKELLSADIRRGLFARCLNLEFDSLLNDVRKLPLD
FT                   RLEESFLHLFLAKSVQHAHVPSVDYLWYRFVMGRKVLMVKPRLLCGIGAVALHGSKPFI
FT                   PRQLCMHFEKFYGESDGLAQYHEELLRIKVESFAKSAGSSISFREKWKVFLEDIDRNVD
FT                   ETCVFRVRDFPYLAESAANADRDLLAQLLFEENKIAIKNRWTLPLLLNLALLQPRLDAD
FT                   FKIRIFSTFYETHKSLDYTDSVCILFQTLRDDVYRSTKLMQFLTERRISLPPLAAKYFM
FT                   SGSSKHS"
FT   gene            <654884..>655633
FT                   /locus_tag="KLTH0H07348g"
FT                   /old_locus_tag="KLTH-ORF1260"
FT   CDS_pept        654884..655633
FT                   /locus_tag="KLTH0H07348g"
FT                   /old_locus_tag="KLTH-ORF1260"
FT                   /product="KLTH0H07348p"
FT                   /note="similar to uniprot|P38957 Saccharomyces cerevisiae
FT                   YDR078C SHU2 Suppressor of hydroxy-urea sensitivity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07348g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30337"
FT                   /db_xref="GOA:C5E2S6"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E2S6"
FT                   /protein_id="CAR30337.1"
FT                   /translation="MVDEHYIDYSQLLAQLLDKDGELNETTVSFLYHLFPSDFFVRAMS
FT                   LIDSNNMFIYVFERDETSAALTTSVGTEPDEVETTTETLRTSPSPPVASEQELGNAVQS
FT                   SALINTLYEKPQSVLHRLIVKQEGPQSPPVCVDLRHWFCSCDEYNTLFEERMLTDEEPS
FT                   LYSKATTELRAGASITDSFASMPPKGASRRYFRHDIIMCPHLLAFAILLQTTPELLTYF
FT                   THKAATVYLITIQNLDEWLKLHLNVVI"
FT   gene            <655985..>658330
FT                   /locus_tag="KLTH0H07370g"
FT                   /old_locus_tag="KLTH-ORF1258"
FT   CDS_pept        655985..658330
FT                   /locus_tag="KLTH0H07370g"
FT                   /old_locus_tag="KLTH-ORF1258"
FT                   /product="KLTH0H07370p"
FT                   /note="some similarities with uniprot|Q01477 Saccharomyces
FT                   cerevisiae YER151C UBP3 Ubiquitin-specific protease that
FT                   interacts with Bre5p to co-regulate anterograde and
FT                   retrograde transport between endoplasmic reticulum and
FT                   Golgi compartments inhibitor of gene silencing cleaves
FT                   ubiquitin fusions but not polyubiquitin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30338"
FT                   /db_xref="GOA:C5E2S7"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2S7"
FT                   /protein_id="CAR30338.1"
FT                   /translation="MSSAASKDGQEGSYSMYPPTSPAGPPASMQYGMGVYGNPNTFAQY
FT                   GYGYPMPMDMYAGQGAPFLGYGINPNMMYYGGGSVPPPSGQKKKYYNKVENNGKTEAGN
FT                   HHNNHHNGVHFYANGKSGPTSNGTAIPAASPSGASKSVPITIKNQYKFELGNANSVSTT
FT                   DLKLEYPFFANTDESEFSKAQEKRRELTLRAFGEIYCGNFGENSQTQDPEVEASALESV
FT                   ETPVETPQASSSEELNAAEKTEKSEQSTEQEKKETESRKSSVTSQAAPTKVIKSWSAVA
FT                   SSAVPKASPSSASDQKKDKKYVPPTVKSLEPLGVVALRVCFDPQYVKYTADQYKGAGMA
FT                   LQSVIPRGIVNTGNICFMSSILQVLLFCEPFVNLMNLISVKTSAKMGSTGFLLLDACLE
FT                   LYRKFDKQAFEREKASRSSSGVNISSALADAIKPDDFYKTLSKLPKFKDLRWGHQEDAE
FT                   EFLTHLLDQLHEEFVNSIDSLSDSEVISLINSINDEDTKTVFIRNLAKYKDAKFIKDSS
FT                   NEIKSMLEKYDADVDDADDTSGNGWQEVSSTSKKGKKTKTAAKRTVVVEPSPISVIFGG
FT                   QFRSVLDVPQNKEPQSITLDPFQTIQLDISDPDVNDLDSAFLKFSEMEHLPFKTSSGNN
FT                   VEAKKQTFIDKLPEVFLIQLKRFSFINNTDKSKIVNYNAYSGHVEKIRKKIHYGHELAI
FT                   PDATISSVHSSFYKEAGTNYKLIGVVYHHGVSPSGGHYTCDVYQETLNKWYRIDDTNVQ
FT                   EIEKDEVLKGGEEGNDSRTAYILIYQKL"
FT   gene            complement(<658464..>658537)
FT                   /locus_tag="KLTH0H07392r"
FT                   /old_locus_tag="Klth0H.tVal_AAC_32"
FT   tRNA            complement(658464..658537)
FT                   /locus_tag="KLTH0H07392r"
FT                   /old_locus_tag="Klth0H.tVal_AAC_32"
FT                   /note="tRNA-Val (AAC) cove score=68.42"
FT   gene            complement(<658932..>660140)
FT                   /locus_tag="KLTH0H07414g"
FT                   /old_locus_tag="KLTH-ORF1252"
FT   CDS_pept        complement(658932..660140)
FT                   /locus_tag="KLTH0H07414g"
FT                   /old_locus_tag="KLTH-ORF1252"
FT                   /product="KLTH0H07414p"
FT                   /note="some similarities with uniprot|Q01589 Saccharomyces
FT                   cerevisiae YDR077W SED1 Isolated as a suppressor of an erd2
FT                   deletion mutant (ERD2 is the HDEL receptor that sorts ER
FT                   proteins) SED1 encodes a cell wall protein."
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07414g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30339"
FT                   /db_xref="GOA:C5E2S8"
FT                   /db_xref="InterPro:IPR038843"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2S8"
FT                   /protein_id="CAR30339.1"
FT                   /translation="MQFSTVALISSLGSAALAQQFLNTTTPLSSARSSSTASLVPSNAG
FT                   ETTTYTDYEVVTAFTTYCPEPTTIITNDETYTVTSATTLTITNCPCTIPKSTTKTATKE
FT                   EPVTVTEEEVVTAFTTYCPEPTTFSTNGETYTVTSATTLTITNCPCTLTRTTTKSSSEA
FT                   PAATSTETTSSKASSEAPVATSTARTITVTEEEVVTAFTTYCPEPTTFSTNGETYTVTS
FT                   PTTLTITDCPCTLTRTSTTTKTEATSTVEGTTVTGTTVPGTTVTGTTAPGTTVTGTTVT
FT                   GTTGQETTVPGTTVEGTTVPGTTVEGTTVPGTTVTGTTAPGTTVEGTTVTPSSAKGTTA
FT                   ATPSVSSSAATLSSVTISTEQGTHAATSATSSHSIAVQSEAGANKIAVGGVAGLAAAAA
FT                   LLI"
FT   gene            complement(<660969..>662171)
FT                   /locus_tag="KLTH0H07436g"
FT                   /old_locus_tag="KLTH-ORF1247"
FT   CDS_pept        complement(660969..662171)
FT                   /locus_tag="KLTH0H07436g"
FT                   /old_locus_tag="KLTH-ORF1247"
FT                   /product="KLTH0H07436p"
FT                   /note="weakly similar to uniprot|P38953 Saccharomyces
FT                   cerevisiae YDR076W RAD55 Protein that stimulates strand
FT                   exchange by stabilizing the binding of Rad51p to single-
FT                   stranded DNA involved in the recombinational repair of
FT                   double-strand breaks in DNA during vegetative growth and
FT                   meiosis forms heterodimer with Rad57p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2S9"
FT                   /protein_id="CAR30340.1"
FT                   /translation="MAIGISLSQLIDDSPPPLRSGVAALDDALGGWHSRCIYELFGPPG
FT                   TSKTRIAQSLVQSEMARDGTCLWVDAHVHTPLETLASPSQSARPAEADAQSRASDAEGD
FT                   ERASSESPSRGLHRTRLTSFAQYVFFFQNLRERYELVVLQGFSQVLTDYIHARAAMPLP
FT                   RADSAHAIKVKSLITLFTLITKYAHAYNATIVLVSDAMNTSYMGGVHHVPQEHVTFADD
FT                   SRFLMRALKRRPVQVLRSALVANLGIGPHDHLWEVFVRRRVALMWDWDWRTPFRRVPRR
FT                   MEVALVYDPARSAAALARVELQDGSALARERGREREQNDQEGAADHVILSSFSSNMSPP
FT                   QLSPGTEPPRKRAKPAAWQGPSEDRCRASQALPLTPRFQELRARNTDPRASADVLYDSE
FT                   G"
FT   gene            complement(<662465..>663388)
FT                   /locus_tag="KLTH0H07458g"
FT                   /old_locus_tag="KLTH-ORF1241"
FT   CDS_pept        complement(662465..663388)
FT                   /locus_tag="KLTH0H07458g"
FT                   /old_locus_tag="KLTH-ORF1241"
FT                   /product="KLTH0H07458p"
FT                   /note="highly similar to uniprot|P32345 Saccharomyces
FT                   cerevisiae YDR075W PPH3 Catalytic subunit of protein
FT                   phosphatase involved in activation of Gln3p which is a
FT                   transcription factor with a role in nitrogen utilization"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07458g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30341"
FT                   /db_xref="GOA:C5E2T0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2T0"
FT                   /protein_id="CAR30341.1"
FT                   /translation="MKVDETIALLRQGKQVSEETVYTLCLRSQELLMSEANVTRVDTPV
FT                   TICGDIHGQLHDLLTLFDKSGGVENNKYVFLGDFVDRGFYSLESFLLLLCYKLRYPDRI
FT                   TMIRGNHETRQITKVYGFYDEIVRKYGNSNVWRYCCEVFDYLSLGAVVDGQVFCVHGGL
FT                   SPNVTTVNQIRAIERKQEVPHEGAMCDLLWSDPDEVSTWSLSPRGAGFLFGRNEVDQFL
FT                   HCNGLELIARAHQLVMEGYKEMFGGGLVTVWSAPNYCYRCGNVAAVLRIEDGLSREYMI
FT                   FEAVQAQDDVGNAIIPTKKPQMDYFL"
FT   gene            <663740..>664927
FT                   /locus_tag="KLTH0H07480g"
FT                   /old_locus_tag="KLTH-ORF1239"
FT   CDS_pept        663740..664927
FT                   /locus_tag="KLTH0H07480g"
FT                   /old_locus_tag="KLTH-ORF1239"
FT                   /product="KLTH0H07480p"
FT                   /note="weakly similar to uniprot|Q70DD8 Saccharomyces
FT                   cerevisiae YER149C PEA2 Coiled-coil polarisome protein
FT                   required for polarized morphogenesis cell fusion"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30342"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2T1"
FT                   /protein_id="CAR30342.1"
FT                   /translation="MGGLKLLRAANPKLFSDPECDKYPTSYDELSVFLKREQVYSGAEL
FT                   ATELDYLDSVLYGDRERGIDLDRKLRVEYAMFKATTMQNERAGPGPSLDELVVLNEQIQ
FT                   NAHKQRTSEITQKQNAFYAALMALLQSVSLDQAALQSILTAAEGGRDCDDLEKSSSGMS
FT                   RSIQPSPLDEVTSYLISGALQHGVELKPSTLEPESPRDDITFFKECIDSLLRNVGLTQP
FT                   PAENQDRDNDRKDETGDSDVAVALKDLQLAHSFLTKKFEGDRNEYLHSIDKLTRTNKEL
FT                   SHELLTYHSELTTVKENCDALTKEREELKSQLEYHTSLNTPTLVASSPVSNASASSAAS
FT                   GSKSYSIGVMRSEFKKVLTDTQNRYEKELQEERELRKQLEQELSSFRTRRSGHNL"
FT   gene            complement(<665022..>665714)
FT                   /locus_tag="KLTH0H07502g"
FT                   /old_locus_tag="KLTH-ORF1235"
FT   CDS_pept        complement(665022..665714)
FT                   /locus_tag="KLTH0H07502g"
FT                   /old_locus_tag="KLTH-ORF1235"
FT                   /product="KLTH0H07502p"
FT                   /note="highly similar to uniprot|P13393 Saccharomyces
FT                   cerevisiae YER148W SPT15 TATA-binding protein general
FT                   transcription factor that interacts with other factors to
FT                   form the preinitiation complex at promoters essential for
FT                   viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30343"
FT                   /db_xref="GOA:C5E2T2"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR030491"
FT                   /db_xref="InterPro:IPR033710"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2T2"
FT                   /protein_id="CAR30343.1"
FT                   /translation="MSEESRLKDFQEANKIVFDPSTRSVWETQEKGPNAGLSKTEDEDS
FT                   QNATTSGIVPTLQNIVATVNLDCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTAL
FT                   IFASGKMVVIGAKSEDDSKLASRKYARIIQKIGFSAKFTDFKIQNIVGSCDVKFPIRLE
FT                   GLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYP
FT                   VLSEFRKL"
FT   gene            <666040..>667884
FT                   /locus_tag="KLTH0H07524g"
FT                   /old_locus_tag="KLTH-ORF1233"
FT   CDS_pept        666040..667884
FT                   /locus_tag="KLTH0H07524g"
FT                   /old_locus_tag="KLTH-ORF1233"
FT                   /product="KLTH0H07524p"
FT                   /note="similar to uniprot|P40090 Saccharomyces cerevisiae
FT                   YER147C SCC4"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30344"
FT                   /db_xref="GOA:C5E2T3"
FT                   /db_xref="InterPro:IPR019440"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2T3"
FT                   /protein_id="CAR30344.1"
FT                   /translation="MNEKLSASEFYRLSHEYSEHAHQLLRDVSTEQQMQQYQTLIYHAI
FT                   HALICTKEQFQLSAEQDVTVTLELCNLLVQETVEFDLAETYLSSVKERLHATDLLHEKM
FT                   LVEEALVRVAKMRGSSQHLKDSLRNVNATLSDLDGSNSAWHLYFSFLRIELISMISPSD
FT                   QRILRLFEELIQSSRDAPPFHLFIMCSYLGYCLDQHLSVPMHYLQELATLSDSEAPPPL
FT                   KLWKHLIELLVLMQIDSNITGKLSEFKEFVTIHKKVLTSPSFNLRLDNKVEITLNSLVF
FT                   RYKDFKNIILLFQSISYLTNCYDKKANFSTRFLPKVKKAATELLDSAEDANILAINNMR
FT                   SFYKRMLDLCHYYTCFEGLILEGVCEEVTDETEYAALINAMKLQLAKNSEGALQAYSKI
FT                   IDSKFSTEFRLIGMLNCFVIKVATMSKHGGTVAFDDYQKVNEIWASITHLVDSHEFRMN
FT                   QTWQCTLVVIWIATHFHPFTNAQLSRENDADYLEKLKWFHSANSYCKVASSSSHGSVNN
FT                   EEKPKAPALKKALLLLFLLNYIAGATVVHDLGEKCQISNACFYLGQQQQMPLMRYLAGL
FT                   SHLLNCGLAMKSKDVAITRSKLKELVENLLKSGFELAQ"
FT   gene            complement(<668029..>670734)
FT                   /locus_tag="KLTH0H07546g"
FT                   /old_locus_tag="KLTH-ORF1232"
FT   CDS_pept        complement(668029..670734)
FT                   /locus_tag="KLTH0H07546g"
FT                   /old_locus_tag="KLTH-ORF1232"
FT                   /product="KLTH0H07546p"
FT                   /note="similar to uniprot|P31688 Saccharomyces cerevisiae
FT                   YDR074W TPS2 Trehalose-6-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30345"
FT                   /db_xref="GOA:C5E2T4"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2T4"
FT                   /protein_id="CAR30345.1"
FT                   /translation="MSSDKPGTAEKPVSGRIINCVPQLPYKVSRNDLYTPGENQDPGDE
FT                   WKLTPISGNSALYSSLYLLRDSPDWEEHVVGWTGEIDPGNKFAYVAPPNQRGTQAANDN
FT                   ARYNSQESNEDPLYLSQEQKRVIAEKLQDKEDSNNKMTVHPVWLLRRDQLRWREYSDKI
FT                   VWPALHYILNPPSDGQKENTWWYDYVKFNEAYALKVAQIYQPGDIIWVHDYYLMLLPQL
FT                   LRMRFGDAIIAYFHHTPWPSSEYFRCLSKRKQLLDGILGSNRVCFQNDGFSRHFVSACK
FT                   RLLDSTSTKKKSKGKGRDEWVISVYGGDVVVDSLPIGVNTEEILRKAFTEDIDEKVKVI
FT                   KEAYANKKIIFGRDRLDTVRGVVQKLQAFEAFLAMYPEYRDKVVLIQVSRPTATDQGLK
FT                   LEQQVNDLVNSINAQYGTLNSSPVHHYHVRIPEDAYHSLLRAADLCLITSARDGMNTTA
FT                   LEYVTVKSRSSIDGCYANPLVLSEFSGTSTVLKDALIVNPWDAVAVARTIKKALCLTAQ
FT                   ERVSLEMKLWSKVPTIQDWNNSFLQRMVEIAKHESQDNKITPALNRPLLLQAYRAAKRR
FT                   LFLFDYDGTLTPIVQDPAAAIPSARLFRILSKLAADPHNLIWIISGRDQQFLSKWLGSR
FT                   MPQLGLSAEHGCFMKDVSSEEWVNLTTKYDMTWQEKVNEAMEQITVQTPGSFIEKKKVA
FT                   VTWHYRRADPEQGEFLAGKLKASLEKFSKDLGLEVMEGKANLEVRPKFVNKGEIVKRLV
FT                   WHPYGEKQLNEDEFKQDDTVPKSQLPDFVLCLGDDFTDEDMFNQLNDIESVWDKKFPDD
FT                   KNEAGHYGIYPVTVGSASKKTVAKAHLTDPQQVLDTLGLLVGDVSLFQSPGTVELDDRG
FT                   HVKDSESSVKSEQAGAAYNMKRSASLKDNA"
FT   gene            complement(<670978..>671445)
FT                   /locus_tag="KLTH0H07568g"
FT                   /old_locus_tag="KLTH-ORF1223"
FT   CDS_pept        complement(670978..671445)
FT                   /locus_tag="KLTH0H07568g"
FT                   /old_locus_tag="KLTH-ORF1223"
FT                   /product="KLTH0H07568p"
FT                   /note="some similarities with uniprot|P38956 Saccharomyces
FT                   cerevisiae YDR073W SNF11 component of SWI/SNF global
FT                   transcription activator complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30346"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2T5"
FT                   /protein_id="CAR30346.1"
FT                   /translation="MWWLSRACFVCDDYYVTPSPRTVPLPQLLSWPTSSHQPPLTVIHT
FT                   SEPPPPMDPQEPRHAQYKVQLLLHINSVLLARVNQLSYNTAHFSPEQQQNIVSQYLKRV
FT                   HANLQCISQLNQGHAGCKPAILEPPQLPSQQPSQDILAKLYLLTSRVFEVW"
FT   gene            <671945..>673438
FT                   /locus_tag="KLTH0H07590g"
FT                   /old_locus_tag="KLTH-ORF1220"
FT   CDS_pept        671945..673438
FT                   /locus_tag="KLTH0H07590g"
FT                   /old_locus_tag="KLTH-ORF1220"
FT                   /product="KLTH0H07590p"
FT                   /note="similar to uniprot|P38954 Saccharomyces cerevisiae
FT                   YDR072C IPT1 Inositolphosphotransferase 1 involved in
FT                   synthesis of mannose-(inositol-P)2-ceramide (M(IP)2C) which
FT                   is the most abundant sphingolipid in cells mutation confers
FT                   resistance to the antifungals syringomycin E and DmAMP1 in
FT                   some growth media"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30347"
FT                   /db_xref="GOA:C5E2T6"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2T6"
FT                   /protein_id="CAR30347.1"
FT                   /translation="MPAVLVSYSSFKSLASLPWQFVVRVYRGGLNRRNIPTLAFNFALN
FT                   FFPVFLWLTIFKNAGVIPTRLRPRIHSQLAFLADVFMFGDSAGELVSQYGADARFAAAM
FT                   TWLTSTVFALAVLVAAPVSVWYYLYYKRRLNYNVIDPYAALFHRNQPFSPTAPRAILPF
FT                   LFLIYTFVGLNTVHLLTSQNEDNFTKNKDLLAWTSYVLLHLLAPIFTAVYLYVFHPPGT
FT                   LKAFSLAMGLQNICGVFSHLLVPMAPPWFVHMYGIKDTEHVSYEQEGFAAGLTRVDSHL
FT                   GTHLNSKGFHKSPIVFGAVPSLHSAIAVQCFLFLITRATSTKANFGSASQGQNRDCVQL
FT                   QEPPTIAASQLSAPKEPESFELDSVTDVSLTPSGGSVTPPPNMVYATPIPEAALNSRWL
FT                   RIFHIAFLPRFLGTTFPLLQWWSTMYLDHHFRFDLFVGMCYAVTSFLIVNHYYLQPRVL
FT                   KRWCNLRMGVEPDIRKEAKTMGMRVFENTNVEWFFDPFA"
FT   gene            complement(<673556..>673801)
FT                   /locus_tag="KLTH0H07612g"
FT                   /old_locus_tag="KLTH.mRNA.248AT.m"
FT   CDS_pept        complement(673556..673801)
FT                   /locus_tag="KLTH0H07612g"
FT                   /old_locus_tag="KLTH.mRNA.248AT.m"
FT                   /product="KLTH0H07612p"
FT                   /note="similar to uniprot|P40089 Saccharomyces cerevisiae
FT                   YER146W LSM5 Component of small nuclear ribonucleoprotein
FT                   complexes involved in RNA processing splicing and decay"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30348"
FT                   /db_xref="GOA:C5E2T7"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR033871"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2T7"
FT                   /protein_id="CAR30348.1"
FT                   /translation="MSIAEVLPLEIIDKTVGQPVWVMLTSHREFAGTLVGYDDFVNVVL
FT                   EDVIEYDHDQEIKRHAGKMLLSGNNISMLVPGGKRL"
FT   gene            <674553..>675140
FT                   /locus_tag="KLTH0H07634g"
FT                   /old_locus_tag="KLTH-ORF1210"
FT   CDS_pept        674553..675140
FT                   /locus_tag="KLTH0H07634g"
FT                   /old_locus_tag="KLTH-ORF1210"
FT                   /product="KLTH0H07634p"
FT                   /note="highly similar to uniprot|Q12447 Saccharomyces
FT                   cerevisiae YDR071C PAA1 Polyamine acetyltransferase
FT                   acetylates polyamines such as putrescine spermidine and
FT                   spermine may be involved in transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30349"
FT                   /db_xref="GOA:C5E2T8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2T8"
FT                   /protein_id="CAR30349.1"
FT                   /translation="MSSTLPLHMYIRPLMVEDTQDVCDLESRGFPPEERASPETAEFRL
FT                   TACPELCSGLFIRDVEGSEVKGEKLIGHILGTKIPCSADGTQNALITLESMGKVHDESS
FT                   TTVGIHSVVIAPEHQKKNLATLLLTDYIQKLSNQEVGQRIAIIAHEPLVPFYERIGFQL
FT                   LGENKTVKADPAFSKSKWCDMVRELVKEEYEN"
FT   gene            <675767..>676057
FT                   /locus_tag="KLTH0H07656g"
FT                   /old_locus_tag="KLTH-ORF1203"
FT   CDS_pept        675767..676057
FT                   /locus_tag="KLTH0H07656g"
FT                   /old_locus_tag="KLTH-ORF1203"
FT                   /product="KLTH0H07656p"
FT                   /note="similar to uniprot|Q12497 Saccharomyces cerevisiae
FT                   YDR070C FMP16 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30350"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2T9"
FT                   /protein_id="CAR30350.1"
FT                   /translation="MLQQTTRGTRMLAGVAVRAATPRASQRFLSRSCALQMPAGKSDMT
FT                   QKDMDANKKKLDELEKKSHNGGAYKRPSTDELKKKGEDAQVEQHRPDDGVY"
FT   gene            <677217..>679802
FT                   /locus_tag="KLTH0H07678g"
FT                   /old_locus_tag="KLTH-ORF1193"
FT   CDS_pept        677217..679802
FT                   /locus_tag="KLTH0H07678g"
FT                   /old_locus_tag="KLTH-ORF1193"
FT                   /product="KLTH0H07678p"
FT                   /note="similar to uniprot|P32571 Saccharomyces cerevisiae
FT                   YDR069C DOA4 Ubiquitin hydrolase required for recycling
FT                   ubiquitin from proteasome-bound ubiquitinated intermediates
FT                   acts at the late endosome/prevacuolar compartment to
FT                   recover ubiquitin from ubiquitinated membrane proteins en
FT                   route to the vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07678g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30351"
FT                   /db_xref="GOA:C5E2U0"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2U0"
FT                   /protein_id="CAR30351.1"
FT                   /translation="MPHSEETRMFCKSLTQLSRIADQFVKQDGENLDMETLLQECIDTL
FT                   VNYQDECKKVRKLGPGPDTRDPAVFEAYESAYVYYKIVSQIVLNKIPDLPQFVQAKDSA
FT                   KSQKERGLLEVYNMLLKTLLTDEKIGELRKFLKDHSRPEPRQHKKGAGDVSKTWANGQA
FT                   ISPSELQSLLGAQNALLIDLRPRIKFVESHIKTDKIMCIEPISFKDSYSDTEITRRSLI
FT                   TSPNEEVQLFQERDKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKPLQRTIILT
FT                   LQGGFENWCRNRGPCDKSESSEETNFASEYGVPPLIPKILPALRPIPPSAQDPLSVKGG
FT                   MTLNTSLTHDKPLNTQPFPEQQQPRLKRTSSFKDKFSSLTPSRSRAGSPSLQSPTILHT
FT                   DSTTYPDAPQLAPSSVQLNALSQLQPIHSRAVTPQSKSLSPPRYNVNGSGQLTSDLMGH
FT                   SPSPPKPVIFPVSSQSSVANYQNGSKPLTRRNTNFTVGLTNLGNSCYMNCIIQCLLGTH
FT                   ELTQIFLDDSYKNHVNLNSKLGSKGVLAKYFSQLIHTMQQQAASASTKQNSGDKTAVQP
FT                   LHFKVACGSINSLFRSSSQQDCQEFCQFLLDGLHEDLNQCGGNPALKELSEEAEGIREK
FT                   LCMRIASSIEWERYLTTDFSVIVDLFQGQYASQLTCKVCGRTSTTYQPFSVLSVPVPSG
FT                   SKCDIIDCFKEFTKVETLEKDEQWSCPRCKCKQPSTKKITITRLPRNLVIHLKRFDNLL
FT                   HKNNIFVSYPHTLDLTPFWANDFDGRLPPGVAELPTRGQVPPFNYNLYAVACHFGTLYG
FT                   GHYTSYVDKGDKAGWCYFDDTSWRKAKSQGECITLSAYVLFYHRKYNVS"
FT   gene            complement(<679846..>680736)
FT                   /locus_tag="KLTH0H07700g"
FT                   /old_locus_tag="KLTH-ORF1187"
FT   CDS_pept        complement(679846..680736)
FT                   /locus_tag="KLTH0H07700g"
FT                   /old_locus_tag="KLTH-ORF1187"
FT                   /product="KLTH0H07700p"
FT                   /note="weakly similar to uniprot|P54858 Saccharomyces
FT                   cerevisiae YDR068W DOS2 Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30352"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="InterPro:IPR035925"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2U1"
FT                   /protein_id="CAR30352.1"
FT                   /translation="MEFFYEEQATRNGEQLVEGDLKSDKDTEKAFQELEGTIDEQYQRT
FT                   ARALKKFVNDERDVELNIPLDTRISEKAQGALDSLDTQLQNVEHLAQDYWKKVSTKSFW
FT                   SSVTNTLGSKLDEVVKVNDQKSSTVCSQTPDAKATTPVAGNRTEAELRMLSSNDKIYLE
FT                   NEDELPDDFKVDEYTAEVSQLLTENKNLELLMNALVPEKLSYQDFWNIFFLKRNRIFEM
FT                   ERKRKELLKKEGEEDKEIDWDDEEEEPELGKASDSENKKEPNKSDIDVQHDEVNDAGAQ
FT                   EKGGDDNDDEDDDWE"
FT   gene            <680854..>681510
FT                   /locus_tag="KLTH0H07722g"
FT                   /old_locus_tag="KLTH-ORF1186"
FT   CDS_pept        680854..681510
FT                   /locus_tag="KLTH0H07722g"
FT                   /old_locus_tag="KLTH-ORF1186"
FT                   /product="KLTH0H07722p"
FT                   /note="similar to uniprot|Q6Q559 Saccharomyces cerevisiae
FT                   YDR067C which is a model system for studying replication of
FT                   positive-strand RNA viruses in their natural hosts"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30353"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2U2"
FT                   /protein_id="CAR30353.1"
FT                   /translation="MSLVTPLYFSAVQPNFYRGSCPRETNIPFLNTLGLKYILSLTPEP
FT                   LTNDAVMSKFCAEKGIQAIHIECNNEKSQKDKSKTKVKRKKKPVPIEYDVVVRCVQFLI
FT                   DRRHYPCYIHCTNGELVTSLVVACLRKLSYWSTVSIFNEYLTYTSSINIHERGFIENFN
FT                   LEIEINDLEMKDKVPWITVRASDVADPHGGNTADKNIRRIQSFPGMLPRLKFHSV"
FT   gene            complement(<681534..>682742)
FT                   /locus_tag="KLTH0H07744g"
FT                   /old_locus_tag="KLTH-ORF1184"
FT   CDS_pept        complement(681534..682742)
FT                   /locus_tag="KLTH0H07744g"
FT                   /old_locus_tag="KLTH-ORF1184"
FT                   /product="KLTH0H07744p"
FT                   /note="similar to uniprot|P40087 Saccharomyces cerevisiae
FT                   YER143W DDI1 DNA damage-inducible v-SNARE binding protein
FT                   contains a ubiquitin-associated (UBA) domain may act as a
FT                   negative regulator of constitutive exocytosis may play a
FT                   role in S-phase checkpoint control"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30354"
FT                   /db_xref="GOA:C5E2U3"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019103"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2U3"
FT                   /protein_id="CAR30354.1"
FT                   /translation="MRLTINSEITDEIFGPLDVTAEMSLQDLIALLEFECGFDATKHNL
FT                   LHKATALNSSESKTLQELQFENDELLVIKAKINNVHENSQSGASMEDMLVEQARQQILQ
FT                   NPALRAQIVSSNPGFESIINDATAFRQQAGPHLLQSMQGGSRQNPFGIAQTEYDELMRN
FT                   PDDPANQKRIGELISQQEIDEQMRNALEFTPEAFTTVHMLYVNLEINGYPVKAFVDSGA
FT                   QSTIISTKLAEKAGLSRLIDKRFSGEAHGVGVQKIIGKIHIAQVKIETQHVPCSFTVLD
FT                   THVDMLLGLDMLKRHQACIDLKDNVLRIAGVQTRFLSEAEIPESLEAKISESTSQGLNI
FT                   PAPSAQLEPPKKAQTSQPHPERAFPESVVQQLMDLGFSRSEVLRSLEQANGNPDVAAAL
FT                   LFQ"
FT   gene            <683735..>684559
FT                   /locus_tag="KLTH0H07766g"
FT                   /old_locus_tag="KLTH-ORF1182"
FT   CDS_pept        683735..684559
FT                   /locus_tag="KLTH0H07766g"
FT                   /old_locus_tag="KLTH-ORF1182"
FT                   /product="KLTH0H07766p"
FT                   /note="similar to uniprot|P22134 Saccharomyces cerevisiae
FT                   YER142C MAG1 3-methyl-adenine DNA glycosylase involved in
FT                   protecting DNA against alkylating agents initiates base
FT                   excision repair by removing damaged bases to create abasic
FT                   sites that are subsequently repaired"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30355"
FT                   /db_xref="GOA:C5E2U4"
FT                   /db_xref="InterPro:IPR000035"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2U4"
FT                   /protein_id="CAR30355.1"
FT                   /translation="MKRSREETVELPQDFAEKHIDTFVKGCHHILGVDPSLYDALLSKD
FT                   FQLFLKREQPPMDLNHHFIKLASSILAQQISGAAANSVKNKLMAYYGGHFPTYQEVVET
FT                   FHKKDVQELRDCGLSARKVQYLESLANYFNDNEKAIEALFEQDNEEIASQLVANIKGIG
FT                   PWSAKMFLVTSLERMDVFAADDLGIARGCSKYLDCRPEILKELMSKRVQGKTKRSKIVH
FT                   KKKNWKIYDEDIVEKCGEMFAPYRSIFMFILWRLSSTNIDALAKREKDFVAK"
FT   gene            complement(<684628..>686067)
FT                   /locus_tag="KLTH0H07788g"
FT                   /old_locus_tag="KLTH-ORF1181"
FT   CDS_pept        complement(684628..686067)
FT                   /locus_tag="KLTH0H07788g"
FT                   /old_locus_tag="KLTH-ORF1181"
FT                   /product="KLTH0H07788p"
FT                   /note="similar to uniprot|P40086 Saccharomyces cerevisiae
FT                   YER141W COX15 Protein required for the hydroxylation of
FT                   heme O to form heme A which is an essential prosthetic
FT                   group for cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30356"
FT                   /db_xref="GOA:C5E2U5"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2U5"
FT                   /protein_id="CAR30356.1"
FT                   /translation="MFGSLLRNSGPRLSLGSALASRILTRTSIARPSLFSRWSSPARAK
FT                   NVQVSRGLFTGTTLRQAAATIKKQPAKNLLNSSKSVGYWLVGTSGLVFGIVVLGGLTRL
FT                   TESGLSITEWKPVTGTLPPMNEQEWLEEFAKYRESPEFQQLNSHIDLDEFKFIFFMEWV
FT                   HRLWGRAIGLVFVLPAVYFAAARKTSPRVNRRIFSLSLLLGLQGFIGWWMVKSGLDKEQ
FT                   LKERNSKPTVSQYRLTTHLGTAFLLYMGMLWTGIEILKEAKWIKNPAKALGVFAKLDNP
FT                   AVTPLRRSALGLLALTFVTAMTGGLVAGLDAGLIYNTFPHMGDDWIPSKRELLDPNFAR
FT                   KDDDSDLLWRNMLENPTTVQLNHRIFATITFFSVFGMHMWCNRMKHVLPKNAIKSMHSM
FT                   MGVATLQVALGIFTLLYLVPVSLGSLHQAGAIALLTNALVFASQLRKPRVPMRILVGGL
FT                   STKANSNAGSKILTEASRLAK"
FT   gene            complement(<687664..>689160)
FT                   /locus_tag="KLTH0H07810g"
FT                   /old_locus_tag="KLTH-ORF1178"
FT   CDS_pept        complement(687664..689160)
FT                   /locus_tag="KLTH0H07810g"
FT                   /old_locus_tag="KLTH-ORF1178"
FT                   /product="KLTH0H07810p"
FT                   /note="similar to uniprot|P40085 Saccharomyces cerevisiae
FT                   YER140W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30357"
FT                   /db_xref="GOA:C5E2U6"
FT                   /db_xref="InterPro:IPR008010"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2U6"
FT                   /protein_id="CAR30357.1"
FT                   /translation="MTKRISKPKKPKRSVHWKYIKEILLAEFEVKDAKRKDQSAEDDQR
FT                   EAEEAEHEMEQILNMLRLFLHMEKLMLFSLLACLNAFLYYFTTFPARLLYNFVGRKKLR
FT                   QADREFNLLALIALASLVLFRVDTSRVYHRIKGQSAIKLYMMFGVLEMCDKMLSSVGQS
FT                   LMVIVQTKRTRQTKLQKALLNMCALGYLSCHGYILMYETIALNVAVNSYSNSLLTLLLS
FT                   MQFAEIKASVFKRFDKEGLFQITISDIIERFQMVILLTIIALRNLVATSTSFSTLIPDS
FT                   WSWNSTSSIVVGILCGPVLTVVGSEILVDWIKHAYITKFNRIRPQMYDTYLRIISHDHM
FT                   CNLQKLQIRLGLPVPALVVLFIVMIRPSLKIGLFEVSTSVAGSVAMVLMAFVCLFLTKF
FT                   VLYLVLARWSQAMQANGLTGSTDTKVTEEMYVPGTPSSGMGKIDEQLRAQLHATDAQQI
FT                   DTKQKQASVPPSSNEIRAQRDSKRNLKNVTRYKMVSKRIW"
FT   gene            <689313..>689987
FT                   /locus_tag="KLTH0H07832g"
FT                   /old_locus_tag="KLTH-ORF1176"
FT   CDS_pept        689313..689987
FT                   /locus_tag="KLTH0H07832g"
FT                   /old_locus_tag="KLTH-ORF1176"
FT                   /product="KLTH0H07832p"
FT                   /note="similar to uniprot|P40084 Saccharomyces cerevisiae
FT                   YER139C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30358"
FT                   /db_xref="GOA:C5E2U7"
FT                   /db_xref="InterPro:IPR007308"
FT                   /db_xref="InterPro:IPR038534"
FT                   /db_xref="InterPro:IPR039693"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2U7"
FT                   /protein_id="CAR30358.1"
FT                   /translation="MSGVNDIKELVLKPYQSHRQLSIKEADTISLELLDLFSQSNCKDK
FT                   ETLKYIANFLTVETYHDLIDERNLNKRCGYPVCNRSQNRVRDPYGGNMMAKKFLQQNNP
FT                   YAYLSSYCSKFHYRCSQFYEIQLTDEALFVRIGIHLDNQEQNGSQKHEITLLEDLMQSE
FT                   QPDQQDLMSIVNGIGQLNIEQSQPSSREELEKDLSDWLSQIKIVENESPSIMGDILKEE
FT                   PR"
FT   gene            complement(<690041..>691123)
FT                   /locus_tag="KLTH0H07854g"
FT                   /old_locus_tag="KLTH-ORF1175"
FT   CDS_pept        complement(690041..691123)
FT                   /locus_tag="KLTH0H07854g"
FT                   /old_locus_tag="KLTH-ORF1175"
FT                   /product="KLTH0H07854p"
FT                   /note="similar to uniprot|Q6Q5U4 Saccharomyces cerevisiae
FT                   YDR065W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30359"
FT                   /db_xref="GOA:C5E2U8"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E2U8"
FT                   /protein_id="CAR30359.1"
FT                   /translation="MVLHFSNLARHKTFVLHWYRYTLRNVARQTFSWHLKARVKDITRT
FT                   TIVKHKSDKSSWSIYILLRDLKALNGFLRNKKTAAAWRLLTLYSKKPLRSGASSPSVAL
FT                   EHSPPLQDPETVRNSHIIHSYIVERQQKNLLPLEIPAEYKTLLLLPLALHDHALKRLHL
FT                   IESKLVRGPPKVSVNYTSAGKARIWFLRTAVNKNQRQSKALGQIIRREKRKNQKNIDYW
FT                   EKCRVNGIWAWHEAAWEHLMETNTMLTESPAKYFDNERSRKRAASDGTSVKAVAEWLDP
FT                   VFSSLDMLQAQSAEQAAYFEQYKHNTVLQGLQQFFARKSDKMYQNRKKRFESLLENDLP
FT                   FVTPYFSQQNLATVMKSHKF"
FT   gene            complement(<691624..>692438)
FT                   /locus_tag="KLTH0H07876g"
FT                   /old_locus_tag="Klth0H.mRNA.5264.m"
FT   CDS_pept        complement(join(691624..692058,692418..692438))
FT                   /locus_tag="KLTH0H07876g"
FT                   /old_locus_tag="Klth0H.mRNA.5264.m"
FT                   /product="KLTH0H07876p"
FT                   /note="highly similar to uniprot|P05756 Saccharomyces
FT                   cerevisiae YDR064W RPS13 Protein component of the small
FT                   (40S) ribosomal subunit; has similarity to E. coli S15 and
FT                   rat S13 ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30360"
FT                   /db_xref="GOA:C5E2U9"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2U9"
FT                   /protein_id="CAR30360.1"
FT                   /translation="MGRMHSSGKGISSSAIPYSRNAPAWFKTSPEAIVEQIIKYARKGL
FT                   TPSQIGVLLRDAHGVTQTRFITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHLER
FT                   NRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN"
FT   gene            complement(<693115..>693555)
FT                   /locus_tag="KLTH0H07898g"
FT                   /old_locus_tag="KLTH-ORF1171"
FT   CDS_pept        complement(693115..693555)
FT                   /locus_tag="KLTH0H07898g"
FT                   /old_locus_tag="KLTH-ORF1171"
FT                   /product="KLTH0H07898p"
FT                   /note="similar to uniprot|Q12156 Saccharomyces cerevisiae
FT                   YDR063W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30361"
FT                   /db_xref="GOA:C5E2V0"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR011171"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2V0"
FT                   /protein_id="CAR30361.1"
FT                   /translation="MSSLYHISTETKNTIRKYRTATARSESLQALVIKIEPKPSCEIII
FT                   DDDEELREASSLEELGEELPDNAPRYVLLCYPMTTADGRKQTPLVLLYWKPATVVSQEW
FT                   KMLYAGALEMVRSECGVSKVIEVATGLEDEDEIEELKEQIQG"
FT   gene            complement(<693778..>695466)
FT                   /locus_tag="KLTH0H07920g"
FT                   /old_locus_tag="KLTH-ORF1169"
FT   CDS_pept        complement(693778..695466)
FT                   /locus_tag="KLTH0H07920g"
FT                   /old_locus_tag="KLTH-ORF1169"
FT                   /product="KLTH0H07920p"
FT                   /note="highly similar to uniprot|P40970 Saccharomyces
FT                   cerevisiae YDR062W LCB2 Component of serine
FT                   palmitoyltransferase responsible along with Lcb1p for the
FT                   first committed step in sphingolipid synthesis which is the
FT                   condensation of serine with palmitoyl-CoA to form 3-
FT                   ketosphinganine"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30362"
FT                   /db_xref="GOA:C5E2V1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2V1"
FT                   /protein_id="CAR30362.1"
FT                   /translation="MSSISNTKVPLFGPAKQSVEHKKNNEFGPLTSDEYLYQVHSRNGE
FT                   PLRDPVLDAPPYYVVVITYLNYLILIILGHIHDYLGMTFQKEKHRELLEKDGLAPWFSK
FT                   FESFYVRRLKLRIDDCFSRPTTGVPGRFITCIDRISHDLNSYYTHPGTTTMCLNLSSYN
FT                   YLGFAQSEGKCTDNAIASVDKYGLTAGGPRAQAGTSDLHLETEKLVARFVGKEDAMVFS
FT                   MGYSTNANFFNSILDSKCLVISDELNHTSIRTGVRLSGTAVKAFKHNDMEALEKLIKEQ
FT                   IVQGQPKTHRPWKKILICVEGLFSMEGTMCNLPKLIELKNKYKCYLFVDEAHSIGAIGP
FT                   QGRGVCDYFGINPSEVDIMMGTFTKSFGAAGGYIAADKKVIDKLRCDLTIPNYGESVPA
FT                   PILAQTSASLRIITGELNPGEGLERLQRIAFNSRYLRLALQRLGFIVYGIADSPVVPML
FT                   LYAPSKMPAFSRMMLQRKIAVVVVAYPATPLIESRVRFCVSAALTKEDIDYLLRHVNEV
FT                   GEKLFLKVSTGKAGGSLDGKPPRWDIEEVIRRTPSDCKDDKYFLI"
FT   gene            complement(<696683..>698269)
FT                   /locus_tag="KLTH0H07942g"
FT                   /old_locus_tag="KLTH-ORF1166"
FT   CDS_pept        complement(696683..698269)
FT                   /locus_tag="KLTH0H07942g"
FT                   /old_locus_tag="KLTH-ORF1166"
FT                   /product="KLTH0H07942p"
FT                   /note="similar to uniprot|Q12298 Saccharomyces cerevisiae
FT                   YDR061W Mitochondrial protein member of the ATP- binding
FT                   cassette (ABC) transporter family transcriptionally
FT                   activated by Yrm1p along with genes involved in multidrug
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30363"
FT                   /db_xref="GOA:C5E2V2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2V2"
FT                   /protein_id="CAR30363.1"
FT                   /translation="MANFIVRINSGLFKSSLQRSAPTLYSKPIKHFEIKPREKWVIWGA
FT                   EKAKFLDVIGNKFLPDPPLSLEYGLKKGSFPRVEFVKFSGVIPTAHLSARYEYFKDDFD
FT                   QTCEKFIKDNTAGSLAVDYEVSKTNRNIDLSLYSELLKDLKLKALEHRWTMGLSNGQMR
FT                   RARLARSLLKEPDLTLIEDPFLGLDPSATDTISNFIGNYSRSCIVIGLRYQDTIPKWCT
FT                   HVCCVDENGIAFQGQKSEVKDLMAETRKQYTSNVPGARQPKYQIKDLVSRHPLAQVPKH
FT                   EIINMPSALELKGLDVSYKGEPVLKDLHWKVAPQSKWHVKGDNGTGKSTLLSLLTADHP
FT                   QSWNSKVVENGRPRKTGSTDYFTINRNIAMSSPELHAIFVKNSRNGLITREALASGFQE
FT                   NSSNNFLPYYNVLSKEQKETLAIFADYFGINDLLSRRFEELSVSDQKLVLFVRCLLKMP
FT                   KILILDEAFSAMETEPMQTCHEFLEYWPGTVFVVSHVPEETPRCDHYLRLISPGHYEIG
FT                   DSTPFSRQAPR"
FT   gene            complement(<698453..>700618)
FT                   /locus_tag="KLTH0H07964g"
FT                   /old_locus_tag="KLTH-ORF1163"
FT   CDS_pept        complement(698453..700618)
FT                   /locus_tag="KLTH0H07964g"
FT                   /old_locus_tag="KLTH-ORF1163"
FT                   /product="KLTH0H07964p"
FT                   /note="weakly similar to uniprot|P39106 Saccharomyces
FT                   cerevisiae YER001W MNN1 Alpha-1 3-mannosyltransferase
FT                   integral membrane glycoprotein of the Golgi complex
FT                   required for addition of alpha1 3-mannose linkages to N-
FT                   linked and O-linked oligosaccharides one of five S.
FT                   cerevisiae proteins of the MNN1 family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30364"
FT                   /db_xref="GOA:C5E2V3"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2V3"
FT                   /protein_id="CAR30364.1"
FT                   /translation="MLRRFLHSLRGVKLPPSRMIVKLAMLLVVVAAAVVLYVQSAKLGH
FT                   YSKVSKYSPDLEEMDAVRGGNNKHPYNFVDGTSLLQPIKGNKFSPLELIPGYDAEMKEK
FT                   RKASWDFLARKHRFKTFTELTPKTQCYFFFQKMYQLNNAWSNNYNRWGFIINDEEEEQL
FT                   STVDDATKEAIHDKKRAVDIALGMERMRMYDTCFVLDESINVSELFKTLQQSDPNLSGF
FT                   DQWDFERRMWPMLKPFDKSTFVDIMPNLISPSGVTIEKGYLPPLDSTPDYINNAVKYEY
FT                   NEKLSFLANWNKMSSIVSRRGLVLGFGDQQLEMASKFIAQLRFIGNTLPIQVVHKGDLS
FT                   RESIDALLKIAQSDKLTFPKTEYPNAQNVKQELWFVDMGPVLDPDVLNSFSRFKNKWLA
FT                   QSFNLFEEYVFMDIDAISYVDLNYYFETHEYRQTGTLFFRDRYRGEPISEKCPAMAETL
FT                   FPSFLENFYWHHYAAVDLDYVEDQCDKYLRPHEKVVKNYFIDNNQHQMESGLVVVHKTS
FT                   HCVALMLSLMLHMTPALGGCSYGDKEFFWLGFYAAGHDFAFHGGRAGTAGTRKEDEKVN
FT                   KYFQQKKYEICSVTIAHMSEHEGELLWVNGGAQSCKFDDAEKDWKNEKLGMSTKFSSLE
FT                   ELQRAYREPIDIQHGIIPAEKFDGWGQPDGRCQGYMHCARYEKHMKPYSFSKLHEKGTL
FT                   IEFQPNKKARYNAINVVWVADYLRQDL"
FT   gene            <701923..>703266
FT                   /locus_tag="KLTH0H07986g"
FT                   /old_locus_tag="KLTH-ORF1158"
FT   CDS_pept        701923..703266
FT                   /locus_tag="KLTH0H07986g"
FT                   /old_locus_tag="KLTH-ORF1158"
FT                   /product="KLTH0H07986p"
FT                   /note="highly similar to uniprot|P39958 Saccharomyces
FT                   cerevisiae YER136W GDI1 GDP dissociation inhibitor
FT                   regulates vesicle traffic in secretory pathways by
FT                   regulating the dissociation of GDP from the Sec4/Ypt/rab
FT                   family of GTP binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30365"
FT                   /db_xref="GOA:C5E2V4"
FT                   /db_xref="InterPro:IPR000806"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2V4"
FT                   /protein_id="CAR30365.1"
FT                   /translation="MDESYDVIVLGTGLTECILSGLLSVDGKKVLHIDKQDHYGGESAS
FT                   VALSQLYQKFKQNPIPKDQMEAKFGRDRDWSVDLIPKFLMADGGLTKILVHTDVTRYID
FT                   FKQVAGSYVYNKGKIYKVPSNEMEAISSPLMGIFEKRRMKRFMEWISEYQEDDVKTHQG
FT                   LDLDKNTMDEVYYKFGLGTSTKDFIGHSMALWTNDDYLQEPARPTFERILLYVQSVARY
FT                   GKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNTPVEKVLYDDDGKFQGVVTKEGTAKA
FT                   PLVIADPTYFPEKCKSTGQKVIRAICILNHPVPNTSNADSLQIIIPQSQVGRKNDIYVA
FT                   VMSDSHNVASKGFYLAIVSTIIETDTPHVELEPAFKLLGPIEERFMGIAEIFEPKESGS
FT                   TDNVFLSRSYDSSSHFESMTDDVKDIYFRVTGHPLVLKKRPQEEEEEE"
FT   gene            <703423..>703786
FT                   /locus_tag="KLTH0H08008g"
FT                   /old_locus_tag="Klth0H.mRNA.699.p"
FT   CDS_pept        join(703423..703476,703553..703786)
FT                   /locus_tag="KLTH0H08008g"
FT                   /old_locus_tag="Klth0H.mRNA.699.p"
FT                   /product="KLTH0H08008p"
FT                   /note="highly similar to uniprot|P38203 Saccharomyces
FT                   cerevisiae YBL026W LSM2 Component of small nuclear
FT                   ribonucleoprotein complexes involved in RNA processing
FT                   splicing and decay"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30366"
FT                   /db_xref="GOA:C5E2V5"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016654"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2V5"
FT                   /protein_id="CAR30366.1"
FT                   /translation="MLFFSFFKTLVDQEVTVELKNDIELKGTLKSVDQFLNLKLDNISC
FT                   SNESKYPHLSSVRNIFIRGSTVRYVYLNKNMVDTNLLQDAARREAMSARK"
FT   gene            complement(<703865..>704317)
FT                   /locus_tag="KLTH0H08030g"
FT                   /old_locus_tag="KLTH-ORF1150"
FT   CDS_pept        complement(703865..704317)
FT                   /locus_tag="KLTH0H08030g"
FT                   /old_locus_tag="KLTH-ORF1150"
FT                   /product="KLTH0H08030p"
FT                   /note="weakly similar to uniprot|P40083 Saccharomyces
FT                   cerevisiae YER137C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30367"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2V6"
FT                   /protein_id="CAR30367.1"
FT                   /translation="MGSQAQDPEQVSRAMDALARSILAKRVQDHKRKPERLRQLELLKQ
FT                   QFDALVLARQAQKEPAPRAPLLDAAQLDRELEQGLGFVERNGRNYVLLPLVGNPNPAPA
FT                   AAPGATPAAPKHAKKKKNKIPCSYCHEAGHTRARCEKRLLGESGGL"
FT   gene            <704755..>705186
FT                   /gene="SNR20"
FT                   /locus_tag="KLTH0H08052r"
FT                   /old_locus_tag="Klth0H_ncRNA_203"
FT   ncRNA           704755..705186
FT                   /gene="SNR20"
FT                   /locus_tag="KLTH0H08052r"
FT                   /old_locus_tag="Klth0H_ncRNA_203"
FT                   /product="SRP RNA"
FT                   /note="SCR1 (SRP RNA)"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            <705605..>706018
FT                   /locus_tag="KLTH0H08074g"
FT                   /old_locus_tag="KLTH-ORF1147"
FT   CDS_pept        705605..706018
FT                   /locus_tag="KLTH0H08074g"
FT                   /old_locus_tag="KLTH-ORF1147"
FT                   /product="KLTH0H08074p"
FT                   /note="similar to uniprot|P38204 Saccharomyces cerevisiae
FT                   YBL025W RRN10 subunit of UAF (upstream activation factor)
FT                   involved in promoting high level transcription of rDNA
FT                   Upstream activation factor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30368"
FT                   /db_xref="GOA:C5E2V7"
FT                   /db_xref="InterPro:IPR022793"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2V7"
FT                   /protein_id="CAR30368.1"
FT                   /translation="MDRSVYEACSDLVEQFGHKVSADEILAQKVSNLVPIPFKSREDLE
FT                   LAALGDKKEGIYSGELAPRIDLKVLHYYATQLIVQKYPHLINCFDETALLTLGLLVEKW
FT                   VEDYLRAQSDELRTNPARLIAKKTDYRKSPSDI"
FT   gene            <706261..>708327
FT                   /locus_tag="KLTH0H08096g"
FT                   /old_locus_tag="KLTH-ORF1144"
FT   CDS_pept        706261..708327
FT                   /locus_tag="KLTH0H08096g"
FT                   /old_locus_tag="KLTH-ORF1144"
FT                   /product="KLTH0H08096p"
FT                   /note="similar to uniprot|P38205 Saccharomyces cerevisiae
FT                   YBL024W"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30369"
FT                   /db_xref="GOA:C5E2V8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023270"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2V8"
FT                   /protein_id="CAR30369.1"
FT                   /translation="MARRRNFKKGNRKTFGARDDSNAQKNWTELEKENPKWEKYYKDLG
FT                   VIPENEWDDFKKTCQAQLPLTFRITGSRKHAHEVLALFEEKHLPGLTNVEFEGEQIQPP
FT                   KRLPWYPENLAWQLDVSKQVIRKNEQFSKVQRFLVVENAVGNISRQEAVSMIPPIVLEV
FT                   ESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGFVVANDADARRSHMLVHQLKRLNSAN
FT                   LVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGTMRKNVNVWKDWGTASGLGL
FT                   HTVQLNILKRGLNLLKKGGRLVYSTCSMNPIENEAVVAAALRQWGDKIKLVDCSDKLPG
FT                   LVRSKGISNWPVIDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGG
FT                   FFITVIEKVGSDSVETAKRATTEEVADEAAVDKKQKTEDGASAAPSAPVKKEKLPRDAN
FT                   EEPFVFLDPKHPELEKCWSFYGIDEKFDKSTCLVRNAAGEPTRVIYYTSSSLKNIIEAN
FT                   EDRLKLVYSGVKLFVAQRSDIECSWRIQNEALQIMKHHMNRNRVVEANVECFKMLLIES
FT                   FPRFEDMEKSHIDDNFVEKMKELSAGCAFIHVDRGEDKESMFLPVWNGTKCVNLMVCKE
FT                   STQELLHRLFGIEVTSKKPAAEPKKEEGDASVEQEGKSEEIAGDDAEKSADTA"
FT   gene            complement(<708435..>711005)
FT                   /locus_tag="KLTH0H08118g"
FT                   /old_locus_tag="KLTH-ORF1139"
FT   CDS_pept        complement(708435..711005)
FT                   /locus_tag="KLTH0H08118g"
FT                   /old_locus_tag="KLTH-ORF1139"
FT                   /product="KLTH0H08118p"
FT                   /note="similar to uniprot|P29469 Saccharomyces cerevisiae
FT                   YBL023C MCM2 Protein involved in DNA replication component
FT                   of the Mcm2-7 hexameric complex that binds chromatin as a
FT                   part of the pre-replicative complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30370"
FT                   /db_xref="GOA:C5E2V9"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008045"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2V9"
FT                   /protein_id="CAR30370.1"
FT                   /translation="MDRRRGREDDDSGDERVVPPSSPQGPSIERSSPLGSPEEIDFENP
FT                   DGEVPDQVEDLDDMEEGLDEVDLMGDDMYRDYGSDALRDTYETTGVDDRNQRELSLAER
FT                   RRIDSQLNERDRLLRSEAYMDDDEDLDKAHVDEMGLPVQRRRRRRQYEDDDDLLSDIDM
FT                   DPLAEELTLESLSDVKASSYTEWITQPNVACTIARELKSFLLEYTDEWGRSVYGARIRT
FT                   LGELNSESLEVNYRHLAESKAILALFLAKCPEEMLKIFDVVAMDATQLHYPDYARIHSE
FT                   IHVRISDFPTVLNLRELRESNLNSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGAVLGPY
FT                   FQDSNEEIKISFCTNCRSKGPFRTNAEKTLYRNYQRLTLQEAPGTVPAGRLPRHREVIL
FT                   LWDLVDIAKPGEEIEVTGVYKNNYDGNLNARNGFPVFATIIEANSIRRREGGRRSGEDE
FT                   EGLDVFGWTEEEEREFRKISRDRGIIDKVISSIAPSIYGHKDIKTAVACALFGGVPKNV
FT                   NGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPIT
FT                   REWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQNISISKAGIVTSLQARCS
FT                   IIAAANPNGGRYNSALPLAQNVDLTEPILSRFDILCVVRDLVDEVKDERLARFVVDSHL
FT                   RSHPLHDKVGGNGSADEDANDADAAVDEEPMSSRQRRLQRDREREEEISPIPQDTLMKY
FT                   IQYARTKIYPKLHQMDMDKVSRVYADLRRESITTGSFPITVRHLESILRIAESFAKMRL
FT                   SEFVSSWDLDRAIKVIVDSFVGAQKISVRRQLQRSFSIYTLGQN"
FT   gene            <713577..>714680
FT                   /locus_tag="KLTH0H08140g"
FT                   /old_locus_tag="KLTH-ORF1134"
FT   CDS_pept        713577..714680
FT                   /locus_tag="KLTH0H08140g"
FT                   /old_locus_tag="KLTH-ORF1134"
FT                   /product="KLTH0H08140p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30371"
FT                   /db_xref="GOA:C5E2W0"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR040204"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2W0"
FT                   /protein_id="CAR30371.1"
FT                   /translation="MSDISASEYISQQNALEDEARGLMPWNPSHCTYADGSLRQPIFAC
FT                   LDCGEIGVCYSCSIQCHADCHLEELFTKRGFTCDCGTERQESKKGEFWCHLRQNLDRDV
FT                   PSLSNRYSQNFKGLFCDCHNKYKADIDSTMIQCVLGLECNEEWYHCCCILKKHDHARHC
FT                   LQSAIQNNQVPSEFPAIDYFEGFICWKCVSRYFTVFQALMSHHRSSDVIAHKVAHLTTF
FT                   EPLGSEDEAPSLSKKRKRDSNTEQLFSIMLKSGYDKVLLEIKEDLEKTDKLYVFLQDIA
FT                   PFLINDDPVYEFPEDSDNDISTYELGTKALNTSLDRDTAVAGIQAMDDIKKKLSDFLRP
FT                   FAEAGEVVKEEDIRNFFELQKGKPKNK"
FT   gene            complement(<714771..>716291)
FT                   /locus_tag="KLTH0H08162g"
FT                   /old_locus_tag="KLTH-ORF1132"
FT   CDS_pept        complement(714771..716291)
FT                   /locus_tag="KLTH0H08162g"
FT                   /old_locus_tag="KLTH-ORF1132"
FT                   /product="KLTH0H08162p"
FT                   /note="similar to uniprot|P38067 Saccharomyces cerevisiae
FT                   YBR006w UGA2 succinate semialdehyde dehydrogenase involved
FT                   in the utilization of gamma- aminobutyrate (GABA) as a
FT                   nitrogen source"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30372"
FT                   /db_xref="GOA:C5E2W1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2W1"
FT                   /protein_id="CAR30372.1"
FT                   /translation="MLRFKQSLIRPKTLFKRFASTSFEDPELFRTKALVNGKWLSGDDQ
FT                   FPVINPSTSEEISTITNCGVADYNEAIGHAHRAFKKFKETSPRERSQVLYNIYDLMSEH
FT                   KNDLARLITMENGKTFKDSLTEIDYSASYFRWFAEEAPRIYGHVIPSSSSLRKQIITLR
FT                   QPLGVVGIMAPWNFPSAMIARKLAPVIATGNACVIKPPHESPMSALALGWLAEQAGLSD
FT                   GVCNVLPTTHTAAIGEYICSHDQVRKITFTGSTKVGKLLMKQCANGNIIKKVSMELGGN
FT                   APFIVFDDADIDKAVNGLISCKFRQLGQTCICANRVFVHESIYGDFATRLVAAIESGFH
FT                   LGDGFSPKVTHGPLINEGAVQKVSELVEDAKNKGANVLTGGVRASSLGPRFYHPTVLSG
FT                   VDETMSIFHTEVFGPVASLIGFKTTEEVIERANKTNVGLAGYFYSSNIQTVLDVASELE
FT                   VGMVGVNSSAISDAAMPFGGIKNSGLGREGSSWGVDDYTDLKSIVLEA"
FT   gene            complement(<716467..>719784)
FT                   /locus_tag="KLTH0H08184g"
FT                   /old_locus_tag="KLTH-ORF1128"
FT   CDS_pept        complement(716467..719784)
FT                   /locus_tag="KLTH0H08184g"
FT                   /old_locus_tag="KLTH-ORF1128"
FT                   /product="KLTH0H08184p"
FT                   /note="similar to uniprot|P36775 Saccharomyces cerevisiae
FT                   YBL022C PIM1 Mitochondrial ATP-dependent protease involved
FT                   in intramitochondrial proteolysis involved in degradation
FT                   of misfolded proteins in mitochondria required for
FT                   bigenesis and maintenance of mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30373"
FT                   /db_xref="GOA:C5E2W2"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027503"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2W2"
FT                   /protein_id="CAR30373.1"
FT                   /translation="MLSKGSLSAFRQAYRRPQLLQVRLASSIARASCGISKVIAPLEQQ
FT                   HWSAYQQQMRSAVLSSELKTLESQWLRSMQLKSEKNNEDESTESKTPGKNTEEDNGDED
FT                   PSRPVREEADDESRLDGKYSHTSSAAADGAGTSAPSGGDGSGSGSSGNGDDGDDSKSSP
FT                   KKQKLPEVYPQMLALPIARRPLFPGFYKAVVISDDRVMKAIKEMLERQQPYIGAFLLKN
FT                   SDTDTDVIHSPDEVHDVGVFAQITSAFPSKDEKTGAETMTALLYPHRRIKIDELLPPME
FT                   NKESERGSAGALGEEELKSSSKQASKSEKKSLQTKKRSDVVDENVDEANPTEFLKNYQI
FT                   SLVNVSNLEDKQFDRKSPVINALTSEILKVFKEISQLNTMFREQIATFSASIQSATTNI
FT                   FEEPARLADFAAAVSAGEEEELQEILESLDIEQRLERSLVVLKKELMNAELQNKISKDV
FT                   ETKIQKRQREYYLMEQLKGIKRELGIDDGRDKLIETFKSRVEKLQLPENVQKVFDDEVN
FT                   KLATLETSMSEFGVIRNYLDWITSLPWGVTSKEQYSIPLAKKILDEDHYGLKDVKDRIL
FT                   EFIAVGKLLGKVDGKIICFVGPPGVGKTSIGKSIARSLNRQFFRFSVGGMTDVAEIKGH
FT                   RRTYIGALPGRVIQALKKCETQNPLILIDEIDKIGHGGIHGDPAAALLELLDPEQNNSF
FT                   LDNYLDIPIDLSKVLFVCTANSLETIPRPLLDRMEIIELTGYVAEEKIKIAEQYLSPSA
FT                   KRDAGLENAHVDISESAIVALMKYYCRESGVRNLKKHIEKVYRKAALNVVKQLKIDDNP
FT                   VNTVDESGKKTRASAGQSPKGEIVGSTESLAEKDGKLQVEKTHDNKEALVVPGDIEVNV
FT                   NAENLKDYVGPPIYTSDRLYETTPPGVVMGLAWTSMGGCSMYVESVLEQPITDKSIPSL
FT                   ERTGQLGDVMKESSRLAYSFARMFLTKKFPENRFFEKAAIHVHCPEGATPKDGPSAGVT
FT                   MASSFLSLALNKPLEPTVAMTGELTLTGKVLRIGGLREKAVAARRSGAKTIIFPKDNMN
FT                   DWADLPDHVKEGLEPLAADWYDQIFDKLFSDVSKESGDSVWKAEFDKIDAKEAKNKS"
FT   gene            complement(<719957..>720508)
FT                   /locus_tag="KLTH0H08206g"
FT                   /old_locus_tag="KLTH-ORF1124"
FT   CDS_pept        complement(719957..720508)
FT                   /locus_tag="KLTH0H08206g"
FT                   /old_locus_tag="KLTH-ORF1124"
FT                   /product="KLTH0H08206p"
FT                   /note="similar to uniprot|P13434 Saccharomyces cerevisiae
FT                   YBL021C HAP3 Subunit of the heme-activated glucose-
FT                   repressed Hap2p/3p/4p/5p CCAAT-binding complex a
FT                   transcriptional activator and global regulator of
FT                   respiratory gene expression contains sequences contributing
FT                   to both complex assembly and DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30374"
FT                   /db_xref="GOA:C5E2W3"
FT                   /db_xref="InterPro:IPR003956"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2W3"
FT                   /protein_id="CAR30374.1"
FT                   /translation="MDKEQEKRDLHNQFVAELREQDRWLPINNVGRLMKNTLPASAKVS
FT                   KDAKECMQECVSEFISFVTSEANDRCTTDKRKTINGEDILISLNALGFENYAEVLKIYL
FT                   AKYRQQQALKNQMTYMRRDGESEDLESGSQDEDPASNTAGLEASKEGQVMASDPSNDKE
FT                   PNKGASKDASHFDQDSQLYL"
FT   gene            <720642..>722345
FT                   /locus_tag="KLTH0H08228g"
FT                   /old_locus_tag="KLTH-ORF1122"
FT   CDS_pept        720642..722345
FT                   /locus_tag="KLTH0H08228g"
FT                   /old_locus_tag="KLTH-ORF1122"
FT                   /product="KLTH0H08228p"
FT                   /note="similar to uniprot|P38206 Saccharomyces cerevisiae
FT                   YBL020W RFT1 Flippase essential integral membrane protein
FT                   that is required for translocation of Man5GlcNac2-PP-Dol
FT                   from the cytoplasmic side to the lumenal side of the ER
FT                   membrane mutation is suppressed by expression human p53
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30375"
FT                   /db_xref="GOA:C5E2W4"
FT                   /db_xref="InterPro:IPR007594"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2W4"
FT                   /protein_id="CAR30375.1"
FT                   /translation="MEKRGQVSQHESMLKRSAKGVTFLMFSQLFSKIVTFILNTLLVRY
FT                   LSPRVFGINAFLEFLLSTVLFFSREAIRMSTLRIKSPVAASSATEDDPETDDAGPGVLQ
FT                   TAINFAYIPLCIGVPLSLVLIGWQYSNLNEYFLSLPYFKLSIAMIWLSIIFELLNEPFF
FT                   VVNQLMLNYKVRSQLESIAVVVSCIANFSIVYVYENKFNGSGIALHDATKQEGIAILAF
FT                   AVSKLVHSTALLCCYYYDYLTRLAPAKKFNISPSKVQLSAGTQPYYLQSEVLQHFKKVY
FT                   LQLCFKHLLTEGDKLIINSMCSVEEQGIYSLLSNYGSLLTRLLFAPIEESLRLFLARLL
FT                   SVTSTKNTKLSMDVLVNLTKFYLYLSLLILVFGPTNSPFLLQFLIGSKWSSTSVLDTIQ
FT                   VYCLYLPFLSINGIFEAFFQSVASGEDILRQSYFMIASSGVFLLSCWLLISQYKMSLEG
FT                   LIFSNIINMLLRIGFCGRFINAFYKRVYSDPASHDSTFLLNFSNLKAVSLVALVIALSN
FT                   YFLFGVVKTFGQLSINAIMAFGLLSLILYKEKDIIRSYLKQSKRDEVKDA"
FT   gene            <722463..>724001
FT                   /locus_tag="KLTH0H08250g"
FT                   /old_locus_tag="KLTH-ORF1121"
FT   CDS_pept        722463..724001
FT                   /locus_tag="KLTH0H08250g"
FT                   /old_locus_tag="KLTH-ORF1121"
FT                   /product="KLTH0H08250p"
FT                   /note="similar to uniprot|P38207 Saccharomyces cerevisiae
FT                   YBL019W APN2 Class II abasic (AP) endonuclease involved in
FT                   repair of DNA damage homolog of human HAP1 and E. coli
FT                   exoIII"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30376"
FT                   /db_xref="GOA:C5E2W5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR010666"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2W5"
FT                   /protein_id="CAR30376.1"
FT                   /translation="MSEIPNKEGHDVRFLTFNVNGIRTLFHYHPFSSMNSSLSRVFEYF
FT                   QSDIITFQELKTDTLSLSKWGKVDGFHSFISLPLKRKGYAGVGCWVRIPKPGDSMFSAL
FT                   QVTKAEEGITGYLQVRVGKTATKYRDNQAVGIGGYEALGIEDEADALSIDSEGRCVMVE
FT                   LKCNMVVISTYCPANSSLTDEGEEMRIRFLKVLFRRIRNLQALGKRVVLMGDINVCRDL
FT                   IDHAEALKETHIFVTDLTKGTQVEQTYSAFVKDFIFAPSRPARRLLNEMLADSVLKPFA
FT                   ESGSLIDTTRYIQGRDRMKMYTVWNTLRNSRPVNYGSRIDYILATAGLKNDLKKADIWP
FT                   KIMGSDHCPVFADIQLHYEAEGGPGDPCLAPPFEAKHRHNLNHRDILSMFSRPTKSNLK
FT                   DSNNFGPGPYRVQKNTSATAQARLLSTSSIHRSIISNESRTKNAGSSSIKKPEPFFQML
FT                   NGMLGKPPLCKHNENAILRTSKTKNNPGKKFWACARPTGDENNKEASCSFFQWK"
FT   gene            complement(<724024..>724338)
FT                   /locus_tag="KLTH0H08272g"
FT                   /old_locus_tag="KLTH-ORF1120"
FT   CDS_pept        complement(724024..724338)
FT                   /locus_tag="KLTH0H08272g"
FT                   /old_locus_tag="KLTH-ORF1120"
FT                   /product="KLTH0H08272p"
FT                   /note="similar to uniprot|P38208 Saccharomyces cerevisiae
FT                   YBL018C POP8 Subunit of both RNase MRP which cleaves pre-
FT                   rRNA and nuclear RNase P which cleaves tRNA precursors to
FT                   generate mature 5' ends"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08272g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30377"
FT                   /db_xref="GOA:C5E2W6"
FT                   /db_xref="InterPro:IPR020347"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2W6"
FT                   /protein_id="CAR30377.1"
FT                   /translation="MTWRQFINNALKKSHGLFGEGCEFYFINQQNTTAYIKVFHKDADK
FT                   FSSAVSTFISDEELVGLPLVVHMIQATKALGNLQVEDSDLIWLKNAVREESEDADYISS
FT                   "
FT   gene            complement(<724705..>729315)
FT                   /locus_tag="KLTH0H08294g"
FT                   /old_locus_tag="KLTH-ORF1118"
FT   CDS_pept        complement(724705..729315)
FT                   /locus_tag="KLTH0H08294g"
FT                   /old_locus_tag="KLTH-ORF1118"
FT                   /product="KLTH0H08294p"
FT                   /note="similar to uniprot|P32319 Saccharomyces cerevisiae
FT                   YBL017C PEP1 Type I transmembrane sorting receptor for
FT                   multiple vacuolar hydrolases cycles between the late-Golgi
FT                   and prevacuolar endosome-like compartments"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30378"
FT                   /db_xref="GOA:C5E2W7"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031777"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2W7"
FT                   /protein_id="CAR30378.1"
FT                   /translation="MIAFKLLLLVWASIALAKWEPRVTSTKSSLSFTLQVFDDSTTLMT
FT                   IDHGKLKISHDNGLNWDVLDQLGRRVSRVEVDRNYPKSRAFAVDAEGKVVYKTDDKGQH
FT                   WEKLNFDSPIVGDENDAPLSMTAYFETNPLSDGDILVHVAGCDIVDGNFLHCSSSKRVF
FT                   VSSNGKDFSLVESLKAESEEKDGEEVFSVFCRFDGFKPEDSEAGDAHGIVCEVDSMETK
FT                   DSETVRSSKVFQSSDYGKTLQIPHGFEDLNIVSLIHVGDYNVITTVEDKYNPDSASQLW
FT                   ISRDGLNYEKAVIPTRTGRYTFVLKFGSSSKELALQNNAFTDSGEKTPSVLISTSNGTK
FT                   FTPLTEAAAVGYYSLSGVGNQEGVVAYTVSTPNYSDESKESPDKAKISFDNGKTWSNLR
FT                   IDDPDHEFDCDTSDPENCYLRPLWFLEDWRNSHVTTTPGISACVAEVIGDSGKPSSFEN
FT                   VKTFITGNGGYSWHKILDFPASVVFGDYGNIILAVPFSPDNDGDPAAEFYYSLDQGNTW
FT                   SEYQFKEPLYFINFVPTALDGSGATFILQAATPTGRDDGRFLTVDFSDAFDGNKCTDSD
FT                   MGEWYTNGGGCVSGSKHKFRRRKEDAKCLVKELFKDLEPTEETCDCTKSDYECSPEFSL
FT                   NKDGECVLDRNLLEISGTCGGENKDRKIKLLPMVLERGNKCRAPLKIDTIEIDCGAYFE
FT                   GGEPSPIKIEEHTLDFGLKSYQYFDTIADETLLLGSDNHEVYISYDSGQTTQKLDFQDK
FT                   IIEVVFNQYFNTSAYLFGSSNKLYVTHDRARSFKEYKLPDAKQLGFPLTFHAKDVDTFI
FT                   FYGAKDCDSLFSPNCHAVAYITKDGGKRFRELTQGALRCEFIGSINDDSADPDMIMCLV
FT                   KDKGANERHVVTSSNFFENQKTVFENAIGFISAGEYTIIAVPHDNDELRAYVTVDGREF
FT                   AEASLPAELNIDKQQAYTVLGSQEGAIFFHLTTEMKQGSEYGALMKSNSNGTSFVVLER
FT                   AVNRGSSGFVDFEKALGLEGIIMINTVSNAEEVSSGSGVQKKLKSKISFNDGADWIYLS
FT                   PPERDSEGKKYQCDSKSLSSCSLNLHGYTERKDERDTYSSGSALGYMIGVGNVGEYLLP
FT                   KEECSTFITTDGGFTWKEIKKGSYQWEFGDRGSVIVLVKDQQKTDLITYSVDSGKTWND
FT                   YKFAGEELYVEDIITTPQDSAMRFLLIGKSSSISGKDTKTFTVDFTQSFDRQCQLDRDY
FT                   QYRVFGDCLFGHQAEYLQKVNDNCYNGAAPLEGMKKIVKNCSCTRSDFECDYNYYKAND
FT                   GTCKLVKGLEPADPSQICKKDSDLIEYFEITGYRKIPLSTCEGGLRLDVASKSHACPGK
FT                   EKEFKNKYGVSGRHILYIMIAPVLIFIGAAWFVYERGIKRNGGLSRFGEIRLGDDDLVE
FT                   ENFTDRVVNSVVRVGVFGFSALAASKQLVQRNAVNAWQRLKLRIQGGRGGPSYSSLTHE
FT                   QLLDEADELLAGHDEDANDLASFIDSEGDYDIGAEELPQTHSPAPYTDHEPSDHETSSH
FT                   ETADHNNENGGNSNEV"
FT   gene            <730027..>731094
FT                   /locus_tag="KLTH0H08316g"
FT                   /old_locus_tag="KLTH-ORF1112"
FT   CDS_pept        730027..731094
FT                   /locus_tag="KLTH0H08316g"
FT                   /old_locus_tag="KLTH-ORF1112"
FT                   /product="KLTH0H08316p"
FT                   /note="similar to uniprot|P16892 Saccharomyces cerevisiae
FT                   YBL016W FUS3 Mitogen-activated protein kinase involved in
FT                   mating pheromone response activated by phoshporylation by
FT                   Ste7p provides specificity during the mating vs.
FT                   filamentous growth response by phosphorylating
FT                   transcriptional and cytoplasmic targets"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30379"
FT                   /db_xref="GOA:C5E2W8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2W8"
FT                   /protein_id="CAR30379.1"
FT                   /translation="MGKKIVFNISSEFQLQQMLGEGAYGVVCSARHLPTGQMVAIKKIE
FT                   PFDRPLFCLRTLREIKLLRCFQHENIISIFDIQRPASFETFSEVYIIQELMDTDLHRVI
FT                   TTQTLSDDHVQYFVYQILRALKCLHGAEVIHRDLKPSNLLVNANCDLKLCDFGLARCAG
FT                   GGTKPGDAGHMTEYVATRWYRAPEVMLTAAEYTFAMDVWSCGCILAELLMRRPLFPGKD
FT                   YHHQLLLIFQVIGSPTAGDLGCVRSKRARQYLNTLPRYAGDGNLRSLVPDASAEALDLL
FT                   EQMLVFDPRRRITASQALKHPYLQAYHDPQDEPATAKVDPALFHFDERKDKLGAGDLKR
FT                   LLWDEIFGKRERTDS"
FT   gene            <732210..>733784
FT                   /locus_tag="KLTH0H08338g"
FT                   /old_locus_tag="KLTH-ORF1104"
FT   CDS_pept        732210..733784
FT                   /locus_tag="KLTH0H08338g"
FT                   /old_locus_tag="KLTH-ORF1104"
FT                   /product="KLTH0H08338p"
FT                   /note="highly similar to uniprot|P32316 Saccharomyces
FT                   cerevisiae YBL015W ACH1 Acetyl-coA hydrolase primarily
FT                   localized to mitochondria required for acetate utilization
FT                   and for diploid pseudohyphal growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30380"
FT                   /db_xref="GOA:C5E2W9"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2W9"
FT                   /protein_id="CAR30380.1"
FT                   /translation="MTISSVLKKRVRYAPYLERLVQPQELVPLFRTGQNLGWSGFTGVG
FT                   APKIVPQVLADHVATNSLQGQLRFNLFVGASAGPEESRWAELDMISRRSPHQVGKPISR
FT                   AINDGRIQFFDKHLSMFPQDLTYGFYTRERPAGAPILDYAIIEATAIKEDGSIVPGPSV
FT                   GASPEFVAVADKVILEVNTATPSFEGMHDIDMPVNPPHRPPYPYMSVDQRNGLDSIPID
FT                   PAKVVAIVESNQRDIVPPNTEADDASRAIASHLIGFLEHEVTCGRLPANLHPLQSGIGN
FT                   IANAVIEGLSSASFKNLTVWTEVLQDSFLDLFENGSLDFATATSIRLTEPGFRRFFDNW
FT                   DEFSKKLCLRSQVVSNNPELIRRLGVIAMNTPVEVDIYAHANSTNVSGSRMLNGLGGSA
FT                   DFLRNAKLSIMHTPAARPSKTDPTGISTIVPMASHVDQTEHDLDIVVTDQGLADLRGLS
FT                   PTERAREIINHCAHPDYKPILTDYLDRAEFYARKHKCLHEPHILKNAHKFHINLAEKGT
FT                   MKVDSWD"
FT   gene            complement(<734055..>734128)
FT                   /locus_tag="KLTH0H08360r"
FT                   /old_locus_tag="Klth0H.tIle_AAT_31"
FT   tRNA            complement(734055..734128)
FT                   /locus_tag="KLTH0H08360r"
FT                   /old_locus_tag="Klth0H.tIle_AAT_31"
FT                   /note="tRNA-Ile (AAT) cove score=71.40"
FT   gene            <734831..>735364
FT                   /locus_tag="KLTH0H08382g"
FT                   /old_locus_tag="KLTH-ORF1098"
FT   CDS_pept        734831..735364
FT                   /locus_tag="KLTH0H08382g"
FT                   /old_locus_tag="KLTH-ORF1098"
FT                   /product="KLTH0H08382p"
FT                   /note="similar to uniprot|P40081 Saccharomyces cerevisiae
FT                   YER134C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30381"
FT                   /db_xref="GOA:C5E2X0"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010036"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2X0"
FT                   /protein_id="CAR30381.1"
FT                   /translation="MPYPEVAAFDLDYTVWPCFCDTHLNPPFKPVTGKNGEVHTLIDSY
FT                   GYEVAFYKDVPRILADLKSHGVKIVSASRTWAPDIARDLLRGFKVEYEGEIVPLITLFD
FT                   SLQWGERSKVNHISLGIKDIFGKKADIKDYKCCLFDDESRNRDVERYGVKYVYVRDPEK
FT                   GTTWDLYQRYLSGN"
FT   gene            <735510..>735582
FT                   /locus_tag="KLTH0H08404r"
FT                   /old_locus_tag="Klth0H.tLys_CTT_1"
FT   tRNA            735510..735582
FT                   /locus_tag="KLTH0H08404r"
FT                   /old_locus_tag="Klth0H.tLys_CTT_1"
FT                   /note="tRNA-Lys (CTT) cove score=77.79"
FT   gene            <736141..>736248
FT                   /locus_tag="KLTH0H08426r"
FT                   /old_locus_tag="Klth0H.tPro_TGG_2"
FT   tRNA            join(736141..736176,736213..736248)
FT                   /locus_tag="KLTH0H08426r"
FT                   /old_locus_tag="Klth0H.tPro_TGG_2"
FT                   /note="tRNA-Pro (TGG) cove"
FT   gene            complement(<736894..>738819)
FT                   /locus_tag="KLTH0H08448g"
FT                   /old_locus_tag="KLTH-ORF1095"
FT   CDS_pept        complement(736894..738819)
FT                   /locus_tag="KLTH0H08448g"
FT                   /old_locus_tag="KLTH-ORF1095"
FT                   /product="KLTH0H08448p"
FT                   /note="highly similar to uniprot|P10592 Saccharomyces
FT                   cerevisiae YLL024C SSA2 member of 70 kDa heat shock protein
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30382"
FT                   /db_xref="GOA:C5E2X1"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2X1"
FT                   /protein_id="CAR30382.1"
FT                   /translation="MSKAVGIDLGTTYSCVAHFSNDRVEILANDQGNRTTPSFVAFTDT
FT                   ERLIGDAAKNQAAMNPANTVFDAKRLIGRNFTDAEVQGDVKHFPFKVVDVGGKPQIQVE
FT                   FKGETKVFTPEEISSMILTKMKETSENYLGCKVNDAVVTVPAYFNDSQRQATKDAGTIA
FT                   GLNVLRIINEPTAAAIAYGLDKKSEGEKNVLIFDLGGGTFDVSLLSIEDGIFEVKATAG
FT                   DTHLGGEDFDNRLVNHFVQEFKRKNKKDLTSNQRALRRLRTACERAKRTLSSSAQTSIE
FT                   IDSLFEGIDLYTSITRARFEELCADLFRSTIDPVEKVLRDAKLDKSQVHEIVLVGGSTR
FT                   IPKVQKLVSDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSKTQDLLLLDVAPLSL
FT                   GIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERARTKDNNLLGKFD
FT                   LSGIPPAPRGVPQIEVTFDVDANGILNVSAVEKGTGKSEKITITNDKGRLSKEDIERMV
FT                   SEAEKFKEEDEKEAARIGAKNQLESMAFSLKNTISEAGDKLEAADKETLTKKCDEVVSW
FT                   LDSNTTATTEEYNDQLKELQEVSNPIMSKLYQQGGAAPGGAAPGGFPGGSAPAPEAEGP
FT                   TVEEVD"
FT   gene            complement(<739626..>740438)
FT                   /locus_tag="KLTH0H08470g"
FT                   /old_locus_tag="KLTH-ORF1090"
FT   CDS_pept        complement(739626..740438)
FT                   /locus_tag="KLTH0H08470g"
FT                   /old_locus_tag="KLTH-ORF1090"
FT                   /product="KLTH0H08470p"
FT                   /note="similar to uniprot|Q12164 Saccharomyces cerevisiae
FT                   YLL023C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30383"
FT                   /db_xref="GOA:C5E2X2"
FT                   /db_xref="InterPro:IPR005344"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2X2"
FT                   /protein_id="CAR30383.1"
FT                   /translation="MPPSQGVPRHFQVSRFLELLKTSQFAWFAGHLVALASAFLYLVTF
FT                   RGGSSGAHNTFYRVLYLGVIESFGIIIYQQHFKRGTPAAGASSAGPRPPVLQLILRDDN
FT                   ALYVALAFMWLLTPRLSLTMFPYVVFSFFHFLTYLKSVILPQVFEIGAKSRLVMAIDKF
FT                   VRENSDRSMVWSSFSELVCLALVLMRALLWYPKSWITAIVYCLFIKIRYETSPYMKSGV
FT                   KKWEVRLDGLVSHPQVPAALKNGYVLFKNNIRELRKYNLSGTAPPKSM"
FT   gene            complement(<740579..>741580)
FT                   /locus_tag="KLTH0H08492g"
FT                   /old_locus_tag="KLTH-ORF1089"
FT   CDS_pept        complement(740579..741580)
FT                   /locus_tag="KLTH0H08492g"
FT                   /old_locus_tag="KLTH-ORF1089"
FT                   /product="KLTH0H08492p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30384"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019544"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2X3"
FT                   /protein_id="CAR30384.1"
FT                   /translation="MGGREEIKHLLAEAAKFYAARDYEKSTNLYSEVNALHDTLTGTSS
FT                   ADYLFLYGKSLFQLALSQSEVFGKDEETAGGESDSDEEESSKKHELYQFSETLAEGDEI
FT                   EKGDDAEQDDEEVEGEHPGENEHEGAGDEGQEEEPSDFENAWEILELARSVYEKQPQEP
FT                   ETLRKLSETYDILGEISLETENFPQAKQDFEKCLELRQAVYGTVDATHRLIIESYYKLS
FT                   LVLEFDPNDAKDCQENLSKAVELLEKRIKEKGAEGGDDGLLEELKLKLKELKTTEASLN
FT                   AIKHQSMAQIKEALGLPSDSKSAPAAVNDLTSMVKKRKSKPEKDTASKKQKN"
FT   gene            <741823..>743307
FT                   /locus_tag="KLTH0H08514g"
FT                   /old_locus_tag="KLTH-ORF1087"
FT   CDS_pept        741823..743307
FT                   /locus_tag="KLTH0H08514g"
FT                   /old_locus_tag="KLTH-ORF1087"
FT                   /product="KLTH0H08514p"
FT                   /note="similar to uniprot|P32457 Saccharomyces cerevisiae
FT                   YLR314C CDC3 Component of the septin ring of the mother-
FT                   bud neck that is required for cytokinesis septins recruit
FT                   proteins to the neck and can act as a barrier to diffusion
FT                   at the membrane and they comprise the 10nm filaments seen
FT                   with EM"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30385"
FT                   /db_xref="GOA:C5E2X4"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2X4"
FT                   /protein_id="CAR30385.1"
FT                   /translation="MQAGEPIEELKSAASTENEFGSVSADVKEENMPDAIEPASSVNGH
FT                   GSDVASEGEVQQKGQVLPKQPELRVLHHKISGYVGFANLPKQWHRKSIRRGFSLNLLCV
FT                   GQGGLGKSTLINTLFNKQLYDLEGKPTEDLAALKLEDSENLSESLERPQGEEQPSVKIE
FT                   TISTDIEENGVKLALTVVDAPGFGDAIDNTDSWVPIVREIDSRFDQYLDAENRIDRDVI
FT                   QDHRIHACLYFIEPTGHCLAPLDLEFCKAVHQKCNLIPVIAKSDILTDEEIEQFKHTIK
FT                   TQLDNAGVELFEPPQYSLDDKDTVARCAALCTRMPFAVVGSTSEVSTPDGRRVRGRSYP
FT                   WGVIEVDNESHSDFVHLRDLLIRLYLMELREKTENVLFERYRSEKLMSLGIKQDNSVFK
FT                   EYDPELKQKEEKQLHEAKLAKLEAEMKAVFQQKVNEKEKKLQKSEAELFARHKEMKDKL
FT                   LKQLKALEDKKHQLEMSYANQSANSPAQTKKKGFLR"
FT   repeat_region   743818..744059
FT                   /locus_tag="KLTH0H08536t"
FT                   /old_locus_tag="Klth0H.LTR.3"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            <744117..>744208
FT                   /locus_tag="KLTH0H08558r"
FT                   /old_locus_tag="Klth0H.tPhe_GAA_3"
FT   tRNA            join(744117..744153,744173..744208)
FT                   /locus_tag="KLTH0H08558r"
FT                   /old_locus_tag="Klth0H.tPhe_GAA_3"
FT                   /note="tRNA-Phe (GAA) cove"
FT   gene            <744429..>744500
FT                   /locus_tag="KLTH0H08580r"
FT                   /old_locus_tag="Klth0H.tPro_AGG_4"
FT   tRNA            744429..744500
FT                   /locus_tag="KLTH0H08580r"
FT                   /old_locus_tag="Klth0H.tPro_AGG_4"
FT                   /note="tRNA-Pro (AGG) cove score=66.45"
FT   gene            <744917..>749275
FT                   /locus_tag="KLTH0H08602g"
FT                   /old_locus_tag="KLTH-ORF1083"
FT   CDS_pept        744917..749275
FT                   /locus_tag="KLTH0H08602g"
FT                   /old_locus_tag="KLTH-ORF1083"
FT                   /product="KLTH0H08602p"
FT                   /note="weakly similar to uniprot|P23201 Saccharomyces
FT                   cerevisiae YLL021W SPA2 Component of the polarisome which
FT                   functions in actin cytoskeletal organization during
FT                   polarized growth acts as a scaffold for Mkk1p and Mpk1p
FT                   cell wall integrity signaling components potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30386"
FT                   /db_xref="InterPro:IPR013724"
FT                   /db_xref="InterPro:IPR022018"
FT                   /db_xref="InterPro:IPR039892"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2X5"
FT                   /protein_id="CAR30386.1"
FT                   /translation="MVTSKADLTAEQRGQLYGYFCELRDFFQVTGTKHDRSNSARAQKA
FT                   RSKLLKLYPSQFFELSTDVHDELQRRIDENQAQPDHLLPKDTFHVKRNQARQKLANLSQ
FT                   SRFNDLVDDILYEIKRRNYHEKPEHKGTDISEKYSGGTPTSSSHFEGVFSGDEAGNHTK
FT                   DTGETSDASQADIHNQKNGYTIAPEMVLSDTNESPSKITPNASVQASQVIPKKASIEWS
FT                   SDEEDEDDSHKPKQVSDKEQDSPVSNSQTGETTIQSPLFSSKDADRLHFSENENGFNKH
FT                   ASPSREENYTFSEEFSSQSPLFSSSKKTKRFSELEDDLNHSRKSISGNENGLLGQSPPQ
FT                   SPLFSLQHRETDGNPELLSASELKDDRKEVEAAHSWGNYSEGHASGKALQGALADDLLP
FT                   VSRGLPEDRRAAPNTSSTNDDNVGNTSRTSHPGRTSNESGTSINAYTGNRGSIKRASLE
FT                   HENSKREIEVLMAEGTKMDMRITELENSNSILSSAKNELDRRIQDHQSEILELKSRLEK
FT                   SSKEAEDAKAEVLRLTEQEVKEGDSLGKSIDQSHQEEFARLTKQVNSLSIENEELKQKN
FT                   AELEFKMKLLNSSNRKDEKSISPSTRQKAVGSDRLKEKELLSDPEALKRYSSEDGLLPL
FT                   DLILSFNKQIETIFYHLHDKQHLPAFGDQLFEDISRISELIHKTIKLVDVSDHQDQVIL
FT                   LKASLSHAITSVRYFASYHDILPPITVESAISDISFAVCGLLDVVKIIDAPQAVISKQH
FT                   LSEPSPQTPIMKNMKSSSSLAGEEANSGLKDPRGINKHAIEESNNSMSPVKPLKITQKV
FT                   VQNSPPTKPTISARKPSSTLFTSMLSPSLSNNSSPRNSQFSNLRFASGAKSEEDVRIDK
FT                   GSESKSHSQTDKEDSARSPEGGISVKEKMDNSLQEASKNGNNSGLSAQERLFLNGKENH
FT                   NLSKGEESRKIEKRVDSIIPTSETKSSVPEKFNRGPDFSLCAASGGDTTDDQYNHKSDA
FT                   SNTTSDEDLTYQALKQSMKKNHEIAGEKKIESSMPSKKPEGKINVPKLRSSLDSSPKRG
FT                   GGDSDGVSALKTIQGAVHAKESPAEPPRIIKQVITTQMEGPPDETDADIETSPFRFDDA
FT                   MALERSVNHKSPTKNLELSPLKNSEVKVKDRAVATTENRAFDVENSAIEINDTNSRAPS
FT                   GAVNGFSKQKENLSLDENSKKKQIKPFLEGVKKGTDANAQKTSPNPSTTQSSSTSQPII
FT                   KVSNFGSEGSPAARTVVKEEEIEDVRNVPAINRAKSTSSNNQKSSARLSNTSLAEKEYE
FT                   DEGDFDIDAFDIENPDNTLSELLLYLEHQTIEVISTIQSLLTSIKQPQASTGELRKGSG
FT                   AITRVIAQMIEATSVSMAQSRNAPLKEHGNWVVQSLEDCQRRMTTLCRLKRDGTVEVNE
FT                   GDSDYADKHFKQRLAGIAFDVAKCTKELVKTVEEASLKEEIEFLNSKISS"
FT   gene            complement(<749443..>750159)
FT                   /locus_tag="KLTH0H08624g"
FT                   /old_locus_tag="KLTH-ORF1076"
FT   CDS_pept        complement(749443..750159)
FT                   /locus_tag="KLTH0H08624g"
FT                   /old_locus_tag="KLTH-ORF1076"
FT                   /product="KLTH0H08624p"
FT                   /note="similar to uniprot|P36523 Saccharomyces cerevisiae
FT                   YLR312W-A MRPL15 Mitochondrial ribosomal protein of the
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30387"
FT                   /db_xref="GOA:C5E2X6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="InterPro:IPR040030"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2X6"
FT                   /protein_id="CAR30387.1"
FT                   /translation="MLQVTKRQTGVLTGIIKANFGARNITYLHSGSRVRGLKRDPSEYL
FT                   RLQNGLMYNEVKPENYQENVRKQLNLAKHNISLSDDIILQCLTHKSFAHGSKPYNEKLA
FT                   ALGMQFLKYHTSVHSLRSAKPLSPVAEGKNQKSINGLNFTNLGTQLSKLLIAKKTTAQV
FT                   IRSRHLDSLIFWKKRDPLKNESFNGETTVYSGVLSALVGGILVTNGPQKTSQFIEKELL
FT                   DPKKEASLVQIAKTMA"
FT   gene            <750413..>752113
FT                   /locus_tag="KLTH0H08646g"
FT                   /old_locus_tag="KLTH-ORF1074"
FT   CDS_pept        750413..752113
FT                   /locus_tag="KLTH0H08646g"
FT                   /old_locus_tag="KLTH-ORF1074"
FT                   /product="KLTH0H08646p"
FT                   /note="highly similar to uniprot|P45818 Saccharomyces
FT                   cerevisiae YGL171W ROK1 ATP-dependent RNA helicase of the
FT                   DEAD box family required for 18S rRNA synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30388"
FT                   /db_xref="GOA:C5E2X7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2X7"
FT                   /protein_id="CAR30388.1"
FT                   /translation="MDIFQVLTRGANVKKNGKLGASGDFSKSNGSQRKQIQAGSTRKED
FT                   DNKQLTKELDFFRNKKVVSKTENAQAGKHDPAEDIAAEVSTLGDEMPPPKISSAHDAVL
FT                   LRKSYKGNVTGQDLPLPIGSFEDLITRFQFDKRLLSNLIESHFTEPTPIQCEAIPLALE
FT                   GRDVLACAPTGSGKTVAFILPLLQQIISLGDKEGLKGLIISPTKELANQIFVECSKLSH
FT                   KIYLARKRPLNIALLSKSLSAKLRNKVISDKKYDLIISTPLRLIDVVKNEALDLSDVKH
FT                   LIFDEADKLFDSTFVEQADSILASCQDSQLRKSMFSATVPSSLEEVVNSIMLDPVRIII
FT                   GHKEAANVNIEQKLVYCGNEEGKLVAIRQMIQEGGFKPPVIIFLESITRAKALFHELLY
FT                   DNLNVDVIHAERTQVQRNTIIERFRTGELWCLICTDVLARGVDFKGVNLVINYDVPRSA
FT                   QAYVHRIGRTGRGGREGKAVTFYTKQDDMAIKPIINVMRQSGFEIAEWMEKFAKMTKRE
FT                   KEALKKGKSRPERKQISTVPNVVKKKRRQREQMVEASKKRKEQDDEERS"
FT   gene            complement(<752358..>752717)
FT                   /locus_tag="KLTH0H08668g"
FT                   /old_locus_tag="KLTH-ORF1071"
FT   CDS_pept        complement(752358..752717)
FT                   /locus_tag="KLTH0H08668g"
FT                   /old_locus_tag="KLTH-ORF1071"
FT                   /product="KLTH0H08668p"
FT                   /note="highly similar to uniprot|Q12233 Saccharomyces
FT                   cerevisiae YPR020W ATP20 Subunit g of the mitochondrial
FT                   F1F0 ATP synthase which is a large enzyme complex required
FT                   for ATP synthesis associated only with the dimeric form of
FT                   ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08668g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30389"
FT                   /db_xref="GOA:C5E2X8"
FT                   /db_xref="InterPro:IPR006808"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2X8"
FT                   /protein_id="CAR30389.1"
FT                   /translation="MLARIQSFATGIASKAQTYTTKTFYYSKVVGELSKQVYLKEGLQP
FT                   PAISDFQSVYTKLYKQALDLALKPRQSLSLFKNIQKDSVLKYGAYGVQLAGLYSLGEVI
FT                   GRRKVVGYTNYAAHH"
FT   gene            complement(<753192..>755921)
FT                   /locus_tag="KLTH0H08690g"
FT                   /old_locus_tag="KLTH-ORF1070"
FT   CDS_pept        complement(753192..755921)
FT                   /locus_tag="KLTH0H08690g"
FT                   /old_locus_tag="KLTH-ORF1070"
FT                   /product="KLTH0H08690p"
FT                   /note="highly similar to uniprot|P30665 Saccharomyces
FT                   cerevisiae YPR019W CDC54 Essential helicase component of
FT                   heterohexameric MCM2-7 complexes which bind pre-
FT                   replication complexes on DNA and melt the DNA prior to
FT                   replication accumulates in the nucleus in G1 homolog of S.
FT                   pombe Cdc21p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30390"
FT                   /db_xref="GOA:C5E2X9"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008047"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2X9"
FT                   /protein_id="CAR30390.1"
FT                   /translation="MSDNRSSPAHDGGSSPMAAPPSSLGGSSPPLFYNPSSSSQPDTYE
FT                   SQQRQHAVGSSPFRYPSSSQGHPHATSDTFASQRRSQRSSGFGRFTDQSSEPDLLSSSL
FT                   SGHASQRSSQRRSDLHASDLSSPRRIVDLDSQPAPSSSSDPVSEAAEPLRIIWGTNVSI
FT                   QECATNFRNFLMSFKYKYRKVLDQNEDLINDTEDQELYYVKRLNQMMEMGSLNLNLDAR
FT                   NLLSFKPTEKLYYQLMSYPQEIISIMDQTVKDCMVSLVVDSNAESTLDDVESKFYKIRP
FT                   YNIETKKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTTVVEIDRGV
FT                   IQEPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDEL
FT                   VDSCRAGDRIEITGIFRSIPVRASSTQRALRSLYKTYLDVVHVKKVAHDRLGADTSTVE
FT                   QELMQNELIHADVQEVPKVSDDQIRKIHAVAARDDVYEVLARSIAPSIFELDDIKKGIL
FT                   LQLFGGTNKTFTKGGRYRGDINILLCGDPSTAKSQILQYVHKIAPRGVYASGKGSSAVG
FT                   LTAYVTRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKA
FT                   GIITTLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEATDR
FT                   DLAKHLTNLYLEDAPANETEGDVLPVELLTTYINYAKQQYAPVITEQAKTELVRAYVTM
FT                   RKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSQLVELQDVQEAVRLIKSAIKDY
FT                   ATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREMVNILRERPNNTISYNELVRSINEQSQ
FT                   DKVDVTDISEALSRLQQEDKVVVLGEGVRRSIRLNGRI"
FT   gene            complement(<756097..>757845)
FT                   /locus_tag="KLTH0H08712g"
FT                   /old_locus_tag="KLTH-ORF1067"
FT   CDS_pept        complement(756097..757845)
FT                   /locus_tag="KLTH0H08712g"
FT                   /old_locus_tag="KLTH-ORF1067"
FT                   /product="KLTH0H08712p"
FT                   /note="some similarities with uniprot|Q12495 Saccharomyces
FT                   cerevisiae YPR018W RLF2 Chromatin Assembly Complex subunit
FT                   1: largest (p90) subunit of three-subunit protein complex
FT                   (yeast CAF-I) involved in DNA-replication- linked
FT                   nucleosome assembly. Homol. to p150 subunit human Chromatin
FT                   Assembly Factor-I (CAF-I) p90 subunit of yeast Chromatin
FT                   Assembly Factor-I (CAF-I)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30391"
FT                   /db_xref="InterPro:IPR022043"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Y0"
FT                   /protein_id="CAR30391.1"
FT                   /translation="MASILSDSSLSDVGSPEVPTVAEQITSSDLLGNLKDEQESREGPQ
FT                   SSQSLTDESESPQRSKDADQLRSLEGVESTNSEIEKAAATKVRKEEAKKLREQLKQEQK
FT                   LQKELKKEQERKDKELKKEQERREKEQRKLEEKKRKEEEKKERERRREEEKRSRELKRE
FT                   QEKREREVRREEEKRRKLVEKLKIEEEKRKKEEAIEKSQTRIGSFFKKSSTHKNVVSTK
FT                   TDFEKSFLPFYIKDGTIMGENFKSSPKDLERSKAEIDAQMKLSSNEDDTIKWLESCRVS
FT                   RGHPVMKSAVELIQMMTSKNKTNKELEQHLQQIPHKFIKFYENVRPPYIGTYSKFVDMP
FT                   RDNPFTIELTGFDYDYDSDWDWVDEEEEEGGGVDDLEDGDEEEDDDDEPEEGTDGEFEG
FT                   FLDREDSQGPRDGKKFLGPLIPTIKLRSQISELDEDDQLYFQMVAVEYLIKEQPFPVDP
FT                   AHYPVASSKRSLVEASLPTKGSKDSPTDDGTSDARSKKPKTLVTEPVDLLRLFNEVHES
FT                   TFSLGTITEILQKNLPHYSKETIRNTIKEHTTRPATKAGGSRKWVLKNLDHWEALKRSH
FT                   GSFSAN"
FT   gene            complement(<758082..>759479)
FT                   /locus_tag="KLTH0H08734g"
FT                   /old_locus_tag="KLTH-ORF1064"
FT   CDS_pept        complement(758082..759479)
FT                   /locus_tag="KLTH0H08734g"
FT                   /old_locus_tag="KLTH-ORF1064"
FT                   /product="KLTH0H08734p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30392"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Y1"
FT                   /protein_id="CAR30392.1"
FT                   /translation="MSEGDSDCDLSELSHGLTQLSLRPANRSAASPARGARAPAKSALP
FT                   KADSSSRVHLASVRNENYHLKLELTQKSQELEALRRQMQSLEKRKQMLGSTDGLLSLRN
FT                   MKVHTWEPAGSPTRPHQSTLSECEIVTHFSGSPYKGERLGSQQDTASRASTSNSRVRRN
FT                   HNFFRNFVVPFLQRNIDAFRHSDMFCDEAANLGQKLEEFKIHGSKNKELKVQLMMDILD
FT                   GLNHLQQQCVAVLNRELQAKKVSSQLEFLFTVFLDPEQYGLVRQAHVEKLRQELYDVML
FT                   QLWDYDGRRPLSQEGSPSRKPTISGLPAKQMPRSGKIPKLQPQGFGKMARTLRKTPCDL
FT                   PVAPSGVLENPRSTEFSPSNKPRAANRLDPLNNAYASERSRLKQNRDALEFIPIGYNEV
FT                   MLSKKTPDRRPKSRSKLQESIHMTPLTRCANNEEEMETDSLQVFITEFFKDTQSQDDST
FT                   TTVASNF"
FT   gene            <759812..>760219
FT                   /locus_tag="KLTH0H08756g"
FT                   /old_locus_tag="KLTH-ORF1059"
FT   CDS_pept        759812..760219
FT                   /locus_tag="KLTH0H08756g"
FT                   /old_locus_tag="KLTH-ORF1059"
FT                   /product="KLTH0H08756p"
FT                   /note="similar to uniprot|P32601 Saccharomyces cerevisiae
FT                   YPR017C DSS4 Nucleotide release factor functioning in the
FT                   post-Golgi secretory pathway required for ER-to-Golgi
FT                   transport binds zinc found both on membranes and in the
FT                   cytosol guanine nucleotide dissociation stimulator"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30393"
FT                   /db_xref="GOA:C5E2Y2"
FT                   /db_xref="InterPro:IPR007515"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR011323"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Y2"
FT                   /protein_id="CAR30393.1"
FT                   /translation="MTKLRCPFAGCDSCIVSAEEGRKVVLPAEVYDKLRLALPSNQAPR
FT                   SGEFSVFEDIWDFDNIGVSRQVPTEIEAAAENAQELRFTWKERPYTLGKLQKYLICADC
FT                   DRGPLGIVCEILDAEGARETVNLLSLASVLA"
FT   gene            <760522..>761259
FT                   /locus_tag="KLTH0H08778g"
FT                   /old_locus_tag="KLTH-ORF1054"
FT   CDS_pept        760522..761259
FT                   /locus_tag="KLTH0H08778g"
FT                   /old_locus_tag="KLTH-ORF1054"
FT                   /product="KLTH0H08778p"
FT                   /note="highly similar to uniprot|Q12522 Saccharomyces
FT                   cerevisiae YPR016c TIF6 translation initiation factor 6
FT                   (eIF6) singleton"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30394"
FT                   /db_xref="GOA:C5E2Y3"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Y3"
FT                   /protein_id="CAR30394.1"
FT                   /translation="MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDA
FT                   IPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSAL
FT                   GNVICCNDYVALVHPDIDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHP
FT                   QTSIQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIF
FT                   RLQDAQPDSISGNLRDTLIETYS"
FT   gene            <762417..>762923
FT                   /locus_tag="KLTH0H08800g"
FT                   /old_locus_tag="KLTH-ORF1044"
FT   CDS_pept        762417..762923
FT                   /locus_tag="KLTH0H08800g"
FT                   /old_locus_tag="KLTH-ORF1044"
FT                   /product="KLTH0H08800p"
FT                   /note="some similarities with uniprot|Q6Q5F4 Saccharomyces
FT                   cerevisiae YPR015C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30395"
FT                   /db_xref="GOA:C5E2Y4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Y4"
FT                   /protein_id="CAR30395.1"
FT                   /translation="MGLIEERGRDASQERGRGESQERGGRSLSEILREVKKPEIRSRAR
FT                   RGEGDAARDPHVPPPLTPTPPLVHTPPMVHTPPLPQSALPFAHMAPLAHPAALAVPARA
FT                   PPSATLHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKIH
FT                   DKPRD"
FT   gene            <764077..>764176
FT                   /locus_tag="KLTH0H08822r"
FT                   /old_locus_tag="Klth0H.tLeu_TAG_5"
FT   tRNA            join(764077..764113,764133..764176)
FT                   /locus_tag="KLTH0H08822r"
FT                   /old_locus_tag="Klth0H.tLeu_TAG_5"
FT                   /note="tRNA-Leu (TAG) cove"
FT   gene            <764341..>765294
FT                   /locus_tag="KLTH0H08844g"
FT                   /old_locus_tag="KLTH-ORF1036"
FT   CDS_pept        764341..765294
FT                   /locus_tag="KLTH0H08844g"
FT                   /old_locus_tag="KLTH-ORF1036"
FT                   /product="KLTH0H08844p"
FT                   /note="similar to uniprot|Q12251 Saccharomyces cerevisiae
FT                   YPR011C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30396"
FT                   /db_xref="GOA:C5E2Y5"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Y5"
FT                   /protein_id="CAR30396.1"
FT                   /translation="MAQENGWTRALRSDASVAFIAGGVAGAVSRTVVSPFERVKILLQV
FT                   QSSTHAYNQGIFGAVRQVYAEEGVPGLLRGNGLNCVRIFPYSAVQFVVYEFCKKQWFER
FT                   GAADGRAPQQMQNWQRLLSGALCGGCSVLATYPLDLVRTRLSIQTANLASLQRAKAANV
FT                   AKPPGVWELLENTYKNEGGVVGLYRGVWPTSIGVVPYVALNFAVYEQLREFIPPSVDPG
FT                   WASVFKLTIGALSGGVAQTITYPFDLLRRRFQVLAMGQNELGFRYKSVTDALVTIGRTE
FT                   GFKGYYKGLTANLFKVVPSTAVSWVVYEAVRDLMQA"
FT   gene            <765552..>766033
FT                   /locus_tag="KLTH0H08866g"
FT                   /old_locus_tag="Klth0H.mRNA.723.p"
FT   CDS_pept        join(765552..765584,765830..766033)
FT                   /locus_tag="KLTH0H08866g"
FT                   /old_locus_tag="Klth0H.mRNA.723.p"
FT                   /product="KLTH0H08866p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30397"
FT                   /db_xref="GOA:C5E2Y6"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Y6"
FT                   /protein_id="CAR30397.1"
FT                   /translation="MRPTSLLLNAAKKQKSGFDIPVELTPLFVAMGVAVSSACWFTYKK
FT                   FRWDESLRVGRKNPDRSGLKTILEEPEKFEKKE"
FT   gene            complement(<766403..>768265)
FT                   /locus_tag="KLTH0H08888g"
FT                   /old_locus_tag="KLTH-ORF1030"
FT   CDS_pept        complement(766403..768265)
FT                   /locus_tag="KLTH0H08888g"
FT                   /old_locus_tag="KLTH-ORF1030"
FT                   /product="KLTH0H08888p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30398"
FT                   /db_xref="GOA:C5E2Y7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Y7"
FT                   /protein_id="CAR30398.1"
FT                   /translation="MEFEESSQEASAVRVGSRVRSTWQKILHKFTTREGLLGDYDYAFL
FT                   FTPSYPFKDWVNRKRGIEPMHRDQPFFSVHSEMPILLGLLLGLQHSLAMLAGVITPPII
FT                   ISSVANFPMEVQQYLVSASLIVSAIMSSIQITRFHIPYTPYYIGSGLLSVVGTSFATIT
FT                   IVEKAIPVMYTSGFCPMEADGTKGACYAGYGALLGTAACCALLEVAMSFTPPKVLQKVF
FT                   PKIVTGPVVLCIAVSLIQSGFNDWVGGSGCVGAICPSEGAPMAGEWGSARFIGLGFLVF
FT                   TTIVTCEKWGSPIMKSCAVIVGLIVGCIVAAACGYFDHSSIDSAPAATFLWVHTFPLKV
FT                   YGPIVLPMLVMYIVLAQECIGDVTATCDVSRMEVEGEIYETRIQGAVLSDGLSGILSAL
FT                   FTLPPMSTFAQNNGVISLTKCANRQVGYWCCFFLLLMGIFAKFGAALVSIPKPVLGGMT
FT                   TFLFTSVAVSGLKIISTIPFTRRDRFVLTGTLLFGFGAILVPNWFETFFHYSGSNQSLQ
FT                   GFLDAIILIMETGFAIAGVIGIILNLMIPQELDEDLMDDIEIQQGNLTALEGQRSALAE
FT                   GGPVLTGKAKEAMSKDNGVSNPQNSFEGKDDRIFVSAGETSPST"
FT   gene            complement(<768960..>769820)
FT                   /locus_tag="KLTH0H08910g"
FT                   /old_locus_tag="KLTH-ORF1026"
FT   CDS_pept        complement(768960..769820)
FT                   /locus_tag="KLTH0H08910g"
FT                   /old_locus_tag="KLTH-ORF1026"
FT                   /product="KLTH0H08910p"
FT                   /note="similar to uniprot|P53212 Saccharomyces cerevisiae
FT                   YGR021W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08910g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30399"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Y8"
FT                   /protein_id="CAR30399.1"
FT                   /translation="MLRLLKPGRCPSALRLFSTCSARLSGHNKWSTIKHDKAKNDAEKN
FT                   KLFNKFANQIALAVKLGGGSTDPALNIRLAAAIESANKNNVTKRVVENAIKKGSGAGGK
FT                   DGSKSGSCVYEGMGPGGVAFVVEALTDNKNRTIGLVRSTFSKVNGSMTPTLYFFDRKGY
FT                   IIVQPPQELDDFDQVFEKVLEHEGVEDLEQVDPENDALAAEDLAPGFASSVYELSTEPA
FT                   ATNQVASSLKQHGFHIKEVGIGYVPKSDMLVDVQNEDTMKSVEKFMGQLDEIDDVTDFY
FT                   CNLRK"
FT   gene            <770159..>770515
FT                   /locus_tag="KLTH0H08932g"
FT                   /old_locus_tag="KLTH-ORF1024"
FT   CDS_pept        770159..770515
FT                   /locus_tag="KLTH0H08932g"
FT                   /old_locus_tag="KLTH-ORF1024"
FT                   /product="KLTH0H08932p"
FT                   /note="highly similar to uniprot|P39111 Saccharomyces
FT                   cerevisiae YGR020C VMA7 Vacuolar H ATPase subunit F of the
FT                   catalytic (V1) sector"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30400"
FT                   /db_xref="GOA:C5E2Y9"
FT                   /db_xref="InterPro:IPR005772"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Y9"
FT                   /protein_id="CAR30400.1"
FT                   /translation="MSENRSLIAIIGDEDTCTGLLLAGVGQISPSSQEKNFFMYQEGKT
FT                   TREEILGAFDKFTQERDDIAILLINQHVAEKIRGQVDSYTAAFPAVLEIPSKEHPYDPE
FT                   KDSVLKRVRRLFGE"
FT   gene            complement(<770614..>772521)
FT                   /locus_tag="KLTH0H08954g"
FT                   /old_locus_tag="KLTH-ORF1023"
FT   CDS_pept        complement(770614..772521)
FT                   /locus_tag="KLTH0H08954g"
FT                   /old_locus_tag="KLTH-ORF1023"
FT                   /product="KLTH0H08954p"
FT                   /note="some similarities with uniprot|Q12114 Saccharomyces
FT                   cerevisiae YLR330W CHS5 Protein of unknown function
FT                   involved in chitin biosynthesis by regulating Chs3p
FT                   localization also involved in cell fusion during mating"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30401"
FT                   /db_xref="GOA:C5E2Z0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR031669"
FT                   /db_xref="InterPro:IPR031673"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Z0"
FT                   /protein_id="CAR30401.1"
FT                   /translation="MASVEVSLTVGRLDASLALLTTKNHHVIEFPTMLLPDNIKAGSIV
FT                   KIQVAEDADLERQELEQFQTLQDEILEKYGTHSPQSPVLKVVNVTQTSGVLGWEPIELG
FT                   SAQLKSLLLYKDGVRSLMIPNPFKTTATKISGLSVDSEYTFQLKLCTTSGDLWSEKITL
FT                   HTHKMTDMSGITACLGALDGIEGITREHIENSLKEIGAKPLQSHVTIDTTHFISNDKDS
FT                   DDDEFHKAQQSNVPIVRPEWVRACELERRIVGVRGFYLDADPNNLASYKFLKLPPKEGQ
FT                   QPVSNAAEDGNVMATDSKSLKEPVEEGEDAVNGDISESATPIQAEKGSREDTVINDSAE
FT                   LKTEDEGTQASQVKLDEAVTNPEYDDGMPEADVAEPAAEFAAEPAAEPVAEPAAESVAE
FT                   SITETAAEPIAESTEEPAEEPAEEPAEEPAEEPAEEPAEEPADEPAEEPADEPEVPVKA
FT                   EAEIESINNEDINTSRVNTELDESQDAQAVAENAGFHDQPPANTETTVTGEKDLQEAAD
FT                   ENAGDFASRQEAEIQEASSTIEPNGMSEVGAVAPTSSQELRHGNAEEDEARAAGTQLDQ
FT                   VEVVGEDNSQLNQKEESTDVSAAEESAEPNASLPKPEANGTQTSSKKKKNKKNKKKGKK
FT                   "
FT   gene            complement(<772894..>774309)
FT                   /locus_tag="KLTH0H08976g"
FT                   /old_locus_tag="KLTH-ORF1018"
FT   CDS_pept        complement(772894..774309)
FT                   /locus_tag="KLTH0H08976g"
FT                   /old_locus_tag="KLTH-ORF1018"
FT                   /product="KLTH0H08976p"
FT                   /note="highly similar to uniprot|P17649 Saccharomyces
FT                   cerevisiae YGR019W UGA1 Gamma-aminobutyrate (GABA)
FT                   transaminase (4-aminobutyrate aminotransferase) involved in
FT                   the 4-aminobutyrate and glutamate degradation pathways
FT                   required for normal oxidative stress tolerance and nitrogen
FT                   utilization"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30402"
FT                   /db_xref="GOA:C5E2Z1"
FT                   /db_xref="InterPro:IPR004631"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Z1"
FT                   /protein_id="CAR30402.1"
FT                   /translation="MSVAAKYYPSEPASPSVVTTSIPGPKSQEELAKLGKVFDARPAYF
FT                   MTDYEKSVGNYIVDADGNTYLDLYAQIASIALGYNNPALIKAAQSPEMVRALVDRPALG
FT                   NFPSKDLAPILEKILKFAPKGQDHVWSGLSGADANELAFKAAFIYYRSKQRGYDTEFST
FT                   EENQSVMKNAEPGSPHLAVLSFKKAFHGRLFASGSVTCSKPIHKLDFPAFQWPHAEYPS
FT                   YKFPLTENEEANRAEDDRCLKIVEDLITSWSIPVAALIIEPIQSEGGDNHASKYFLQSL
FT                   RDLTLKHGVVYIVDEVQTGVGATGKFWCHEWADIQPPVDLVTFSKKFQSAGYFFHDPKF
FT                   IPNKPYRQFNTWCGEPARMIIAGAIGQEIVDNKLLEQCSRVGDYLFSKLEALQSKYPEK
FT                   FQRLRGQNRGTFIAWDLPSAAERDALLKSLKLHGCNVGGCAELSVRLRPSLTFEEKHAD
FT                   IFVDALSKAVSEL"
FT   gene            complement(<774665..>775600)
FT                   /locus_tag="KLTH0H08998g"
FT                   /old_locus_tag="KLTH-ORF1015"
FT   CDS_pept        complement(774665..775600)
FT                   /locus_tag="KLTH0H08998g"
FT                   /old_locus_tag="KLTH-ORF1015"
FT                   /product="KLTH0H08998p"
FT                   /note="similar to uniprot|P53210 Saccharomyces cerevisiae
FT                   YGR017W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30403"
FT                   /db_xref="GOA:C5E2Z2"
FT                   /db_xref="InterPro:IPR024624"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Z2"
FT                   /protein_id="CAR30403.1"
FT                   /translation="MIHQMAPWVPQFIQSWKNHSQPFAPFTFATLDMQSNRPKCRTVIF
FT                   RDFLFHDKRSNVLTFTTDMRGDKVKEILGSGAETAPFEACFYFPSSWEQYRFSGKCFVV
FT                   SRQSKPLITHTFNGAESGAIEYPILSPSIYGDAHVLYQHEHVDESEDEHVQNDEEHNGT
FT                   SADNETEPDVASVRPELSRTSTRSSGPAAHHAVLTPAEYAPPTPKEWDLELARQWADLS
FT                   RSTKAQFRKPHPGTPVTSETSKQLDKIQRGVDGAKENTGFDNFGVVCLCIDEVDFLNLK
FT                   DGRGGERWKFRRHVEEDSHLESWIEEEVCP"
FT   gene            complement(<775981..>776598)
FT                   /locus_tag="KLTH0H09020g"
FT                   /old_locus_tag="KLTH-ORF1010"
FT   CDS_pept        complement(775981..776598)
FT                   /locus_tag="KLTH0H09020g"
FT                   /old_locus_tag="KLTH-ORF1010"
FT                   /product="KLTH0H09020p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30404"
FT                   /db_xref="GOA:C5E2Z3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Z3"
FT                   /protein_id="CAR30404.1"
FT                   /translation="MVRLTIALGSKCATRHYTVAARPQTGFSLLNLRIGFASQVGAHPN
FT                   SDKMFVSQIKVSNGGADAFKQVCSGLRGFVTREDLEGSLLVLVDNMKKCKLRGEVSEAM
FT                   ILCGDDSVSGIVQPCKPANFDLTLVGQPVVLEGTPAGAQPTSRRIKNNEWLEVSSRLYV
FT                   DNKARVVYKDPETQTETPLCVYNEEKAIPILVGSVSPGSPVR"
FT   gene            <776732..>777460
FT                   /locus_tag="KLTH0H09042g"
FT                   /old_locus_tag="KLTH-ORF1009"
FT   CDS_pept        776732..777460
FT                   /locus_tag="KLTH0H09042g"
FT                   /old_locus_tag="KLTH-ORF1009"
FT                   /product="KLTH0H09042p"
FT                   /note="similar to uniprot|P13856 Saccharomyces cerevisiae
FT                   YGR152C RSR1 GTP-binding protein of the ras superfamily
FT                   required for bud site selection, morphological changes in
FT                   response to mating pheromone, and efficient cell fusion;
FT                   localized to the plasma membrane; significantly similar to
FT                   mammalian Rap GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09042g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30405"
FT                   /db_xref="GOA:C5E2Z4"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041841"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Z4"
FT                   /protein_id="CAR30405.1"
FT                   /translation="MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTME
FT                   IDNKVFDLEILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVLRIK
FT                   DSTRVPMVLVGNKADLQDERVISVEEGIEMSSNWGKVPFYETSALLRSNVDEVFVDAVR
FT                   QIIRNEIEAQNSSTAALGHMSRKNTGLGAASANAADPSAAQDTPKKQVTLNRPATAKQA
FT                   PGKPSTKRKTKKTKTSCVIL"
FT   gene            complement(<777657..>779027)
FT                   /locus_tag="KLTH0H09064g"
FT                   /old_locus_tag="KLTH-ORF1007"
FT   CDS_pept        complement(777657..779027)
FT                   /locus_tag="KLTH0H09064g"
FT                   /old_locus_tag="KLTH-ORF1007"
FT                   /product="KLTH0H09064p"
FT                   /note="similar to uniprot|P31755 Saccharomyces cerevisiae
FT                   YGL038C OCH1 Mannosyltransferase of the cis- Golgi
FT                   apparatus initiates the polymannose outer chain elongation
FT                   of N-linked oligosaccharides of glycoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09064g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30406"
FT                   /db_xref="GOA:C5E2Z5"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039367"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Z5"
FT                   /protein_id="CAR30406.1"
FT                   /translation="MLKFNKKERTILTSVVFLYVIASFQLSSWKLEKQFFRGFKTLIPT
FT                   ATEGQTINLKTFKPANMKGAPIAELRSQLTQQFPYDPSQPIPRRIWQTWKTPFNSPKMS
FT                   QGFKDFSGRWASAASEAPLYDYTLVPDDHIMPLLHNLYGAVPQIIQAFDSMPLNILKAD
FT                   FFRYLVLYARGGIYSDMDTFPLKALDEWPSIKTSRLPKPEVPIKYKGLDSASSPPTQEP
FT                   GFIAGIEADPDRDDWNDWYARRVQFCQWTIQSKPGHPLLRELIINITATTLASTNVKTN
FT                   IKAPDFIIDEGHKDDYFVNARGKKRLDSKFPPTQKKTAKNTDGTDTMNWTGPGVFSDAI
FT                   FNYLNNIIQTNPDIMIINNNLKANNMEDGSGTRKFYRKITEGLMSSATFVTEFFSLIEE
FT                   PVIVDDVMILPITSFSPGVNHMGSKPEDDDMAFVKHMFKGTWKNDPKPSSKGQRQQE"
FT   gene            complement(<779286..>779927)
FT                   /locus_tag="KLTH0H09086g"
FT                   /old_locus_tag="KLTH-ORF1004"
FT   CDS_pept        complement(779286..779927)
FT                   /locus_tag="KLTH0H09086g"
FT                   /old_locus_tag="KLTH-ORF1004"
FT                   /product="KLTH0H09086p"
FT                   /note="similar to uniprot|P53184 Saccharomyces cerevisiae
FT                   YGL037C PNC1 NAD( ) salvage pathway gene pyrazinamidase and
FT                   nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30407"
FT                   /db_xref="GOA:C5E2Z6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Z6"
FT                   /protein_id="CAR30407.1"
FT                   /translation="MGKALIVVDVQLDFLPPDGSLAVAAGDEIVDRIAELVKDPRWCVV
FT                   VATQDWHPVDHISFAKNHGLPEFSSYQYVSPVDRHETQQATLWPVHCVQGTPGAELAPA
FT                   LSESLQSLECDHHTVKKGYISDREYYSAFNDIWNDHRTELDGLLRKHGVNDVFVVGLAL
FT                   DYCVKNTALSAAALGYRTTILQDYTRAIASDSKSMCNLKQELVQNDITLK"
FT   gene            <780617..>783001
FT                   /locus_tag="KLTH0H09108g"
FT                   /old_locus_tag="KLTH-ORF1001"
FT   CDS_pept        780617..783001
FT                   /locus_tag="KLTH0H09108g"
FT                   /old_locus_tag="KLTH-ORF1001"
FT                   /product="KLTH0H09108p"
FT                   /note="weakly similar to uniprot|P53185 Saccharomyces
FT                   cerevisiae YGL036W Mtf1 Two Hybrid Clone 2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30408"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Z7"
FT                   /protein_id="CAR30408.1"
FT                   /translation="MVAAEMDALSRKRSESTDDPMAADMMLTVESSARILHSYPPSAAE
FT                   ALSAAYEFANAIRQLKPHQEPQVADLDVFTPLVQLCVSERDSKDILLDLLATTFAYCSV
FT                   HRTLAKLVRVFVSRSLHNQPVASQLRELCGSFATDYKPGFYSVISKLECYDRLDASVFR
FT                   ELQLNLGPTMRMTWIPLWTQETGIDLYSAVLSHNLLVSTSAEPKLDFLIASWAHATTEW
FT                   VGLKDRSNEALKSFIYQTARRTILFAKWIPGGFFKFCQQAIAEWIESDCLLKTETDVSF
FT                   SLSVVMEVLDHPDLNFLEEPHLALLLKVALRRIWHMCSEGQVQTLHFELGKMGATQSLP
FT                   GLLNITQYLTARFLLRVGSLAMSARNYNSNKEWMLQETSYQLPSFFDDIVPTIPPIPRS
FT                   TFSFVNNTIESELLANRHLETVSSLLDSLKCVLSINKMVLRHYNASEIQVLALKSSNPQ
FT                   KDTTIDNRSSLEVLQLYFISMTSALLLSRQLTEEQYLMVAEGQYEYTIQGRLIRREALA
FT                   CFETLIGTFKGISLFQLVKFSARVSMAELSLQKVSMQTLNFVFFEASFSVTQVPSLTNK
FT                   LTVQSLYEYINLWNDGSPIFRPFYTEMFRVPQPLVKCVQVELERFLCLLTFEVKKDSSA
FT                   PTPTTSRGTESKNNGYVPKYNAHASSFIPASKAGSKPSMDIEKSFGTQASNQLIPLSAD
FT                   FPRQLSICHERTEDAGSAFAAQRYSGSADSTTPGSAQAPSPFSARRWDSNCFSQGLNNS
FT                   PETSSAVVSTGKDYILGGHNKATNNSRAQSVHVDRFDYVRQ"
FT   gene            <783260..>785347
FT                   /locus_tag="KLTH0H09130g"
FT                   /old_locus_tag="KLTH-ORF997"
FT   CDS_pept        783260..785347
FT                   /locus_tag="KLTH0H09130g"
FT                   /old_locus_tag="KLTH-ORF997"
FT                   /product="KLTH0H09130p"
FT                   /note="similar to uniprot|P48234 Saccharomyces cerevisiae
FT                   YGR145W ENP2 Essential nucleolar protein of unknown
FT                   function contains WD repeats interacts with Mpp10p and
FT                   Bfr2p and has homology to Spb1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30409"
FT                   /db_xref="GOA:C5E2Z8"
FT                   /db_xref="InterPro:IPR012580"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040382"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Z8"
FT                   /protein_id="CAR30409.1"
FT                   /translation="MVLKSTSASDNSVYQVSGTNVSRSLPDWIAKKRKRSLKHDLEYQN
FT                   RVELIQDFEFSEASNKVKCTPDGQFAMATGTYKPQIHLYDFANLSLKFERHTDAENVDF
FT                   LILSDDWTKSVHLQNDRSIQFQNKGGLYYTTRIPKFGRSIAYNKANCGLYVGASGDELY
FT                   RLNLEQGRFLNPFKLDSEGVNHVSVNDVNGLVAVGMEDNVVEFWDSRARARAAKLLLEN
FT                   SYDSSPFQVTATSFRNDGLNFACGTSTGYSYLYDLRASQPMIVKDQGYGFDIKKIIWLD
FT                   NTGAENGNNNILTCDKRIAKIWDRNSGKPFASMEPSVDINDIEHVPGTGMFFTANEGIP
FT                   LHTYYIPNLGPAPKWCSFLDSITEELEEKPSDTVYSNYRFITREDVKKLGLNHLIGSKV
FT                   MRAYMHGYFINSELYDKVSLIANPNSYRDEREREVRRRIEKERESRIRTSGAVKKPAVK
FT                   INKVLVDKLSQKRGDKIADNVLADDRFKEMFEDEDFQVDEDDYDYKQLNPVKSARETEE
FT                   GAEKRIRALTAAEESDEERIAIKEGRGHYSDSESEESESDEEKGSEEMTEKEKKALAKQ
FT                   IAVTQRRKREKEKADKFMNQMSVGADDRLSQEAQDLTFDRKVAQLRREEQREKRQEPAV
FT                   RRNHQGEAEFSFVPSKKKPAGKKKVTFDSDGDEAENKKDSGRSKPRFQGRRASKNVFRG
FT                   M"
FT   gene            <785536..>787242
FT                   /locus_tag="KLTH0H09152g"
FT                   /old_locus_tag="KLTH-ORF993"
FT   CDS_pept        785536..787242
FT                   /locus_tag="KLTH0H09152g"
FT                   /old_locus_tag="KLTH-ORF993"
FT                   /product="KLTH0H09152p"
FT                   /note="similar to uniprot|P40357 Saccharomyces cerevisiae
FT                   YGR009C SEC9 t-SNARE protein important for fusion of
FT                   secretory vesicles with the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30410"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2Z9"
FT                   /protein_id="CAR30410.1"
FT                   /translation="MGIKRFFKIKPPEEDTPEVNRDNLIEQGIPTKNVNRTKKEKFAAY
FT                   GKFAKDKAEDKFYAPPGYENFGKSNPPVLDDLNKSEVDSDAGNAYMREPSKNDFDPYAR
FT                   NNFTNSSAAADPYGKQPYDPYGKQPSDPYGKQSSDPYSSYSSNAYGNQPSGRSSGSATP
FT                   YADPYTQGRGPSAPALNAGNPYGQRPGNPYAGHSSFSSSTAGSAQPSQNPYSMMKSDPY
FT                   SAGASSTNVPAPQKPNPYVSREASRSSRPSAAPEDDQFDFETSAAAPKIRNPDLNDDEI
FT                   DLNATLQDEGDDLNGSIHENYAGELGQTQLQQPDDTRGYQTFEDVQRQNQELQQQQEDE
FT                   EVDEIKQQIRFTKQSSVASTRNTLKMAQEAEMAGTNTLGMLGHQSEKLNNVERNLDLMK
FT                   MQNRVADDRVAELKKLNRNILAVHVSNPFTSKRRLREAEERIRNQRIEDKLMQKQTNGR
FT                   LHQSTNRIEGALNGASQDHDTIRQRYQNQAILEKAKRYQFENDEEDDEMELEIDKNLDK
FT                   VGQISGRLKRLAIAAGDEIDAQQNRVQNIEEDTDNMDIKIHLNTTRLTQIR"
FT   gene            complement(<787674..>788042)
FT                   /locus_tag="KLTH0H09174g"
FT                   /old_locus_tag="KLTH-ORF988"
FT   CDS_pept        complement(787674..788042)
FT                   /locus_tag="KLTH0H09174g"
FT                   /old_locus_tag="KLTH-ORF988"
FT                   /product="KLTH0H09174p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09174g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30411"
FT                   /db_xref="InterPro:IPR024368"
FT                   /db_xref="UniProtKB/TrEMBL:C5E300"
FT                   /protein_id="CAR30411.1"
FT                   /translation="MSAFNDFCIVCERLIDGSSRLYCSQACCERDTSAGRRKSVVESLV
FT                   ATPQLCPLDMDAEDSDGDEDFFELDYTSTVPTTLSSPRAFAKEQQGGYFSLARDVVFDH
FT                   TAENNYKLWLNAHGAHAG"
FT   gene            complement(<789919..>791301)
FT                   /locus_tag="KLTH0H09196g"
FT                   /old_locus_tag="KLTH-ORF981"
FT   CDS_pept        complement(789919..791301)
FT                   /locus_tag="KLTH0H09196g"
FT                   /old_locus_tag="KLTH-ORF981"
FT                   /product="KLTH0H09196p"
FT                   /note="some similarities with uniprot|P27705 Saccharomyces
FT                   cerevisiae YGL035C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30412"
FT                   /db_xref="GOA:C5E301"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5E301"
FT                   /protein_id="CAR30412.1"
FT                   /translation="MSSTDDTKGNKKRRSPNSGPDSPRPYICPICSRAFHRLEHQTRHI
FT                   RTHTGEKPHACDFPGCTKKFSRSDELTRHKRIHTNPHPKGKRGRKKKTETQSSGADTAV
FT                   QQGNLPRERATRPAPTFQLGGEDDDASDVNNPASSPEDQSMGILANAALKFQARSTDTP
FT                   LHSVRSLPSLKTLEANGMRVASPPGLAGAALPPHNSSTGNLQSVGSLLPARSTPSRLKL
FT                   NVLSSLQRMTPLAPVQAGNPGTAQYSSQTASASNSGTTTPYQSPEHPEYLGSCPPRHKT
FT                   YSSSASLTSISNLITTDDEDREFDEEEMGRARKKSRTTTPTISRSHSQTNLSSRTGTFT
FT                   NLASLNGVGQPPGITGILSSRPSSSDFSSELNQRLQSVQRSRSSQFLDRYASTPSVALS
FT                   GAPSAKFTPLGTPPQLASPPNARAVPTDLQGHSQSSHCIKTESEESMLPPIRSLDLQFP
FT                   TG"
FT   gene            <793572..>795695
FT                   /locus_tag="KLTH0H09218g"
FT                   /old_locus_tag="KLTH-ORF968"
FT   CDS_pept        793572..795695
FT                   /locus_tag="KLTH0H09218g"
FT                   /old_locus_tag="KLTH-ORF968"
FT                   /product="KLTH0H09218p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09218g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30413"
FT                   /db_xref="UniProtKB/TrEMBL:C5E302"
FT                   /protein_id="CAR30413.1"
FT                   /translation="MPVSSVVTAAPGAAATSTAVSSAPEGQPSAVSPVEPSVASSTVTT
FT                   PGTEATPSSVSSSASAFSPSSSSSLPPLSSASPSFASPSSSSTSPSSPNPPADTTSSSS
FT                   LSPSSSPVSSLLSSASPSSSSSSSLTLVQESAYTTVTVTLTTTEFFTNHEAVSTYYSEE
FT                   QVSVPTTVLLSYSPVYTTQYVEGTTISVPVTTISSEYVVTPTTILYSTVETSSPTTFTE
FT                   ESVLYSTISSPTATVYDAQETVIEYITETSVFTTTFSTIITTLGPVAVTSHYTESGTTE
FT                   IVSPSVYTSFVTYTTTAEHTSIGLATSTAVSTRTYTTTITAAVTSAPGPAATGSVPTVT
FT                   STSTAYTTYVITEPDSTYVITRDIDMETTFETVAPATITSEYLTTLLDVPLSTSIIKPS
FT                   VLYSNKTETDTVIVYEAISLVSLARTVLTTEVTVLTTSTIESQTLETITAPGQLVTRVV
FT                   PVSPEIITLRKRCEACEELPQTTFQSVLSEEVQSNYVYTTTIVADEPTVVVNCNLETSY
FT                   STITTDYVVAHASVYSTFGTYTTEVATTSVGTTVYSYPVTKTLSASSSDILYNVEVVPV
FT                   ATSTLVLTSYLPLEQEVAYTTVTGAPVTASETASYGASIIPGSSTVYIISSTPIYSTSY
FT                   FVTTEEEPVSTAFSDEVVTETITSTSVSVATLPGAVIVPANAGNSIGVPAVTLGWQCIA
FT                   TVASIVLLSAIVV"
FT   gene            <796183..>796934
FT                   /locus_tag="KLTH0H09240g"
FT                   /old_locus_tag="Klth0H.mRNA.at.278.p"
FT   CDS_pept        join(796183..796234,796342..796934)
FT                   /locus_tag="KLTH0H09240g"
FT                   /old_locus_tag="Klth0H.mRNA.at.278.p"
FT                   /product="KLTH0H09240p"
FT                   /note="similar to uniprot|P53187 Saccharomyces cerevisiae
FT                   YGL033W HOP2 Meiosis-specific protein that localizes to
FT                   chromosomes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30414"
FT                   /db_xref="GOA:C5E303"
FT                   /db_xref="InterPro:IPR010776"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040461"
FT                   /db_xref="UniProtKB/TrEMBL:C5E303"
FT                   /protein_id="CAR30414.1"
FT                   /translation="MSSKKKAEKAPQAKGAEAESIIESYLIEQYRPFAVNDIIQNLHNK
FT                   VSRTNTIKALESLTKQQRITCKTFGKIAIYVCNEQELTSTNIGTGTDVSIETVTQLREE
FT                   LLETEKDRSEYSAQLQGVMRHPPNEELLAIVEAKKAEVLEVNNMLQNLLSDWKPENEEL
FT                   IQTVRAYEQKIGKELSARKKILNSAIALMKEALSLKNIDEFLVRVMPGTFI"
FT   gene            <797482..>798405
FT                   /locus_tag="KLTH0H09262g"
FT                   /old_locus_tag="KLTH-ORF964"
FT   CDS_pept        797482..798405
FT                   /locus_tag="KLTH0H09262g"
FT                   /old_locus_tag="KLTH-ORF964"
FT                   /product="KLTH0H09262p"
FT                   /note="highly similar to uniprot|P78609 Pichia jadinii
FT                   Uricase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09262g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30415"
FT                   /db_xref="GOA:C5E304"
FT                   /db_xref="InterPro:IPR002042"
FT                   /db_xref="InterPro:IPR019842"
FT                   /db_xref="UniProtKB/TrEMBL:C5E304"
FT                   /protein_id="CAR30415.1"
FT                   /translation="MPYSYLESSTYGKDNVKFLKVKKDKTNPKVHEIMEATVCVLLKGD
FT                   FEISYTEADNAPIVPTDTVKNTILILAKKYDTFPIEKFAAKLALHFTSKYSHVSGLTVK
FT                   ITQDRWVKFDVDGKESQHSFVHQGPEKKITFLDYDKKNGPSNYSLSSSIKDLTVLKSTN
FT                   SMFYGYNVCDYTTLKPTTDRILSTDIFATMDWCPKKLGCLESIASGSKDEIFTNAYNSA
FT                   RDITLDIFAKENSPSVQATMYNMATAILKIAPQVAYVSYELPNKHYFLFDLKWFQGLEN
FT                   DNELFYPSPHPNGLIKCKVGRNGSKL"
FT   gene            complement(<798515..>799306)
FT                   /locus_tag="KLTH0H09284g"
FT                   /old_locus_tag="KLTH-ORF961"
FT   CDS_pept        complement(798515..799306)
FT                   /locus_tag="KLTH0H09284g"
FT                   /old_locus_tag="KLTH-ORF961"
FT                   /product="KLTH0H09284p"
FT                   /note="weakly similar to uniprot|P37293 Saccharomyces
FT                   cerevisiae YGR147C NAT2 N alpha-acetyl-transferase
FT                   transfers acetyl group from acetyl coenzyme A to the N-
FT                   terminal methionine residues of proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30416"
FT                   /db_xref="GOA:C5E305"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniProtKB/TrEMBL:C5E305"
FT                   /protein_id="CAR30416.1"
FT                   /translation="MLTFRNNKRSIYEIRSLLTKDQIENLSQFITHKQPPNHMSLFTRF
FT                   SRLACSKAIRSPALRWPSNIASSRFASTATKSEKPSLKNLMKTYGSSALVVYFGLSAID
FT                   LPICFFAVHSLGEETIRVYINRAKQIFGYGRDEQELIKDVRAQIEEKEQRKLSGEEQHN
FT                   TSLWERLKESTILTEFLIAYGIHKSLIILRLPVTAAITPATVKLLQKWGFNIGKFNKSF
FT                   QTAGDVAKFKNKTGRPEDFVKGNPIPKQTQTKGRKWFNGLM"
FT   gene            complement(<799475..>799753)
FT                   /locus_tag="KLTH0H09306g"
FT                   /old_locus_tag="KLTH-ORF960"
FT   CDS_pept        complement(799475..799753)
FT                   /locus_tag="KLTH0H09306g"
FT                   /old_locus_tag="KLTH-ORF960"
FT                   /product="KLTH0H09306p"
FT                   /note="similar to uniprot|P32781 Saccharomyces cerevisiae
FT                   YGL032C AGA2 Adhesion subunit of a-agglutinin of a-cells C-
FT                   terminal sequence acts as a ligand for alpha- agglutinin
FT                   (Sag1p) during agglutination modified with O- linked
FT                   oligomannosyl chains linked to anchorage subunit Aga1p via
FT                   two disulfide bonds"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30417"
FT                   /db_xref="GOA:C5E306"
FT                   /db_xref="InterPro:IPR014404"
FT                   /db_xref="UniProtKB/TrEMBL:C5E306"
FT                   /protein_id="CAR30417.1"
FT                   /translation="MKFSSVVTAYLAIFPSMCAAATVSWASVSCESISTGGTLETTPYS
FT                   SSTATILKNGKEMVGVYEFFQSVTYISDCNPSTRKTSAEPNPTITIY"
FT   gene            complement(<800260..>800727)
FT                   /locus_tag="KLTH0H09328g"
FT                   /old_locus_tag="KLTH-ORF958"
FT   CDS_pept        complement(800260..800727)
FT                   /locus_tag="KLTH0H09328g"
FT                   /old_locus_tag="KLTH-ORF958"
FT                   /product="KLTH0H09328p"
FT                   /note="similar to uniprot|P04449 Saccharomyces cerevisiae
FT                   YGL031C RPL24A and to uniprot|P24000 Saccharomyces
FT                   cerevisiae YGR148C RPL24B"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30418"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:C5E307"
FT                   /protein_id="CAR30418.1"
FT                   /translation="MKVEIDSFSGGKIYPGRGTLFVRGDSKIFRFQSSKSSSLFKQRKN
FT                   PRRIAWTVLYRRHHKKGITEEVAKKRSRKTVKAQRAIVGASLEFIKERRSLKTEVRKAQ
FT                   REDKKKADKEKKKADKEKRKAEKAKLAGTQGSKVSKQQAKGAFQKVAATSR"
FT   gene            <801551..>801925
FT                   /locus_tag="KLTH0H09350g"
FT                   /old_locus_tag="KLTH.mRNA.162AT.p"
FT   CDS_pept        join(801551..801553,801611..801925)
FT                   /locus_tag="KLTH0H09350g"
FT                   /old_locus_tag="KLTH.mRNA.162AT.p"
FT                   /product="KLTH0H09350p"
FT                   /note="highly similar to uniprot|P14120 Saccharomyces
FT                   cerevisiae YGL030W RPL30 Protein component of the large
FT                   (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30419"
FT                   /db_xref="GOA:C5E308"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:C5E308"
FT                   /protein_id="CAR30419.1"
FT                   /translation="MAPVKSQESINQKLALVIKSGKYTLGYKSTVKALRQGKSKLVIIA
FT                   ANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVTILDAGDSDILTTL
FT                   A"
FT   gene            complement(<802071..>802334)
FT                   /locus_tag="KLTH0H09372g"
FT                   /old_locus_tag="KLTH-ORF953"
FT   CDS_pept        complement(802071..802334)
FT                   /locus_tag="KLTH0H09372g"
FT                   /old_locus_tag="KLTH-ORF953"
FT                   /product="KLTH0H09372p"
FT                   /note="highly similar to uniprot|Q3E731 Saccharomyces
FT                   cerevisiae YLL018C-A COX19 Cytochrome c oxidase assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30420"
FT                   /db_xref="UniProtKB/TrEMBL:C5E309"
FT                   /protein_id="CAR30420.1"
FT                   /translation="MSGNPGNALKALSPTPPERGSFPLDHDGDCTKQMQEYLECIKLVK
FT                   GENAPNCRLLAKEYLNCRMDHRLMDRDEWKNLGLPDDAPDKK"
FT   gene            complement(<802549..>804354)
FT                   /locus_tag="KLTH0H09394g"
FT                   /old_locus_tag="KLTH-ORF952"
FT   CDS_pept        complement(802549..804354)
FT                   /locus_tag="KLTH0H09394g"
FT                   /old_locus_tag="KLTH-ORF952"
FT                   /product="KLTH0H09394p"
FT                   /note="similar to uniprot|P04802 Saccharomyces cerevisiae
FT                   YLL018C DPS1 Cytoplasmic aspartyl-tRNA synthetase
FT                   homodimeric enzyme that catalyzes the specific
FT                   aspartylation of tRNA(Asp) class II aminoacyl tRNA
FT                   synthetase binding to its own mRNA may confer
FT                   autoregulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09394g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30421"
FT                   /db_xref="GOA:C5E310"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5E310"
FT                   /protein_id="CAR30421.1"
FT                   /translation="MIYLIKFCSHFTKDEKGRPALKPQKSSLLSLAMSEAVAKAAEAVK
FT                   ESVEKVTEQVKDLTTQEPSEPVILGEDGQPLSKKALKKLQKEQEKQRKKEEKARQLAEE
FT                   KAQREREAAANDTAKENYGKLPLIQSASKTGVPRTKLEDLSEADDGKEVLIRARVHNSR
FT                   QQGATLVFLTLRQQAQLIQALAKSNAEGTISKQMVKWIGSVNPESIVLVKGVVKKVEEP
FT                   IKSATVQNLEIHITQIHTISEAPQQLPILIEDASRSDAEAETAGLPVVNLDTRLDARVI
FT                   DLRTATNQAIFRIQSGVCELFREFLAKRKFVEIHTPKLLGAPSEGGANVFEVTYFKGKS
FT                   YLAQSPQFYKQELIAADFERVFEVAPVFRAENSNTHRHMTEFIGLDLEMAFEEHYDEVI
FT                   DVLSELFVFIFSELKTRYAKEIALVRKQYPVEEFKLPKDGKMVRLAYKDGIAMLKAAGK
FT                   EVGELEDLSTENEKFLGALVREKYDTDFYILDKFPLEVRPFYTMPDPVDPRYSNSYDFF
FT                   MRGEEILSGAQRIHDANFLKERMSHHGLSPEDPGLKDYVDSFTYGCPPHAGGGIGLERV
FT                   VMFFLDLKNIRRASLFPRDPKRLRP"
FT   gene            <806836..>811422
FT                   /locus_tag="KLTH0H09416g"
FT                   /old_locus_tag="KLTH-ORF939"
FT   CDS_pept        806836..811422
FT                   /locus_tag="KLTH0H09416g"
FT                   /old_locus_tag="KLTH-ORF939"
FT                   /product="KLTH0H09416p"
FT                   /note="similar to uniprot|P04821 Saccharomyces cerevisiae
FT                   YLR310C CDC25 Membrane bound guanine nucleotide exchange
FT                   factor (GEF or GDP-release factor) indirectly regulates
FT                   adenylate cyclase through activation of Ras1p and Ras2p by
FT                   stimulating the exchange of GDP for GTP required for
FT                   progression through G1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09416g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30422"
FT                   /db_xref="GOA:C5E311"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036964"
FT                   /db_xref="UniProtKB/TrEMBL:C5E311"
FT                   /protein_id="CAR30422.1"
FT                   /translation="MSLSRVSSHDEQTPAARAGSTRPVDVVVATCDFTPTKKAQLRLSA
FT                   GDVVYVLGKNESGWWDGVTVCGRSPQRVARGWFPHNFTRSYREHKRGGLAAKCGAASSV
FT                   AGTRSNRSGGSSRRSSLAAPPMPGHMDFGSSMRLGTVSEPNLSPTDSHAPHLKQDYRFD
FT                   MRSNLAGQAGSRRPSMASGWSAGANSLSKSPSHSSNEQQSHGSQSQPQQVDPLQKSTAD
FT                   ERRRRSHVAETDKMNVLGTDEVQMIFSNIHDNSPPIWTPVPTTEGKILYYNRDYDIYCS
FT                   GLPLLQSPELNIKSVFSDHDWFVDIQERALTHNKKVLDKKEEPAGANGAATGPMSANTQ
FT                   STSQNTRNHSGSRRPSVDEKSKNYLAATIISDSAGTGSRNTKINALKSDNLSPKRVAGD
FT                   DTNTNTNSDSKAGIKTATENENDTEVAASDPGWWQKNPKHTLLAKEELFYHHRMDLRSW
FT                   TEMRDTTLYFARKAYASFFQNDYHQFNRNFEVTAKFSIYYHNACRLLKGELIKNNVKRE
FT                   VRRILRQMTDAVSAISINGNLFFSSPQRFDISFSPSVQQQQLQQRHKSSVGSTGTAIQD
FT                   PLRVSISTLNPLQPGDLQKLSISSNDILINEESQSLETKSKNDRDDRFGSVLSSYTIQA
FT                   HSTAFDENSKISIQALFQTIDAQFSRFMICVRNLDALMKTKCSGGDILPQLFPRFFRDG
FT                   FSGGAWTSTFQDQVISLTPRASLASLGSPLTGEAYQAVNNVFGSISSKAGTVESSILSK
FT                   STADNDRTSAIKGSPKAKNQKSLKFPLNEDTLALLKKRIDYFSTPTYASYGTLIDQPRT
FT                   NKRNLEISANCHRELSHSVVIIEMLENLDLRFFLNMRNLAYNHALDEDSEELRQHTMTS
FT                   SATLLMEFFDIKQALYDVTIKKVMDIQNLTLDDPFVFCSMAGDLSFGGEREEGSREEHV
FT                   LKQERLAEAYRKRLVAEDVEVNDMTYFNPDTEVKATQISFLAVIDSTYQVVEQLIQARE
FT                   NVLNYAARMMKNDLISELTRGEQEKIFEDDKIDAKTSDAEIEHIGPKDFGDSSFTSDVP
FT                   WYLDSEHEYSLIYDNQGRIKGGTKVALLEHLTSHRAIDASFNIAMLLSFRSIFTTSEFL
FT                   HALVERYHLYPPEGLSFEEYSAWIEKKSTPVKTRVVNILKTLFSNYWTPAYYEPGIDDL
FT                   VSFAQLATAQSISGAPALLVELKNRLSLKGNLKNFVPETIRFDESGHNYSGNALNPRVS
FT                   TGGPAEFGAGYGFRMRKLKLLDIDPQTFAKQLTTKEHYLYSKITPFECLDRIWSKKYCY
FT                   FGGSEDISKFISSANALTSYVSFAIVKQTNTKKRAKVLQHFISVAEYCYELNNFSSMTA
FT                   IVSALYSSPIFRLKKSWSAVPEDSKKVLENLNTLMDPAKNFITYRNWLKTVHDVACVPF
FT                   FGVYLSDLTFIAEGNPNCLHRSPEIINFSKRLRIVDILKEISSYQIIRYKFKRYDDIQS
FT                   FIEESMKNIPNIEKQYEQSLRLEPRTEVSAGLSSGGTGMSKTDLGKKLEKKSRFMKNKK
FT                   RPTKLVSL"
FT   gene            <811653..>814436
FT                   /locus_tag="KLTH0H09438g"
FT                   /old_locus_tag="KLTH-ORF937"
FT   CDS_pept        811653..814436
FT                   /locus_tag="KLTH0H09438g"
FT                   /old_locus_tag="KLTH-ORF937"
FT                   /product="KLTH0H09438p"
FT                   /note="similar to uniprot|Q06704 Saccharomyces cerevisiae
FT                   YLR309C IMH1 Protein involved in vesicular transport
FT                   mediates transport between an endosomal compartment and the
FT                   Golgi contains a Golgi-localization (GRIP) domain that
FT                   interacts with activated Arl1p-GTP to localize Imh1p to the
FT                   Golgi"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09438g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30423"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="UniProtKB/TrEMBL:C5E312"
FT                   /protein_id="CAR30423.1"
FT                   /translation="MFKQLSQLGKNLTDELAKGLTDELNEGQFDKNSDIPVEVQAKLRK
FT                   FEKYEQKYPLLLNAYKSEKAKSEKLAAVQKILSENTPISSIDDYDSLTSFFKNTNLKTD
FT                   MLNDEIKRLTSEKNEHLREIQDLRAQKDVAADKAFSEGHSEKSEGLEQVKQLEQKISEY
FT                   LKDIESLKHELAAREEEKYAFVKQQTEMKNQIESLKGESTDFATASKNLAATEKLVDEF
FT                   KKKLDSERQEHTKLNSELTKLEDEAARKSERIVSLEKLIKSEEEDEALSKQDPVSSGTS
FT                   QTSTFKSKKKKKKGKSQNTSSNAKVLPSPPLPGSSADQKSDLDNRLHETLKDLQETQEK
FT                   LKVIQSKYDDLVAASGNSESLQLELEKTRGEIEKLEVDNERLLRELQESKKELKFKSEE
FT                   VENVKDLLKTVGNELVEAKDTIKNSNGASETEMKHLKSQLESLRSQNSENIKSYETTQS
FT                   ELKQKVASLQKEKSETEKELDDLRTTLNKHMQEKSKLLTDLKQSHEKMSILNNENITLS
FT                   DQVKNLNALKRSESSLKSSLSQKEKTIVYLEQQVKEYSSKEEASSRALREAKMENGRLS
FT                   NKISLVSKECESLKNELEKSKTSLEKFIKENGGLSERLEILNEKYETLQDMKTNSHEQV
FT                   ELIRRQCDELNVKIKELNKKNLSLEDELNESVSALQERTQEASSMRRLLAERQSDKDFQ
FT                   VQKLEQSFAAASEEKNRLESELALHDAKTKRTINELKEVNDDLRVQVQTLIAKEKDYEQ
FT                   EVARLTSLNKEMQTTRNESSQSSNELKEALANVKAALMTSEKKLREMESSSENIKELND
FT                   DLTKKLERISKNYKLVSGQLAAIKERNVPSRGPSRSNSVLSISDRASNEPPSRRGSFNG
FT                   ETVIESQSEINDKIAYIKNVLLGFLEHKDQRNQLLPVVSTLLQLDSNDEKRLMAIR"
FT   gene            <814825..>815742
FT                   /locus_tag="KLTH0H09460g"
FT                   /old_locus_tag="KLTH-ORF932"
FT   CDS_pept        814825..815742
FT                   /locus_tag="KLTH0H09460g"
FT                   /old_locus_tag="KLTH-ORF932"
FT                   /product="KLTH0H09460p"
FT                   /note="similar to uniprot|P38892 Saccharomyces cerevisiae
FT                   YHR209W Putative S-adenosylmethionine-dependent
FT                   methyltransferase of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09460g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30424"
FT                   /db_xref="GOA:C5E313"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E313"
FT                   /protein_id="CAR30424.1"
FT                   /translation="MDHQRSRPKYIQLTREMSTYSENSFNSDFYQEKRPRYPESLYQEI
FT                   LSYHSGDLKLAIDVGCGTGISTLPLLKSFERVVGCDPSSTMLESAKKFKDKITVKDINR
FT                   IEYSVCGAEDLTSLFASDSIDLVTGAESIHWVDEERFFKQAFQVLKPNGTLAYWFYVEP
FT                   IFIEHPQANEIYEEFVYEDPAYMGPQWKPGKEKLRVYGEQIRIPEDKFTDIERHVYRPL
FT                   VSKEKTAYFYGRDSMTVDDLRQYLRSWSAYHTWQQKFGEKGCDVAELLLDELKSKCGWD
FT                   EANTRLKVEWGTAYYLARKKATTK"
FT   gene            complement(<815929..>816885)
FT                   /locus_tag="KLTH0H09482g"
FT                   /old_locus_tag="KLTH-ORF931"
FT   CDS_pept        complement(815929..816885)
FT                   /locus_tag="KLTH0H09482g"
FT                   /old_locus_tag="KLTH-ORF931"
FT                   /product="KLTH0H09482p"
FT                   /note="highly similar to uniprot|Q06703 Saccharomyces
FT                   cerevisiae YLR308W CDA2 Chitin deacetylase together with
FT                   Cda1p involved in the biosynthesis ascospore wall component
FT                   chitosan required for proper rigidity of the ascospore
FT                   wall"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30425"
FT                   /db_xref="GOA:C5E314"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C5E314"
FT                   /protein_id="CAR30425.1"
FT                   /translation="MKFPISVLDHLSCKQVALLTAVVASVSAASNDSGVGQPVGGLISV
FT                   RVGHSQTPFPEWLTEFTGLKEWPGIDPPYIPMDFIDFDQIPDYRSYEQGVCGANPRESC
FT                   SFDCDHCVAPDDVFTCSKLSQTFDDGPSLATERLLDNLDHKTTFFNLGINIVNYPDVYK
FT                   KILDGGHLVGTHTWSHPFLPSLSNEKIIAQLQWSIWAMNATGHHLPKWFRPPYGAIDNR
FT                   VRAISRMFGLQAVLWDHDTFDWQLLVEDQSLRTEESIYRDIQDWKQSGTGLILEHDGAF
FT                   KTVQVGINVGRILGNDQMTVAECVGGSDYIKSFQQEG"
FT   gene            complement(<817855..>818465)
FT                   /locus_tag="KLTH0H09504g"
FT                   /old_locus_tag="KLTH.mRNA.104ML.m"
FT   CDS_pept        complement(join(817855..818406,818463..818465))
FT                   /locus_tag="KLTH0H09504g"
FT                   /old_locus_tag="KLTH.mRNA.104ML.m"
FT                   /product="KLTH0H09504p"
FT                   /note="similar to uniprot|P52491 Saccharomyces cerevisiae
FT                   YLR306W UBC12 Enzyme that mediates the conjugation of Rub1p
FT                   a ubiquitin-like protein to other proteins related to E2
FT                   ubiquitin-conjugating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30426"
FT                   /db_xref="GOA:C5E315"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:C5E315"
FT                   /protein_id="CAR30426.1"
FT                   /translation="MLKLRQLQKQKQEQARQNGTIPAPGNAPVSACQLRLRKDLASLDI
FT                   PPCVSIDVSECESNSRLYINITPDEGYYKCGHFKFCATFKDTYPIEPPKVTLLSKIFHP
FT                   NIDLQGNVCLNILREDWSPVLDVQSILIGLLMLFLEPNATDPLNKVAADVLAANPHQFR
FT                   RDVATSLRGGQVNGQWYDRVI"
FT   gene            <819533..>820510
FT                   /locus_tag="KLTH0H09526g"
FT                   /old_locus_tag="KLTH-ORF923"
FT   CDS_pept        819533..820510
FT                   /locus_tag="KLTH0H09526g"
FT                   /old_locus_tag="KLTH-ORF923"
FT                   /product="KLTH0H09526p"
FT                   /note="similar to uniprot|P05150 YJL088W Saccharomyces
FT                   cerevisiae ARG3 Ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09526g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30427"
FT                   /db_xref="GOA:C5E316"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C5E316"
FT                   /protein_id="CAR30427.1"
FT                   /translation="MRHLVSIKDLTDKEFQVLVDRAEYYKKTFKCGDLSAAQKNHVKLL
FT                   GKTAALIFSKRSTRTRVSTEGALSFFGAQPMFLGKDDIQLGVNESFYDTTRVVSSMVSC
FT                   IFARVNKHSEIQELTKHSSVPIINSLCDMFHPLQAICDILTIKEHLDYTKNKLKVAWIG
FT                   DANNVINDMAIACLKVGIDVSISTPSGIEMDPEIIKAGQEVAKANGSKLIVTHSSTEAA
FT                   TGANVLVTDTFISMGEEYARVAKLKQFQGFQINSELCSYADPNYKFMHCLPRHHEEVTD
FT                   DIFYSDHSIVFDEAENRLYAAMAAVDVFVINKGNFSAGPDDILN"
FT   gene            complement(<820616..>823087)
FT                   /locus_tag="KLTH0H09548g"
FT                   /old_locus_tag="KLTH-ORF920"
FT   CDS_pept        complement(820616..823087)
FT                   /locus_tag="KLTH0H09548g"
FT                   /old_locus_tag="KLTH-ORF920"
FT                   /product="KLTH0H09548p"
FT                   /note="similar to uniprot|P09880 YJL087C Saccharomyces
FT                   cerevisiae TRL1 tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30428"
FT                   /db_xref="GOA:C5E317"
FT                   /db_xref="InterPro:IPR012387"
FT                   /db_xref="InterPro:IPR015965"
FT                   /db_xref="InterPro:IPR015966"
FT                   /db_xref="InterPro:IPR019039"
FT                   /db_xref="UniProtKB/TrEMBL:C5E317"
FT                   /protein_id="CAR30428.1"
FT                   /translation="MVFETAEDSKKLVKELEAATLLPKRGRSYKHKCQIKNTNKEVFSW
FT                   KFNEWDYGKNNIKLPLNARGLFTLDDPENPRIVARGYDKFFNINEVSTTKWDWLAANTL
FT                   GPYEVTVKENGCIIFVSGLEDGSLVVCSKHSTGERDDTDRNHSMAGENFLKRQLESYGL
FT                   EPRELGLALFNMNATAVAEYCDDSFEEHILEYTKDAAGLYLHGININKRVFQTLPMNEV
FT                   HDFALAYGFKTIEYFTKHDITTLRQFLEECASVGSYRNKEIEGFVVRCKLRDGSAFFFK
FT                   FKFEEPYLMYRQWREATKKYITTKSRVFSFKKHRFITNKYLDFVIPILDADPKICEEYM
FT                   RDSGIIKLRKVFLEDYGLTGMEILNSEVIQQLELQNAIDYNKVDENTKFLLFPVATIGC
FT                   GKTTTALTIRNLFPETWSHVQNDDITGKDKSLLMKRSLELLAKDNIKAVVTDRNNHQFR
FT                   ERKQLFEWFEELKEKYLPYDCNVKIVALSFLPYEDIDATSRLTIKRVMARGDRHQSIKV
FT                   DSDGEKKVLGIMRGFLKRYQPVAPDRDPDNMFDLVINLQVRDTDSSLINAKEILRELNH
FT                   HYPVLVPSIPPAEDIKAAFDKSLLYTPTTTKKIGKSSSSEGKAFKLKPSYFSANIEGPQ
FT                   SFIKAICDLVSRVETSTDVSSVIKAFEENKAQPEFHITLCHVATGKRGTQKQKDIWCEF
FT                   NKRYNHLLVKGEGNQTFQNTLIKTNDKVEFKVKSVVWDSSIVTLVAELPENCVLDRTTG
FT                   KAAPRLSCANEVAHITIALLQPGVKPFYSNTLCQKMQQEHGFEEGNFDDGTNCVVIHES
FT                   PVFEATVSINP"
FT   gene            <823303..>825168
FT                   /locus_tag="KLTH0H09570g"
FT                   /old_locus_tag="KLTH-ORF918"
FT   CDS_pept        823303..825168
FT                   /locus_tag="KLTH0H09570g"
FT                   /old_locus_tag="KLTH-ORF918"
FT                   /product="KLTH0H09570p"
FT                   /note="similar to uniprot|P19658 YJL085W Saccharomyces
FT                   cerevisiae EXO70 Essential 70kDa subunit of the exocyst
FT                   complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
FT                   Exo84p)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30429"
FT                   /db_xref="GOA:C5E318"
FT                   /db_xref="InterPro:IPR004140"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniProtKB/TrEMBL:C5E318"
FT                   /protein_id="CAR30429.1"
FT                   /translation="MDEYDVDGADILVLREKLNRVSRLSLNINKSLKKIGKATIQSSEL
FT                   FTPIIQSNTALGVLQRNIEGSLDAVSSIKDLANDASKHELVLTQGIEAVGLKPYIKAIR
FT                   KLQGIQESMDYQNQVSPESSEFQGIRTHLSQIVQSSEEALRTHFTIILRKIEPFDPQIN
FT                   LNKKVPFPYYEDSDLSQLTDIINFFGGSSSSPLVAILANNRSQLILTSLAFLEPFAKQI
FT                   TTNENVPYRKGSSGFLNYTEALLGFIANEYMFTEDILAKKPSFRDQVFANIVTPVLNNY
FT                   VKLVKLNISLIKKNVLNVGLFTFELSDCVGNALKFLRNKPLENYTPLVSSLDESTSILQ
FT                   SLFRDLIVYIESKASQLSQLPSDNGVIESTIDVMSRLRKFSEYKQGCLNCIVGMRREEW
FT                   LPKDYNEKEYTLQERKQINSNTALLSCFFSDCIDCLIVSLERRAQRILMPNQEPDIANP
FT                   TSPRNTFKQRIGFFLITNITLIEQIVSRSELNSILGERGNARLEKLKKRYVNYFVSDWR
FT                   ALTSNLLDAVFVDSSGKVSAKDKDQIKEKFKKFNDGFEELASNFKHFRISDPAMKKLLK
FT                   SEINSLVLPLYERFHGRYKDSFKNPRKHIKYTPNELSTVLNSLDR"
FT   gene            complement(<825306..>828095)
FT                   /locus_tag="KLTH0H09592g"
FT                   /old_locus_tag="KLTH-ORF917"
FT   CDS_pept        complement(825306..828095)
FT                   /locus_tag="KLTH0H09592g"
FT                   /old_locus_tag="KLTH-ORF917"
FT                   /product="KLTH0H09592p"
FT                   /note="similar to uniprot|P47029 Saccharomyces cerevisiae
FT                   YJL084C Cytoplasmic protein of unknown function that
FT                   interacts with Pcl7p phosphorylated in vitro potential
FT                   Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30430"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:C5E319"
FT                   /protein_id="CAR30430.1"
FT                   /translation="MSSSVDAGNSPMFPVDKDLQIADSAQPLTQTTSIQIFIQLAEPVL
FT                   FLQGFEQHQWEERPPGLLRGTLIIRVLKPSKIKSIDLTFKGTSRTEWPEGIPPRRQEFL
FT                   ETIDIVNHTWPFFQLEHNNVHSSGSTDADDLLKGSCASLYRPLKNKRGSVSYINLNAAT
FT                   PASPPKNQGTNFLPIGNILRKATSPDSQKRERSRSISDLLAGTLSNNSDNASLFSKSSS
FT                   SGGEPFIFQPGDYIYGFEQTIPLSCPESVQAAFGSVEYTLSANVERSGAFKSNLHARLP
FT                   LEVIRTPSDSSVEETEPIAISRDWEDQLHYDIVIASKDIVLDAFLPIAFKITPMDKVNL
FT                   HRIRIYLTETMEYYCKNKKVHRLEPAKKFLLAEHKAPVLENLPSNANASKAKNLGNLLI
FT                   DESNGDLVSKEFGYQVFIPERLNLQQRIHPDTSYQNIKANHWIKICLRLSRNLDGKKKH
FT                   YEVSIDSPIHVLNKLCSHANTLLPSYDTHTFIPGTDCSEFGDLNVNLYHVSNLYFPKEV
FT                   IGSPALSPEVMPLEERGTFSPRSLSPIRNGGSSISLHSRRADGQPKMLDDFILRSPELK
FT                   SNVYQPDNIKPELTSPQAIPLSPISSPRARPINMIRTPSFEPPPFDANEPPSRTLFKAM
FT                   TDPMSRAPRDPPTYQEVMAADGVAPVLRPPKFKITSSNEYDDDGVDPKNTQKKNLEEES
FT                   GDIASSFSFNGTRLDSPDLPSSILKSSPKLRPLNFAHGPSRRGSIQDNLPSTVKNSSEN
FT                   YSDLNDILNSPDISTDRNIVPSRSSSAAASPRSSIETAASFITQREDTMNMEPLLSPKA
FT                   NQTLDTLLQSKESLDDYADDATEASVDITALYDRNSNSWHPLQNNVPTHPIISRQYSSG
FT                   VADGNNVFEDFKKAFKIPAGTEYTRASTKQELTTSSATAGSESSPENITFSDSPQTNQ"
FT   gene            complement(<828395..>828796)
FT                   /locus_tag="KLTH0H09614g"
FT                   /old_locus_tag="KLTH-ORF915"
FT   CDS_pept        complement(828395..828796)
FT                   /locus_tag="KLTH0H09614g"
FT                   /old_locus_tag="KLTH-ORF915"
FT                   /product="KLTH0H09614p"
FT                   /note="some similarities with uniprot|P36116 Saccharomyces
FT                   cerevisiae YKR020W VPS51 whiskey (whi) mutant forms a
FT                   tetramer with VPS52 VPS53 and VPS54"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30431"
FT                   /db_xref="UniProtKB/TrEMBL:C5E320"
FT                   /protein_id="CAR30431.1"
FT                   /translation="MAEQITHKRPIRIKIDKDKRKQLQDFYKLREEQSPVSDNINENHE
FT                   SVDQDVASASEDCVEPPTLKISESTLSELVSAHNTLLGKETEVNNTIKNTIYENYYDLI
FT                   KVNELLKSVGNDSSDRLAQLSDILKLLEK"
FT   gene            <829108..>831087
FT                   /locus_tag="KLTH0H09636g"
FT                   /old_locus_tag="KLTH-ORF914"
FT   CDS_pept        829108..831087
FT                   /locus_tag="KLTH0H09636g"
FT                   /old_locus_tag="KLTH-ORF914"
FT                   /product="KLTH0H09636p"
FT                   /note="weakly similar to uniprot|P47030 Saccharomyces
FT                   cerevisiae YJL083W TAX4 and to uniprot|P36115 Saccharomyces
FT                   cerevisiae YKR019C IRS4"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09636g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30432"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:C5E321"
FT                   /protein_id="CAR30432.1"
FT                   /translation="MRLNWPKRQSAVISRDPHSGNEDLLSSDASLKAAQAIFKKHSFSS
FT                   EDGRPDGLAAPSVQPRHKTGNTTRPHPSKALKKRPRAAPKPSMASQTAAPSKQVAQVAN
FT                   SAAACAAAATAQKTTWTIEPQGKPKNKVAQYFTPNQLKPPVTYSASRSNSRSGSIRSRS
FT                   SSKSDDFADIVAQLQGNHDAAQSQRSARVGSVSPRANASSDSIASSHMSSDEMAQAHAI
FT                   NGSNGPPLLSSISPRHSVAGKGYSDFHSSEVENNSIKPSETPTFLNARGVSTRTLPDRR
FT                   SPPRVYLKDTDAENASTSSLQSSAFSGLPNGGAEVLSEPEYAEYGVSPNTNTNPYRHDY
FT                   PRSSIDQSSGTMDLNSDRLSYETLSKMPVQVKYHGTLPDLIPNHKREKKRGRLSSLFGR
FT                   KHKIEEADGSQTDLIQQNDVAVVKATQPTRLKTTMRAQSEDQAVSSANESSDEYESGSE
FT                   DEFGTADKKKKPRRRRVHIRRQIKKASGHHNSSDKSFNEDKPWKSHIDIGFVTQAERKR
FT                   YEGMWVTNRNCYLELLPWWQTSGEQQVYVPDEGLILNLVVLDIWSRSNLPQDKLASIYD
FT                   MVDFRKDGTLERKSFIVGMWLVDQSLYGRKLPAKIEPRVWESVDKYVVNVPSEAQVGFS
FT                   HKDKQRQIKQEIKSLKKDLKRVQL"
FT   gene            <831223..>833400
FT                   /locus_tag="KLTH0H09658g"
FT                   /old_locus_tag="KLTH-ORF912"
FT   CDS_pept        831223..833400
FT                   /locus_tag="KLTH0H09658g"
FT                   /old_locus_tag="KLTH-ORF912"
FT                   /product="KLTH0H09658p"
FT                   /note="similar to uniprot|P36114 Saccharomyces cerevisiae
FT                   YKR018C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30433"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E322"
FT                   /protein_id="CAR30433.1"
FT                   /translation="MFRVLGALTGTGGPAKLDQEEQSEKILSQAHDFEVALQAMDYVLD
FT                   DHPGKGLQLLEGSGAKPKNEEDQCVRVLARGVIEFLEATLGFEASVMKKAAATLSEAQQ
FT                   LSAKRRQQFQKMGLKTSSLYPPGTEYAVTFAEACLLHALLMLFSESMVESAKALFKLRK
FT                   AYHMLREILNDINAAKKKKGSAMYAQGNNESFASFVSADSSTFKSVDIPYSLSTEEQQN
FT                   KELMELAENVYNMRKKRLEGAHIGNSPAIERLRTDLGIQALKDLPKKKEAKKPVTLSKA
FT                   EIDKDQATIDEFIHSGVNLCFGILQVVLSLIPPAIGAVLSVVGFHGSREEGLRLVWRST
FT                   KDRNIHGGIGLLGLLFYYDGPFQFTDVDFDVPATSDGLKKTSSNDLDNSTLLHPGKMLE
FT                   DALLQARALFPNSALWLLQEARMLSSRGRLQEAVDLMDSIDVSGIEMKQVRALMIFDRA
FT                   MTLVHLHEFERAAEDLLSLLDINEWSHALYTYFAGCCYLENYRMCQMGLMEYSRIDFFK
FT                   ERATTLIFDAPNMLSRKKFMSKNLPLDRFMLRKVEQFKKFQSQLQLQDPLDAIGVSPVH
FT                   ELTYFYNGYNRMTEDCLKLSHKLLTEYHNPTIDAKEPNQELVKNLLTSLTSRRLGKVQE
FT                   GCDMLDKNVLPQIITLQPDGKVKYIKKTEDPWAYPTALYERALFTWKLKGLDGLEECKM
FT                   WLTRAQDYADDYELSARIGMKIKAAIDRLEG"
FT   gene            <833533..>835155
FT                   /locus_tag="KLTH0H09680g"
FT                   /old_locus_tag="KLTH-ORF910"
FT   CDS_pept        833533..835155
FT                   /locus_tag="KLTH0H09680g"
FT                   /old_locus_tag="KLTH-ORF910"
FT                   /product="KLTH0H09680p"
FT                   /note="similar to uniprot|P36113 Saccharomyces cerevisiae
FT                   YKR017C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30434"
FT                   /db_xref="GOA:C5E323"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="InterPro:IPR031127"
FT                   /db_xref="UniProtKB/TrEMBL:C5E323"
FT                   /protein_id="CAR30434.1"
FT                   /translation="MKEGSVYDEGFNDDDDDDSILLEFESGSDIEYDDTGLLRRDPGLA
FT                   SLSDEESGKGGNNGYYLDGATISSRNVVIPKDELYENDGVPKLSYRCLTTDQIYELMLE
FT                   RLERIQPIFDISYEDIIVLLQQYAWSEERLLEDWTENRDNVIVSCGLKLGHEPVASRGI
FT                   RKHANFLCHICCEANKMKTFTLECGHEYCLECYQHYIKDKLLEGKIITCMSCPLALKNK
FT                   DIDAIMGDNSSQKLMRSSIKGFIQKHSNHYKWCPFVDCNCIIQVGNISTLSEFPRFHLS
FT                   PYVVCDNQHRFCFKCGLESHSPGDCHVAELWVKMAQLESANLNWVLTNTKECPKCGVNI
FT                   EKNGGCNHMTCKSCAYEFCWICEGCWAEHGGGYYECTRFKKEDKNGAVESKNAIRKYTF
FT                   YYKLFSEHENSAKLDWSLGLTVEQKVKALQENIGISWIETQFLPESIRALIEGRTTLKW
FT                   SFPVAFYSDPSHNLTKIFVDNQSLLVSAVEDLSQLLQVKEPQKIIDRKLEFFNKARFVR
FT                   SRDKALVECGRDLLCKGICIPHQ"
FT   gene            complement(<835255..>836700)
FT                   /locus_tag="KLTH0H09702g"
FT                   /old_locus_tag="KLTH-ORF907"
FT   CDS_pept        complement(835255..836700)
FT                   /locus_tag="KLTH0H09702g"
FT                   /old_locus_tag="KLTH-ORF907"
FT                   /product="KLTH0H09702p"
FT                   /note="similar to uniprot|P80428 Saccharomyces cerevisiae
FT                   YJL081C ARP4 Nuclear actin-related protein involved in
FT                   chromatin remodeling component of chromatin-remodeling
FT                   enzyme complexes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09702g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30435"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/TrEMBL:C5E324"
FT                   /protein_id="CAR30435.1"
FT                   /translation="MSNPALQIYGGDEISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYG
FT                   QYTAGGKEGQKSFNDQFMIMPRPDFEIKRILENGCVVDWEAAQEQWAWAIRDELKFESF
FT                   KGTPAFLTEAIWNPEENRKKSLEVLLEGMEFEACYIAPTATCTSFAMGRPTCLVLDIGH
FT                   DVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRELVPLYKVERKRPEFVPKKF
FT                   EFTVSKSVDEFANSRGFLQECKETMLHVAAVELPKFQSELETTSKRSIEAPWGENIIFD
FT                   SNARYSFAEQLFKPTKEMLPSDWPVTKDGVVETWHNDYVPMKRAKPGLGNKDKEGTTES
FT                   TPAPEEANGETPSATTNENGKRPIEESSKTSDAIAGLADLVNTAITATDVDLRATLAHN
FT                   LVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSGHLRERQSRAWLGGSILSSLGTFH
FT                   QLWVGRQEYEEVGAERLLKDRFR"
FT   gene            complement(<836980..>838563)
FT                   /locus_tag="KLTH0H09724g"
FT                   /old_locus_tag="KLTH-ORF904"
FT   CDS_pept        complement(836980..838563)
FT                   /locus_tag="KLTH0H09724g"
FT                   /old_locus_tag="KLTH-ORF904"
FT                   /product="KLTH0H09724p"
FT                   /note="weakly similar to uniprot|P36112 Saccharomyces
FT                   cerevisiae YKR016W FMP13 The authentic non-tagged protein
FT                   was localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30436"
FT                   /db_xref="GOA:C5E325"
FT                   /db_xref="InterPro:IPR019133"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E325"
FT                   /protein_id="CAR30436.1"
FT                   /translation="MLRSRATINCVKSGRAGRALSRGMATFEGQPAARPNRLSKLLVRV
FT                   GLATVGFYVGGVTLSLNNDQFGELFCDNVPLAESLVEMYEEFRDEKMQASRMSLDELKQ
FT                   KFGELGTKVDRIPNRGADPALTSQAVAALPASKEVRLEDESLVKLRLPEVEQLGSCKRA
FT                   TPLVESVNAAVAAVNEQSLLLPEDTYNAVHDAFTKLKSALQAINEDIRTNVAESVAVQY
FT                   GQASKDLHESFEIRAKSREVELTQQFLNEFNAFKAQLEKHSSEELASALKANEQALLAK
FT                   QSNEVALLSMKQVEEFTKILSEKLDQERQGRLSKLEALNGSVQELAEAVDQVDTLVMKS
FT                   EVLSQLSLLTTLLKNKLHAGDESSVKIDSELARLKTLCDILPGRPSKCCSKNPQLLDVV
FT                   VSQLDSLASQQLILSNEQLYNRWTLLQKDLSTSSLLPPNAGILGHISAKIFGFFLFNKN
FT                   GAPVDNDIDSVIARVGQNLRLSKLDKAVEEVVALKGWPRVLCDEWVQEARKKLEIETLI
FT                   DALDCEIRSS"
FT   gene            <839114..>840394
FT                   /locus_tag="KLTH0H09746g"
FT                   /old_locus_tag="KLTH-ORF901"
FT   CDS_pept        839114..840394
FT                   /locus_tag="KLTH0H09746g"
FT                   /old_locus_tag="KLTH-ORF901"
FT                   /product="KLTH0H09746p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09746g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30437"
FT                   /db_xref="UniProtKB/TrEMBL:C5E326"
FT                   /protein_id="CAR30437.1"
FT                   /translation="MDTLLANIDSGPELLEHSSELQDCSRNLGLEEFASFSKMCRLYHE
FT                   LRETAYGEEMNKLAVAFANVLLKQQGFRAQALAQNAELAEDVQMRLERDSVSSEGFKVE
FT                   WEVPLWRVLFLLAHGHADGSRSFEVFSRDLVPNKFQHLAEKLAENEQQSSKLPLVFEEL
FT                   GKYWYALCYNYGSFVVTHGAHFWSSLESFTASLRANDGRLLGDYASALLQLCSPLLLFP
FT                   ENNLLATFDMVLNLTLILKHGIIAWSGKVSEELYSSPQDYKIPQILHVIFVFVAKSPHA
FT                   VRKRIQPCFSGEEGCGVNLRKQVLDLQCSKITCSETRETLDRILSALGLTVSANDDGEL
FT                   EVIHVVQSQPPSARDSTETVYDQRYSQSSSRLSDLSSSGTTLHNSLDGDYDDLWSEEDK
FT                   IAEADRIMAVIRRLDELGIIKPKFPGQ"
FT   gene            <840625..>841314
FT                   /locus_tag="KLTH0H09768g"
FT                   /old_locus_tag="KLTH-ORF898"
FT   CDS_pept        840625..841314
FT                   /locus_tag="KLTH0H09768g"
FT                   /old_locus_tag="KLTH-ORF898"
FT                   /product="KLTH0H09768p"
FT                   /note="similar to uniprot|P36018 Saccharomyces cerevisiae
FT                   YKR014C YPT52 rab5-like GTPase involved in vacuolar protein
FT                   sorting and endocytosis probable purine nucleotide- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30438"
FT                   /db_xref="GOA:C5E327"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E327"
FT                   /protein_id="CAR30438.1"
FT                   /translation="MGWVKSPIHKRAHQNKRYNTATMLQFKLVLLGDSSVGKSSIVHRF
FT                   VKDSFDEFRESTIGAAFLSQTIKLEKHPDVTIKFEIWDTAGQERYKSLAPMYYRNANAA
FT                   LIVYDVTQPGSLVKAQSWVEELKNKVGDQDLVICLAGNKVDICDEDATAREVQREDAQL
FT                   YAQEQGLLFYETSAKTGAGVSAIFQEIGERVYQKKGMEVPSSTQARKPLNVELQRPSTN
FT                   DSTSCCS"
FT   gene            complement(<841554..>845168)
FT                   /locus_tag="KLTH0H09790g"
FT                   /old_locus_tag="KLTH-ORF896"
FT   CDS_pept        complement(841554..845168)
FT                   /locus_tag="KLTH0H09790g"
FT                   /old_locus_tag="KLTH-ORF896"
FT                   /product="KLTH0H09790p"
FT                   /note="similar to uniprot|P06105 Saccharomyces cerevisiae
FT                   YJL080C SCP160 May be required during cell division for
FT                   faithful partitioning of the ER-nuclear envelope membranes
FT                   involved in control of mitotic chromosome transmission"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30439"
FT                   /db_xref="GOA:C5E328"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C5E328"
FT                   /protein_id="CAR30439.1"
FT                   /translation="MSFPETEISAPAVEQDAAIETPPTSVDASSEGAAPAPEAAPAKKP
FT                   LPTKKDFPTLGSGAFLAAANKVSWGPNMKPAAATASGTSSGSSSATQSRSATPAPSAKP
FT                   ARSKTIQEAFSLDLQSQIAVSKPDFSRIVQGVKTAHSVSVESTLSKTSRMFLIAGKPES
FT                   VRAAKREIVKKLTKPVTTTLQVPSKCRSAIIGAGGRKIREISEPLEVRIDVGKEIVEGS
FT                   YDEDLDDSMVDITIHGDLESVRIAQEKILAIVKEDTKNASIKVNVENKDLVPFVDLEAL
FT                   NLKVEAHFNASAGQFQISGLRDDVQAAKAAVNKYLSELGSQIKTLKVKIPSKFQFLIDT
FT                   ADIKKRFNVIVNMPAPGEEEVAFIGPADKLDEAVTYARENSKKFIVESLEISKAHGKNV
FT                   AHAKNIAIYFSKYNSLEEIKKSYPNVRFAIPTAQELQGTDAVAIRVTTTSENAGELKAV
FT                   RKDIINLVNELPTSQVLIVDDLDYELFHKDIKHLLQQQEQKAGFVQLGDLYPGDDRVLI
FT                   VAKLSDEDFRPSDEELKEILAEVNSALEPLRAKQSNLSHKTFEVPAADQDNYFSSSALI
FT                   RKLIEQDIAAEGGHVQFKLHHPSAKQLTIRGDTKAAKVATAAVESIIGSPDEKFETKFA
FT                   VSSNSVPRLIGSKGANLNAIREKYQCNIDVAQESNGTTTDVTISGLQFCVEHAKAYMIS
FT                   ESKKWADIITKELNVLPKYRGKLIGSQGSYRNRLQNKYSVHIHFPSEGENEGVTIRGPS
FT                   RGVAKAYDELKALLDFEIENGHTSTITVPAEHVPRIIGKNGDTINDIRADCGVEMDFLQ
FT                   KTTDAKAVETGKVELKITGSRQAIKEATQKVEAIIKEASDVETESFEVKPEYIRDIVGA
FT                   GGRVLKSLISKAGGDEIRNKSVDIPDASSKDKKITVQGPQAFVKSIVKEIKAIIEEREN
FT                   SIEKELDVPADRVGALIGPGGVTRRQLEADFHVRLSLPDIGDKDSKVKVSGLAENIAAC
FT                   EKQIFTQIIRDSCDLEIQVPASFHEFVSEKGALIQRLRSDFFVNVKFGNANGRANKLAR
FT                   ANLNIPVEKASGSDEESIKLTTEEVPLNVDESQAPIPWRLSYEPVDLSDILTEEERAND
FT                   KQVSKDEVLEKVQKIIQQKIDLAPQASTVGYLWSRKPQDFRKVVGSLGSNIKRIREATN
FT                   TVLNVPKKNEKVNDIIYIRGTKEGVEKASELIKNKLKN"
FT   gene            complement(<845566..>846210)
FT                   /locus_tag="KLTH0H09812g"
FT                   /old_locus_tag="KLTH-ORF886"
FT   CDS_pept        complement(845566..846210)
FT                   /locus_tag="KLTH0H09812g"
FT                   /old_locus_tag="KLTH-ORF886"
FT                   /product="KLTH0H09812p"
FT                   /note="some similarities with uniprot|P47032 Saccharomyces
FT                   cerevisiae YJL079C PRY1 Protein of unknown function, has
FT                   similarity to Pry2p and Pry3p and to the plant PR-1 class
FT                   of pathogen related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09812g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30440"
FT                   /db_xref="GOA:C5E329"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="InterPro:IPR034120"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C5E329"
FT                   /protein_id="CAR30440.1"
FT                   /translation="MNPLSVLGALLLLTSRALAATIALASEPAPAWITTRTTVFRTVRL
FT                   SSTSAPRASSPLSVTTATTASATATLPSTTSSSFQTQILLEHNSYRALHHAPALTWSTQ
FT                   LASYAQNYANSYNCNGTLVHSGGSYGENLALGYNSSAAVAAWYNEVRLYNFKNPGFAED
FT                   TGHFSQLVWVSSKRLGCARVDCGDYYGQYTICSYDPPGNVAGQYKANVLKT"
FT   gene            complement(<846452..>847540)
FT                   /locus_tag="KLTH0H09834g"
FT                   /old_locus_tag="KLTH-ORF883"
FT   CDS_pept        complement(846452..847540)
FT                   /locus_tag="KLTH0H09834g"
FT                   /old_locus_tag="KLTH-ORF883"
FT                   /product="KLTH0H09834p"
FT                   /note="some similarities with uniprot|P47032 Saccharomyces
FT                   cerevisiae YJL079C PRY1 Protein of unknown function, has
FT                   similarity to Pry2p and Pry3p and to the plant PR-1 class
FT                   of pathogen related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30441"
FT                   /db_xref="GOA:C5E330"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="InterPro:IPR034120"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C5E330"
FT                   /protein_id="CAR30441.1"
FT                   /translation="MKLSQIALVSATAVGAALAAPAAQTTVTEHVHQEHTATVRAAVYV
FT                   DNGSTYTSLTTEQPSDAVATATASASEATGSVVVVVTTLYGSGAASSAPVSSAESTSSA
FT                   PLVTAVAQKAAAVSETASESSEAATSSAASSADAGTSAAETSVAASTSSSAAPETTTVA
FT                   ATSESSTSSTSSPAKTSTSAAETSSSAAAETSISTSSPAATSSASSTSSSAAASSTSGS
FT                   SSFASAILQAHNDKRSLHQDTSSLSWSDELASYAQDYADNYDCSGTLTHSGGPYGENLA
FT                   AGYSGTGAVDAWYSEIKSYDWSDPNYSSSTGHFTQLVWKSTSEVGCGIKSCGSGTGDYV
FT                   ICSYKSAGNVIGSFAENVKSLN"
FT   gene            <848950..>850599
FT                   /locus_tag="KLTH0H09856g"
FT                   /old_locus_tag="KLTH-ORF872"
FT   CDS_pept        848950..850599
FT                   /locus_tag="KLTH0H09856g"
FT                   /old_locus_tag="KLTH-ORF872"
FT                   /product="KLTH0H09856p"
FT                   /note="similar to uniprot|P38124 Saccharomyces cerevisiae
FT                   YBR008C FLR1 Plasma membrane multidrug transporter member
FT                   of the major facilitator superfamily involved in efflux of
FT                   fluconazole diazaborine benomyl methotrexate and other
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30442"
FT                   /db_xref="GOA:C5E331"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E331"
FT                   /protein_id="CAR30442.1"
FT                   /translation="MYSDNYRNTLLVDVLEYFRLVKPSHNFAPQATQASLDQESSNKST
FT                   KEADIEKDLESGSGAGSAAASATGENRTDGEAAASDPFLVDWNGPSDPENPHNWSRSKK
FT                   GFVVVQIMILTCVTYMGASIYTPGQEYIQQEFGVGHVVGTLNLSLYVLGYGLGPMVFSP
FT                   LSETARFGRQHIYLVTLFLFMIFQVGAATVHNIGGLVVIRFISGVLCSPALATGAGSMG
FT                   DFISPELVPIFIGMWAVGAVAAPVLAPLLGAAMTVAENWRWIFWLLMWLAAATFLLLAA
FT                   FFPETYASNILHRRAARIRRETGDNRYYTKQERAESEIKTKDFISEILYRPFEIIFKEP
FT                   IVLAFDIYIALCYGAFYLFFEAFPIVFVGIYNFTLIELGLAFLGFCVGCVIAYIAFLTF
FT                   LAKVIMPKFKNNTFTPESFLLLAMSVCWSLPLSLFLFGWAAGVHWILPMIAEIFFVLCV
FT                   FNLFQATFAYLAICYPRYMASVFAGNGFCRAVFACAFPLFGRAMYENLGSEKYPVGWGS
FT                   SLVGFFSIALAAIPFIFNKYGSQLRGRSSYAN"
FT   gene            <851111..>851183
FT                   /locus_tag="KLTH0H09878r"
FT                   /old_locus_tag="Klth0H.tAla_AGC_6"
FT   tRNA            851111..851183
FT                   /locus_tag="KLTH0H09878r"
FT                   /old_locus_tag="Klth0H.tAla_AGC_6"
FT                   /note="tRNA-Ala (AGC) cove score=70.00"
FT   gene            <851372..>852346
FT                   /locus_tag="KLTH0H09900g"
FT                   /old_locus_tag="KLTH-ORF864"
FT   CDS_pept        851372..852346
FT                   /locus_tag="KLTH0H09900g"
FT                   /old_locus_tag="KLTH-ORF864"
FT                   /product="KLTH0H09900p"
FT                   /note="weakly similar to uniprot|Q02209 Saccharomyces
FT                   cerevisiae YKR011C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30443"
FT                   /db_xref="UniProtKB/TrEMBL:C5E332"
FT                   /protein_id="CAR30443.1"
FT                   /translation="MQEIYVPIGEDQRVKLTLVSTFQHIGQVRKYLHSIQDTFSVELDT
FT                   CDTITQNLKIQCVSHRACRSCPLYILEFDDVSDGYALWKSAGDWALGTVLSSLFAARPA
FT                   SKHRAARLETQLAAHATRKHDPEFLAQALQKLNVDWDAPHARFEFDFALFVRLLDEAVA
FT                   PEIGARTCDSYLELVSPLQYKSLTTMVVLRTKVAVSKQHVECSLKDYDARMRGLALARR
FT                   AADRADSVALDRSHEASVLSDAAERSPSPPVSTSDDDAYLLSSSQQLLTNFQKHFRGMA
FT                   ETFETFDVKRAAQSPRRLAAPSDCWKVSKPVKNGKSKPSKVHA"
FT   gene            complement(<852480..>854204)
FT                   /locus_tag="KLTH0H09922g"
FT                   /old_locus_tag="KLTH-ORF856"
FT   CDS_pept        complement(852480..854204)
FT                   /locus_tag="KLTH0H09922g"
FT                   /old_locus_tag="KLTH-ORF856"
FT                   /product="KLTH0H09922p"
FT                   /note="similar to uniprot|P05066 Saccharomyces cerevisiae
FT                   YOR386W PHR1 DNA photolyase involved in photoreactivation
FT                   repairs pyrimidine dimers in the presence of visible light
FT                   induced by DNA damage regulated by transcriptional
FT                   repressor Rph1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09922g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30444"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:C5E333"
FT                   /protein_id="CAR30444.1"
FT                   /translation="MKRSVSPPPAVSKKLKLSEGFEAYYKLDPRYYPNAITWQQANEFN
FT                   NGKREKPAALLDERIKKQKLPAKADISAVVHWFRTDLRVRDNAALSNAIKLLREIRGQK
FT                   KDAQLIALYTINEHDWRAHLDSGWKLTFALNALESLREMLKQMNVALVVRKFESKKPLL
FT                   SRSSEFVDWVKEQCVSLAQGNVLVTANAQYETDELYRDLKLFDKQDEQFRFQVYHDQCI
FT                   VQPGSLTTGKGSQYTVFTPWYKRWVEYLKSHKQGKEAIKIHAVDQESKVNESLAKFESE
FT                   AYELSDEFLAYLPCDKLEVPPATEADAHELLQEFISSGNAHKYNEKKDTLSLDSTSHLS
FT                   CYITSGLISTREVVNRAFHENGDSLMRRDIKQNNSVENFIKEVAWRDFYKHVMCNWPYM
FT                   SMEIAIKFETMDIKWENDEEKFSKWCLGETGLPVVDAIMRKLLYTGYISNRCRMIVASF
FT                   LSKNLLVDWRWGERWFRKHLLDADLASNAGGWGFCSSTGIDAQPYFRIFNMKLQCERYD
FT                   PDGKFVKMWVPELKDADNVRIIREGRSEKDAVDGYPSPIVDLKDSRERALEAFREAL"
FT   gene            <855476..>859174
FT                   /locus_tag="KLTH0H09944g"
FT                   /old_locus_tag="KLTH-ORF853"
FT   CDS_pept        855476..859174
FT                   /locus_tag="KLTH0H09944g"
FT                   /old_locus_tag="KLTH-ORF853"
FT                   /product="KLTH0H09944p"
FT                   /note="some similarities with uniprot|P47035 Saccharomyces
FT                   cerevisiae YJL076W NET1 Core subunit of the RENT complex
FT                   which is a complex involved in nucleolar silencing and
FT                   telophase exit stimulates transcription by RNA polymerase I
FT                   and regulates nucleolar structure"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30445"
FT                   /db_xref="InterPro:IPR018844"
FT                   /db_xref="UniProtKB/TrEMBL:C5E334"
FT                   /protein_id="CAR30445.1"
FT                   /translation="MYKLQVVLVPPSPGTGAFPLPMNPPTTENSQVLPSGGGVNGSAIL
FT                   GGGRPDLVSTTSANNLFMSSFVSSHIPQPKLRKLLHFTKPTNTLFTLAQEIVERCDKLY
FT                   PNLAQPVEVLTLQDSNECDLDPDYLVKDVFIVDNVVRAVLRNDIEIAEEDPQSLYSVKR
FT                   RRLNSSAPSSGGQSNVLHIAKKRPHMLRNSAAMRVSTPLANQIYPPAGGRQVNSDYEDE
FT                   DVGDRSVLPPPQPQSQPIRISSGVDSAKKINFNEDTVSRSEAVDPDKSRQQRLPSGTPM
FT                   RSINNKNAMTPERSNAQGQSAAAELTSKVSATPLATNNRITSGMLRIPEPKISEVENEL
FT                   RQGPASPSAELPARPDRIPMKKQQLPQSDDDEQSDPSAEEEPVLAELNNQHFEPGLKNS
FT                   ASRQTSIADNNGSPIKDGNKIGNVNLAELPQVGRRATRKSSLESKVESLIKSATNLSEE
FT                   AREDMQRRKEDSNNARRKDTFSDEDEAEEGPLQDDPNDTVRVNHLDSANTSFQKSELLS
FT                   MLKGNKFNIPSDFNKRSLRSNRGFVDNVVQKPDTNPKDVINQRVQRGAARKASELLSSG
FT                   QSRAQEPSSESDDESSGIETDRSDSGKITVLENEALKKLNIHPLKERVIGEERKEQSKP
FT                   EKEILERTSVISSVEPQPDREELPGPGVSRGVKRSAAKIPKSSQPATNEPAKAANGKGI
FT                   KGKSLANKTQKPEPPSAVSSSSSQDSSPASGQTETSSEHPNTIQKSPSREEVSSKLMKA
FT                   ISPAPGDLETKAYQSPEFIEDSDENELTSEKASASEASIPSKDQQKKLPPSILKRKEEA
FT                   EKRRKEREAVRKARDEEKAKIKAEKEAKKREKEEAIAHKKAEREAKRKLREEEAAKKKT
FT                   ERESRSGAKGPRGASKQTTKPVKESKPADENITSAKAADSGTNEKPVTSNPPEIGSSKS
FT                   QNHVDDKNTGSLKPQDLAQYFATSDKNKTTAAQKNTPTSSQVAETTDENDTKLEKLKSQ
FT                   FASGKPQSAESKVKAPMEPSTHSQISPETSTSSELPDEDSSSNDNESSGDDSSEDESTL
FT                   NTKTRRGIVDTPKGAIISIPKRGQKDEFSGVESAPQSTQTALDNKSPEKTPAKVPVTRM
FT                   MEMSSPAAASKSPSSPKVTKKPESKPSRSLSSLSDLVSRGVPEVKEVSMKSATPLRSST
FT                   GKEVSSDDQSEDDSEQSDSDDSESSDGSSDGEGSNFISAKSASKALGRNKKSHSGFASL
FT                   VKDSKKN"
FT   gene            complement(<859362..>863036)
FT                   /locus_tag="KLTH0H09966g"
FT                   /old_locus_tag="KLTH-ORF846"
FT   CDS_pept        complement(859362..863036)
FT                   /locus_tag="KLTH0H09966g"
FT                   /old_locus_tag="KLTH-ORF846"
FT                   /product="KLTH0H09966p"
FT                   /note="similar to uniprot|P47037 Saccharomyces cerevisiae
FT                   YJL074C SMC3 Subunit of the multiprotein cohesin complex
FT                   required for sister chromatid cohesion in mitotic cells
FT                   also required with Rec8p for cohesion and recombination
FT                   during meiosis phylogenetically conserved SMC chromosomal
FT                   ATPase family member"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30446"
FT                   /db_xref="GOA:C5E335"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="InterPro:IPR041741"
FT                   /db_xref="UniProtKB/TrEMBL:C5E335"
FT                   /protein_id="CAR30446.1"
FT                   /translation="MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAV
FT                   RFVLSDDYSNLKREERQGLIHQGTGSVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRV
FT                   RRTIGLKKDEYSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAKDRERLA
FT                   LLEEVVGAKSFEIKLRESAKKMEATNRDRTRIDSELAELRTRLDELNEERQELEKYQKL
FT                   ERDRRIFQFVLYDRELNEVTSQIESLEDEYNHVLQSSEEFLQELYKREELIENVTKNIS
FT                   NIETELRVKESMDLQQEKSRLQEISKRKADLEVHLEEAKRQAEAHKKQTSVDQNNLKTV
FT                   EEEIEKKSLQLERLIPRFEQLKSESQEFESQLSNYQRSQREIVSKRGIYAQFKSKVERD
FT                   EWLKNEIASLKAQHQDLAEQLAALTREKEQTGSEVEVFNEEITELNDSVRGPGIQAELQ
FT                   DLQSHLDSLKQSYLGKIDERKELWRAEQKFLTVSDALNDGVKRSERNLSETMDRGLASG
FT                   LRAVREISERLKLPADSVHGPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASILM
FT                   EELYNTKAGRVTFIPLNRIADSNPVTFPDNSQAECTPLIWKMKYEKRFEKAVRHVFGRT
FT                   IVVRDIGTGSKLAKSFNLDAVTLDGDRTDKRGLITGGYHDYHKRNRLDCLKEMSAAKRQ
FT                   LLEATKNLDAARGQITAIDTEIDQINDEIKTQSSRKEAILSNIENMRAKLNKKTAERAL
FT                   KKEILDSITTKHARMETSLKLNEEKTERFETDLNKPFEKGLSDEEEQTLKSLADKMRAV
FT                   SEPLSVTADALNELTLKIDLLKAELGVKLVPQKKEIEDRISQASGSKRLASSEELSQIS
FT                   TELEKLASREHELQTSLQGISDNIASLNEEKENNQQILEKANSQQRALLKKLDGYQKDA
FT                   EKSVIRKTTLVSRRDEVQQKISEIGLLSEESLDRHQNLDSEEVLRRLNEVNDKISKTSN
FT                   VNRRAIENFRKFNEKREELENRAEELARSKESIEELVDSLKKQKIEAVEATFSKVANNF
FT                   THIFEKLVPAGVGKLVIHRNESTRNASGGRGPQQGSGASGNEDDSIETMYSGVSISVSF
FT                   NSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANVI
FT                   KELSVHAQFICTTFRSDMLQVADSFYRVRFDNKISEISAVSQQDAIRFIKGKSRMGEL"
FT   gene            complement(<863828..>863942)
FT                   /locus_tag="KLTH0H09988r"
FT                   /old_locus_tag="Klth0H.tLeu_CAA_30"
FT   tRNA            complement(join(863828..863871,863905..863942))
FT                   /locus_tag="KLTH0H09988r"
FT                   /old_locus_tag="Klth0H.tLeu_CAA_30"
FT                   /note="tRNA-Leu (CAA) cove"
FT   gene            complement(<864238..>865470)
FT                   /locus_tag="KLTH0H10010g"
FT                   /old_locus_tag="KLTH-ORF838"
FT   CDS_pept        complement(864238..865470)
FT                   /locus_tag="KLTH0H10010g"
FT                   /old_locus_tag="KLTH-ORF838"
FT                   /product="KLTH0H10010p"
FT                   /note="similar to uniprot|P38355 Saccharomyces cerevisiae
FT                   YBR287W ZSP1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10010g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30447"
FT                   /db_xref="GOA:C5E336"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:C5E336"
FT                   /protein_id="CAR30447.1"
FT                   /translation="MDDSSGLSFGHISYVTLESVLQVVIVAFSGFWCAYTGLLPKQGQK
FT                   VISRLNVDVFTPCLIFSKLARSLSLAKILEIAVIPVFYAMTTGVSFMSGKLMSRILGLD
FT                   KDESNFVVANSIFGNSNSLPVSLTVSLAYTLPGLLWDEIKDDNRDNVASRGILYLLIFQ
FT                   QIGHVLRWSYGYNTLMRWSGDRGHPSIASVSEQLEVPDSEAGRSETPSGISARSYSSLY
FT                   KLKGKVMKMWEKIQAVMNPPLWAMVISVFVASVHPIQHEFFSKNGFINNTLSDAIKELG
FT                   ALSIPLILVVLGSNLYPSQDTPQMTRNHKKMVLGSIVGRMILPSCFMLPVIALAVKYIK
FT                   VSILDDPIFLVCGFILTISPPAIQLTQITQLNEFFEAEMASVLFWGYVVLSLPISIFGV
FT                   TAAMTVLKWAA"
FT   gene            <865827..>867650
FT                   /locus_tag="KLTH0H10032g"
FT                   /old_locus_tag="KLTH-ORF836"
FT   CDS_pept        865827..867650
FT                   /locus_tag="KLTH0H10032g"
FT                   /old_locus_tag="KLTH-ORF836"
FT                   /product="KLTH0H10032p"
FT                   /note="weakly similar to uniprot|P40358 Saccharomyces
FT                   cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
FT                   nuclear membrane fusion during mating localizes to the ER
FT                   membrane exhibits genetic interactions with KAR2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10032g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30448"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5E337"
FT                   /protein_id="CAR30448.1"
FT                   /translation="MIRWIFYVAVGIAHAAGKCDFGRLSGASHELRYDDSEIPQYQKLC
FT                   EQLSHCDHPEAEALRNQLLYKSGLIQVSSGQELAAAETLEQILGSSDVKFQSQASKRLD
FT                   EIYLQFGFWDKLKGEGGKKQEYEALRNAVVVQLSRNQAVPHESLAQLEEIAPFALETRI
FT                   LLNDALLRELGETLDINAAQSIIENYKIILTKHKKLVNVQDKLRIHHAVAVLQMFVMAT
FT                   PPTNLLSCLALDMDYKPCRELSKLSSKLNRINPPLNAVTHPDQFLSLSQFDWAKLVDFY
FT                   LNAPSIKFTGTSSAKNNFDLLSSIQRQLLQNLLSERPLSLIKNKWKLGKRKSAFTTNQN
FT                   QLVCEGYDAMHKSKLAEPYCQAALGEKLPENSAKALSEFTDNFQNQQAVQDVLNSLWQD
FT                   SPSLAAHAVRKIVSSLAAHEKNQKSGNTAQVWFFLESFTKNHNWAQSSNSGLSKIAKHI
FT                   SSISAKRKQQQQQQQQQQQQQHFFRQQRQQQRQPPPAPNDMSKKNYYKVLEVTPQATSK
FT                   DIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSDEGKRKEYDDQRAGR
FT                   GQQRQGFPFGQGANGGFPFGGGSFKMNFGGF"
FT   gene            complement(<867826..>869364)
FT                   /locus_tag="KLTH0H10054g"
FT                   /old_locus_tag="KLTH-ORF834"
FT   CDS_pept        complement(867826..869364)
FT                   /locus_tag="KLTH0H10054g"
FT                   /old_locus_tag="KLTH-ORF834"
FT                   /product="KLTH0H10054p"
FT                   /note="similar to uniprot|P37302 Saccharomyces cerevisiae
FT                   YBR286W APE3 Vacuolar aminopeptidase Y processed to mature
FT                   form by Prb1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10054g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30449"
FT                   /db_xref="GOA:C5E338"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR037457"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:C5E338"
FT                   /protein_id="CAR30449.1"
FT                   /translation="MRISTLVATSIGCAQAFVLPQAFFDAFAAPAPVADASLWPHKPYF
FT                   LKHNVDPDTFPDEIQLEELNATALDLYHIAESSNGTYGHPTRVIGSPGHWKTLGYILHQ
FT                   FDQMRDYYDVTVQSFKALNGKVSHYDLNYTNGEAVPSAQAFSLSPPVEPFVGTLVEIPN
FT                   LGCSDADFEALEISKDSIALIERGECPFGQKSTLAGKHGFKAVVIYDNDPKSKKGISGT
FT                   LEKPTKHTVSTIGVSFAVGQKLIAGIELDPEFSLFFYMDSFVKKVKTKNIIADTKHGDP
FT                   DNIVALGAHTDSVAAGPGINDDGSGTISLLTVAKHLSDYKINNKVRFAFWAAEEEGLVG
FT                   SNYYVEKLSPEENQKIRLFMDYDMMASPNYQFQVYDANNIDNPRGSEELKNLYIDYYTS
FT                   HGLNYTLIPFDGRSDYVAFINHGIPGGGIAAGAEGINTDNGKVLDRCYHELCDDVNNLN
FT                   WEAFLTNTQLIAYSVANYAHSLKEFPERETNTSSVLSSASAPKYPYKGGANLLL"
FT   gene            complement(<869863..>869934)
FT                   /locus_tag="KLTH0H10076r"
FT                   /old_locus_tag="Klth0H.tGlu_CTC_29"
FT   tRNA            complement(869863..869934)
FT                   /locus_tag="KLTH0H10076r"
FT                   /old_locus_tag="Klth0H.tGlu_CTC_29"
FT                   /note="tRNA-Glu (CTC) cove score=70.44"
FT   gene            complement(<870103..>870174)
FT                   /locus_tag="KLTH0H10098r"
FT                   /old_locus_tag="Klth0H.tGlu_CTC_28"
FT   tRNA            complement(870103..870174)
FT                   /locus_tag="KLTH0H10098r"
FT                   /old_locus_tag="Klth0H.tGlu_CTC_28"
FT                   /note="tRNA-Glu (CTC) cove score=73.79"
FT   gene            complement(<871210..>871281)
FT                   /locus_tag="KLTH0H10120r"
FT                   /old_locus_tag="Klth0H.tGlu_CTC_27"
FT   tRNA            complement(871210..871281)
FT                   /locus_tag="KLTH0H10120r"
FT                   /old_locus_tag="Klth0H.tGlu_CTC_27"
FT                   /note="tRNA-Glu (CTC) cove score=73.79"
FT   gene            complement(<871688..>872194)
FT                   /locus_tag="KLTH0H10142g"
FT                   /old_locus_tag="KLTH-ORF829"
FT   CDS_pept        complement(871688..872194)
FT                   /locus_tag="KLTH0H10142g"
FT                   /old_locus_tag="KLTH-ORF829"
FT                   /product="KLTH0H10142p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10142g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30450"
FT                   /db_xref="UniProtKB/TrEMBL:C5E339"
FT                   /protein_id="CAR30450.1"
FT                   /translation="MSFLRRLFGRKNQEHGATSTHSVSWRDADDLDSEYVFVTGGEMLD
FT                   SQAVLETRSEFSEDPSEVDVTAWEMARAWTHRGSAGDLRPARGSKAARLAHRLDDIRKL
FT                   PTVSFGTSASLPLGHQGNRASQPAWVVEYHDESMDEEAECLFDDKWNRKTKVESRRDRS
FT                   QKCGV"
FT   gene            complement(<872929..>873558)
FT                   /locus_tag="KLTH0H10164g"
FT                   /old_locus_tag="KLTH-ORF825"
FT   CDS_pept        complement(872929..873558)
FT                   /locus_tag="KLTH0H10164g"
FT                   /old_locus_tag="KLTH-ORF825"
FT                   /product="KLTH0H10164p"
FT                   /note="similar to uniprot|P40359 Saccharomyces cerevisiae
FT                   YJL072C PSF2 Subunit of the GINS complex (Sld5p Psf1p Psf2p
FT                   Psf3p) which binds to DNA replication origins and
FT                   facilitates assembly of the DNA replication machinery"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30451"
FT                   /db_xref="GOA:C5E340"
FT                   /db_xref="InterPro:IPR007257"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="UniProtKB/TrEMBL:C5E340"
FT                   /protein_id="CAR30451.1"
FT                   /translation="MSLPWNIQETFSPEEIQFIVENEPIKIFPRFTTRVSLRGDRAKPA
FT                   HTRWKLVTADDHPLNNLVAIQTTEVALWMALLLKQQGKCSIVAPGWLRLSQLQKYIDYE
FT                   LKHAERFSELPWNWLVVAQLLFSKAADDLHDPVHLLRGKIQDLREIRLGKIGQGLKHLN
FT                   ESHLQLDNLSLLEINELRPFVLGVMNKLKQVHSSISEERGSEDYYE"
FT   gene            <873771..>875396
FT                   /locus_tag="KLTH0H10186g"
FT                   /old_locus_tag="KLTH-ORF823"
FT   CDS_pept        873771..875396
FT                   /locus_tag="KLTH0H10186g"
FT                   /old_locus_tag="KLTH-ORF823"
FT                   /product="KLTH0H10186p"
FT                   /note="similar to uniprot|P40360 Saccharomyces cerevisiae
FT                   YJL071W ARG2 Acetylglutamate synthase (glutamate N-
FT                   acetyltransferase) mitochondrial enzyme that catalyzes the
FT                   first step in the biosynthesis of the arginine precursor
FT                   ornithine forms a complex with Arg5 6p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10186g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30452"
FT                   /db_xref="GOA:C5E341"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011190"
FT                   /db_xref="UniProtKB/TrEMBL:C5E341"
FT                   /protein_id="CAR30452.1"
FT                   /translation="MFRRLYQTAGYSQPNGLNKELILAVLNSTATKREAQNYLKKYGSD
FT                   KIQNHCLVMIRGLLKQDSKALSCFAVTIKRLKMLGVKPMFVLHPGQDVEEQAQLLDYHL
FT                   HKEDLRAVCLSEALVRNFNGSYQSIVQYAQLKDLIPIIKPRIFDEKTCASKPTTNVPEL
FT                   MGQLVRQLDCHIDKVVIISDFGGISSGERQDNAHVFINLSQEFESLSDSLSKDIKVLNA
FT                   KVSNNEKSSVDAMQLILDMDKLKQTYTRQHAHLEDLQIMDRVLSELPISATGIITALSA
FT                   ASNLFKNNPLLHNVLTDRSLISSSLPRFKRGNQLSHAWYELPVDNEPVVDLKDAALITT
FT                   VVKKGVNIKVFDYRTLNEKNSIGFPGISSLPTPSNDKVNITKLKAIIDQSFGRKLDIKH
FT                   YLKRINGQIAAIIVIGDYEGIAILTFEGPEGAKFPYLDKFAVMPHLKGSLGISDIMFNL
FT                   MFQKFPKELVWRSRSDNVVNKWYFQRSVGVLDLSMDLGKNDAKPSIFKLFFHGDNDKED
FT                   PFCDFERLQTYSKYVRDIQPSWDT"
FT   gene            complement(<875962..>878361)
FT                   /locus_tag="KLTH0H10208g"
FT                   /old_locus_tag="KLTH-ORF820"
FT   CDS_pept        complement(875962..878361)
FT                   /locus_tag="KLTH0H10208g"
FT                   /old_locus_tag="KLTH-ORF820"
FT                   /product="KLTH0H10208p"
FT                   /note="similar to uniprot|P40361 Saccharomyces cerevisiae
FT                   YJL070C and to uniprot|P38150 Saccharomyces cerevisiae
FT                   YBR284W Hypothetical ORFs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10208g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30453"
FT                   /db_xref="GOA:C5E342"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006329"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5E342"
FT                   /protein_id="CAR30453.1"
FT                   /translation="MAEIQRRPSLMLDDEEDLSHERRSRLPSQVTDAPLDDTDMIALNT
FT                   TYDKQIIQGQPMHLEFNGHTNPIHQEVSASQLKNHRHLDEKGCLTVFDIIGKKRAHYLK
FT                   SSAQDALSSPKNDTKSWFLYPRPLPKFWKFDKDRRLQDTQDRAIENNGRPDHKGYFTTR
FT                   ASHADAYNQSSPTDKINLNYTGKFFELENYAEEFRNVVGPRNTTTLSYKEVVAKISPIE
FT                   EFSKDFQWVLSYLVSEELNSLATKRIEYLLNRFDLFQQLEGRTEIRENRLVPHRDFYNV
FT                   RKVDQNFLLSGCVSQRQLNEFIWEKLNLEPERIVYKNSEGKEFKLRQIFCNGADAKSNE
FT                   DASIGLKAVDDLFLEWYQTVYLPGSHLMGRCAPAPGKDHTFFMIAKTFLEFDNCMNGEY
FT                   FAELVVRYVIQSFEKSKYQLAQLSVDFQFCEDWWFKFSDWITKWKLVSYNIRWNVRLGR
FT                   SYTKLHASGIVESFQDYLDYIFRPLFSSKAKNDMKLQYFLSTVCCLDLSATEGDDYVWK
FT                   KFMDPQSTLPIDWSATRDNPPIAYYMFYLMEYVKQFNLMRRNNLQNPVTLRLYAPLLRS
FT                   RVSQFKAGISITEQLESLICNVLLCHSGLLQAEPLWDASPAVLYLYYLLQIPVIVSPLS
FT                   SVSIAQEKPKTSRADGIRDVTVQSTRFYTGNPFLQMQKIGLRVILSSNSVLFNSSYTME
FT                   PIIEEYSVAASIYLLNSADLCEFVRNSIVTSGYEGFYKAHWNGIGLTKTQFLREKIGGT
FT                   DSWYDQELDTSYKHNVPTTRRLYRKDCLDREWEFIRKQVPSELCFS"
FT   gene            <879442..>879513
FT                   /locus_tag="KLTH0H10230r"
FT                   /old_locus_tag="Klth0H.tCys_GCA_7"
FT   tRNA            879442..879513
FT                   /locus_tag="KLTH0H10230r"
FT                   /old_locus_tag="Klth0H.tCys_GCA_7"
FT                   /note="tRNA-Cys (GCA) cove score=75.27"
FT   gene            <880852..>882333
FT                   /locus_tag="KLTH0H10252g"
FT                   /old_locus_tag="KLTH-ORF817"
FT   CDS_pept        880852..882333
FT                   /locus_tag="KLTH0H10252g"
FT                   /old_locus_tag="KLTH-ORF817"
FT                   /product="KLTH0H10252p"
FT                   /note="similar to uniprot|P37292 Saccharomyces cerevisiae
FT                   YBR263W SHM1 Serine hydroxymethyltransferase mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30454"
FT                   /db_xref="GOA:C5E343"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:C5E343"
FT                   /protein_id="CAR30454.1"
FT                   /translation="MISRIASRQLKPVLVYRRLYATAKSTANQVMVSKHVQEIDPEMHE
FT                   ILTNERHRQKHSVTLIPSENFTSKSVMDLLGSEMQNKYSEGYPGERYYGGNQFIDQAES
FT                   LCQKRALDLYGLDPEKWGVNVQPLSGAPANLYAYSAILDVNERLMGLDLPHGGHLSHGY
FT                   QLPSGTKISYISKYFQTMPYHVNIQTGLIDYEMLAQTSKLFRPKVIVAGTSAYSRTLDY
FT                   KRFKEITDACGAYLMSDMAHISGLVAAGVLPSPFEYSDIVTTTTHKSLRGPRGAMIFYR
FT                   KGVRKVTKKGKEIMYDLDKRINFSVFPGHQGGPHNHTISALAVALKQAATPEFKEYQTA
FT                   VVANASVFGEELVKRGFQLVSGGTDTHLVLIDLSNIGIDGARLETILEKINIAANKNTI
FT                   PGDKSALFPSGLRVGTPAMTTRGFGPEDFAKVAEYIDKAAKLAIGLKSQESSEAKDARS
FT                   KLANFKQLCAESDEVAALANKVSEWVGEFPVPGEL"
FT   gene            complement(<882443..>883048)
FT                   /locus_tag="KLTH0H10274g"
FT                   /old_locus_tag="KLTH-ORF815"
FT   CDS_pept        complement(882443..883048)
FT                   /locus_tag="KLTH0H10274g"
FT                   /old_locus_tag="KLTH-ORF815"
FT                   /product="KLTH0H10274p"
FT                   /note="weakly similar to uniprot|P36018 Saccharomyces
FT                   cerevisiae YKR014C YPT52 rab5-like GTPase involved in
FT                   vacuolar protein sorting and endocytosis; probable purine
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30455"
FT                   /db_xref="GOA:C5E344"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E344"
FT                   /protein_id="CAR30455.1"
FT                   /translation="MDKPIHSAELKLVLLGESSVGKSALVTRFTTGAFHKNNATIGAAF
FT                   TTKVVSWETNEAIKQVKFEIWDTAGQERYRSLTPMYYRKTDVAFVVFDVTDDATFSKAG
FT                   SWIDELKGYMQSEDAHDIIIKLVGNKTDLLDHVPDTTLEWTPVSAKTGEGVANLFESVA
FT                   REVPSSKFTIPNEEPRQSNVINVAPSSESPKGAKACNC"
FT   gene            <883534..>888540
FT                   /locus_tag="KLTH0H10296g"
FT                   /old_locus_tag="KLTH-ORF814"
FT   CDS_pept        883534..888540
FT                   /locus_tag="KLTH0H10296g"
FT                   /old_locus_tag="KLTH-ORF814"
FT                   /product="KLTH0H10296p"
FT                   /note="weakly similar to uniprot|P29539 Saccharomyces
FT                   cerevisiae YBR275C RIF1 Protein that binds to the Rap1p C-
FT                   terminus and acts synergistically with Rif2p to help
FT                   control telomere length and establish telomeric silencing
FT                   deletion results in telomere elongation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30456"
FT                   /db_xref="InterPro:IPR022031"
FT                   /db_xref="UniProtKB/TrEMBL:C5E345"
FT                   /protein_id="CAR30456.1"
FT                   /translation="MTANSSPTKKRGKALDVLEKHISQQNKKPKNNQYGALLSMFQTIT
FT                   DSIKLPAPVSQPRPRMISSSPPRRVEQPFGSRQHPTSKSPEPPSQRSSPKKSVAFSDQI
FT                   DSSPPPASLHSSPHRSSQAVPSKPILKFTLPLARTPSPRRKNNQPGFNDKLTIDQREND
FT                   SSEDPMSLSYWVSGEVHGLGDIKSISEFKDVLTGGLYFLSSDIPEAKKRYFEIYATFNN
FT                   IMPIFTSPNYSEVKDKKVQILAQNMNVILATCIPHLISIQAELLSSLKKDPFTSRIYVQ
FT                   IVRFFNALFSNFKLVKICENNQSFQTALHKVVESFTEAIQHPNSNKVMVTAQLALLRDE
FT                   QCGIKRLTPLKVQSFVKSLANMKKISSSNLTCEKLLLLKIFLAKYPEVMFETIDIWLQA
FT                   EVLSRLLIEEEFYSLKIANNCVSILLDLLKRCLTDRDNHQVLEVLKQTTTKELFSVNCE
FT                   GNKTLAHLQTKEDNLETLLRKRVIYLIEEKDEPKLAMDLWLAMVGLLFNSAGEVSSLCS
FT                   DRGKLWLDLNLRYQNNSNPKAKKLALRSWRIVTYMICSKRLADIGESQKLVAVLLDPFS
FT                   YLSKDYYKDPDYESLIYVLNGLLYSTLCNHHKDQFTYNLEFILSPFINEILMGQKSLKI
FT                   RKVALEVLLRVVNQSPGGPTPKKEFNALKVVTSSGVEAADFIPFSSPLLSRNWHALMSI
FT                   VQKCKQTSPPETYDLSFTLLLAVIERIPQRAIDGTTRDNCSATLLPGTEDSEQKPRSRM
FT                   TDALASLMRTFKDLMCEPSPIINKLCMEIATAIKNGEIDCTDMLKTVLKETSNSISYLE
FT                   VYSFFLRLKDTRIDDFIYNSISSKILSPKISAHAFEAFIDIVNSYSSTEIIQAFLDTSE
FT                   KGSFDLWKASKLDTSRWDFGCTVRYFTMRFQREDLKVDDEFVSQFSSALTQHSRLAEEL
FT                   RKSLGVDRYAKSVVKFLKQEKRTDSYGLDSQWKLSMISCFSMDDYLEMLKFAADLREDV
FT                   QLLLINGAQNNDESLHLSLRFIQLLISSEKQIVDDIKNGCDRALYELLEKCYQKKLLCL
FT                   LNQCVLFIIENDAYYLVEKFWATCGPDFLNLLENSTLATIMNQVASKNEVVINIFNFVF
FT                   EQKPTDYVLGLMENVLAQDQLPTLNCCREKIINFLVREGIRSNEGGRKKVLAIFERASE
FT                   VLIFQHKRLLAEFMRSLISKLPAEKGEFVYDLLSFICKDERFKLKGYDNLLVKINHGLP
FT                   LASDTFQSEKKRETQRYKFHSAPQTPPNKTSSVSEAAAYSLNQLPQKVVEMRETSPSDA
FT                   TFPSCRELSSNLNQQRKLKESAAASETKTLHALGTVLNDQKHMDTSDEDQSCREKKRIP
FT                   GPNNGDKALRSITPPEETVCSSKDDGLTPRNNEKGGQDPTHKLTEISQKKQIIVSEVAQ
FT                   SKLQASRGAEALSEKSTTKGQIKQNVKSQGVSLNDEVETVAVPSPPKKHESSTTDAAAQ
FT                   IACSKLHENAQKTHHGDEVHEKRSCFEETQPKAASASALHNENSQISDGEKRTSVDSKV
FT                   GSLVIEQSLMNETLMNREGFSRGTDLSNAIGIKSTFSNVESLAKIPIFNSRKLISKNKQ
FT                   PVTCENKSNEGVTANKSSKELPGKLEDFETIKRKNLHGSVYSACEDKKLKVILQIMKEF
FT                   GVNEFSQLSDVQKQFVKQEMIKFLSKSNAS"
FT   gene            complement(<888661..>890316)
FT                   /locus_tag="KLTH0H10318g"
FT                   /old_locus_tag="Klth0H.mRNA.gf.446.m"
FT   CDS_pept        complement(join(888661..890128,890228..890316))
FT                   /locus_tag="KLTH0H10318g"
FT                   /old_locus_tag="Klth0H.mRNA.gf.446.m"
FT                   /product="KLTH0H10318p"
FT                   /note="similar to uniprot|P38147 Saccharomyces cerevisiae
FT                   YBR274W CHK1 checkpoint kinase 1 homolog of the S. pombe
FT                   and mammalian Chk1 checkpoint kinases Protein kinase Chk1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10318g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30457"
FT                   /db_xref="GOA:C5E346"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E346"
FT                   /protein_id="CAR30457.1"
FT                   /translation="MSINFSQRSPLPKIKNLVLGETVGQGSFAFVKAACLESNPETVVA
FT                   VKFVHLPTCVKHGLSEKDAIQEVVIQSKCSDHLNILKVIDCNVTKNFLWIAMEMAGGGD
FT                   LFDKIEPDVGVDAEVAQFYFKQLISAVTYLHEKCGIAHRDIKPENILLDSDGNLKLADF
FT                   GLASQFRRKDGTKRLSSDTRGSLPYMAPEILHSRNYHADLTDIWSCGVLVFVLLTGETP
FT                   WEQPSRDDDQFREFSENCGNMVSGPWNKISLTQLNLVRKMLQPDPRKRVTLSELRTHVW
FT                   YTSLVSFSDEGGRCNDPQLLSQKLLSKLHVSLSDDAYTQFMKDDFCLKIPTHTSTQPIQ
FT                   SEIADLRHDSFCASGRLATQHEFFGQPGSRQASNPDTEWTQQVHVDMATQQFQVNSIPE
FT                   GAFISTSVLTKFYSHREMSSILPMLEYALRNFSIPVKTGSYETFLELRDSHKLEDVFPV
FT                   TIQIKTMDRKGWFLSGNVSLSNAYGGLVLISFNRRSGDPLEWRRLFKKVSLVCRELVYV
FT                   P"
FT   gene            <890416..>891633
FT                   /locus_tag="KLTH0H10340g"
FT                   /old_locus_tag="KLTH-ORF808"
FT   CDS_pept        890416..891633
FT                   /locus_tag="KLTH0H10340g"
FT                   /old_locus_tag="KLTH-ORF808"
FT                   /product="KLTH0H10340p"
FT                   /note="similar to uniprot|P38349 Saccharomyces cerevisiae
FT                   YBR273C UBX7 UBX (ubiquitin regulatory X) domain-
FT                   containing protein that interacts with Cdc48p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30458"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C5E347"
FT                   /protein_id="CAR30458.1"
FT                   /translation="MSRPELEFMSSVQQAVQLSLQEQKPLVVYCTEGNDNWLRSWFNRE
FT                   LRQQLVTTCIALKLTKGQPEYGYFEQIFPSVPVPSVCCIKEGKITGVVEATVVKTDGQV
FT                   HRNTLLACLGHIPRNTNSESSPKQNSTLKEQAAQRAAQLHHEEVLKQRKVEKEERERIR
FT                   RLVKADREELKAKNREPVAHERRALDSLHDNIKNTDHLTAKTCTLQIRLLNGHAICHQF
FT                   KSNATLNSVRRWIDENRDDGDAPYVFFRSIPRESFQESDELRSLSSLQLTPRSVLILKA
FT                   VENDDNNVQIIDVQGPGLLGRMFNSVTGWWNSEKANEPDSDIQQTTKPNEKSPASSKFN
FT                   SPANSPYIRHQLARNPSELSLPSRPVSPNVFQFVNADDNEASDRDRKTFNGNSVKLEDK
FT                   KGKEGK"
FT   gene            complement(<891643..>892968)
FT                   /locus_tag="KLTH0H10362g"
FT                   /old_locus_tag="KLTH-ORF806"
FT   CDS_pept        complement(891643..892968)
FT                   /locus_tag="KLTH0H10362g"
FT                   /old_locus_tag="KLTH-ORF806"
FT                   /product="KLTH0H10362p"
FT                   /note="weakly similar to uniprot|P47048 Saccharomyces
FT                   cerevisiae YJL049W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10362g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30459"
FT                   /db_xref="GOA:C5E348"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:C5E348"
FT                   /protein_id="CAR30459.1"
FT                   /translation="MRDTTLSKSRLTSLYSDFRKLKDLNPEGYEANVRYWRHLLLDEVF
FT                   SDKLICQCGSELLKELSDKELGPPKCLDTALDSLISDGLLIAKERFKRNNNSKILKAFS
FT                   WTIGYILAGRSQATTRTSEGANYLRDADFVVLPTTKRKSLQAEQRMRSSICKKAIRYSD
FT                   LIFSKLEFCKIVGMEENLQGWNEFEIVLMYMETYMGVIVTDCNTVKVCTRDMAPLLAKF
FT                   DFNFISENDRNIASVKETYSILQFQVSMLEDRIRERKQVLAECIKSDKPKDLQRLHLRA
FT                   KKLLERNLTTACRNLQNIETLKSDIEMSLDNVNLRNTLLASRDVMSNVSAELGDTESVE
FT                   KLLDEISLERSKNEEISDILAGKLDDQNDEQLNEELEELDAEVKKEQEVTRELSKLKIS
FT                   SYQGFGPEEVALVAGRESPVEEESRADLGPSESKNKEPILST"
FT   gene            <893051..>894493
FT                   /locus_tag="KLTH0H10384g"
FT                   /old_locus_tag="KLTH-ORF804"
FT   CDS_pept        893051..894493
FT                   /locus_tag="KLTH0H10384g"
FT                   /old_locus_tag="KLTH-ORF804"
FT                   /product="KLTH0H10384p"
FT                   /note="similar to uniprot|P38348 Saccharomyces cerevisiae
FT                   YBR272C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10384g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30460"
FT                   /db_xref="InterPro:IPR040752"
FT                   /db_xref="InterPro:IPR041335"
FT                   /db_xref="UniProtKB/TrEMBL:C5E349"
FT                   /protein_id="CAR30460.1"
FT                   /translation="MAELTNNLSSDCLLDAITTSFNTKDYVTLNKQLNRANLQLCNATT
FT                   LPGNKTEFLKSLKEIFSQAPEELDHSTTAEVFERVIGLTSFDQVLEAFTVEEMGHALSS
FT                   HVINLVRLACKVLSRSQPKGLFAGTGLIDLMLEQLFDASTELDIVSEIEKCLEQLTSDA
FT                   LIRRRILKDNLQLLLRVRSQFDPICTTRLLALMNGILPHTDRSEFQDKLFIFGETEIHK
FT                   ALDKDIFLFINVTDYYVSILKIMGATSEQRQFSIWVLDRVLSVVIPIYGKLYKQMHEDY
FT                   MIETFGRKYLFSLFKEISMLSDSHYFEELDSRYLNLTPSNLDFSEFMKFIKPSYLMEVQ
FT                   HDYILGNLTVTPSNLMAWRNLISEKQSFDQVKDNLTSDAILSLPYSEQMVLLQKLTCYE
FT                   YSARYLLNDLSKVMSNTLDDKSGSITEPETSELRREVLENLLTFDSGMLNVWFQPTQEA
FT                   YRLLVNGGKVQDSMAHVADTYL"
FT   gene            complement(<894542..>897769)
FT                   /locus_tag="KLTH0H10406g"
FT   CDS_pept        complement(894542..897769)
FT                   /locus_tag="KLTH0H10406g"
FT                   /product="KLTH0H10406p"
FT                   /note="highly similar to uniprot|P47047 Saccharomyces
FT                   cerevisiae YJL050W MTR4 Dead-box family ATP dependent
FT                   helicase required for mRNA export from the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10406g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30461"
FT                   /db_xref="GOA:C5E350"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="InterPro:IPR025696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E350"
FT                   /protein_id="CAR30461.1"
FT                   /translation="MDNDDLFDVFDEKSTDLPQLEAPPKEPIETNGEAVEEVQDVKKRH
FT                   RASSEDEPKEDSATAHDSAKRPKNGKKILEKKKKSEVVPVLADSFEQEASREVNASMGL
FT                   GAANSVQVEEDGKVKLSHQVRHQVALPPHYDYKPIGEHKRQNEARTYPFTLDPFQDTAI
FT                   SCIDRGESVLVSAHTSAGKTVVAEYAIAQSMRNKQRVIYTSPIKALSNQKYRELLADFG
FT                   DVGLMTGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVVFDEVHYMRDKERGVVW
FT                   EETIILLPDKVRYVFLSATIPNAMEFAEWICKIHSQPCHIVYTDFRPTPLQHYLFPAHG
FT                   DGIHLVVDEKSTFREENFQKAMASISNQVGDNPGSTNSRGKKGQTYKGGASKGDSKGDI
FT                   YKIVRMIWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSEDEKEALTKIFTNAIELLPE
FT                   TDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMP
FT                   AKTVVFTSVRKWDGKQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVAKGM
FT                   VKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLEHSFFQFQNATSVPLMEKKLTELSA
FT                   KSESMVIEDEQNIKDYYEIQKTLDGYSEDIRQIVTHPSNVLSFLQPGRLIEVQVGNANY
FT                   CWAAVVDCTKRTSKLSAVYSDHESWIVKVVVNTMYVDAPLNLIKPFNPVFPEGIRPASV
FT                   GEKSVSTIIPITLNSIKSVGNLRLHMPKDILAGSQQVAVGKSIKEVRRRFSDKVPVMDP
FT                   IKNMKIEDEDFQKLLQKSEVLKSRQSSNPLSGSVRLDDLYQKYNEKVSINSEIRQLKKK
FT                   IQEAQAVTQLDDLRRRKRVLRRLDFCTPNDIIELKGRVACEISSGDELLLTELIFNGNF
FT                   NDLTPEQAAALLSCFAFQERCKEAPRLKPELAEPLKNMREVAAKIAKIVKDSKIEIVEK
FT                   DYVESFRHELMEVVYEWCKGATFTQICKMTDVYEGSLIRMFKRLEELIKELVEVSNTIG
FT                   NSMLREKMEAALNLIHRDIVSAGSLYL"
FT   gene            complement(<898234..>900537)
FT                   /locus_tag="KLTH0H10428g"
FT                   /old_locus_tag="KLTH-ORF799"
FT   CDS_pept        complement(898234..900537)
FT                   /locus_tag="KLTH0H10428g"
FT                   /old_locus_tag="KLTH-ORF799"
FT                   /product="KLTH0H10428p"
FT                   /note="weakly similar to uniprot|P47046 Saccharomyces
FT                   cerevisiae YJL051W Protein of unknown function localized to
FT                   the bud tip mRNA is targeted to the bud via the mRNA
FT                   transport system involving She2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30462"
FT                   /db_xref="GOA:C5E351"
FT                   /db_xref="UniProtKB/TrEMBL:C5E351"
FT                   /protein_id="CAR30462.1"
FT                   /translation="MRRKKPCNLVLSLTRICAALLSLSSGAFSIAVLCVGPQESCFNEA
FT                   ALIIILIGAIMNAMVQIALAIRDELFFKFISIFPLSMTLGSGVCYIKFLIERLPTTNIS
FT                   SGRAGLVTAHLSILLSTLLLSGASSSLTPQHATKESVKVHGPGGDMEPGNNEQTKVATK
FT                   TVAMKNSSQTLTPEHDFQEIYSHQNWMNKYSSTYSGSESASATSVVKHSLEAQASQNSA
FT                   QEQMFADPSRKISKKPKVRSFLRMRPKNKVSKDRAVLETPQMDESIQAHYVTRLSTIQD
FT                   NSKSFLNVTHNLQHRDVSSKSARSSSLLSDHGKATVFDEDAFLMEKNAVHRINSALLPP
FT                   SLRASDKDDKNYKWNSGISELHNSPPTSSVTEDGLDLLQENDLEDIPQAPDWSKPLDTN
FT                   ADTPKLLKKVNFQDWQTHSDRLLESERILSESSPKLLPGLLFQPKDRLQPEVDFSFPAQ
FT                   KPKLDFDDFLGHNNDDTVSELDILFRREEGGLTDKSDTADFMESILKQNDVSTNLKRLS
FT                   KEMSFTSGNHSPTKSMTSIITNSANGSFKYPSRSPQKSPSKSPSKFGSMFSNAGHSQAS
FT                   NHIHHSRSNSQITAFLHTVANKGNTNSSVQSSPTRGGRLRRSFSKKMSLSSISFKQEED
FT                   ECLHEHIRGKSIDFSYVHSLQNKHSPSKSLTLAGRRNSMFAPGDLKLRTVSAIFSEDDA
FT                   GHNSTVSKLKQGIGPTEDVTNQKTEDSSTRSSQSITSETHYPQAVIGEYDREKWSTLLS
FT                   MSLIDSPKSAAANY"
FT   gene            complement(<901280..>902218)
FT                   /locus_tag="KLTH0H10450g"
FT                   /old_locus_tag="KLTH-ORF797"
FT   CDS_pept        complement(901280..902218)
FT                   /locus_tag="KLTH0H10450g"
FT                   /old_locus_tag="KLTH-ORF797"
FT                   /product="KLTH0H10450p"
FT                   /note="highly similar to uniprot|P40335 Saccharomyces
FT                   cerevisiae YJL053W PEP8 vacuolar protein sorting protein
FT                   that forms part of the multimeric membrane-associated
FT                   retromer complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10450g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30463"
FT                   /db_xref="GOA:C5E352"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR028934"
FT                   /db_xref="UniProtKB/TrEMBL:C5E352"
FT                   /protein_id="CAR30463.1"
FT                   /translation="MSLFFKSPIDIEVLLDGEESRKHVEVANASNNSTAKTLKDRFPVY
FT                   EDGESVSGIVTLRVKEGRKLEHLGVKVSLIGSVDISKSSSDYKKRPVDTFLSLSADLCP
FT                   QGELMHSQSFPFSFKDVEKRYDSYRGKNVDVSYYVKVTVLRKSTDVVKFKRFWCLLYNS
FT                   EPPAPALSKSSDDAKPVKLDIGIENCLHIEFEYSKSQYSLKDVIVGRIYFLLTRLKVKH
FT                   MELSLVTRETCGLEPNQLSDTTSIRYEIMDGSPVKGETIPIRLFLGGYDLTPNSNFNHF
FT                   SIRNYLSLVIIDEDGRRYFKQSEIVLYRKRN"
FT   gene            complement(<902520..>903968)
FT                   /locus_tag="KLTH0H10472g"
FT                   /old_locus_tag="KLTH-ORF795"
FT   CDS_pept        complement(902520..903968)
FT                   /locus_tag="KLTH0H10472g"
FT                   /old_locus_tag="KLTH-ORF795"
FT                   /product="KLTH0H10472p"
FT                   /note="similar to uniprot|P47045 Saccharomyces cerevisiae
FT                   YJL054W TIM54 Translocase Inner Membrane 54kD Translocase
FT                   for the insertion of proteins into the mitochondrial inner
FT                   membrane."
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30464"
FT                   /db_xref="InterPro:IPR021056"
FT                   /db_xref="UniProtKB/TrEMBL:C5E353"
FT                   /protein_id="CAR30464.1"
FT                   /translation="MSSSENPKPPQDGPKILKKPGYSNPAFKAMGIPTLRLPSRNWMIF
FT                   WTVLTVSVSGIVYDKQQQKKIVKKWCKTVEPLSEEKFPVNEVPRKVTVFVAPPPSDYLD
FT                   TSMSVWRRFVKPVLYSSGIDYEVFTEEKQGPIRAEVAERIRELRRELIKHEEDIKRLND
FT                   EKKIWNRCKRALTGKLQHMRSSEGLDQEIEKAAAEKFKAEFDYKNLLGVYYKNKNKSNK
FT                   VVAEDALVSSPEMAGGVICIGRGAYKEYIEGVHEGILGPLEPTATTNAQTEAASEKAPA
FT                   LPEVLSGATQTEAKVENSNEVSENATPNTETALTNESAEAESAKDSDLDPEGSAKPKPV
FT                   PKPYISPKGYESAELPQELSSPNVARDLITGIPALFYQPILVIPMPNLVGFLNIPERIY
FT                   RYYRRRYLAEEYCKAAASCVLQKVRPFDGTTDLEIAKSEENDWPKKWVQQGLEKDSPWV
FT                   QELQGDRRVLEKLTVYDPSLIKEE"
FT   gene            complement(<904424..>905893)
FT                   /locus_tag="KLTH0H10494g"
FT                   /old_locus_tag="KLTH-ORF793"
FT   CDS_pept        complement(904424..905893)
FT                   /locus_tag="KLTH0H10494g"
FT                   /old_locus_tag="KLTH-ORF793"
FT                   /product="KLTH0H10494p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30465"
FT                   /db_xref="GOA:C5E354"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:C5E354"
FT                   /protein_id="CAR30465.1"
FT                   /translation="MDKHTKKGPWTPAEDRALLSLVQELGPQNWVRIASSLQFRSPKQC
FT                   RERYHQNLKPSLNKSPISDDEGAVIEDLVNKLGKKWAEIARLLNNGRSDNAIKNWWNGG
FT                   ANKRKRARSLTSVNTASSPAHPGINGAGALSPPMAYAKSPGAYAPHSAGPQPVSVVSSV
FT                   SHALPSALPTPPGASLAPARQSATVGASSTPPSLSPPLRSRALPSTSLPPVTFLQQPMY
FT                   MLPYANMSSGPAQPPLPPPPFHGVNQFYAPAQPLLQRPSHSQHAPQQLQSHPHSLMHAL
FT                   PHSKSQSELPSLNSGPRPRSRRTSVSIENRGSADAKNGPSSGTSRRSSIAFLDGFGSNK
FT                   RPNFNQNGSPLTFSRRVSAVSLGPSASNSSSTSSILSFPVGSSGVGSAATSQATPPGSL
FT                   NVASNASPPPGATSKSTGEIFKLDFKFGDNRVQKGTPANSKPKLHTSFASEKSCQQAVN
FT                   PPRVPEQSRVKLHDLLNDSNDDDQPSNSTVS"
FT   gene            complement(<908060..>908779)
FT                   /locus_tag="KLTH0H10516g"
FT                   /old_locus_tag="KLTH-ORF779"
FT   CDS_pept        complement(908060..908779)
FT                   /locus_tag="KLTH0H10516g"
FT                   /old_locus_tag="KLTH-ORF779"
FT                   /product="KLTH0H10516p"
FT                   /note="similar to uniprot|P47044 Saccharomyces cerevisiae
FT                   YJL055W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10516g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30466"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C5E355"
FT                   /protein_id="CAR30466.1"
FT                   /translation="MTEIKSQKAVCVYCGSSFGKDPKFSDEARKLGQLLHSMRWKLVYG
FT                   GGTTGLMGEIARATMGPDVDGFVHGIIPNALVARERTEESEAPEATGKASVSTFNEEIR
FT                   KSVENHKGSTPLSHEYGSTTIVPDMHTRKRMMATESDAFVAMPGGYGTLEEIMECITWS
FT                   QLGIHQKPVVLFNTDGFFDSLLRFIQHSIESGFISEKNGRIIQVATTAEEVIDKIQQYQ
FT                   VPDGRFNLNWSDEHEGN"
FT   gene            <910730..>912778
FT                   /locus_tag="KLTH0H10538g"
FT                   /old_locus_tag="KLTH-ORF771"
FT   CDS_pept        910730..912778
FT                   /locus_tag="KLTH0H10538g"
FT                   /old_locus_tag="KLTH-ORF771"
FT                   /product="KLTH0H10538p"
FT                   /note="weakly similar to uniprot|P47043 Saccharomyces
FT                   cerevisiae YJL056C ZAP1 Zinc-regulated transcription factor
FT                   binds to zinc-responsive promoter elements to induce
FT                   transcription of certain genes in the presence of zinc
FT                   regulates its own transcription contains seven zinc- finger
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10538g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30467"
FT                   /db_xref="GOA:C5E356"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR040792"
FT                   /db_xref="UniProtKB/TrEMBL:C5E356"
FT                   /protein_id="CAR30467.1"
FT                   /translation="MPNSQGVVHGHIHNFNSVTYIHGHVHRKSSVSERPAGVLRDLAPE
FT                   GAQLQAEEALDFHNGSELAQLPQVSAPVPNAPLSPPGSNSDVMNAIATDPSLCSQFKDC
FT                   QHFEFMNYHNLNLFGKNKAPPASDETLVMPDKRRKLADCSCHPRVVEICCEEDHEFNGQ
FT                   PSASPLNEDLVLFTNNVEANRPLHQTAIPIVSNLPDLIDCDLTCASSNPEDDQLFEKLC
FT                   EQCVDLDQSENHHSHNHTHNNRSACEPVPAAPSNPTSSHDHVINSSSDMKILEDLANIS
FT                   SMYDFPFGKHIHSHDNAINGDNINLLQTSLPGLKAENLDEQLNKAHHHHRIEVHPHPAH
FT                   QGSNTQDPNFSNERNSQLPDFGTFMDYGKIHHGTSQQEFPPPDMRNHTVNFNWSFKDDD
FT                   SKVNCGWNHCPQKYDSLIDLQSHILRDHISEGTTATKLPTPRTQFDCEWDNCGFEGDDM
FT                   CTLINHINGKHGIAFNMKFLDKDKLEEQSEQHHMLHCDEACDDCRPCKDHNDEQDHTCR
FT                   WEGCMQVFNSCEELNGHIEKVHIPRGKSSYVCGWENCGKVITQRQKLLRHLRVHTRYKP
FT                   CKCPHCAKTFSTQDILQQHIRTHSGEKPYKCVHCGKGFATSSSLRIHIRTHTGEKPLEC
FT                   KVCGKRFNESSNLSKHMRTHERKYKCGKCKRSFDLQEQLEVHQSRCY"
FT   gene            complement(<912880..>914133)
FT                   /locus_tag="KLTH0H10560g"
FT                   /old_locus_tag="KLTH-ORF769"
FT   CDS_pept        complement(912880..914133)
FT                   /locus_tag="KLTH0H10560g"
FT                   /old_locus_tag="KLTH-ORF769"
FT                   /product="KLTH0H10560p"
FT                   /note="similar to uniprot|P38347 YBR271W Saccharomyces
FT                   cerevisiae Putative S-adenosylmethionine-dependent
FT                   methyltransferase of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10560g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30468"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E357"
FT                   /protein_id="CAR30468.1"
FT                   /translation="MFDPLDFLSGSEKPSACAGNQMRSISSDTLVTVIQPQESAYNDRD
FT                   LEEEVDAPIGVIDLPHVAIAPPSVVLTALLLLRPSINVNFSERDDTIDRSVESVCREKD
FT                   ITVSQIEAFASWCSGFGMSVLDTPAKICARVPGLASTADGKDLLMYYTMVLSKYEKMQT
FT                   ADQVNERILKEASMRISEKCGRTAQPAMNRIFKIGGLRTGVKLHEPALTSDNLGLKTWG
FT                   ASLVLARKLCENFSKFERQRDLRILELGAGTGLVGISLVLKMLESNSGHNCSMHLTDLP
FT                   EIVTNLKENVKINCCNSRSDLKVYADVLDWTNPDSFEKTYGAHKFDVLLIADPVYSPQH
FT                   PQWIVDMISKFLSPRGVLYLEVPIRQKYHDERQHLWGLIRDASLQVIKEELDEGVDDWG
FT                   KVSYLYKKIVPVNANQSD"
FT   gene            <914695..>916440
FT                   /locus_tag="KLTH0H10582g"
FT                   /old_locus_tag="KLTH-ORF766"
FT   CDS_pept        914695..916440
FT                   /locus_tag="KLTH0H10582g"
FT                   /old_locus_tag="KLTH-ORF766"
FT                   /product="KLTH0H10582p"
FT                   /note="weakly similar to uniprot|P47042 Saccharomyces
FT                   cerevisiae YJL057C probable serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10582g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30469"
FT                   /db_xref="GOA:C5E358"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5E358"
FT                   /protein_id="CAR30469.1"
FT                   /translation="MSLIVYGDKIDDENNESVVLQDPSSRSLVVMNQESGEISLLRQIR
FT                   GPQNGSRRKGGTGLISSYFCPQCGSEIGCGYNFASSPPSTKKPSGSFVHKNYFNLLEHR
FT                   SSQTQLPSIESPSAIPASLFTPGYYQRFFKELSLLGSGARGSVFKVEHVLMDNHLGVYA
FT                   LKKIHIGNNLSWLERGMKEVKFLSALTHSSVNLITYNHVWLEMDNASGIVKARNGEEVG
FT                   PPESVPCVFILQQFCCGGNLEEVVLNKVFEKFTDHESPEARKRRFRLRRSANAHGSRQL
FT                   GLGTNQILSIIHDVASGLKELHDLNIIHRDLKPSNCLLLESYEAGKEGYGDKSFPTVVI
FT                   SDFGESQLGGQPRSATGATGTLEFTAPEVVITNSENLSANLPQFSFQSDMYSLGMVCYF
FT                   LVFGELPFGCQQSLPELKKNIKLLSITKEGLSQKHDDMKLHPIDSAIFVLIEKLLSRDA
FT                   LSRPTAGEVKAEIAEIMDRLDDCVSATFDEKQELLSDDESELQSIFGRQPEEISAKSGP
FT                   SCSAIIDLANVATVLIAICFFNEKSLIPCVCVALLALSLKVPPPARKLFLITELTLLIV
FT                   AHLAI"
FT   gene            <916591..>918201
FT                   /locus_tag="KLTH0H10604g"
FT                   /old_locus_tag="KLTH-ORF765"
FT   CDS_pept        916591..918201
FT                   /locus_tag="KLTH0H10604g"
FT                   /old_locus_tag="KLTH-ORF765"
FT                   /product="KLTH0H10604p"
FT                   /note="similar to uniprot|P38346 Saccharomyces cerevisiae
FT                   YBR270C BIT2 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10604g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30470"
FT                   /db_xref="InterPro:IPR013745"
FT                   /db_xref="UniProtKB/TrEMBL:C5E359"
FT                   /protein_id="CAR30470.1"
FT                   /translation="MNTSKKVMDNNVKRKRSFSALPIVHKLPGKNADSGRARFYSVSSQ
FT                   IVPQTIQVTDDLGRKAAATEPKSSSPALADLSKVGFQSIYRDPTVKKSQRSINTPEPSA
FT                   KLHATSSSSSIKSSTITSNRSYRSGSNTSGLSHKRSALSLSNKLSGKKSVDTFDREKRK
FT                   INGVDGSSSSISSSNKERSRLFTNTLTSAARKLFHRKDGRQEKRGEQLKSPTAVTSSTF
FT                   GRFLHNKYSKHVGKATAHYKYSSGSFIDSAKSNANNPSTSNDVPLQLVQESNLDASDIQ
FT                   MLHDLIKNLKSLESNYRTFTVEELDALMSNVWGVYCSVVLTLFKNRELWELPAKIEDLN
FT                   KILSFYIKLKTTSKNASASSKFLSEIEEFLTTCLYTLENQIVFNYSNENTINTALKRLC
FT                   VIWEVFYQQIYHSTIALFLPLSNSFLVDTRYWSETFNGFSSDGIGNKRAGSLSLDFLLL
FT                   KSFRDSIVSPYYQSFINSHEGASKGFHLYIMSEEEEKGVTQQDKLVLLQCFGILSSIRG
FT                   TDIKQRVVDELLVGIRMSI"
FT   gene            complement(<918216..>919424)
FT                   /locus_tag="KLTH0H10626g"
FT                   /old_locus_tag="KLTH-ORF764"
FT   CDS_pept        complement(918216..919424)
FT                   /locus_tag="KLTH0H10626g"
FT                   /old_locus_tag="KLTH-ORF764"
FT                   /product="KLTH0H10626p"
FT                   /note="similar to uniprot|P47040 Saccharomyces cerevisiae
FT                   YJL059W YHC3 Homolog of human CLN3 vacuolar/lysosomal
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10626g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30471"
FT                   /db_xref="GOA:C5E360"
FT                   /db_xref="InterPro:IPR003492"
FT                   /db_xref="InterPro:IPR018460"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E360"
FT                   /protein_id="CAR30471.1"
FT                   /translation="MVESSTVFRYFWIFGLVNNVLYVVILSAAADIVGPNLPKSLILLV
FT                   DILPSFTVKLSAPFFIHKVPHNRRIALLIILSCVGMILVSGGKLSVCIGGIILASLSSG
FT                   LGEITFLQLTHYYQHPSLNGWSSGTGGAGLLGSGAYLLLTSILKVPVGISLLLFSVLPF
FT                   AFLLYFRLDTQDSYQPIEGEITESAQPSTASSDSFPDNYKATSKWMALKNHINTTLTRL
FT                   RSLFIPYMLPLSTVYLFEYLINQAVSPTLLFPLDGDHTHPFFFNKYRDIYVTYGTLYQL
FT                   GVFISRSSGSFIRIKKLFLLSVLQGLNLTVVICQSWFYIVHSVYPVMLLIFFEGLLGGA
FT                   SYVHTFMNIIHDVNPSEREFTLGAVSMSDSFGTLLAAFIGIALEPKLCSHQVDTGRDWC
FT                   LKE"
FT   gene            complement(<919601..>920932)
FT                   /locus_tag="KLTH0H10648g"
FT                   /old_locus_tag="KLTH-ORF761"
FT   CDS_pept        complement(919601..920932)
FT                   /locus_tag="KLTH0H10648g"
FT                   /old_locus_tag="KLTH-ORF761"
FT                   /product="KLTH0H10648p"
FT                   /note="highly similar to uniprot|P47039 Saccharomyces
FT                   cerevisiae YJL060W BNA3 Arylformamidase involved in
FT                   biosynthesis of nicotinic acid from tryptophan via
FT                   kynurenine pathway potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10648g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30472"
FT                   /db_xref="GOA:C5E361"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5E361"
FT                   /protein_id="CAR30472.1"
FT                   /translation="MIKHLSRKLSMSVGKQRQIVPNLALTQNLTKDVWSLTNEAAAAAA
FT                   HNAQNKGRDLINLGQGFFSYSPPAFVVEEAQKALDDAMVNQYSPTKGRMSLINSLIKQY
FT                   SPLYNTQLQANNIQVTTGANEGILACLVGLLNPGDEVIVFEPFFDQYISNIQIPGGKVT
FT                   YVPLHPPKEMSVRPTEGTEWTVDYDELRAAITPKTKALILNTPHNPVGKVFTREELLQI
FT                   GQICVENNVVIISDEVYEHLYFTPEFTRVATLSPEIGQITLTIGSAGKSFAATGWRIGW
FT                   IVSLNPELLEYASMAHTRICFASPSPLQEACANALPIALDNGYFKKMREEYIHKFNIFT
FT                   RVFDELGLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAKDFRISYWLINELGVVA
FT                   IPPTEFYIKEHEKVAENLLRFAVCKTDDYLEGAVERLRLLKEHL"
FT   gene            <921312..>921719
FT                   /locus_tag="KLTH0H10670g"
FT                   /old_locus_tag="KLTH-ORF758"
FT   CDS_pept        921312..921719
FT                   /locus_tag="KLTH0H10670g"
FT                   /old_locus_tag="KLTH-ORF758"
FT                   /product="KLTH0H10670p"
FT                   /note="similar to uniprot|P38345 Saccharomyces cerevisiae
FT                   YBR269C FMP21 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10670g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30473"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:C5E362"
FT                   /protein_id="CAR30473.1"
FT                   /translation="MSFIGSRASLTAGTLFKRSRNVIPAAFSRSFQAKRGPAPPQLPKE
FT                   EQEEFERLQRIAQSQEAIDEYNREIENDTTKESAKSPILKADIGGFSPEFSKTIPEFAG
FT                   DVNPKTGERGGPKQDPLKHGDYSFNGRVTDF"
FT   gene            complement(<921787..>923862)
FT                   /locus_tag="KLTH0H10692g"
FT                   /old_locus_tag="KLTH-ORF755"
FT   CDS_pept        complement(921787..923862)
FT                   /locus_tag="KLTH0H10692g"
FT                   /old_locus_tag="KLTH-ORF755"
FT                   /product="KLTH0H10692p"
FT                   /note="similar to uniprot|P40368 Saccharomyces cerevisiae
FT                   YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
FT                   forms a subcomplex with Nup159p and Nsp1p interacts with
FT                   Nup116p and is required for proper localization of Nup116p
FT                   in the NPC"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10692g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30474"
FT                   /db_xref="GOA:C5E363"
FT                   /db_xref="InterPro:IPR037700"
FT                   /db_xref="UniProtKB/TrEMBL:C5E363"
FT                   /protein_id="CAR30474.1"
FT                   /translation="MLPEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLM
FT                   DAPNYEYMELNAISNYTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGV
FT                   KQVLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIES
FT                   VCFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSP
FT                   ELKLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLY
FT                   LATAKQIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSL
FT                   KLPGSISLIYGSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKK
FT                   GTFQSAGLWPESGMQKIVLLSEKEITSIDISSMQTPASSTTEKIEKSETNRQRPYSQPL
FT                   SEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQT
FT                   LGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFE
FT                   SLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLAEALSSLKLSL
FT                   EYVRVDSAEAASRSKKSAESAGGVPWDELQAMLAKDSRIIKECQAELQCTTQELDS"
FT   gene            complement(<924077..>924397)
FT                   /locus_tag="KLTH0H10714g"
FT                   /old_locus_tag="KLTH-ORF751"
FT   CDS_pept        complement(924077..924397)
FT                   /locus_tag="KLTH0H10714g"
FT                   /old_locus_tag="KLTH-ORF751"
FT                   /product="KLTH0H10714p"
FT                   /note="similar to uniprot|P36532 Saccharomyces cerevisiae
FT                   YBR268W MRPL37 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10714g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30475"
FT                   /db_xref="InterPro:IPR013870"
FT                   /db_xref="UniProtKB/TrEMBL:C5E364"
FT                   /protein_id="CAR30475.1"
FT                   /translation="MFANLRNLTSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQI
FT                   KKSGKEPVALEDHEYPEWLWTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLS
FT                   EI"
FT   gene            complement(<924558..>926990)
FT                   /locus_tag="KLTH0H10736g"
FT                   /old_locus_tag="KLTH-ORF750"
FT   CDS_pept        complement(924558..926990)
FT                   /locus_tag="KLTH0H10736g"
FT                   /old_locus_tag="KLTH-ORF750"
FT                   /product="KLTH0H10736p"
FT                   /note="similar to uniprot|P40367 Saccharomyces cerevisiae
FT                   YJL062W LAS21 Integral plasma membrane protein involved in
FT                   the synthesis of the glycosylphosphatidylinositol (GPI)
FT                   core structure mutations affect cell wall integrity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10736g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30476"
FT                   /db_xref="GOA:C5E365"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR037674"
FT                   /db_xref="InterPro:IPR039527"
FT                   /db_xref="UniProtKB/TrEMBL:C5E365"
FT                   /protein_id="CAR30476.1"
FT                   /translation="MNKRLLVLLVLEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRR
FT                   MAPKFEKMVLVIVDALRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLK
FT                   GITTGSTPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEF
FT                   FDETDGTNSFFVSDFEEVDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSF
FT                   MPPKHREMDAVIEQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLE
FT                   KYEKPLAQQGQDIPVASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLK
FT                   LLSPADAKTKVIDNYQQLLSISGGSTKKLGDPDAIIEEMREVQSDLAKTATNYNYLLLG
FT                   IGFLTLLVVSSVALFFSWTSFPSTFGLFLLLGTSLLLSLSTFGSSFIEEEHQIWWWTSI
FT                   ALVGLSYISAPRELGDHLTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLIT
FT                   TTIFVVQFQGRAKGFSAFQYSFLMSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMK
FT                   GVSKDQIDFSDALVPMARLFFQVTAAVIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQ
FT                   TSSANIPQFLAFHILSRKLNSLWSRRQWSFPVLMTVNLVLQHLSFFQFGNTNSIATVSL
FT                   TNAYNGVSENYNIYVVGALMCVSNFAPSIYWSLSCLKILYSKSTQSKWETFFTSRLPSF
FT                   LYYCLFGCFLLGSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAIIAWFFEGTLVALL"
FT   gene            complement(<927171..>928358)
FT                   /locus_tag="KLTH0H10758g"
FT                   /old_locus_tag="KLTH-ORF749"
FT   CDS_pept        complement(927171..928358)
FT                   /locus_tag="KLTH0H10758g"
FT                   /old_locus_tag="KLTH-ORF749"
FT                   /product="KLTH0H10758p"
FT                   /note="similar to uniprot|P38344 Saccharomyces cerevisiae
FT                   YBR267W REI1 Protein of unknown function involved in bud
FT                   growth in the mitotic signaling network proposed negative
FT                   regulator of Swe1p and Gin4p contains dispersed C2H2 zinc
FT                   finger domains"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10758g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30477"
FT                   /db_xref="GOA:C5E366"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR040025"
FT                   /db_xref="InterPro:IPR041661"
FT                   /db_xref="UniProtKB/TrEMBL:C5E366"
FT                   /protein_id="CAR30477.1"
FT                   /translation="MSSFTCNSCGLQFSAIGGQREHMKTDWHSYNLKRRVAQLPPINEA
FT                   TFNAKVKAFAEQDSEPEKQKQMTKKEARRREKEALLAKKKALLEQARESILNNMQKEGN
FT                   EASESGPSEQAVEAPQKEGEQEASEAPDSTLTPDQLAEQLMQQKLENKVDIPLNVCLFC
FT                   TRKREFADLDSNLDHMFKNHGFYIPEQKYLVDKAGLVKYMSEKIGLGNVCLVCSYQGRS
FT                   LEAVRAHMLSKSHCRVPYELEDERLEISEFYDFSGTYGDQETPVVRAEAAGEDGEWEDV
FT                   DSEEDGEQASDEDLPQDYIYNDGVELHLPTGVKVGHRSLQKYYRQNLKPESVLTEGQGT
FT                   LIAAETRHFATVFDPKQVATQKRVWQAEVKDKKRDDKRAAKFVNNQPHYRDQLLQ"
FT   gene            complement(<928608..>929552)
FT                   /locus_tag="KLTH0H10780g"
FT                   /old_locus_tag="KLTH-ORF744"
FT   CDS_pept        complement(928608..929552)
FT                   /locus_tag="KLTH0H10780g"
FT                   /old_locus_tag="KLTH-ORF744"
FT                   /product="KLTH0H10780p"
FT                   /note="similar to uniprot|P38342 Saccharomyces cerevisiae
FT                   YBR265W TSC10 catalyzes the second step in the synthesis of
FT                   phytosphingosine 3-ketosphinganine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10780g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30478"
FT                   /db_xref="GOA:C5E367"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E367"
FT                   /protein_id="CAR30478.1"
FT                   /translation="MAKFSLENQVALIAGGSQGLGKEFARKLYQEGTNNTVIVVSRSQD
FT                   KLQRAVCSITGLETALELSEDARNLQHEQQQNRIFFASCDLAEYAQVEKLYELLAACEI
FT                   VPTQVFLCAGGSTPGLFKDLSGRELDLGVRVNYMTCVNLAHIAVRKWPGSHLVFFSSEV
FT                   AFFPFIGYSQYAPLKQSIKSLVAILRQECAPQRISCVYPGNFDSEGYALENETKPTITK
FT                   EIEGPSDAISCAECCDRICKTLKAGYDDVTTDFIGWVLMSTDMGLNKQNNVSFGWPLQW
FT                   LLGIFANLIIVPIYMLICKFQIRQWRKSCQKKN"
FT   gene            complement(<929775..>930050)
FT                   /locus_tag="KLTH0H10802g"
FT                   /old_locus_tag="KLTH-ORF742"
FT   CDS_pept        complement(929775..930050)
FT                   /locus_tag="KLTH0H10802g"
FT                   /old_locus_tag="KLTH-ORF742"
FT                   /product="KLTH0H10802p"
FT                   /note="similar to uniprot|Q3E7B2 Saccharomyces cerevisiae
FT                   YJL062W-A Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10802g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30479"
FT                   /db_xref="GOA:C5E368"
FT                   /db_xref="InterPro:IPR041752"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E368"
FT                   /protein_id="CAR30479.1"
FT                   /translation="MAFEPSRYQDPRTWKMTPAMIRARRPFFKKNLLGLGILVSVTGGI
FT                   YVYTHRFLNRDNDFADVPIPPIDPKELEQLKKEYEQHKRDVAARDE"
FT   gene            <930412..>931143
FT                   /locus_tag="KLTH0H10824g"
FT                   /old_locus_tag="KLTH-ORF741"
FT   CDS_pept        930412..931143
FT                   /locus_tag="KLTH0H10824g"
FT                   /old_locus_tag="KLTH-ORF741"
FT                   /product="KLTH0H10824p"
FT                   /note="similar to uniprot|P22353 Saccharomyces cerevisiae
FT                   YJL063C MRPL8 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10824g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30480"
FT                   /db_xref="GOA:C5E369"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="InterPro:IPR040894"
FT                   /db_xref="UniProtKB/TrEMBL:C5E369"
FT                   /protein_id="CAR30480.1"
FT                   /translation="MTAGLMRHFSRTKAHRDSMFRNLVSQLFQHGSIVSTHEKCLEASR
FT                   MADRVITMAKKLKHHPNSAMEIQSRLSLAGDNSKLLSRVVGELAPRYKQRPGGYTRVLK
FT                   LEPRLGDRAKQSVLELVDTPVVDAAGALQRGDIKLWLLCKTTIQNESKSVGYSQLTLRN
FT                   FAKMLKFRKNSHTFFTNDVLAVRKFIKQEQGLDWDEKHELKLVKQLKKQVLNEQAQPAQ
FT                   TQTQPEAPGYTYVQERPQRQI"
FT   gene            <931560..>932609
FT                   /locus_tag="KLTH0H10846g"
FT                   /old_locus_tag="KLTH-ORF739"
FT   CDS_pept        931560..932609
FT                   /locus_tag="KLTH0H10846g"
FT                   /old_locus_tag="KLTH-ORF739"
FT                   /product="KLTH0H10846p"
FT                   /note="similar to uniprot|P53206 Saccharomyces cerevisiae
FT                   YGR012W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10846g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30481"
FT                   /db_xref="GOA:C5E370"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C5E370"
FT                   /protein_id="CAR30481.1"
FT                   /translation="MTQFPVLASKGLVDAVGKTPLIKLNTLSKELGRNIFGKAEFQNPG
FT                   GSVKDRAALYLIEQAEKSGQIDPSRPATIVEGSAGNTAIGLAHIARSKGYKSIFYMPNT
FT                   QSVSKINLLKYLGAEVYPVPVCPISDPMNFNNRARDHAKRLDNAIWTDQFDNPANWKSH
FT                   YATTGPEILQQLQSAGLSCDAFTCSTGTGGTFTGVAKYLKEATNGQSKLVVADPPGSVI
FT                   YSYIKTGEMNREGSSFTEGIGQGRITKNLRESIDITDDAVFVPDEESIVMLFRLLDEEG
FT                   LFIGGTTALNVVAACKVAKTLPEGSNISTILCDSGHKYADRVFSKKWLREKKLYDAIPD
FT                   SLKRYAILD"
FT   gene            complement(<932678..>935029)
FT                   /locus_tag="KLTH0H10868g"
FT                   /old_locus_tag="KLTH-ORF736"
FT   CDS_pept        complement(932678..935029)
FT                   /locus_tag="KLTH0H10868g"
FT                   /old_locus_tag="KLTH-ORF736"
FT                   /product="KLTH0H10868p"
FT                   /note="similar to uniprot|P38148 Saccharomyces cerevisiae
FT                   YBR276C PPS1 Protein phosphatase with specificity for
FT                   serine threonine and tyrosine residues has a role in the
FT                   DNA synthesis phase of the cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10868g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30482"
FT                   /db_xref="GOA:C5E371"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C5E371"
FT                   /protein_id="CAR30482.1"
FT                   /translation="MFYPAEPNGPGQPPNKRRKGHSEEQGSSFTDSASDKNHLIPGRVS
FT                   LISHEKMRKLVAQHISQRLPDCDEVFPWLHGYSGATNPPHSCQWLAVIRSQPLSQGLIE
FT                   NSGLLKSSLDPHEFLMTLEPRKHHLESLLSNVGGILNLTSAEIKILTSACERHKLLPFL
FT                   ISDAKAQSWFGVGANKHSVGKSSSKHDPPRNWKQPGMFRRFDLQVAKFVEMSRNCVVYC
FT                   LDQTTHYTSCPCCGLALLIHVARRIVDPKGNFRISVLDSTQIDPEWWGTPPMKVNALKK
FT                   VHNSQLASDFDVASFNNWDRDLFYRERLEISKMSSASCISADASVWCGNSTDFEIYRLY
FT                   NGDAMNAKPVNASVTSPDTVVTLPNLRSSNDDELIDTQLFNLPRPSKPWRLFLHCSESS
FT                   CLPELSKVTSLIEHVQRKTPLAQTLISFPNSGSIGLGNLNLDSIKVILNMCLLLYSVGK
FT                   HTNCGSLIYCSDGYTETSFLLVAFLIFVWDQPLDKVLVRLHGEVNRPFFLFPIDLQVLG
FT                   HLQILLREQSPRRTEPESSSLDVDPELFSKMFFTKVSDNLNLLQLKGPLPSKILPHLYL
FT                   GSLEHAQNPKLLQEIGIKNIVSVGETMPWLLAAISRKRSLTVSDINDQKTCTRPSISSA
FT                   SSASQIPSLQGSFLKRENGCAIIEENGFRVLHITNLDDNGEDHLLSQLDEVLSFIEECY
FT                   NRQEKVLVHCMVGVSRSATVCIAECMRRLNCDVLRAYLYVRVRRLNIIIQPNLMFVYEL
FT                   CKWQETHGRPSHVDWHIICRAISELNSVYF"
FT   gene            <936960..>937565
FT                   /locus_tag="KLTH0H10890g"
FT                   /old_locus_tag="KLTH-ORF730"
FT   CDS_pept        936960..937565
FT                   /locus_tag="KLTH0H10890g"
FT                   /old_locus_tag="KLTH-ORF730"
FT                   /product="KLTH0H10890p"
FT                   /note="some similarities with uniprot|P40366 Saccharomyces
FT                   cerevisiae YJL065C DLS1 Subunit of ISW2/yCHRAC chromatin
FT                   accessibility complex along with Itc1p Isw2p and Dpb4p
FT                   involved in inheritance of telomeric silencing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30483"
FT                   /db_xref="GOA:C5E372"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5E372"
FT                   /protein_id="CAR30483.1"
FT                   /translation="MEHSSSLEAVQKAAPRLPISKVKRIAKCDPEHMLTSQSATAAVAF
FT                   ATELFVQVFSEEGFARSQLERPAGARLTLRYDDLSACVASSDRFAFLADVVPETQSLVS
FT                   LTCENRVRYTTLAPGQTVLPFRAKEEPANSDGDGEEEPDEQPEAELDAEIDEDGDNHVE
FT                   AEIDVYTQNDADLEPELDAEADTDIKPTADPEAGAVVI"
FT   gene            <938065..>938928
FT                   /locus_tag="KLTH0H10912g"
FT                   /old_locus_tag="KLTH-ORF728"
FT   CDS_pept        938065..938928
FT                   /locus_tag="KLTH0H10912g"
FT                   /old_locus_tag="KLTH-ORF728"
FT                   /product="KLTH0H10912p"
FT                   /note="weakly similar to uniprot|P40364 Saccharomyces
FT                   cerevisiae YJL066C MPM1 Mitochondrial membrane protein of
FT                   unknown function contains no hydrophobic stretches"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30484"
FT                   /db_xref="InterPro:IPR035187"
FT                   /db_xref="UniProtKB/TrEMBL:C5E373"
FT                   /protein_id="CAR30484.1"
FT                   /translation="MGIFTGDNDKETQEYNDKLVASSLRERLCNNFNSVGDSISSLWKD
FT                   AVDRVDNKLPDLWVNASGSIGDVLSGLGFPGGFGHPARIRTLMDDQAAEEGTTGLYSYR
FT                   TPSDRQYLECQNIKGLSVWDTHGWWRCLFPESAVRSKVNAERLQEVLTREKVEKDKNHS
FT                   LGLFFTDYSAYLTWRANMLRLADERRRSAEESARDNSWRPTTPEDLMNSTPGKHVVGTS
FT                   EYVTYNTTPEGQEKVKETKTYFNDGSVRLRSEKQRQGPDGQPHIESFEKLLTEDDKHNE
FT                   GWFWRK"
FT   gene            <939374..>940579
FT                   /locus_tag="KLTH0H10934g"
FT                   /old_locus_tag="KLTH-ORF725"
FT   CDS_pept        939374..940579
FT                   /locus_tag="KLTH0H10934g"
FT                   /old_locus_tag="KLTH-ORF725"
FT                   /product="KLTH0H10934p"
FT                   /note="similar to uniprot|P38351 Saccharomyces cerevisiae
FT                   YBR279W PAF1 RNA polymerase II-associated protein defines a
FT                   large complex that is biochemically and functionally
FT                   distinct from the Srb-Mediator form of Pol II holoenzyme
FT                   and is required for full expression of a subset of cell
FT                   cycle-regulated genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10934g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30485"
FT                   /db_xref="GOA:C5E374"
FT                   /db_xref="InterPro:IPR007133"
FT                   /db_xref="UniProtKB/TrEMBL:C5E374"
FT                   /protein_id="CAR30485.1"
FT                   /translation="MSKKHEYIAKIRYRNDLPAPLLPPKLLKYQGPPNEEVDSPQLITS
FT                   LYAKSNVTPLIKLNDDLSMPLDLTKIPGVLDHKDTKLLHGFENIKLHPEDRVLLRDPRM
FT                   DRLTKTDTSKVTFLRRTEYVSSSSAPKPSNRKRPVSEAIDPDDEILTPAQRVKRVESTF
FT                   DSVTDDLSKVKHPFKKNVHAVKAWELLPDTVSMDQTFFTIRLVGSAALDKAEKEQLALS
FT                   TALFRPVELEEDEWVSLYTTEKNSSEEYEKNLEQQIDEITDDDRVYKFKRLRDFDMKQL
FT                   QPAGSGLFSELALRFNNDKKTIYYTPLRSRIELRRRRVNDVIKPLVRENNLDQINIKIK
FT                   NPTTQETRIRDKIRMKFDPIDFPNIEDEIDDEAPQEEQVTKVSEAASQDAQQGSQDVDA
FT                   EK"
FT   gene            <940867..>941763
FT                   /locus_tag="KLTH0H10956g"
FT                   /old_locus_tag="KLTH-ORF721"
FT   CDS_pept        940867..941763
FT                   /locus_tag="KLTH0H10956g"
FT                   /old_locus_tag="KLTH-ORF721"
FT                   /product="KLTH0H10956p"
FT                   /note="similar to uniprot|P40363 Saccharomyces cerevisiae
FT                   YJL068C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10956g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30486"
FT                   /db_xref="GOA:C5E375"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5E375"
FT                   /protein_id="CAR30486.1"
FT                   /translation="MTFQIKQEIASCGGKLMKLSHPSKKTGTEMEVNVYLPKQYFHKQD
FT                   QSIPVLYYLSGLTCSPQNASEKAFWQPQADKYGFALVFPDTSPRGEGVPDDPEESWDFG
FT                   ISASFYVDATQEPYKKNYQMFSYIHDELPRELSQFFENKGNSKLDFVENVAITGHSMGG
FT                   FGALSAFLKLYPERKYKSCSAFAPITFPSKVQWGQKAFGGYLGQEEEKWKPYDPGHLLK
FT                   MTTNIGSDKILIHQGTGDPFYKNQLKPELLLEASKGTSWDGKINLNLVEGFDHSYYFVS
FT                   TFVPEHAEFHAKNLGLI"
FT   gene            complement(<941811..>943547)
FT                   /locus_tag="KLTH0H10978g"
FT                   /old_locus_tag="KLTH-ORF719"
FT   CDS_pept        complement(941811..943547)
FT                   /locus_tag="KLTH0H10978g"
FT                   /old_locus_tag="KLTH-ORF719"
FT                   /product="KLTH0H10978p"
FT                   /note="similar to uniprot|P38352 Saccharomyces cerevisiae
FT                   YBR280C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H10978g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30487"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C5E376"
FT                   /protein_id="CAR30487.1"
FT                   /translation="MSHSIEHELPPDIIEAALPYLSTQDIKNLSLTNRYFHKLLDFGKS
FT                   NTLWHELFHKSFGSTHSDAEPLVSQQNHEYMSCSEAILRNRHPDKSWCDLYKLRSHDVR
FT                   FYTWGCLKHARLGFTSISHGSLPASWINNAGMRLQFGVNTPVAVPWFEDEGNEKSPEAD
FT                   QSIACISGGGFSFQVLTRSGKLYMTGSTYSGGHKGPGPREGEHDFNSFQQIIMDTERSL
FT                   TFFNGRIPHGRGALPFQGNSSATLEAPHENIYANFEDVERILDQKIPGNKHMRRLFTRE
FT                   VIKVERGGAPVLSVDATKLDVIKFTSVSSGRSHILALSAEGNVYSWDGPDVEQGVKIAF
FT                   EGLPTKETNPVIKIGCGWNFNCVSIYNLGLVVWESREPIRENETSAGAHYKVIPSTGQV
FT                   SGEGKIVDFACCANMSVFFISAAGDKLWRYANETVDEVKLPFHGKLVKLVGSYTTLAIF
FT                   TENHCYAVKVTEGHMRPETFMELELDDENEKLISLSTGDYHTVALTSSGKIYTWGLESE
FT                   LCGCLGLGSRDEIVNERRVGRIENLRSTLVLKPSKVKIGDSDYTCVAITAGGWQTGALI
FT                   VK"
FT   gene            complement(<943669..>946260)
FT                   /locus_tag="KLTH0H11000g"
FT                   /old_locus_tag="KLTH-ORF718"
FT   CDS_pept        complement(943669..946260)
FT                   /locus_tag="KLTH0H11000g"
FT                   /old_locus_tag="KLTH-ORF718"
FT                   /product="KLTH0H11000p"
FT                   /note="similar to uniprot|P38149 Saccharomyces cerevisiae
FT                   YBR281C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11000g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30488"
FT                   /db_xref="GOA:C5E377"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017149"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E377"
FT                   /protein_id="CAR30488.1"
FT                   /translation="MPPSIHKWNHQYAILSTVAFPHKRILFAGTHDSKILCFDLTTYNL
FT                   AKTICLGDTEETHTRSSVLCMTKSQDERFLFSAGADSLVRIWSVDSLTASGNITITEVG
FT                   TLYSLLDIGDIFSLKYLDAHQTIVFGCQNANMLYLPHVMDSVNRKTQAEDLNKLPHRRF
FT                   DRFFDSTGPGVRPIVANATPPPEPEELEHVIIEIPPEYIIPYAHNSFIYSTQPLKGQNG
FT                   NLPTHFYTDGMTKENTDFIVSGGGDGMSKIWALSQEAGGYMKPRLITEMNNEESVLCQI
FT                   VSFPFLYCGLSDGLIKMWDLNTKELVSTFQAPSKCDIVSISVYKDHIFATHQKGVTKFY
FT                   RDEVYQWNAHQGLVLSAELLRRKCTGYSHLRLATGGNDGALTLWNVNRLVGEEDENEIN
FT                   NISSASAYVSSHIDIKSREKYNAQLVDHDNMFETLRELISFKTVSALTDTQYVIDLRRC
FT                   ASFLQELFTKLGAACTLLTIKNGCSPLIHAQFHGKAQKKKKILWYGHYDIISPGDPSRW
FT                   KTDPFTLTCENGYLKGRGVTDNKGPLVAAMYSVGSAFLKGELLNDVVFLIEGQEESSSQ
FT                   GFAETINKHRDLIGNDVDWVLFSNSYWVDDKVPCLNYGLRGVINARITVWNNEPDKHSG
FT                   FDGGTDREPTADLISVTSKLQDDDGRVLIPGFYEPLKQLSAEEEIHFKEILKRTNVCKS
FT                   ISLEKLRAKWTKPSLSVTNMKVSGPGNVTVIPSSASVTVSIRIVPEQDVADIKNSLEQY
FT                   VNECFKKLKTNNKLTLETLNTAEPWLGDPKNSAYQVLREEIQEAWGADPLLVREGGSIP
FT                   QIRFLERVLRAPAVQVPCGQSTDNAHLDNERLRIENWYKMRQILHKAFNRL"
FT   gene            <947447..>949195
FT                   /locus_tag="KLTH0H11022g"
FT                   /old_locus_tag="KLTH-ORF714"
FT   CDS_pept        947447..949195
FT                   /locus_tag="KLTH0H11022g"
FT                   /old_locus_tag="KLTH-ORF714"
FT                   /product="KLTH0H11022p"
FT                   /note="similar to uniprot|P40362 Saccharomyces cerevisiae
FT                   YJL069C UTP18 Possible U3 snoRNP protein involved in
FT                   maturation of pre-18S rRNA based on computational analysis
FT                   of large-scale protein-protein interaction data"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11022g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30489"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E378"
FT                   /protein_id="CAR30489.1"
FT                   /translation="MSAPVVHSQPVPPPDDEELMLSKLVFGDTSDFNENLSQLRSLDTE
FT                   FGDADDVEMIEANSEEENDEDPEHNNMDAIQDDQLFFVDDGMTGEEQDKESAELGNGSD
FT                   SASESDTGSEYYSEDSAVWSDSEDERVEVAFTTSNRTKKLRSSYSEGRIKGRDYVSRLR
FT                   HQFEKIYPRPKWADSESSEEGPGSDDDSDREDREEVINGDLNALSRILQSTYNYRDTSS
FT                   RLLPPSSLDITRLKDANAAHPSRAAVQSLSFHPSKPLLLTGGYDRTLRVYHIDGKNNHL
FT                   VTSLYLTGTPIQTCSFYVSPSHQEQRIFTAGRRRYMHSWDISGTTPQQSRIEKISRMYG
FT                   HEATQRSFEKFKLAHVCAQSGKAHGVILLQGNNGWVNVLHATTGVWMIGCKIEGVLVDF
FT                   CVDYKPISNNKFQTILIMVNTYGEIWEFDLAKQGEVLRRWKDDGSVGVTTVQTGGGNNS
FT                   TQLLPFKKIRHNRWLAIGSESGYVHVYDRNSSSAEPVAKLDQLTTPISSLAFSPDGQIL
FT                   CMASRATKDALRLVHLPTGKVFSNWPTSGTPLGKVTSVAFSPRGEMLAAGNEQGKVRLW
FT                   RLNHYA"
FT   gene            <949487..>949924
FT                   /locus_tag="KLTH0H11044g"
FT                   /old_locus_tag="KLTH-ORF711"
FT   CDS_pept        949487..949924
FT                   /locus_tag="KLTH0H11044g"
FT                   /old_locus_tag="KLTH-ORF711"
FT                   /product="KLTH0H11044p"
FT                   /note="similar to uniprot|P36526 Saccharomyces cerevisiae
FT                   YBR282W MRPL27 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11044g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30490"
FT                   /db_xref="InterPro:IPR019189"
FT                   /db_xref="UniProtKB/TrEMBL:C5E379"
FT                   /protein_id="CAR30490.1"
FT                   /translation="MRPSPATLFHESPLSLLTRPWKKNRDGTLFYGVSKSGNNRTPLTT
FT                   KQGNKTMYKGTRSSGIGRHTRYGGYTIQWDKVRTYVTPKNFNTELKPLVSHNLPELRHS
FT                   FSGYQKGALDSRLYFEKLKEYVKNGKAQGEATDVKCYVERG"
FT   gene            complement(<950234..>951772)
FT                   /locus_tag="KLTH0H11066g"
FT   CDS_pept        complement(join(950234..951696,951763..951772))
FT                   /locus_tag="KLTH0H11066g"
FT                   /product="KLTH0H11066p"
FT                   /note="highly similar to uniprot|P38353 Saccharomyces
FT                   cerevisiae YBR283C SSH1 Subunit of the Ssh1 translocon
FT                   complex Sec61p homolog involved in co-translational pathway
FT                   of protein translocation not essential"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11066g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30491"
FT                   /db_xref="GOA:C5E380"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="UniProtKB/TrEMBL:C5E380"
FT                   /protein_id="CAR30491.1"
FT                   /translation="MAGFRLIELAKPFLPLLPEVEVPYEKIGFDDKVVYTIIAALIYLF
FT                   GQFPLAGVSKEASGVLDPLYFLRSVFAAEPKTLLEFGVFPVVSSALIMQVLAGLKLIKV
FT                   NFKIRQDRELFQTCTKLFALLQYLVLANVFIFSGYYGTDLSVVQITALNVQLVVAGFFV
FT                   TLLVEVIDKGYGFASGAMAITTVTISTNFVADVFGVGQFPVDNEGHTEPQGAFINLIQS
FT                   LRASHKTWTGAIVGAFNRDYLPNLTTAFLVLALAASICFLTNFRLELPIRSTRTRGVNN
FT                   VYPIRLFYVGSLSVLFAYVILFYIHVGAFVLVQLIAHNNPSSIIYKVVGGYASHNNLLY
FT                   VPQFPLSLLTPPKSFVECITRQPLTPLFFTTFLVITGIWFAGLWQQISGSSARDISEQF
FT                   KEQGITLTGRREQGVTKELDKIVPVAATTGAIVLGLLVACGELLGLKGKGASIIVGVSG
FT                   GFALLELITAEYQQSGGQSALAQVLGAPSGGI"
FT   gene            <952862..>953170
FT                   /locus_tag="KLTH0H11088g"
FT                   /old_locus_tag="KLTH-ORF703"
FT   CDS_pept        952862..953170
FT                   /locus_tag="KLTH0H11088g"
FT                   /old_locus_tag="KLTH-ORF703"
FT                   /product="KLTH0H11088p"
FT                   /note="similar to uniprot|P38341 Saccharomyces cerevisiae
FT                   YBR262C Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11088g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30492"
FT                   /db_xref="GOA:C5E381"
FT                   /db_xref="InterPro:IPR031463"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E381"
FT                   /protein_id="CAR30492.1"
FT                   /translation="MSKVLKLTSVTLAASSLAAAGYFYAFDRDSYHYKNASWKRIGDHV
FT                   QGILDRKEDIAVQRTSSEARDVTVRPIKETMKDLWNEQVRNTAQWVYSFGSNTSTKA"
FT   gene            <953330..>954022
FT                   /locus_tag="KLTH0H11110g"
FT                   /old_locus_tag="KLTH-ORF702"
FT   CDS_pept        953330..954022
FT                   /locus_tag="KLTH0H11110g"
FT                   /old_locus_tag="KLTH-ORF702"
FT                   /product="KLTH0H11110p"
FT                   /note="similar to uniprot|P38340 Saccharomyces cerevisiae
FT                   YBR261C Putative S-adenosylmethionine-dependent
FT                   methyltransferase of the seven beta-strand family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11110g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30493"
FT                   /db_xref="GOA:C5E382"
FT                   /db_xref="InterPro:IPR008576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E382"
FT                   /protein_id="CAR30493.1"
FT                   /translation="MSKPDSNINYGDAIDYWTAVPATVDGVLGGYGEGTTVPVMDVLGS
FT                   NHFLRKLKSRMIPAENCRKIGCDIGAGIGRVTRDMLHKHCDVVDLVEPVVPFVKQMDVE
FT                   LASLKEAGRIGHIFDIGMQEWTPETGRYWLIWCQWCVGHLPDEELVAFFLRCKKGLQPN
FT                   GTIVVKENNTQALEDDFDEDDSSVTRSDDKFKELFQRAGLKLIATERQKGLPKELYPVR
FT                   MYALKPQD"
FT   gene            complement(<954610..>954739)
FT                   /gene="SNR60"
FT                   /locus_tag="KLTH0H11132r"
FT                   /old_locus_tag="Klth0H_snoRNA_229"
FT   ncRNA           complement(954610..954739)
FT                   /gene="SNR60"
FT                   /locus_tag="KLTH0H11132r"
FT                   /old_locus_tag="Klth0H_snoRNA_229"
FT                   /product="snR60"
FT                   /note="C/D snoRNA monocistronic SNR60"
FT                   /ncRNA_class="snoRNA"
FT   gene            <955400..>957517
FT                   /locus_tag="KLTH0H11154g"
FT                   /old_locus_tag="KLTH-ORF699"
FT   CDS_pept        955400..957517
FT                   /locus_tag="KLTH0H11154g"
FT                   /old_locus_tag="KLTH-ORF699"
FT                   /product="KLTH0H11154p"
FT                   /note="similar to uniprot|P38339 Saccharomyces cerevisiae
FT                   YBR260C RGD1 GTPase-activating protein (RhoGAP) for Rho3p
FT                   and Rho4p possibly involved in control of actin
FT                   cytoskeleton organization"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30494"
FT                   /db_xref="GOA:C5E383"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="UniProtKB/TrEMBL:C5E383"
FT                   /protein_id="CAR30494.1"
FT                   /translation="MSVSRSSSRTDQTSEANSALQPSKSPASGSNETPSAGSTGVQPDL
FT                   LGKPEITRVLDSDVAINALLSRLKQSLLTCEEFTKFVRKKYLLEDVHAQELGKTYKNFF
FT                   PDSSASSSLQKSIHTVLEFDGKLSQVKHSYVKALHTMSDELGALLLTMTKMRKGLKENS
FT                   RRLEKEVADAIHMAEKAKSRYNSLCQDWEKLRMADPTKTKLTLRGSKTTREQEEDLLRK
FT                   IDSADLDFKQKVDHSTSLRNTFLSRERPKIVSELKDLILELDTAMAIQLQKYTIWTETL
FT                   ILNSGVTVTPFDATKSMKSIAASTSNELDLYNFLNKYNQGSRSNNFVNKNLIPVEYKQY
FT                   PSMAKPVMAKNGQTRSGNHTSSSQNTFSVNTNMNSLPKRIVSTQHESPFDSTPTPRTGF
FT                   SPVQNGSPAGSPNSHPGNASRGNLAQTTPSHQKAVSSMLDVADSQTPRSSQSGTRPDGP
FT                   DSDFATLDPGNGTRSTSLTTSMITSISERPVSHIQSAATLPPGINRNFKTFGVALESLL
FT                   EYEQDMVPAIVRQCIYVVDKFGLDLEGIYRKPANVLDVSKLREEIDKDPSNISMIVPPK
FT                   NHTDSDIYLAGSLLKAFFANLPESLLPPSMTSEIKTCLTIADPVTRKNYMHGLIYKLPD
FT                   GQYWTLRSLVFHLKRIIEHEPTNRMNLKSVCIIWGPTLIAPNDTDINDVNYQIQAMEVL
FT                   IDVADQAFEPE"
FT   gene            complement(<957667..>959991)
FT                   /locus_tag="KLTH0H11176g"
FT                   /old_locus_tag="KLTH-ORF696"
FT   CDS_pept        complement(957667..959991)
FT                   /locus_tag="KLTH0H11176g"
FT                   /old_locus_tag="KLTH-ORF696"
FT                   /product="KLTH0H11176p"
FT                   /note="weakly similar to uniprot|P47050 Saccharomyces
FT                   cerevisiae YJL047C RTT101 Cullin family member subunit of a
FT                   complex containing ubiquitin ligase activity binds HRT1 and
FT                   is modified by the ubiquitin like protein RUB1 Regulator of
FT                   Ty1 Transposition Regulator of Ty1 Transposition"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11176g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30495"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="UniProtKB/TrEMBL:C5E384"
FT                   /protein_id="CAR30495.1"
FT                   /translation="MQNGEGLLTFDVVSLQFRNAVDELLRRSFDKKLRTLDGPNLLSTI
FT                   DRIFYYELSRRLARSKIYVPTATEVSGEDTTLRKKAKAFRLLSQEEVVIKIWHLIIEEL
FT                   DKSVDDVVSELAEKLTLESEPKAAFVRHWPSLCLGQFEVQVSLLAEAFHLFAEDFSFIF
FT                   NAFTGVHTIREFAEYRLVESALSVLGNEAEGALTEALTEIRKQYHNCDEEGARKAENYN
FT                   RTGTECLKKFVEVVGKCHLRFTHHRKSFRVFYLDNLEFVLSKTNMEIDKDYLKNVKNLL
FT                   IREDMIVNLISKSIHLETKKIILTKFLFSAGVLENLLEIYALQRGFVREFKMIKLAYNS
FT                   DNRCNEFYASLANVIGIRFGNSFQRQRTLDEVLSYTCSLYDLEDDKVPQLVKRGLELAV
FT                   DGELNLVEPLVKSLDSKVKGCYKRLKEPQSVGLQQAKKDYEIFLSLWRILESFDLLEPF
FT                   FKLYMERSLFRRMIIMGTEYLAYMNHPENLEKRFFDLLEARQSHWELVTQLKALRSNLI
FT                   DTQKLFQGFETQELQNVQLAPMIFERKNVPASFHDFTFPELKIPRSLDALWQKFCAFYA
FT                   ESDPRSTKKPLVLQNMLHHLEVQTNFKLEDGRPLMLELTLLQASILDLFNESGELTVRD
FT                   IESELGVAANILEPALTSFISAGLLNTDGGSFIVNEEFKPDIKKMKDGRLKIFHKAAPK
FT                   AALKPPEDGLEKKDTSWIKEVLRARIVRVLKTSSASFSFEQLKTAVEKEKSGFSMGEFK
FT                   TALAECKDFYSLNKELYQYKP"
FT   gene            complement(<960669..>962633)
FT                   /locus_tag="KLTH0H11198g"
FT                   /old_locus_tag="KLTH-ORF694"
FT   CDS_pept        complement(960669..962633)
FT                   /locus_tag="KLTH0H11198g"
FT                   /old_locus_tag="KLTH-ORF694"
FT                   /product="KLTH0H11198p"
FT                   /note="some similarities with uniprot|P47050 Saccharomyces
FT                   cerevisiae YJL047C RTT101 Cullin family member subunit of a
FT                   complex containing ubiquitin ligase activity binds HRT1 and
FT                   is modified by the ubiquitin like protein RUB1 Regulator of
FT                   Ty1 Transposition Regulator of Ty1 Transposition"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30496"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="UniProtKB/TrEMBL:C5E385"
FT                   /protein_id="CAR30496.1"
FT                   /translation="MEDIKQSRSKKHGSIESPDCSDTSLFNQLEADINTLDLTESTAFD
FT                   VEQLVIKFAYLECSGNAQPPLQKKRKGKRLASNKFVQSLDLKFKKHASKLVRTFRKRAD
FT                   GDCSLLSTFLELDADYQQKFFKLSELYRLLDDRQHLEDCSRDPEINILKVKHLFLDELF
FT                   SRENTNISKIICHCLHEARYDKLSIKTASAILGRLNEAALIFVDQRKDSCQPSDIVVSS
FT                   AISYASKLTLPLQVGFLNMAEAVISKEMKLVEGFSLEVKEKIRMSFLDALLCDSNLEQL
FT                   LKHHVSQYQDSKSVICNELKQLFQIAKAKERLQEFALALITGACDAFAEAINSRVGFNG
FT                   LLNLKAFQSEVFRCLFHGSDFGEISDKMWSYFEASDLHQTSLKLYIKVLNSFFNKACSS
FT                   PSKVTDISVNALIGFIEFYRFGKGFTPIYLQQCLLRRAVRKGYSFLRVFCDRKKFCIER
FT                   DFCETLITEGAPHSELLNNTLRCLNSSHNMCLKNRDKDCKIEPIVIGMNEMKSIFKAPI
FT                   SGIPQLPQEMQAMWESQIVLYQEAVVESTVPKKLTLVPTLNNIELSTPFVLENSCPLVL
FT                   EVNLLQAVVLDAFNDGTDQTFQELKDSLKFGNDDLLSIAVGSYVKASILLQEKNTFTLN
FT                   QLFKPEKSVLRGNKLRVDF"
FT   gene            <962932..>963324
FT                   /locus_tag="KLTH0H11220g"
FT                   /old_locus_tag="KLTH-ORF692"
FT   CDS_pept        962932..963324
FT                   /locus_tag="KLTH0H11220g"
FT                   /old_locus_tag="KLTH-ORF692"
FT                   /product="KLTH0H11220p"
FT                   /note="similar to uniprot|P38337 Saccharomyces cerevisiae
FT                   YBR258C SHG1 Subunit of the COMPASS complex which
FT                   methylates histone H3 on lysine 4 and is required in
FT                   transcriptional silencing near telomeres"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30497"
FT                   /db_xref="UniProtKB/TrEMBL:C5E386"
FT                   /protein_id="CAR30497.1"
FT                   /translation="MSREELDPAVNLADEFKKRGYFDEAKNGILAGPIQESSTTTLEQF
FT                   IKDRVTSVVAEMVNEDESLIFKNRGSTTALIEGQLLKDGYEKLNTESIQIDVLLRRVLE
FT                   DPDLKAEIKAKLKGDLEANKLQQRSQ"
FT   gene            complement(<963370..>964194)
FT                   /locus_tag="KLTH0H11242g"
FT                   /old_locus_tag="KLTH-ORF690"
FT   CDS_pept        complement(963370..964194)
FT                   /locus_tag="KLTH0H11242g"
FT                   /old_locus_tag="KLTH-ORF690"
FT                   /product="KLTH0H11242p"
FT                   /note="similar to uniprot|P38336 Saccharomyces cerevisiae
FT                   YBR257W POP4 Subunit of both RNase MRP which cleaves pre-
FT                   rRNA and nuclear RNase P which cleaves tRNA precursors to
FT                   generate mature 5' ends binds to the RPR1 RNA subunit in
FT                   Rnase P"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11242g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30498"
FT                   /db_xref="GOA:C5E387"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR016848"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/TrEMBL:C5E387"
FT                   /protein_id="CAR30498.1"
FT                   /translation="MNREQTFITEQILAKSLPTAEKAVDENRLQDTLLLLPTDGGLSSR
FT                   LKKKNGKLRLLSGEHIKNSTHSAYREINKNSKHALKSYINGARKASSTAKRIASEKNLR
FT                   ERPELLGYLKEKHPSVFGSIPRFDQILPMHEELWVNYMREILNIPDDVPSASKLNINGT
FT                   NALLKLSMADYNGCMITVTKSRNENLRGIKGIVIWDSQKDFILLCRGELVDEIKCVPKM
FT                   GTIFAFEIPVNKDEALQYTILGDRFKYRSSDRAGRKFKSRRCDDMLYYISGR"
FT   gene            <964294..>965517
FT                   /locus_tag="KLTH0H11264g"
FT                   /old_locus_tag="KLTH-ORF689"
FT   CDS_pept        964294..965517
FT                   /locus_tag="KLTH0H11264g"
FT                   /old_locus_tag="KLTH-ORF689"
FT                   /product="KLTH0H11264p"
FT                   /note="similar to uniprot|P47051 Saccharomyces cerevisiae
FT                   YJL046W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11264g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30499"
FT                   /db_xref="GOA:C5E388"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="UniProtKB/TrEMBL:C5E388"
FT                   /protein_id="CAR30499.1"
FT                   /translation="MLGAIHTKALSRGAYFKSRCFRRYVSTQTPLELDSTARDENYADL
FT                   NYMYTDMFAGSDVKSPVVGTGGKEGLSEIDQLNAEISETYDFTAQPLSGHELEQVVRSA
FT                   GRFILKSLSNNPYYNLALEDYVFLNTPVPKEGLFSSERLLFYVNDRCVVIGKNQNPWRE
FT                   LFLDECSKKGYEFVRRKSGGGAVVHDLGNVNYSYLTSRDLFRREYFNKQIMNWLVHAFP
FT                   SASIGLSPRGDINLDNKKVSGSAFKVAKGKSYHHGTMLVNADLASFSGLLKPDFLKGIE
FT                   WSGGSVESVRSRVTNLSQMGIGNTDTFVDICTEGFKYLMNENMPVYWADESYTRNAQIC
FT                   ETISHLKSDEWLYDSGPNFTVSFNGHTINVEKGIIKDSTISEGIGSHFRDFVSLLRKNK
FT                   HFKTDIEI"
FT   gene            complement(<965578..>967500)
FT                   /locus_tag="KLTH0H11286g"
FT                   /old_locus_tag="KLTH-ORF688"
FT   CDS_pept        complement(965578..967500)
FT                   /locus_tag="KLTH0H11286g"
FT                   /old_locus_tag="KLTH-ORF688"
FT                   /product="KLTH0H11286p"
FT                   /note="similar to uniprot|P43606 Saccharomyces cerevisiae
FT                   YFR029W PTR3 Component of the SPS plasma membrane amino
FT                   acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
FT                   external amino acid concentration and transmits
FT                   intracellular signals that result in regulation of
FT                   expression of amino acid permease genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30500"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E389"
FT                   /protein_id="CAR30500.1"
FT                   /translation="MDVNQVLSEFEQNLFLPRELISCEKEQERYRFTVKYGIVSDALVL
FT                   ICGCIISQALYEELKRDYQNEACCPICQKLPLSSIGPVKPLRILYDQLQYFKREQAELV
FT                   EAAPTQNTKSESQQQNLISLFHSVASEVGDSNEFEATEVHSLDNVSNTRTMPIQDSSST
FT                   SVPIAITESPPSVQLSQLDEKKEFYFAKCFPMYRKRTQYNTHSRFLRTKSRQFINTAIS
FT                   PDCTKFALITEHKWEVYQISRYRKRDGQNKEKDFAKKLGKYAQNKKDRSGSSECVELLF
FT                   CGKVSGEYGPSFDELSLPEDLDSLIPLSGKQRKSSQSSIDDHSNTWEHLYCKLSNELLV
FT                   ISGSKGHFRVFDLNNGGVPLYTYASSFPIRCIEIDPKSTIIACGITGSDRASGAEQALI
FT                   LFHQIEKDIITQTSVNSEVARYKFSPPITTTLPYRDPINTLQFSPDSAYISCSTALESR
FT                   FLVISLRRIHEPRLVMKSLRSIDTSLESEGITDTKMFPGNSNLMCVTSVAFNAPPIVIN
FT                   TKIQTINGMQSVAQPTMLLRLDELGSKIHKCEISPRNDSIAFLDRNGTVYIMYAPTLLD
FT                   NEKRRIVSVEVAANAYRMREAASLRFSADGHKLFILDRKGIIYIEDFAYGLPQDEEVTK
FT                   CKQIN"
FT   gene            <968074..>968979
FT                   /locus_tag="KLTH0H11308g"
FT                   /old_locus_tag="KLTH-ORF687"
FT   CDS_pept        968074..968979
FT                   /locus_tag="KLTH0H11308g"
FT                   /old_locus_tag="KLTH-ORF687"
FT                   /product="KLTH0H11308p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30501"
FT                   /db_xref="GOA:C5E390"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:C5E390"
FT                   /protein_id="CAR30501.1"
FT                   /translation="MVDYQKWIGEKDDDTEISKLSLPGTHNSAACHVALPSVKCQDHSV
FT                   STQLRNGIRFFDFRLGKLFLKDGEDGKYNGKELQVIHGKFPVRIPIPLKFSSVLDEFYS
FT                   FLDQNPSETCIVSIKQEGDNFNDKSEFPRFVWDQYINQNLDKWYLNGDVPKIRDARGKI
FT                   ILFRRFGLTDEFQDRPYGIDAAWWPYNTINDDRGVFQVQDFCEVKHAEDIHTKAGYVKD
FT                   FLQTATQHNSSADAPPRLFVNFCTGANLFDMDCWPEKVADEMRKCDIGALVNKGCGIVI
FT                   LDYAGRDNWDLVKSIVDSNF"
FT   gene            <969133..>971628
FT                   /locus_tag="KLTH0H11330g"
FT                   /old_locus_tag="KLTH-ORF686"
FT   CDS_pept        969133..971628
FT                   /locus_tag="KLTH0H11330g"
FT                   /old_locus_tag="KLTH-ORF686"
FT                   /product="KLTH0H11330p"
FT                   /note="similar to uniprot|P43596 Saccharomyces cerevisiae
FT                   YFR013W IOC3 Member of a complex (Isw1a) with Isw1p that
FT                   has nucleosome-stimulated ATPase activity and represses
FT                   transcription initiation by specific positioning of a
FT                   promoter proximal dinucleosome has homology to Esc8p which
FT                   is involved in silencing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30502"
FT                   /db_xref="InterPro:IPR028942"
FT                   /db_xref="UniProtKB/TrEMBL:C5E391"
FT                   /protein_id="CAR30502.1"
FT                   /translation="MSDPLESDSKSSSEPSLEATVSEGTNSKSKPKKIQLTFQDFKNIK
FT                   SSTQSPEGLLKHATDMLESNRRRSRRVVPKRPVDEDDEETSRAAPKKKKKPAVKSKEPN
FT                   INREAVRERVKKQQQAIENPETAILEENWSPNVPLPSSDFKNHYSIVSRFRSPNMKSVP
FT                   YAKDVIQIMTFINKFSGFLPRDLWSLSFQDFELGLDLYPESDKETPLKLYQDFMPIKDL
FT                   VKCQDAMNLLFLSLMKLALNNNTPTSSKSLSEGPKPYSKFLGQLRTNAWAWGYPKEWKF
FT                   QVGDAHSKVFTDDDTEPVDPNNHEILTPNLPTWPQQYAIDSDPLLTPELEKLGILALSP
FT                   SDRIVLLRILVQWCLSQSDKIHTEVFRLSHLKRDAPYGVPTYHVPRIFLEGEIPTKAKF
FT                   KRLCELVQARLEIKSTKKHVKKQLEHGKRADLSQKLALIKSIEQSREEVHSNGEGEIAP
FT                   PVDIFDREFDSWNEIIDGELPDHPMSSPYEDEIFKLRDLEFFIGRVPHVGDFYIPRLHT
FT                   YQEAKKRLIPTTYTDPRSLARTLDSFANNEVDTLTLFTQNGKLMSTHFKVFYHDSPAMI
FT                   RDVASQSTTRPKTYWYEMCHDCNTLREFITLLDYKLNLLESPGSEPANKGLINKNPLPK
FT                   ESKFNASREKLRSVRDYLTKLLPFLAAFEELDAKFDEIESSKRTLRRSQRNRATYSKDD
FT                   DLDDAYSEDEAYVEKEGGSGDELGQESESDAYADEDFPEEDDGNDDFTDDENDDESYEL
FT                   RGAKPKIATTSRGRGRGRGRGRGRGRGRGRGKGGSTRGGTTTEGRGGARGSGRGRGRGR
FT                   GRGRGRGRGRGRGRGRGGE"
FT   gene            complement(<971902..>971974)
FT                   /locus_tag="KLTH0H11352r"
FT                   /old_locus_tag="Klth0H.tMet_CAT_26"
FT   tRNA            complement(971902..971974)
FT                   /locus_tag="KLTH0H11352r"
FT                   /old_locus_tag="Klth0H.tMet_CAT_26"
FT                   /note="tRNA-Met (CAT) cove score=73.94"
FT   repeat_region   complement(972036..972281)
FT                   /locus_tag="KLTH0H11374t"
FT                   /old_locus_tag="Klth0H.LTR.4"
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT   gene            complement(<973355..>974668)
FT                   /locus_tag="KLTH0H11396g"
FT                   /old_locus_tag="KLTH-ORF682"
FT   CDS_pept        complement(973355..974668)
FT                   /locus_tag="KLTH0H11396g"
FT                   /old_locus_tag="KLTH-ORF682"
FT                   /product="KLTH0H11396p"
FT                   /note="similar to uniprot|P22517 Saccharomyces cerevisiae
FT                   YOL016C CMK2 Calmodulin-dependent protein kinase and to
FT                   YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
FT                   CMK1 Calmodulin-dependent protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30503"
FT                   /db_xref="GOA:C5E392"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E392"
FT                   /protein_id="CAR30503.1"
FT                   /translation="MGGLVDEYLSSQGKPEEPEKIEGHTFKKVLNKISGQPDSYVNKAD
FT                   YIFGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGKDVQLQMLYDELSILQKLDH
FT                   PNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQILKAVEYLHS
FT                   RNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGYVAPEVLTT
FT                   SGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTSGRYPVTFHKPYWSSISDDA
FT                   KDFILQALTVTPRYRPSATELLNHKWITGEYTKTDNLLPGIRKEFDARRKFREAVEIVK
FT                   LNNRIKKLNQLYATGEEDDSDIEENSPSNSLNSSMSNLSVGGSRSSDKSVGSKHLKSAL
FT                   TQDAFAQIVKAATQNKDRIMNYKDDQPLSDDNSSSSAK"
FT   gene            complement(<975327..>977459)
FT                   /locus_tag="KLTH0H11418g"
FT                   /old_locus_tag="KLTH-ORF681"
FT   CDS_pept        complement(975327..977459)
FT                   /locus_tag="KLTH0H11418g"
FT                   /old_locus_tag="KLTH-ORF681"
FT                   /product="KLTH0H11418p"
FT                   /note="highly similar to uniprot|P23337 Saccharomyces
FT                   cerevisiae or YLR258W uniprot|P27472 Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30504"
FT                   /db_xref="GOA:C5E393"
FT                   /db_xref="InterPro:IPR008631"
FT                   /db_xref="UniProtKB/TrEMBL:C5E393"
FT                   /protein_id="CAR30504.1"
FT                   /translation="MARDIQNQLLFEIATEVANRVGGIYSVLKSKAPITCARYRDNYTL
FT                   IGLLNPETYQTEVEPLDWRDSATFESSSAHTPEIRNALENMSNRGVQFVYGRWLIEGAP
FT                   RVLLFQLDSVRAHLNEWKSDLWDIAGIPSPEGDTWTDDAILLGYVVAWFLGELAHLDQR
FT                   HAIIAHFHEWMAGVALPLCRKRRIDVVTIFTTHATLLGRYLCAGNVDFYNNLDKFDVDS
FT                   EAGKRGIYHRYCIERAAAHTADVFTTVSQITAYESEYLLKRKPDGILPNGINVVKFQAV
FT                   HEFQNLHALKKEKINDFVKGHFHGHYDFNLDNTLYFFIAGRYEFRNKGADMFIEALARL
FT                   NYRLKMANSRMTVVAFIIMPAKNKSYTVDALKGQAVVTSLENTVKDVAGLIEKRLFEYA
FT                   MRHPDGGTSGIPTELDQLLKPSDKVLLKRRTLALRRPEGSLPPVVTHNMADDANDPVLN
FT                   HIRRVQLFNNSNDRVKVIFHPEFLNANNPILSLDYDEFVRGCHLGVFPSYYEPWGYTPA
FT                   ECTVMGIPSITTNLSGFGAYMEDLIEQDQAKDYGIYIVDRRFKNADESVEQLVDYMESF
FT                   VKKTRRQRINQRNRTERLCDLLDWKRMGLEYAKARQLALRRAYPDLFKAVVGEEVSDAN
FT                   MNSLAGGKKFKISRPLSVPGSPRDPRAESIGSTILMTPGDLGTLQDANNADDYFHLSMG
FT                   VEDEEEDEVNYLAAAD"
FT   gene            complement(<978785..>981295)
FT                   /locus_tag="KLTH0H11440g"
FT                   /old_locus_tag="KLTH-ORF674"
FT   CDS_pept        complement(978785..981295)
FT                   /locus_tag="KLTH0H11440g"
FT                   /old_locus_tag="KLTH-ORF674"
FT                   /product="KLTH0H11440p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30505"
FT                   /db_xref="UniProtKB/TrEMBL:C5E394"
FT                   /protein_id="CAR30505.1"
FT                   /translation="MVLIKEVVLDLTNFVLSNANDAISFKPQLFYQVPAQDYVELRERY
FT                   IAFTGTSMRKNKSKLYFLPTNISDELQQLNPSIPESAKRVPRDGHVYYKNRLITELDFE
FT                   NVKRVELACAYIAYAAVNKATGVEVDDVVAESGDYDADSGSLADPDPSSAGAGAGASGT
FT                   DDSDKLSPAESTLQALRRGGVIGFRELGYLVSITPWHFHRVFKVITGLTIREYGQLCTE
FT                   FVKKNRDIMNACKKKVEELKSQGHSFHCFDEPDFLKDGSLCYEPTTNVVLLPEYFIDPN
FT                   KSKEHKKKQKESKSSDGKCSQRVEARKRRSSVMSGRIRRASQTSIASNSSIQDPLQSEV
FT                   SYPSTPQLSPSEQAAAHHSGNSLSASPVVGFNLGGTMDAPVMGTRPLNPQYLAKSRKGS
FT                   LVNSATGVLSSASALGKVLKPRSSGGAVSGGSNFIRKMSEPSLALAARGLQSLPLEADG
FT                   DEANAGITTVTSATDLNLQPVLSPQIDFKFDIFGTAGSREDPMGSGSCVASGSASGASL
FT                   SVAETDSAQTPSNPNGESRTVSSLTAGSSNGSLNMGFADEIAPNALAPAEQNEYSIGMP
FT                   AGSSSTAATSVQGFASRANESLPRGSVHTLLDDITGLEPEENMLLDLNAMHDEDLSAQS
FT                   YGLLGPKAETGIHSSNSFTSLPNYAASSLHQDHQGQHDLQVLQQGHTAQQQFSAQEISA
FT                   LSGGELPYSRNRLNSVAPEMDDLDRMFLSGYEGSTPGLSSALAAQFSTGDVDTLGMNAH
FT                   MSSEQSTRDNTMATTATAATADTTDSTRAFEDKNTLESYTHLGFDTLSPCASPTSRIDQ
FT                   SSFEAMISSSGNEEIVGNQFHFVQ"
FT   gene            complement(<981666..>982340)
FT                   /locus_tag="KLTH0H11462g"
FT                   /old_locus_tag="KLTH-ORF668"
FT   CDS_pept        complement(981666..982340)
FT                   /locus_tag="KLTH0H11462g"
FT                   /old_locus_tag="KLTH-ORF668"
FT                   /product="KLTH0H11462p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30506"
FT                   /db_xref="UniProtKB/TrEMBL:C5E395"
FT                   /protein_id="CAR30506.1"
FT                   /translation="MPPLYFRLYDLSSGREANRSAGFWLLGELAQQLHARCRGYQATNW
FT                   LARLVAAVPQWASGAHSPYVPRSGSFTVRRICICPSRPAPAESTGDTRARGNGLQETHV
FT                   YAAAAWANAYVRTHACVLHSQHARGIRVTPSPVQTEAGNRDSQGLLDRKRHSHVTTNTI
FT                   TWTNGPTQPYFFRAAARSGARVSSCVIVLHFSLYSPFLHGGWRTGEKIMYIKVETSYVC
FT                   DV"
FT   gene            complement(<982395..>985235)
FT                   /locus_tag="KLTH0H11484g"
FT                   /old_locus_tag="KLTH-ORF665"
FT   CDS_pept        complement(982395..985235)
FT                   /locus_tag="KLTH0H11484g"
FT                   /old_locus_tag="KLTH-ORF665"
FT                   /product="KLTH0H11484p"
FT                   /note="some similarities with uniprot|P43597 Saccharomyces
FT                   cerevisiae YFR016C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30507"
FT                   /db_xref="GOA:C5E396"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5E396"
FT                   /protein_id="CAR30507.1"
FT                   /translation="MDGIEDFMLTQDQPTTSEDKATMPLSPPEEQASQRPESHAAAVAP
FT                   APDHKTCAGEPQRTIEAAGALASGGENEAIEVEETNVDSDNNSRLRTKPSDLGRGHQDG
FT                   DAAVAEAVAEPSPNIELGASAQGSIDAHADEVPKHEEPSALNPVGETPDRKPQRKQSLK
FT                   REEHSKDESEHEGPDETSAGSRVASCGEIAKKNYQGGATIKGGERSGAAPLKAESKPNN
FT                   NRNGRVPDKKDEADKTDDADLKNGTLIERKKNNAGLDEDLQPAGTDAAAENLEKASGEI
FT                   KEDASGKCEKGAESADEDASVIEQQTQTQSANKAVGSGAAADSTPDLRGSAKGEEREEH
FT                   ERALDGGDAPNAHDTVEAREPANGELAMGEEAVELTSAEPTETAEAVEPTSAEPTETAE
FT                   QAEEAEHPAQRAESRGAELSHRPKTSDVRESREPEVPEAGDAELVGRKEAHAAQQDDEG
FT                   LAGRDGQAAHALQDKQGIQATIALQGEHENPAGAAGLASDADPSEQKHNDRANLGAETA
FT                   AAQTENPEPNKARGTDRPETLRHTERKEATCTDPAQTTQCDSGSAVLGAAAASRNRDAQ
FT                   QPGFRAATHTKDKEDEDATTEDQAQETGPEANSDLISDLLSELHLEPQPDPRSHVVAQT
FT                   EPEAGLDHNKQTQASRPKQSPTASSSADQSSDPENQLNATDGAADDVAFDADGSAEPPA
FT                   ARVSAANSESASPAQSSTSEPAAVPSGSNTPPTHVKPGPAVPESINNDQRAEVTKQDVP
FT                   DAEHQQTSVDSSGNHAKSGPAPAHPDAPSPLSAARDSDAPAQSQSRALADEIDDLLRGL
FT                   EASSGVADKSSAEKGAARSPSVGGDKNKSISAISAISDILASEPVYLYTSLAGGGFHMP
FT                   SRTNRLAHILSANRVDFSYRDLGTDDEARRVWKRFGRGRSLPAVVRGRDDIIGNWEEMD
FT                   QANEDYRVRELIYETL"
FT   gene            complement(<985252..>986166)
FT                   /locus_tag="KLTH0H11506g"
FT                   /old_locus_tag="KLTH-ORF655"
FT   CDS_pept        complement(985252..986166)
FT                   /locus_tag="KLTH0H11506g"
FT                   /old_locus_tag="KLTH-ORF655"
FT                   /product="KLTH0H11506p"
FT                   /note="weakly similar to uniprot|Q06146 Saccharomyces
FT                   cerevisiae YLR257W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11506g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30508"
FT                   /db_xref="UniProtKB/TrEMBL:C5E397"
FT                   /protein_id="CAR30508.1"
FT                   /translation="MERSSTPSLVGVSVRSINDSNNPDFKGNRGPSVAEARSSPQLLEK
FT                   IHSSTQLNKLSSAYTTVDELNREGALLTDDNDVDLDKVVQGDTEGASGRRKVLLRRKKN
FT                   NSSSSKMPSSSSLSVSSMMSPSRSRSSLVTSTDPVHDHASEGEARAGAATADNEDRIRN
FT                   SYGEFIPNRSHRPHLAGGESYQSTQNDSTGEDADAERPGRSSKREDASRGYLRSLSRSL
FT                   SRDPQKKAHDQEQEDARMYSTNNYRISQLDLENAPHVIKEEIEEEQDQGALMDDEGNEE
FT                   YSEPLRESASKQLDNDKLQEGDH"
FT   gene            complement(<986667..>986737)
FT                   /locus_tag="KLTH0H11528r"
FT                   /old_locus_tag="Klth0H.tGly_GCC_25"
FT   tRNA            complement(986667..986737)
FT                   /locus_tag="KLTH0H11528r"
FT                   /old_locus_tag="Klth0H.tGly_GCC_25"
FT                   /note="tRNA-Gly (GCC) cove score=62.63"
FT   gene            <986923..>988524
FT                   /locus_tag="KLTH0H11550g"
FT                   /old_locus_tag="KLTH-ORF650"
FT   CDS_pept        986923..988524
FT                   /locus_tag="KLTH0H11550g"
FT                   /old_locus_tag="KLTH-ORF650"
FT                   /product="KLTH0H11550p"
FT                   /note="similar to uniprot|P53109 Saccharomyces cerevisiae
FT                   YGL160W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30509"
FT                   /db_xref="GOA:C5E398"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E398"
FT                   /protein_id="CAR30509.1"
FT                   /translation="MAMTLLPRHGKTHLANIPYGYYTATVSLIFIILLIGARKLIPVRQ
FT                   RNRSKWAKWALSSARGGSPLLYLVVLFVALLVPFVHHYSLLGYVGLYLKRLGRLSYVLA
FT                   TLNLFLTLRPNFLLPGYVYLDLIPLHKWLSRSLCLLALVHGVGFLVKWALDSQVSFVAK
FT                   AFYNIPNLAGLVVGALMAFMVLLSVRPVRRFSYRSFYLTHIIGAWVFVFLTAYHARPGV
FT                   FVPYTLLNAGLFVFYILSKTVPARGVELVSKSTDDVNNCLTRIVLPRKAMPEHFAPGSH
FT                   LRISPYRRVNPLYYMLPSHPYTVASMPEDKDVELIVREHASGFHLLTGLGYTIQNHYES
FT                   VPRQCLQSATRIALVCGGSGLSYALPIFRHFASEEKADQVKYLRLIWLVRDKYDVNVLG
FT                   NIRSLASSVAQFDIFVTRSVPPDDTVESGSKLSPAQQQSPITDDLEFELESFGDQLDQN
FT                   GALITPEIPNLPSGLASSFHFGRKLDWMTDLAQFVEREDLGSTWLVACGPKGLNDAAKL
FT                   YAQQNEINLASETYAL"
FT   gene            complement(<989095..>992808)
FT                   /locus_tag="KLTH0H11572g"
FT                   /old_locus_tag="KLTH-ORF647"
FT   CDS_pept        complement(989095..992808)
FT                   /locus_tag="KLTH0H11572g"
FT                   /old_locus_tag="KLTH-ORF647"
FT                   /product="KLTH0H11572p"
FT                   /note="similar to uniprot|P12351 Saccharomyces cerevisiae
FT                   YLR256W HAP1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30510"
FT                   /db_xref="GOA:C5E399"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E399"
FT                   /protein_id="CAR30510.1"
FT                   /translation="MGAQMKRKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLC
FT                   HYMEQTWAEEAEKELSKESELKQLRERIKALEETLAKMHSASSNTPESASVALEEPRVF
FT                   QESKLIQEPKLLQSNKYDNDELDLSRQFDMLHLKNNGTVHLGATHWLAIMKGDPYLKLL
FT                   WAHIFTMREKMSEWVQHKKKGAGTSGGTHLAGRCPVIHQPAASRCPVSGATASNLGHHT
FT                   KETAKCPVDHQALLSHHREDRVPESRPDSGLSGVSAREPLDSAPRCPVAHNFSGSPPGL
FT                   NSRSGSEGAGSGLKCPVAHDTHGEIQPSNKVSASGPGTNGRPAPLLPSFDKLASKCPVI
FT                   HDNSPPPPSGLGPNPSNVTQDQAITEICKLLPPKRIIALILDKFFKHIYPVIPILDEQS
FT                   FKHQISQIVQSKDETISLRLAKSSDCCTLGILIIILRLTWLSLPQNACEVDLGPQCAAF
FT                   FVPRITTSTVAQSREELLLLNFETPAETVHLVRKYLIRLDEMTSFSNSNVNLTTVQFAI
FT                   FYKLYLMCCPEKTTDTQLNAFTSTSQDNEAHQMLLSSIVQMAFSCGLHRDPDNFPQLAA
FT                   STKGKLNKEAISNTERLKHTWRKTWYIIVSLDVQQSISLGSPRLLRNLRDFSDTKLPCT
FT                   SKIDYVRDIKELIVVKNYTLFFQIDNCIVAVLNHILNVSMAKTVRKFELDSLIEILKKL
FT                   CFGGGNVSEALGKLVNKGLLFTTEGSADQSYDEFYPLPSLEEVLSPPPPSENEKDKKVN
FT                   LPHEMTTRALFFSKHIMLRMLLYLLNYILFTYYEPKGEVDADTRPLAKEYAQEALNYAM
FT                   DGFRNCLLFFSNSKAGEGGNGSIFNHMEVVLAPYCLDIGHRALQFMVCLILRARCGPLT
FT                   GMNESPILSSGNNTSGSEDENETRSSEVKKKEDNAEIADVTKDISLDVGDELAEILISR
FT                   MTLFHKLTKQVSAKYHYAKRMMKSTGFFITLLRNPSSKSQLGEKNSSGYKFQHPSIAKM
FT                   TGFFKNVPSLVLSANGDQIKRCPVYQDAIGFLPRNNSVVSGPRSKPETPVQLPPFRAYQ
FT                   PITYLSNDLRRTSDVRNADNKRRKLTPRGSVTGSPVEEPVKQEGWRAMSPPAPNFGTPI
FT                   MSPVPNSPAFRTDILPPLERLTETASPAAPNSRNNSILSGPPHGLNSPAGMSENSSVNY
FT                   TPDFEDFLMQNSNFNGLMINPSSIVEAVGFDNYAHNDSSSVGAAADFLPIDTTEIDGLS
FT                   EIPANPGFPVWD"
FT   gene            <994752..>995753
FT                   /locus_tag="KLTH0H11594g"
FT                   /old_locus_tag="KLTH-ORF637"
FT   CDS_pept        994752..995753
FT                   /locus_tag="KLTH0H11594g"
FT                   /old_locus_tag="KLTH-ORF637"
FT                   /product="KLTH0H11594p"
FT                   /note="similar to uniprot|P53110 Saccharomyces cerevisiae
FT                   YGL159W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30511"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3A0"
FT                   /protein_id="CAR30511.1"
FT                   /translation="MCSAIIQDAQVQKHFLNVSHKALCRYIDQLQIALHRYSSRPEIIP
FT                   PRLVDTTMNGNTTHLIMPVLDDVFSGLKWLGYNPQGGLGFVGAVTVTDPRSGGLIGVVQ
FT                   AKQLTGVRTALASCIGIRNQLSAFKNKTSITVFGTGLQSFWHIFVCAKLLEGREIAVNV
FT                   IYRSSPMDTALLEDHLPSLKVAQFQLSDTEQVRDKVSQSNIIFGCVPSTEPSILKKYLE
FT                   ASSGPEYTYISLIGSYKSHMHECDTALVEQFKDQGVQILVDSKEHTLIEAGELIDANVA
FT                   PTQLLEIGNLEPNKPLPKSTCKNGKLVTLCKIVGLAIMDVSMAKTLLADLSS"
FT   gene            <996041..>996616
FT                   /locus_tag="KLTH0H11616g"
FT                   /old_locus_tag="KLTH-ORF636"
FT   CDS_pept        996041..996616
FT                   /locus_tag="KLTH0H11616g"
FT                   /old_locus_tag="KLTH-ORF636"
FT                   /product="KLTH0H11616p"
FT                   /note="similar to uniprot|Q06568 Saccharomyces cerevisiae
FT                   YLR254C NDL1 homolog of nuclear distribution factor NudE
FT                   NUDEL"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30512"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3A1"
FT                   /protein_id="CAR30512.1"
FT                   /translation="MENKHLSLDDAFQIIEDLQKQIEELEAASHEYETELEGVVKKLES
FT                   QLNEKDAFIASLQQAQMPTGGFKERLTVLEIQVDELESENYALRSRLKLLEAENDSVIE
FT                   QNVLLQHELADVRQGTKPSIETPKADSLINVSNPPNRTCSTHSSRSSNALKVSSNQNSL
FT                   RVSPRNARADTSATHLSSTSVVSTTSYK"
FT   gene            complement(<996661..>998358)
FT                   /locus_tag="KLTH0H11638g"
FT                   /old_locus_tag="KLTH-ORF635"
FT   CDS_pept        complement(996661..998358)
FT                   /locus_tag="KLTH0H11638g"
FT                   /old_locus_tag="KLTH-ORF635"
FT                   /product="KLTH0H11638p"
FT                   /note="similar to uniprot|Q06567 Saccharomyces cerevisiae
FT                   YLR253W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30513"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3A2"
FT                   /protein_id="CAR30513.1"
FT                   /translation="MVQPLLNLARIAPLKLGARGPFRSYSSSAKSFVRPKSPVITTKRV
FT                   LVVTAFAAAAYVYTDDTAKSAVRHLGVTSKRVGVVAQATMRCVYNYQRTLSANYSSEQE
FT                   RSDALKKCHQLCAKVTLRALETNGGVFIKLGQHIAAMTYLLPPEWTETMVPLQDKCPQS
FT                   THQEIEDLFKQDLKIDIQDMFSDFDPEPIGVASLAQVHVATLRSTGEKVAVKCQHPSLK
FT                   EFVPLDVLLTQTVFNVVDVLFPEYPLTWLADELQNSIYVELDFTKEAENARRTADYFSN
FT                   YISETALRIPKVIVANKRILIMEYIGGHRLDDLAYLDENHISRAQVSSCLSHIFNNMIF
FT                   TPNVGIHCDPHGGNLAIRHLEKSRGHHNFEIILYDHGLYRHPTTEMRRDYAKFWLALLD
FT                   NDVANMKKYAMKFANINEDQFPLFAAAITGRSIDAAQSSDILKPRSDEEIRVMADALME
FT                   GSLLGDLMTFLCKVPRVVLLILKTNDLTRHLDECLQSPLSVERTFLIMTQYCARTVYEE
FT                   VRQNINEQYQKWSLTWIFKEITAWWEYERRKNQLVLYDLGFWFKNRFL"
FT   gene            complement(<998622..>999224)
FT                   /locus_tag="KLTH0H11660g"
FT                   /old_locus_tag="KLTH-ORF634"
FT   CDS_pept        complement(998622..999224)
FT                   /locus_tag="KLTH0H11660g"
FT                   /old_locus_tag="KLTH-ORF634"
FT                   /product="KLTH0H11660p"
FT                   /note="similar to uniprot|Q06563 Saccharomyces cerevisiae
FT                   YLR251W SYM1 Protein homologous to mammalian peroxisomal
FT                   membrane protein Mpv17 required for ethanol metabolismand
FT                   induced by heat shock localized to the inner mitochondrial
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30514"
FT                   /db_xref="GOA:C5E3A3"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3A3"
FT                   /protein_id="CAR30514.1"
FT                   /translation="MSMLLNFYTSSLKKNPKTTNAIMTGSLFGIGDAIAQIGFPSSHSK
FT                   AQGYDIARTVRAVTYGSLIFSFIGDKWFKVLNNKVRFSNRPTNHWSNLPLRVGTDQLLF
FT                   APLCIPFYFGILTLMEGKSLKHADTKVRAVWWDILKTNWMVWPLFQLINFSIIPVQHRL
FT                   LAVNVLAIFWNTFLSFRNSEASHADHQFPVNNPPVPE"
FT   gene            <1000534..>1003563
FT                   /locus_tag="KLTH0H11682g"
FT                   /old_locus_tag="KLTH-ORF633"
FT   CDS_pept        1000534..1003563
FT                   /locus_tag="KLTH0H11682g"
FT                   /old_locus_tag="KLTH-ORF633"
FT                   /product="KLTH0H11682p"
FT                   /note="some similarities with uniprot|P36111 Saccharomyces
FT                   cerevisiae YKR015C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30515"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3A4"
FT                   /protein_id="CAR30515.1"
FT                   /translation="MFVDYSSQNKFMSINYKFADKYLEMLHIEKLSSPENRLECLKVRT
FT                   EGLGIKIIQNLEINDFAGDFNWIVYLYGLVLSKEQMLECGETLLSCPTLYMVEFALQGC
FT                   RIEDAFSEESTLSSQLKLAIKCAYYEFIGPCEKIIYSLKTHFLSLRPRYDLPFNKFGYF
FT                   QKVLYNEMFTDQAGNYKIHAGLLIMPSKFPSSYRILISEEGYPKSNIKVRFHKWSGYRA
FT                   KSNLNRLEMNDVKPSCIENKVISVWKQGHSSELFGHYSYMLRLGKLPSNEEPPSETTVV
FT                   MKDIKARSAKRTEKLRQFEDFVTSGNSWSSQKGQGVSSTYKSADLSFEGCQNSFNSKTD
FT                   PSNEVLEFKARPSKRSRILPEGVMRSDSTACNTSIQGHIVSSRCGEQSPTSFIKENCTP
FT                   VPIEPPNTAGDTNAGPHEIMRKTSSGVYENNKINSSLSNKYSRPKGQQTCVLAQCEKPL
FT                   LPKKRLLVKSGTAGYREMTELEKDIYHLLEIRQTPKGVRGSAPLPSRSDKISAEKAKRF
FT                   QQVRQELMENEEEFLFSSKKAGPPLSGDGVIDRHLKIAASTSRPQNAINPNLVKSLKPV
FT                   SEIVAIIEKAEKVVAGQDLVQQLEGISQELKCSKSLESLSSSTLGKSFDNYSTARCYSS
FT                   PGVPVNERGKNKTIAPAEKAACPPGENPLPNASIVQNRVTVPLDKALSSNDFYKFMNSS
FT                   ETLDSEQSVIIRRHLFSSEHEVQGQVYPSPEGQKENNASLSGEFLIEANSVSSSYDSSE
FT                   IPEKCCVRSWQHITEAKNSIEAKKRPERSSCEAVFSYEPSDSSPERLKDLSAGEFSNFR
FT                   NRNSALLTTSKDSGSYSASQPCSPTFSDAASLATSHTRPLDLKSKCASECSNNALCAKN
FT                   RYCSIESGYVATELPVFKINENDPDLLYRVYMADPQNCLGQPEVIFRKPFEQRSNGLTQ
FT                   KLRKFMSSHSSSRKNTKSEPTYQEMYPALSNIRFRDFLRFKSRKLREDVRYFSHVAKLC
FT                   VTDFKERPITAERELYEQFK"
FT   gene            complement(<1003625..>1007182)
FT                   /locus_tag="KLTH0H11704g"
FT                   /old_locus_tag="KLTH-ORF630"
FT   CDS_pept        complement(1003625..1007182)
FT                   /locus_tag="KLTH0H11704g"
FT                   /old_locus_tag="KLTH-ORF630"
FT                   /product="KLTH0H11704p"
FT                   /note="similar to uniprot|P12351 Saccharomyces cerevisiae
FT                   YLR256W HAP1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30516"
FT                   /db_xref="GOA:C5E3A5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3A5"
FT                   /protein_id="CAR30516.1"
FT                   /translation="MSGPKIRAGGSCLVCRRRKVKCDRTKPVCLACIKYKSDSACDYET
FT                   KRNVRFLHMVYSEPTGNIDGENKVTKPQLQKPNTNVSNVGGSNCNMTFKKTKGVEASEQ
FT                   RLPTQLLAFGHMSFYDGYEAVEIKASRLLFTGALHSIAVLRRDPFLYVLVAMIRKDRSK
FT                   LHERISKAEPSSSRKYPVPLYTQEEIASQLIINARANHEHPCSNSVDDCRRYSRSGRSQ
FT                   NDSKISESLKLEPQKPGFPSQGKLTSADISTDTKFQQKLIENEGLDEVKSVVEEGNLPR
FT                   NPLSVVNLLNEDSQAKSSLANSSTQNNDKNKDIEIWRKLQSMLATLQQRQHRLMRQLEP
FT                   SRKNDLNAITSASFLGAMPSPEMSVLAKVREILPPTKIIWLHLRNYFRSPLHALFPVLT
FT                   EDWFCDTVKEFIKNHKDDMSKPEVVVTQRCDFGKIGCMLIIMRLSFLMYADKAEKNLPE
FT                   EQRDVYAHSIGPEFISTAELCLSLFRLLRKAILPVLHCAVLLRIYRRYAPDEGDIADSG
FT                   GSEPFSGILTKMATSIGLHVDAEFSGQFAFSKMYSQAWRKCWYVIYFLDLYEGMNSGNA
FT                   TTINEHSFSTRLPVVGTNEDGTLSSYITVPELEIASIECLRKNYDFSIACHKLLNLVMN
FT                   RNFKVSCEKVQSAAGELELLLKKTYEKGLRKILKHPAKTIDESITKCNDFKVFIETYSF
FT                   LFMVYFHLFLHVDKLVIGDPDRCPPSTSFHYLQKLLEIYVELEPALVVLRASKDYHGND
FT                   SEFFDTLFGNNSKLVVIQSCGMFIVRFTTILQCLAARLLHLKYNFLLRPSPYRLAGEER
FT                   EVPGVSEAADELITLLLKKLSIINEVTQSLSETYFYAWRISKGNSYIYDLLMAEDSILD
FT                   HKSNISRSYRAACKDEPAFNSEKPMPFVNFYDVIPESNSLLHAKVSDLKKLLFILQSDD
FT                   GNLLSSLTHRSHSFVTENTPLSAFQSPLSKFEEPGQNALSLIGMSSIKKATDASSDPNT
FT                   FTSLASPTSFRVEGTSSGSNSLNSQKMEKSRSYVNSEDIDTFWYKIKLRNANMSAERSF
FT                   SQSSGPPNRPNASDEKSKIFSSSWHNNNHNPPSPTERLVRNELHDTGHFNEIFNNQSLL
FT                   QEHVMQQLQQLTEEQPIPQNPSRQGEYVESFTPHLAPNHREDKRNIEGSFLNNNSLEAG
FT                   DFDMFLPTFDAFIEDIDFT"
FT   gene            complement(<1007328..>1009139)
FT                   /locus_tag="KLTH0H11726g"
FT                   /old_locus_tag="KLTH-ORF628"
FT   CDS_pept        complement(1007328..1009139)
FT                   /locus_tag="KLTH0H11726g"
FT                   /old_locus_tag="KLTH-ORF628"
FT                   /product="KLTH0H11726p"
FT                   /note="weakly similar to uniprot|Q06247 Saccharomyces
FT                   cerevisiae YLR173W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30517"
FT                   /db_xref="GOA:C5E3A6"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3A6"
FT                   /protein_id="CAR30517.1"
FT                   /translation="MESQDLEEQPLLRPEPHYEATSPPPQKKTKTRRRGWTKLIWGFII
FT                   ILLLHAGVVLWAARYIPSQQLIQDYYEDATNVKLRHLAFDGWYSDSNGSHIENEDSPKY
FT                   LKLRAQLDVWFDYDQVHKFENSSASVRKQRTIRFMSQSVVKSLCFDFDSIRAFNDNETD
FT                   SQDLGTISIPTRTCIDVRHQKVNQLDVPILIRPDAKNVASVIMKIWKGEFKKLDLWSSL
FT                   NVRLSKKVLNKWDLPLWKLKIARLDWKQFLNLDSLSSKLDSIRAALSQAVEVQSLEITD
FT                   DVENDMNFRISVAYIVPEEIRSDMIFPQDSVFPPTSWNIQLPGCDPTRPVSLENALFRA
FT                   PAIRLNDLAPGELANMDIVGNIQGPLPDDLLYQVCSSDEENVVTPVNLLLNKIFNATEL
FT                   LQFEILGHGYTDSQGSILPPNFMDQLLPSIQQPINANLSLNSNNLVEYVTVEGMRLRWI
FT                   QSGWDERKLTIKGKVIAVINLPYYNSAFAGGEETVAIEKIKGLTKLFHNDVHFVNVPMD
FT                   VWLNAESEFLPTEDPKHNQLSVSFDIAHQDVEIVNSFELTRCLNEILIRGQAQVHVEGK
FT                   LDLMADTKLGAIVVLGLEGEGTTIVKK"
FT   gene            <1009647..>1010546
FT                   /locus_tag="KLTH0H11748g"
FT                   /old_locus_tag="KLTH-ORF627"
FT   CDS_pept        1009647..1010546
FT                   /locus_tag="KLTH0H11748g"
FT                   /old_locus_tag="KLTH-ORF627"
FT                   /product="KLTH0H11748p"
FT                   /note="highly similar to uniprot|P32469 Saccharomyces
FT                   cerevisiae YLR172C DPH5 Methyltransferase required for
FT                   synthesis of diphthamide which is a modified histidine
FT                   residue of translation elongation factor 2 (Eft1p or Eft2p)
FT                   not essential for viability GFP-Dph5p fusion protein
FT                   localizes to the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30518"
FT                   /db_xref="GOA:C5E3A7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3A7"
FT                   /protein_id="CAR30518.1"
FT                   /translation="MLYLIGLGLSYTTDITVRGLEAIKKCDRIYLEHYTSILMAASLEE
FT                   LEQFYGKPVTLADRELVESGCEEILRDADKQDVAFLVVGDPFGATTHTDLVLRAKRQGL
FT                   PVEVIHNASVMNAVGSCGLQLYTFGQTVSMVFFTDDWRPDSWYNKIWENRKIGLHTLVL
FT                   LDIKVKEQSIENMARGRLIYEPPRYMSISQCCEQLLEIEETRGTKAYTPDTPVVAISRL
FT                   GSASQEFKSGTIEELSRYDAGEPLHSLVILGRQCHELELEYLLDFASDREAFKQAVIKD
FT                   QEYFKPAPWVPPAEEDDE"
FT   gene            <1010683..>1011153
FT                   /locus_tag="KLTH0H11770g"
FT                   /old_locus_tag="KLTH-ORF626"
FT   CDS_pept        1010683..1011153
FT                   /locus_tag="KLTH0H11770g"
FT                   /old_locus_tag="KLTH-ORF626"
FT                   /product="KLTH0H11770p"
FT                   /note="highly similar to uniprot|P35181 Saccharomyces
FT                   cerevisiae YLR170C APS1 Small subunit of the clathrin-
FT                   associated adaptor complex AP-1 which is involved in
FT                   protein sorting at the trans-Golgi network homolog of the
FT                   sigma subunit of the mammalian clathrin AP-1 complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30519"
FT                   /db_xref="GOA:C5E3A8"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3A8"
FT                   /protein_id="CAR30519.1"
FT                   /translation="MTQIKYMLLVSRQGKVRLMRWYSAYDSKGKSKISRELATMVLARK
FT                   AKMCNILEYQDHKVVYKRYASLYFICGISSDSDNELLTLEVIHRYVEAMDSYFNNVCEL
FT                   DIIFNFTKAYEILNEVLVCDGSMTETSKQAILRSVMTMDSLETSDSLDQVLS"
FT   gene            complement(<1011230..>1011598)
FT                   /locus_tag="KLTH0H11792g"
FT                   /old_locus_tag="KLTH-ORF624"
FT   CDS_pept        complement(1011230..1011598)
FT                   /locus_tag="KLTH0H11792g"
FT                   /old_locus_tag="KLTH-ORF624"
FT                   /product="KLTH0H11792p"
FT                   /note="some similarities with uniprot|Q04814 Saccharomyces
FT                   cerevisiae YMR252C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30520"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3A9"
FT                   /protein_id="CAR30520.1"
FT                   /translation="MLNRVFANSSNSLLRALARSGSRFVHSSAPALLYKKWGDISLKDK
FT                   QAFINNYVGLYKEKHPCSKSNVMYQTLVGEMEEYDDAPYVFGILYNEIRSVSQNESADN
FT                   AKGSGAMGDPDFEKLLYR"
FT   gene            <1011877..>1011948
FT                   /locus_tag="KLTH0H11814r"
FT                   /old_locus_tag="Klth0H.tHis_GTG_8"
FT   tRNA            1011877..1011948
FT                   /locus_tag="KLTH0H11814r"
FT                   /old_locus_tag="Klth0H.tHis_GTG_8"
FT                   /note="tRNA-His (GTG) cove score=66.56"
FT   gene            <1012387..>1012500
FT                   /locus_tag="KLTH0H11836r"
FT                   /old_locus_tag="Klth0H.tLeu_CAA_9"
FT   tRNA            join(1012387..1012424,1012457..1012500)
FT                   /locus_tag="KLTH0H11836r"
FT                   /old_locus_tag="Klth0H.tLeu_CAA_9"
FT                   /note="tRNA-Leu (CAA) cove"
FT   gene            <1013677..>1015374
FT                   /locus_tag="KLTH0H11858g"
FT                   /old_locus_tag="KLTH-ORF619"
FT   CDS_pept        1013677..1015374
FT                   /locus_tag="KLTH0H11858g"
FT                   /old_locus_tag="KLTH-ORF619"
FT                   /product="KLTH0H11858p"
FT                   /note="some similarities with uniprot|P38623 Saccharomyces
FT                   cerevisiae YLR248W RCK2 Protein kinase involved in the
FT                   response to oxidative stress identified as suppressor of S.
FT                   pombe cell cycle checkpoint mutations"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30521"
FT                   /db_xref="GOA:C5E3B0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3B0"
FT                   /protein_id="CAR30521.1"
FT                   /translation="MVPQALDESVTPVLGPLVQEKANAEVLETNLYNSDSTTNAASNAA
FT                   SNGGSSQSALNDRSDTRVPDIDAGDIRAYNDLHGLKGGIVGGSEVAGLVSETESEPGLV
FT                   EVISVGDDEASSSSSLDEDPEGDFVEQLELQDYKLISKIGEGAFSKVYRGVPRAESSKS
FT                   FLFKTFKHVAIKVINKKHLTSSQKDSKSKATSREQVLKEVAIHRTVSASENVVSFVDFH
FT                   ESPSYYFIVQELLAGGEIFGEIVRLTYFSEDLSRHVIRQLALAVKHMHSLGIIHRDIKP
FT                   ENLLFEPVDYEPSPKPVLRKSDDPKTKQDEGVFKPSVGGGGIGIVKLADFGLSKQIYST
FT                   NTKTPCGTVGYTAPEVVKDERYSLQVDMWGIGCVLYTILCGFPPFYDEKIDVLTEKISR
FT                   GEYTFLRPWWDEISDGAKHAVRKLLEVDPSKRYNIDEFLADPWLNSYDCLRGQALKKHK
FT                   NESMENVHSLASKKKKRYAKHNFKRDSSLLYSPAAVAMRDAFEVNNALQRKEEDRRRTP
FT                   TPSNLGQLQEDEEMSLEQDMFQLRLNSSTIIKRRKNKDEVTVPATLAE"
FT   gene            <1016025..>1016711
FT                   /locus_tag="KLTH0H11880g"
FT                   /old_locus_tag="KLTH-ORF613"
FT   CDS_pept        1016025..1016711
FT                   /locus_tag="KLTH0H11880g"
FT                   /old_locus_tag="KLTH-ORF613"
FT                   /product="KLTH0H11880p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30522"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3B1"
FT                   /protein_id="CAR30522.1"
FT                   /translation="MLSKESNPQQTSRTSTTTVIKILRDFSRRGIIFNTTRNVVDSAPC
FT                   HKVRATSNSTSTLVLVDQTCNDTGLLLLLSATKRLVQPTLDTSVAQAPVLIWHKHRKDE
FT                   LRLIPDERTGSIVRATLMLYWFISGTCLCTVAYWPSTPPLQIRTSTCCPAASFSQENLL
FT                   RTHPTARLACFIFPHATHDPAQGAVFRCRLSYPSSAFPQRVRTVSRKSTTTRTNRSLWD
FT                   LIVCHV"
FT   gene            <1017096..>1020230
FT                   /locus_tag="KLTH0H11902g"
FT                   /old_locus_tag="KLTH-ORF610"
FT   CDS_pept        1017096..1020230
FT                   /locus_tag="KLTH0H11902g"
FT                   /old_locus_tag="KLTH-ORF610"
FT                   /product="KLTH0H11902p"
FT                   /note="highly similar to uniprot|P53978 Saccharomyces
FT                   cerevisiae YNL014W HEF3 Translational elongation factor EF-
FT                   3 paralog of YEF3 and member of the ABC superfamily
FT                   stimulates EF-1 alpha-dependent binding of aminoacyl-tRNA
FT                   by the ribosome normally expressed in zinc deficient cells"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30523"
FT                   /db_xref="GOA:C5E3B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040533"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3B2"
FT                   /protein_id="CAR30523.1"
FT                   /translation="MSDSEQSIKVLNELFEKLSVATPETREATAVEISSFLNGNIIEHD
FT                   VPEQFFASISKALKDKKAASNALEAIIRVASESNLAPSVEACVVRLVPEICAKAGDKDK
FT                   DIQQQASTALLAIVKAINPVATKVLLPHLTTRIAETNKWQEKVAILAAVSDLVDAAKTQ
FT                   VALRMPELIPVLSEAMWDTKKEVKEAATATITKATETVDNKDIDRFIPKLIECIANPKE
FT                   VPETVHLLGATTFVAEVTPATLSIMVPLLARGLAERETSIKRKAAVIIDNMCKLVEDPQ
FT                   VVAPFLSKLLPGLKNNFATIADPEAREVTLRALKTLRRVGNVGADDSLPEVSHAGDIST
FT                   TRGVLDSLLKDKKIDSRFEHVKHYIAGMAADLIDERIIDQQAWFTHVLPYATVFLHERE
FT                   AKEIIDDFRKLAVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRARR
FT                   YGLCGPNGAGKSTLMRAIANGQVDGFPTQDECRTVYVEHDIDGTHSDTSVLDFVFQGDV
FT                   GTKEVITEKLREFGFSDEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT
FT                   VNVAWLVNYLNTCGITSIIVSHDSGFLDSVTQYIIHYEGLKLRKYKGNMSEFVKKCPTA
FT                   KSYYELGASDLEFRFPEPGFLEGVKTKQKAIVKVSNMSFQYPGTAKPQIRDVSFQCSLS
FT                   SRIAVIGPNGAGKSTLINVLTGELLPTTGEVYTHENCRIAYIKQHAFAHIESHLDKTPS
FT                   EYIQWRFQTGEDRETMDRANRVINEEDAESMNKIFKIEGTPRRIQGIHARRKFKNSYEY
FT                   ECSFLLGENIGMKSERWVPMMSVDNAWIPRGELVESHSKMVAEVDMKEALASGQFRPLT
FT                   RKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAACSWQRPHLIVLDEPTNYLDRD
FT                   SLGALSKALKAFDGGVIIITHSAEFTKNLTEEVWAVNNGVMVPSGHNWVAGQGSGPRIE
FT                   KKEDEEDKFDAMGNKISSGTKKKKLSSAELRKKKKERMKKKKEMGDAYVSSDEDF"
FT   gene            <1020731..>1022587
FT                   /locus_tag="KLTH0H11924g"
FT                   /old_locus_tag="KLTH-ORF605"
FT   CDS_pept        1020731..1022587
FT                   /locus_tag="KLTH0H11924g"
FT                   /old_locus_tag="KLTH-ORF605"
FT                   /product="KLTH0H11924p"
FT                   /note="similar to uniprot|P53541 Saccharomyces cerevisiae
FT                   YNL012W SPO1 Meiosis-specific protein with similarity to
FT                   phospholipase B"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30524"
FT                   /db_xref="GOA:C5E3B3"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3B3"
FT                   /protein_id="CAR30524.1"
FT                   /translation="MRGKLEVFMRSLNVRAADVENLVNISHQQINMGLAVSGGGYRSML
FT                   TGSGFLLGMQEYGLVDCLNYITGVSGGSWILAKLISNGFDFDSLGQWELERSLLEGVPD
FT                   LDIPDGNVATMLETNNLSEIFKADKWFYDKLTQASGLWKRNADPQPLDIFEQFYSELEQ
FT                   YTQLQPLGRLESRNPKPLSRITKAVARLFSSGGGKEEQVNKLLNASNEFRQVVQTYVAL
FT                   HLKVKSKKFEGFPLSFTDYWGHALIGAIAPSSEAKSVSSLLDQSPAFQNFKTPLPIFVA
FT                   NCKNKDLENAVFEFTPFEFGSWNSLGLFVKLRFLGSKIVAGQALKCFTGFDEVGFLAAT
FT                   SSSLFNNVLVYVWHLVAPSMDMRMAVRAIFSAFNLHGIKAEIEASNGGKEFSHPEYAIY
FT                   QPNPFFGYPGKNNILAEQDQLYLVDGGEDGENIPIGPLLIEQRRLDVIFALDSSSDMGS
FT                   FPNGSMLRNFYENHEIKSSSSSGPFNLLPYIPPSGEFVNEGLLSRPVAFGCHLESFPEL
FT                   YGRNQGNLSAVPLPPIIIYHANSEHSFPSNMSTFKLRYTADEVQKMIQNGKDIFNFDSS
FT                   PKYKRCLACIISKRSYDRATIDSEEAPLPFFCEVCFSEYCYN"
FT   gene            <1022709..>1023404
FT                   /locus_tag="KLTH0H11946g"
FT                   /old_locus_tag="KLTH-ORF604"
FT   CDS_pept        1022709..1023404
FT                   /locus_tag="KLTH0H11946g"
FT                   /old_locus_tag="KLTH-ORF604"
FT                   /product="KLTH0H11946p"
FT                   /note="similar to uniprot|P39931 Saccharomyces cerevisiae
FT                   YLR250W SSP120 Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cytoplasm in a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30525"
FT                   /db_xref="GOA:C5E3B4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR040250"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3B4"
FT                   /protein_id="CAR30525.1"
FT                   /translation="MRLWYILSALALPAFGVPLKNDGSEINEEVERKPNDLSWEQWHMQ
FT                   REHQMETYEPETFFTLHDIGNKGYFDRQDILTMYGLNRDEVVGSGDGMGKHDNSEQIDQ
FT                   ETSDRVFQLVMELLDVDDDSKIEKQEYLDFAKRGGQLPDLGVGVGHHSDFELEYELHHW
FT                   NKYHMDKDPDVKVVHKEDVAHDLLHHEHKMEHEDQVQQGASRVTVVTDDELEARIKLEN
FT                   IPQKFKNGF"
FT   gene            complement(<1023447..>1024880)
FT                   /locus_tag="KLTH0H11968g"
FT                   /old_locus_tag="KLTH-ORF602"
FT   CDS_pept        complement(1023447..1024880)
FT                   /locus_tag="KLTH0H11968g"
FT                   /old_locus_tag="KLTH-ORF602"
FT                   /product="KLTH0H11968p"
FT                   /note="similar to uniprot|P53980 Saccharomyces cerevisiae
FT                   YNL011C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30526"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3B5"
FT                   /protein_id="CAR30526.1"
FT                   /translation="MNIVVLSGGTAANALLPAFEAVSRELCFMLPISDNGGSTSEILRV
FT                   VGGPAIGDVRSRLVRLIRDDALARLLGYRLPNEVVAAKYEWNAIVDGTHDVWADFPSEV
FT                   KDICRSFLVHMQGELLKKHKSSAPFQFEKASIGNLFLTGVRLFLGSLDASIELTHRVCR
FT                   CDERISVVPCINTNHTHHISALLQNGDVITGQSQISHPSTQKLRSARRLRAATPALCAP
FT                   NASTDSLVAPESFVHLRVQDTGHGRADSSHEQTGHGDNVSLSSSSSSEEDDDHEEYAYA
FT                   GYIHPELKLSQLHFDKLDISEDQLLPAPVRRIFYINPYGEEVLPRGNSRAIGKLKTFDM
FT                   IVYSVGSVVTSLLPIVILGNVAETIAENSRAAKVLLINNKYDRETFGLNGADIVQLVVD
FT                   SMNRAVHNHRRRRKSNKSESTGDKTVWNEFVTDVVYLEKGEIPVDTYALNAQGVRTHAV
FT                   DSDIFDNHMLANVLSSLQN"
FT   gene            <1025209..>1025922
FT                   /locus_tag="KLTH0H11990g"
FT                   /old_locus_tag="KLTH-ORF597"
FT   CDS_pept        1025209..1025922
FT                   /locus_tag="KLTH0H11990g"
FT                   /old_locus_tag="KLTH-ORF597"
FT                   /product="KLTH0H11990p"
FT                   /note="highly similar to uniprot|P53981 Saccharomyces
FT                   cerevisiae YNL010W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H11990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30527"
FT                   /db_xref="GOA:C5E3B6"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3B6"
FT                   /protein_id="CAR30527.1"
FT                   /translation="MVKAVIFTDFDGTVTWQDSNDFLTDNKGFGKVEREKVFEGVLDGS
FT                   KSFRDGFWEMLESVKTPFPECVKLLEQNIDLDPGFKDTYEWAQENGVPIVVISSGMRPL
FT                   IRALLERLVGPEAIKNIEIVSNEVEIDDDGQWRIVYKDETPFGHDKSRSIKAYKKKFEA
FT                   DGEHPTYFYCGDGVSDLSAAKECDLLFAKRGKDLVTYCKRQDVPFHEFDTYEDILKSMK
FT                   QVLAGEKTVKELMQN"
FT   gene            <1026586..>1027827
FT                   /locus_tag="KLTH0H12012g"
FT                   /old_locus_tag="KLTH-ORF595"
FT   CDS_pept        1026586..1027827
FT                   /locus_tag="KLTH0H12012g"
FT                   /old_locus_tag="KLTH-ORF595"
FT                   /product="KLTH0H12012p"
FT                   /note="highly similar to uniprot|P41939 Saccharomyces
FT                   cerevisiae YLR174W IDP2 Cytosolic NADP-specific isocitrate
FT                   dehydrogenase catalyzes oxidation of isocitrate to alpha-
FT                   ketoglutarate levels are elevated during growth on non-
FT                   fermentable carbon sources and reduced during growth on
FT                   glucose"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H12012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30528"
FT                   /db_xref="GOA:C5E3B7"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3B7"
FT                   /protein_id="CAR30528.1"
FT                   /translation="MAKIRVANPIVEMDGDEQTRIIWHLIREKLIMPFLDIDLKYYDLS
FT                   IQNRDATDDEVTAASARATLKYGVAVKCATVTPDEARVREFGLKRMWASPNGTIRNILG
FT                   GTVFREPIVIPRIPRLVPGWQRPIIIGRHAFGDQYKATDVAIEGAGELRLVFRSRDGDQ
FT                   AKDLDLQVYEFPESGGVALAMYNTTESIRGFARASFELALQRKMPLYSTTKNTILKRYD
FT                   GRFKDEFEAMYEAEYRERFERAGIWYEHRLIDDMVAQMLKSAGGFVIAMKNYDGDVQSD
FT                   IVAQGFGSLGLMTSVLVTPDGRAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTR
FT                   GLLQRGRLDGTPEVEGFARALETATVATVNEDGIMTKDLALMLGRTDRASYVTTEDFID
FT                   AVEQRLIRSLKEDR"
FT   gene            <1028332..>1028403
FT                   /locus_tag="KLTH0H12034r"
FT                   /old_locus_tag="Klth0H.tAsp_GTC_10"
FT   tRNA            1028332..1028403
FT                   /locus_tag="KLTH0H12034r"
FT                   /old_locus_tag="Klth0H.tAsp_GTC_10"
FT                   /note="tRNA-Asp (GTC) cove score=69.96"
FT   gene            <1029016..>1030673
FT                   /locus_tag="KLTH0H12056g"
FT                   /old_locus_tag="KLTH.mRNA.220AT.p"
FT   CDS_pept        join(1029016..1029240,1029312..1030673)
FT                   /locus_tag="KLTH0H12056g"
FT                   /old_locus_tag="KLTH.mRNA.220AT.p"
FT                   /product="KLTH0H12056p"
FT                   /note="similar to uniprot|P25604 Saccharomyces cerevisiae
FT                   YCL008C STP22 Component of the ESCRT-I complex which is
FT                   involved in ubiquitin-dependent sorting of proteins into
FT                   the endosome homologous to the mouse and human Tsg101 tumor
FT                   susceptibility gene mutants exhibit a Class E Vps
FT                   phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H12056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30529"
FT                   /db_xref="GOA:C5E3B8"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="InterPro:IPR037202"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3B8"
FT                   /protein_id="CAR30529.1"
FT                   /translation="MKGAQTYKLIRIVGFCLGVGRGGALVTVNLPYFQKPFLYFTLSTK
FT                   SGASPPKQTAMNAVNLPPQVLDWLFKVLQPYYDARTTFRDVVFTLSENTALRPKTRVFT
FT                   DFQGRSQLLLCLYGRLESVPVLVWVPLEYPIAAPYPFVDLEALRGARLRANSYVDANGA
FT                   FSVPALDRWDPQVSTVGGLVSEMARAITEEPPVYMDEELQSPPIPPRAALVPTAVPNAV
FT                   VDDLVRRVGASSLEDDISSRAPALPPKPPLGVASESSNTPVVPLPPRPPMVAPERSVET
FT                   SYSSHSLQPPASIPTSPHDTPLPPRPPTKNSFSSQAYTDGQLDTQQTGNPAASVTTAPA
FT                   TPQPIPDLMGTDTGAESNSSHHHAIEELRHTIASLSEQDRQSVQETLKTRMYAVQNATA
FT                   QFKHISDHEAAALKQFSQTLCSRRQALRENLDQVDLQLQKAQQYIQDYGPDTDLRSILA
FT                   PEPAGVQQLRSLVAKDHAITDAIHALTRMLGQNSITLDIFIKKTRSLGRDQFLARVHIN
FT                   KILGQIQPRSN"
FT   gene            <1030928..>1032382
FT                   /locus_tag="KLTH0H12078g"
FT                   /old_locus_tag="KLTH-ORF586"
FT   CDS_pept        1030928..1032382
FT                   /locus_tag="KLTH0H12078g"
FT                   /old_locus_tag="KLTH-ORF586"
FT                   /product="KLTH0H12078p"
FT                   /note="highly similar to uniprot|P33322 Saccharomyces
FT                   cerevisiae YLR175W CBF5 Component of box H/ACA small
FT                   nucleolar ribonucleoprotein particles (snoRNPs) probable
FT                   rRNA pseudouridine synthase binds to snoRNP Nop10p and also
FT                   interacts with ribosomal biogenesis protein Nop53p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H12078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30530"
FT                   /db_xref="GOA:C5E3B9"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3B9"
FT                   /protein_id="CAR30530.1"
FT                   /translation="MSEEYLIKPENVAPTTDASEWPLLLKNYDKLLVRSGHYTPIPTGS
FT                   SPHKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLIVC
FT                   VDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRGLENLTGALFQRPPLISAVKRQL
FT                   RVRTIYDSNLIEFDTNRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRVRSGA
FT                   LSENDNLVTLHDVMDAQWVYDNTRDESYLRKIIQPLETLLLGYKRIVVKDSAVNAVCYG
FT                   AKLMIPGLLRYEEGIELYDEVVLMTTKGEAIAIAIAQMSTVDLATCDHGVVAKVKRCIM
FT                   ERDLYPRRWGLGPVAQKKKQMKADGKLDKYGRVNEQTPEDWKKSYVSHEGDQPAAQVSS
FT                   TVTESVSATSDSAPVQEMVKEVKVETIVKESEDDEDKEESGKKEKKDKKDKKEKKEKKE
FT                   KKEKKDKKRKAEGEESADKKKKKSKK"
FT   gene            complement(<1032695..>1033747)
FT                   /locus_tag="KLTH0H12100g"
FT                   /old_locus_tag="KLTH-ORF582"
FT   CDS_pept        complement(1032695..1033747)
FT                   /locus_tag="KLTH0H12100g"
FT                   /old_locus_tag="KLTH-ORF582"
FT                   /product="KLTH0H12100p"
FT                   /note="some similarities with uniprot|P25294 Saccharomyces
FT                   cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
FT                   suppressor dnaJ homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H12100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30531"
FT                   /db_xref="GOA:C5E3C0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3C0"
FT                   /protein_id="CAR30531.1"
FT                   /translation="MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAEKF
FT                   KEISEAFEILNDPQKREIYDNYGLEAARNGGPAFGGAGGAGGAGGHPGFASSHSFSNED
FT                   AFNIFSQFFGGGSGGASPFGFGGDDAFGGGFPGGGSSGFSTGGFPGGAGFRTTTGGMPG
FT                   GFSSSGASSPLPEEKTVQVNLPVSLEDLFSGKKKSFKITRKGPGGAPEKQQVDIQLRPG
FT                   WKAGTKITYKNEGDYNPRTGRRQTMQFIIQEKPHENYTRDGNDLIYTLPLTFKESLLGF
FT                   NKTIQTIDGRTLPISRVQPVQPSDVSTYPGQGMPVAKNPSQRGNLIVKYKIDYPATLND
FT                   SQRRAISENF"
FT   gene            <1034092..>1035003
FT                   /locus_tag="KLTH0H12122g"
FT                   /old_locus_tag="KLTH-ORF580"
FT   CDS_pept        1034092..1035003
FT                   /locus_tag="KLTH0H12122g"
FT                   /old_locus_tag="KLTH-ORF580"
FT                   /product="KLTH0H12122p"
FT                   /note="highly similar to uniprot|P41318 Saccharomyces
FT                   cerevisiae YNL006W LST8 Protein required for the transport
FT                   of amino acid permease Gap1p from the Golgi to the cell
FT                   surface component of the TOR signaling pathway associates
FT                   with both Tor1p and Tor2p contains a WD-repeat"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H12122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30532"
FT                   /db_xref="GOA:C5E3C1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037588"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3C1"
FT                   /protein_id="CAR30532.1"
FT                   /translation="MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKR
FT                   FLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDV
FT                   RAPSVQRNYKHHAAVNEVVIHPNQGELISCDQDGNIKIWDLGENQCVHQLAPEDDTPLQ
FT                   SLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPRPVTKFRSHAKYITRVLLSSDVKHL
FT                   ATCSADHTARVWSIDDNFQLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLST
FT                   REIVRQYGGHHKGAICVALNDV"
FT   gene            complement(<1035244..>1037466)
FT                   /locus_tag="KLTH0H12144g"
FT                   /old_locus_tag="KLTH-ORF579"
FT   CDS_pept        complement(1035244..1037466)
FT                   /locus_tag="KLTH0H12144g"
FT                   /old_locus_tag="KLTH-ORF579"
FT                   /product="KLTH0H12144p"
FT                   /note="some similarities with uniprot|P48743 Saccharomyces
FT                   cerevisiae YLR176C"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0H12144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30533"
FT                   /db_xref="GOA:C5E3C2"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039779"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3C2"
FT                   /protein_id="CAR30533.1"
FT                   /translation="MSDRQPSAGDEKPMPPPLQPLLTKNGSAGSTGSAGSSGTSGTGGA
FT                   SGMSGVGGSSGANSNSAGGPAGAGVLQIPPRADSVPPLAAASQPYQTQHSFLSAAFQQP
FT                   QRGYAPNYGLPMSANKQQPMPPYTASYTPPLGPGYLPSPIPQLMLNEKSMDLHRGFQQQ
FT                   FPVFHAPQPHFAPTMESDSSMKKRRLLDYSDQRSEAVKDRGATKKNGNEAILRDLAMEN
FT                   KARPLSECALTVREAEIAVLNMDPTTHSKSEIQAAEQVRERERQVYALTWLMNTCVEEK
FT                   NSFVPRGRIFAQYAACCAQNNLKPLSQATLGKLIRTIFPDLTTRRLGMRGQSKYHYCGL
FT                   NLIGSSRSASPVPSLGNSDLGGVNNVQNISNVNVGVNNSSNNSLYSSIQGQGVAALSSE
FT                   TPSIFQESHEARSDKWEDVAHWDCLRIADELFHNVSTVDVNVSLEIPSINSYLPPNTDI
FT                   DIAASLECMYKVHCNTVHENISFAKFDALTNTLESFSSGSISPQMFNLFISEALYDWVQ
FT                   QADLVTHKATAKSLFKFIKEFATLPSSVSEKL