(data stored in ACNUC9543 zone)

EMBL: CU928181

ID   CU928181; SV 1; linear; genomic DNA; STD; FUN; 881646 BP.
XX
AC   CU928181;
XX
PR   Project:PRJNA12502;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Zygosaccharomyces rouxii strain CBS732 chromosome E complete sequence.
XX
KW   genomic DNA.
XX
OS   Zygosaccharomyces rouxii
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Zygosaccharomyces.
XX
RN   [1]
RP   1-881646
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-881646
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   MD5; e2ecc6faf141deba0639c78c90793c1b.
DR   BioSample; SAMEA3138235.
DR   CABRI; CBS 732.
DR   EnsemblGenomes-Gn; ENSRNA049647623.
DR   EnsemblGenomes-Gn; ENSRNA049647658.
DR   EnsemblGenomes-Gn; ENSRNA049647693.
DR   EnsemblGenomes-Gn; ENSRNA049647721.
DR   EnsemblGenomes-Gn; ENSRNA049647753.
DR   EnsemblGenomes-Gn; ENSRNA049647777.
DR   EnsemblGenomes-Gn; ENSRNA049647809.
DR   EnsemblGenomes-Gn; ENSRNA049647836.
DR   EnsemblGenomes-Gn; ENSRNA049647867.
DR   EnsemblGenomes-Gn; ENSRNA049647881.
DR   EnsemblGenomes-Gn; ENSRNA049647907.
DR   EnsemblGenomes-Gn; ENSRNA049647926.
DR   EnsemblGenomes-Gn; ENSRNA049647941.
DR   EnsemblGenomes-Gn; ENSRNA049647971.
DR   EnsemblGenomes-Gn; ENSRNA049647989.
DR   EnsemblGenomes-Gn; ENSRNA049648017.
DR   EnsemblGenomes-Gn; ENSRNA049648047.
DR   EnsemblGenomes-Gn; ENSRNA049648062.
DR   EnsemblGenomes-Gn; ENSRNA049648089.
DR   EnsemblGenomes-Gn; ENSRNA049648123.
DR   EnsemblGenomes-Gn; ENSRNA049648162.
DR   EnsemblGenomes-Gn; ENSRNA049648213.
DR   EnsemblGenomes-Gn; ENSRNA049648250.
DR   EnsemblGenomes-Gn; ENSRNA049648278.
DR   EnsemblGenomes-Gn; ENSRNA049648311.
DR   EnsemblGenomes-Gn; ENSRNA049648331.
DR   EnsemblGenomes-Gn; ENSRNA049648365.
DR   EnsemblGenomes-Gn; ENSRNA049648413.
DR   EnsemblGenomes-Gn; ENSRNA049648437.
DR   EnsemblGenomes-Gn; ENSRNA049648473.
DR   EnsemblGenomes-Gn; ENSRNA049648515.
DR   EnsemblGenomes-Gn; ENSRNA049648553.
DR   EnsemblGenomes-Gn; ENSRNA049675838.
DR   EnsemblGenomes-Gn; ENSRNA049675865.
DR   EnsemblGenomes-Gn; ENSRNA049675939.
DR   EnsemblGenomes-Gn; ENSRNA049676004.
DR   EnsemblGenomes-Gn; ENSRNA049676077.
DR   EnsemblGenomes-Gn; ENSRNA049676171.
DR   EnsemblGenomes-Gn; ENSRNA049676283.
DR   EnsemblGenomes-Gn; ENSRNA049676351.
DR   EnsemblGenomes-Gn; ENSRNA049676429.
DR   EnsemblGenomes-Gn; ENSRNA049676508.
DR   EnsemblGenomes-Gn; ENSRNA049676583.
DR   EnsemblGenomes-Gn; ENSRNA049676639.
DR   EnsemblGenomes-Gn; ENSRNA049676715.
DR   EnsemblGenomes-Gn; ZYRO0E00374r.
DR   EnsemblGenomes-Gn; ZYRO0E00506r.
DR   EnsemblGenomes-Gn; ZYRO0E01034r.
DR   EnsemblGenomes-Gn; ZYRO0E01562r.
DR   EnsemblGenomes-Gn; ZYRO0E02112r.
DR   EnsemblGenomes-Gn; ZYRO0E02244r.
DR   EnsemblGenomes-Gn; ZYRO0E02640r.
DR   EnsemblGenomes-Gn; ZYRO0E02706r.
DR   EnsemblGenomes-Gn; ZYRO0E02794r.
DR   EnsemblGenomes-Gn; ZYRO0E02816r.
DR   EnsemblGenomes-Gn; ZYRO0E02904r.
DR   EnsemblGenomes-Gn; ZYRO0E03212r.
DR   EnsemblGenomes-Gn; ZYRO0E03234r.
DR   EnsemblGenomes-Gn; ZYRO0E03432r.
DR   EnsemblGenomes-Gn; ZYRO0E03674r.
DR   EnsemblGenomes-Gn; ZYRO0E03696r.
DR   EnsemblGenomes-Gn; ZYRO0E03850r.
DR   EnsemblGenomes-Gn; ZYRO0E03960r.
DR   EnsemblGenomes-Gn; ZYRO0E03982r.
DR   EnsemblGenomes-Gn; ZYRO0E04268r.
DR   EnsemblGenomes-Gn; ZYRO0E04510r.
DR   EnsemblGenomes-Gn; ZYRO0E04664r.
DR   EnsemblGenomes-Gn; ZYRO0E04730r.
DR   EnsemblGenomes-Gn; ZYRO0E05038r.
DR   EnsemblGenomes-Gn; ZYRO0E05478r.
DR   EnsemblGenomes-Gn; ZYRO0E05742r.
DR   EnsemblGenomes-Gn; ZYRO0E05962r.
DR   EnsemblGenomes-Gn; ZYRO0E06028r.
DR   EnsemblGenomes-Gn; ZYRO0E06050r.
DR   EnsemblGenomes-Gn; ZYRO0E06072r.
DR   EnsemblGenomes-Gn; ZYRO0E06094r.
DR   EnsemblGenomes-Gn; ZYRO0E06116r.
DR   EnsemblGenomes-Gn; ZYRO0E06138r.
DR   EnsemblGenomes-Gn; ZYRO0E06160r.
DR   EnsemblGenomes-Gn; ZYRO0E06468r.
DR   EnsemblGenomes-Gn; ZYRO0E09658r.
DR   EnsemblGenomes-Gn; ZYRO0E10100r.
DR   EnsemblGenomes-Gn; ZYRO0E10104r.
DR   EnsemblGenomes-Gn; ZYRO0E10106r.
DR   EnsemblGenomes-Gn; ZYRO0E10108r.
DR   EnsemblGenomes-Gn; ZYRO0E10112r.
DR   EnsemblGenomes-Gn; ZYRO0E10114r.
DR   EnsemblGenomes-Gn; ZYRO0E10118r.
DR   EnsemblGenomes-Gn; ZYRO0E10127r.
DR   EnsemblGenomes-Gn; ZYRO0E10134r.
DR   EnsemblGenomes-Gn; ZYRO0E10164r.
DR   EnsemblGenomes-Gn; ZYRO0E10186r.
DR   EnsemblGenomes-Gn; ZYRO0E10208r.
DR   EnsemblGenomes-Gn; ZYRO0E10274r.
DR   EnsemblGenomes-Gn; ZYRO0E10384r.
DR   EnsemblGenomes-Gn; ZYRO0E10494r.
DR   EnsemblGenomes-Tr; EFT00001983159.
DR   EnsemblGenomes-Tr; EFT00001983160.
DR   EnsemblGenomes-Tr; EFT00001983161.
DR   EnsemblGenomes-Tr; EFT00001983162.
DR   EnsemblGenomes-Tr; EFT00001983163.
DR   EnsemblGenomes-Tr; EFT00001983164.
DR   EnsemblGenomes-Tr; EFT00001983165.
DR   EnsemblGenomes-Tr; EFT00001983166.
DR   EnsemblGenomes-Tr; EFT00001983167.
DR   EnsemblGenomes-Tr; EFT00001983168.
DR   EnsemblGenomes-Tr; EFT00001983169.
DR   EnsemblGenomes-Tr; EFT00001983170.
DR   EnsemblGenomes-Tr; EFT00001983171.
DR   EnsemblGenomes-Tr; EFT00001983172.
DR   EnsemblGenomes-Tr; EFT00001983173.
DR   EnsemblGenomes-Tr; EFT00001983174.
DR   EnsemblGenomes-Tr; EFT00001983175.
DR   EnsemblGenomes-Tr; EFT00001983176.
DR   EnsemblGenomes-Tr; EFT00001983177.
DR   EnsemblGenomes-Tr; EFT00001983178.
DR   EnsemblGenomes-Tr; EFT00001983179.
DR   EnsemblGenomes-Tr; EFT00001983180.
DR   EnsemblGenomes-Tr; EFT00001983182.
DR   EnsemblGenomes-Tr; EFT00001983183.
DR   EnsemblGenomes-Tr; EFT00001983185.
DR   EnsemblGenomes-Tr; EFT00001983186.
DR   EnsemblGenomes-Tr; EFT00001983187.
DR   EnsemblGenomes-Tr; EFT00001983188.
DR   EnsemblGenomes-Tr; EFT00001983189.
DR   EnsemblGenomes-Tr; EFT00001983190.
DR   EnsemblGenomes-Tr; EFT00001983191.
DR   EnsemblGenomes-Tr; EFT00001983192.
DR   EnsemblGenomes-Tr; EFT00001983193.
DR   EnsemblGenomes-Tr; EFT00001983194.
DR   EnsemblGenomes-Tr; EFT00001983195.
DR   EnsemblGenomes-Tr; EFT00001983196.
DR   EnsemblGenomes-Tr; EFT00001983197.
DR   EnsemblGenomes-Tr; EFT00001983198.
DR   EnsemblGenomes-Tr; EFT00001983199.
DR   EnsemblGenomes-Tr; EFT00001983200.
DR   EnsemblGenomes-Tr; EFT00001983201.
DR   EnsemblGenomes-Tr; EFT00001983202.
DR   EnsemblGenomes-Tr; EFT00001983203.
DR   EnsemblGenomes-Tr; EFT00001983204.
DR   EnsemblGenomes-Tr; EFT00001983205.
DR   EnsemblGenomes-Tr; EFT00001983206.
DR   EnsemblGenomes-Tr; EFT00001983208.
DR   EnsemblGenomes-Tr; EFT00001983209.
DR   EnsemblGenomes-Tr; EFT00001983210.
DR   EnsemblGenomes-Tr; EFT00001983211.
DR   EnsemblGenomes-Tr; EFT00001983212.
DR   EnsemblGenomes-Tr; EFT00001983213.
DR   EnsemblGenomes-Tr; EFT00001983214.
DR   EnsemblGenomes-Tr; EFT00001983215.
DR   EnsemblGenomes-Tr; EFT00001983216.
DR   EnsemblGenomes-Tr; EFT00001983217.
DR   EnsemblGenomes-Tr; ZYRO0E00374r-1.
DR   EnsemblGenomes-Tr; ZYRO0E00506r-1.
DR   EnsemblGenomes-Tr; ZYRO0E01034r-1.
DR   EnsemblGenomes-Tr; ZYRO0E01562r-1.
DR   EnsemblGenomes-Tr; ZYRO0E02112r-1.
DR   EnsemblGenomes-Tr; ZYRO0E02244r-1.
DR   EnsemblGenomes-Tr; ZYRO0E02640r-1.
DR   EnsemblGenomes-Tr; ZYRO0E02706r-1.
DR   EnsemblGenomes-Tr; ZYRO0E02794r-1.
DR   EnsemblGenomes-Tr; ZYRO0E02816r-1.
DR   EnsemblGenomes-Tr; ZYRO0E02904r-1.
DR   EnsemblGenomes-Tr; ZYRO0E03212r-1.
DR   EnsemblGenomes-Tr; ZYRO0E03234r-1.
DR   EnsemblGenomes-Tr; ZYRO0E03432r-1.
DR   EnsemblGenomes-Tr; ZYRO0E03674r-1.
DR   EnsemblGenomes-Tr; ZYRO0E03696r-1.
DR   EnsemblGenomes-Tr; ZYRO0E03850r-1.
DR   EnsemblGenomes-Tr; ZYRO0E03960r-1.
DR   EnsemblGenomes-Tr; ZYRO0E03982r-1.
DR   EnsemblGenomes-Tr; ZYRO0E04268r-1.
DR   EnsemblGenomes-Tr; ZYRO0E04510r-1.
DR   EnsemblGenomes-Tr; ZYRO0E04664r-1.
DR   EnsemblGenomes-Tr; ZYRO0E04730r-1.
DR   EnsemblGenomes-Tr; ZYRO0E05038r-1.
DR   EnsemblGenomes-Tr; ZYRO0E05478r-1.
DR   EnsemblGenomes-Tr; ZYRO0E05742r-1.
DR   EnsemblGenomes-Tr; ZYRO0E05962r-1.
DR   EnsemblGenomes-Tr; ZYRO0E06028r-1.
DR   EnsemblGenomes-Tr; ZYRO0E06050r-1.
DR   EnsemblGenomes-Tr; ZYRO0E06072r-1.
DR   EnsemblGenomes-Tr; ZYRO0E06094r-1.
DR   EnsemblGenomes-Tr; ZYRO0E06116r-1.
DR   EnsemblGenomes-Tr; ZYRO0E06138r-1.
DR   EnsemblGenomes-Tr; ZYRO0E06160r-1.
DR   EnsemblGenomes-Tr; ZYRO0E06468r-1.
DR   EnsemblGenomes-Tr; ZYRO0E09658r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10100r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10104r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10106r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10108r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10112r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10114r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10118r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10127r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10134r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10164r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10186r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10208r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10274r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10384r-1.
DR   EnsemblGenomes-Tr; ZYRO0E10494r-1.
DR   EuropePMC; PMC2765284; 19525356.
DR   EuropePMC; PMC5734014; 29079616.
DR   PR2; CU928181.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00009; RNaseP_nuc.
DR   RFAM; RF00086; SNORD27.
DR   RFAM; RF00213; snoR38.
DR   RFAM; RF00475; snosnR69.
DR   RFAM; RF01176; snR78.
DR   RFAM; RF01181; snR77.
DR   RFAM; RF01185; snR75.
DR   RFAM; RF01207; snR73.
DR   RFAM; RF01209; snR76.
DR   RFAM; RF01256; snR43.
DR   RFAM; RF01960; SSU_rRNA_eukarya.
DR   SILVA-LSU; CU928181.
DR   SILVA-SSU; CU928181.
DR   StrainInfo; 105346; 0.
XX
CC   The Zygosaccharomyces rouxii sequence is made of 7 chromosomes (A to G).
CC   The sequence was annotated by the Genolevures Consortium. For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..881646
FT                   /organism="Zygosaccharomyces rouxii"
FT                   /chromosome="E"
FT                   /strain="CBS 732"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Zyro0E"
FT                   /db_xref="taxon:4956"
FT   gene            <556..>1485
FT                   /pseudo
FT                   /locus_tag="ZYRO0E00110g"
FT                   /old_locus_tag="pseudo-Zyro0E-556-1485"
FT   gene            <2603..>3472
FT                   /locus_tag="ZYRO0E00132g"
FT                   /old_locus_tag="ZYRO-ORF4285"
FT   CDS_pept        2603..3472
FT                   /locus_tag="ZYRO0E00132g"
FT                   /old_locus_tag="ZYRO-ORF4285"
FT                   /product="ZYRO0E00132p"
FT                   /note="weakly similar to uniprot|P38363 Saccharomyces
FT                   cerevisiae YML132W COS3 Protein involved in salt resistance
FT                   interacts with sodium:hydrogen antiporter Nha1p member of a
FT                   family of conserved often subtelomerically- encoded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00132g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30703"
FT                   /db_xref="GOA:C5E3U2"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3U2"
FT                   /protein_id="CAR30703.1"
FT                   /translation="MFATLYLEFSILLPLARLQYSKMYPNTTVLVRQVLELNPQRDFKK
FT                   WDDIASKLNLLFYQEHIWNTPYFFYDGQQTQLAFKDNVLRPYHQGKFNGITDADKIQSA
FT                   RSYMQSIKKDFGLSLRDSLSKPVLNSKLPRDTYRGKFSFYSRYLLVGLTYLFQIDSLLK
FT                   IVTTFGQKPFEALISLIYWQFLFLIFYRYRYRLLYQEMGTMQAIKFLSIITKVNPEKEL
FT                   NKWDQVARHMNEYLASEENSSHSKRRFLDGKRCLNCYKTYFEPLSVGNGPSEYCELKEI
FT                   VEIIKPDA"
FT   gene            <3878..>6153
FT                   /pseudo
FT                   /locus_tag="ZYRO0E00154g"
FT                   /old_locus_tag="pseudo-Zyro0E-3878-6153"
FT   gene            <6608..>7139
FT                   /pseudo
FT                   /locus_tag="ZYRO0E00176g"
FT                   /old_locus_tag="pseudo-Zyro0E-6608-7139"
FT   gene            complement(<8207..>9667)
FT                   /locus_tag="ZYRO0E00198g"
FT                   /old_locus_tag="ZYRO-ORF4277"
FT   CDS_pept        complement(8207..9667)
FT                   /locus_tag="ZYRO0E00198g"
FT                   /old_locus_tag="ZYRO-ORF4277"
FT                   /product="ZYRO0E00198p"
FT                   /note="similar to uniprot|P50277 Saccharomyces cerevisiae
FT                   YNR058W BIO3 7 8-diamino-pelargonic acid aminotransferase
FT                   (DAPA) catalyzes the second step in the biotin biosynthesis
FT                   pathway BIO3 is in a cluster of 3 genes (BIO3 BIO4 and
FT                   BIO5) that mediate biotin synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00198g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30704"
FT                   /db_xref="GOA:C5E3U3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3U3"
FT                   /protein_id="CAR30704.1"
FT                   /translation="MKLPEETKALLRFDREHIWHPYTSMVNPLPVHLVKAAYDCELILE
FT                   TQDGSENRVIDGMSSWWCAIHGYNHKELNDALISQASQMSHVMFGGLAHRPAINLVQKL
FT                   LKMMNHKELQHCFLADSGSVAVEVAMKMALQYHFTLGKPKKSKFLTISSGYHGDTTGAM
FT                   SVCDPVGSMHSIYRGYLAENIFARGPSMIPVLPTSGVFRKYGKSFGDRTSWKEDDINDV
FT                   RDKIENHHDELCAVFLEPILQGAGGMRLYHPQFLIEVRRLCNRYHIPLILDEIATGFGR
FT                   TGTTFAFHHCQIYQEQNHIPREMQIDVYPDIICVGKALTGGYLTLSAVVTTPKIALGIS
FT                   SPSSPTGGCMMHGPTFMGNPLACAVANKSLDILMCGYWKQQVHRIEEQLFEELFVPLME
FT                   GAAAKELWLVEDVRIVGAVGVIELKVSIDQEWFQEAFISKGVYIRPFRNLCYIMPPYII
FT                   SKEQLRKLTTGLVSALREWHSVRANSTV"
FT   gene            <10096..>10788
FT                   /locus_tag="ZYRO0E00220g"
FT                   /old_locus_tag="ZYRO-ORF4276"
FT   CDS_pept        10096..10788
FT                   /locus_tag="ZYRO0E00220g"
FT                   /old_locus_tag="ZYRO-ORF4276"
FT                   /product="ZYRO0E00220p"
FT                   /note="similar to uniprot|P53630 Saccharomyces cerevisiae
FT                   YNR057C BIO4 Dethiobiotin synthetase catalyzes the third
FT                   step in the biotin biosynthesis pathway BIO4 is in a
FT                   cluster of 3 genes (BIO3 BIO4 and BIO5) that mediate biotin
FT                   synthesis expression appears to be repressed at low iron
FT                   levels"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00220g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30705"
FT                   /db_xref="GOA:C5E3U4"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3U4"
FT                   /protein_id="CAR30705.1"
FT                   /translation="MKPPVFFVTGTDTDVGKTFISSLLVYKWRANYWKPVQTGIESDIG
FT                   DTATVSNVLVDDSWKPHLFPPRHQLLKPLSPYEAMDYEPGVNVQITDFEIPEGTDEHPL
FT                   VVEGAGGVAVLVTKKMETIVDLIKELSFKCDRPFYIILVARSTLGTINHTFLTLNYLRS
FT                   KGLGDKILGVVVNGEQNEGNLKVMREFGVNILATVDYHTSMSEALSDIPSFCSLDLAHN
FT                   DPASIQKN"
FT   gene            <10876..>11967
FT                   /pseudo
FT                   /locus_tag="ZYRO0E00242g"
FT                   /old_locus_tag="pseudo-Zyro0E-10876-11967"
FT   gene            <12350..>13443
FT                   /pseudo
FT                   /locus_tag="ZYRO0E00264g"
FT                   /old_locus_tag="pseudo-Zyro0E-12350-13443"
FT   gene            complement(<14074..>14937)
FT                   /locus_tag="ZYRO0E00286g"
FT                   /old_locus_tag="ZYRO-ORF4270"
FT   CDS_pept        complement(14074..14937)
FT                   /locus_tag="ZYRO0E00286g"
FT                   /old_locus_tag="ZYRO-ORF4270"
FT                   /product="ZYRO0E00286p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00286g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30706"
FT                   /db_xref="GOA:C5E3U5"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3U5"
FT                   /protein_id="CAR30706.1"
FT                   /translation="MSMISDDSEKDLEKCVQMYEEEEIELPEDSSGGKLTYFLAPYFFE
FT                   KTWFYDIIASLVGAFLSPSLVRLPYFILRDFYHDPYEPKLLDVFSPLWMIIHYFLCFTF
FT                   SFWNFIDNRKNVDIEKKVLQKLLKEVAETDLMGDPLAWQRIASRVNHFSEEGGYHYSVF
FT                   YSGEHCMRFFVREIVKPIERQTYDIRCYYEGEICSNFWKNPSNKALTERALANYNKSVE
FT                   NFGELSHTAEKDEFRDGIFEKFHSIFDTSLFYLVMTELGSFMIMMLTFIISVISCAIFN
FT                   SFATPH"
FT   gene            <15270..>15968
FT                   /locus_tag="ZYRO0E00308g"
FT                   /old_locus_tag="ZYRO-ORF4269"
FT   CDS_pept        15270..15968
FT                   /locus_tag="ZYRO0E00308g"
FT                   /old_locus_tag="ZYRO-ORF4269"
FT                   /product="ZYRO0E00308p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00308g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30707"
FT                   /db_xref="GOA:C5E3U6"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3U6"
FT                   /protein_id="CAR30707.1"
FT                   /translation="MSNKKQSKSKASESHKRGGRENSPRGQHNSPSPQRNNSITDQQGS
FT                   ENGGTGSRTYGIKLAARLFRNPLLSKRGVKHAKEGLKIRSSDKSISGVRCGGSFCLFVY
FT                   PIFLIGYSIFGFLYGDKNNSIHVFLYGSPLFTAVPYIIQYLNDVDTLLLSIFEIGEKNL
FT                   LEYFADPGIRELLLIVFEIVGFIYQLVKGRQNFGIFICGIVGFVSYLLGHTLLILERKK
FT                   RPGSVAGDSA"
FT   gene            <16701..>17774
FT                   /locus_tag="ZYRO0E00330g"
FT                   /old_locus_tag="ZYRO-ORF4267"
FT   CDS_pept        16701..17774
FT                   /locus_tag="ZYRO0E00330g"
FT                   /old_locus_tag="ZYRO-ORF4267"
FT                   /product="ZYRO0E00330p"
FT                   /note="weakly similar to uniprot|P47187 Saccharomyces
FT                   cerevisiae YJR161C COS5 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00330g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30708"
FT                   /db_xref="GOA:C5E3U7"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3U7"
FT                   /protein_id="CAR30708.1"
FT                   /translation="MESDNESQKPVLPKDLFKNAFTWMFYEISKHRFPSVVSCVYLVIV
FT                   LVGFWWNFADKNLPLSIVLAAVGLFGILFGLIPAWFQNVKEHPNTKKLVQQVLESNPGV
FT                   DTRKWDEIANILNLFFYRENIWRTPYFFFNGQHVQRVFKYNVLKPYLGGQFEGVADADK
FT                   IQSAKCYMQSIKVYFELSLKDSISEFFLNSELPRDTHRNKFFFHPRYFFMGFMICFFQG
FT                   QILLLVVQLFVQRSFWILPTIINYQYCLLKCYQYGYRFWYPEMDVMQAIKFLAIITKFS
FT                   PRKELDKWDQIARYMNQYLMEGNSSHSRNIFFDGKHCLDCYKACFESLSLGNNSLSYDE
FT                   LKEIVEITQPSLNEETD"
FT   gene            <18625..>19686
FT                   /pseudo
FT                   /locus_tag="ZYRO0E00352g"
FT                   /old_locus_tag="pseudo-Zyro0E-18625-19686"
FT   gene            complement(<20280..>20351)
FT                   /locus_tag="ZYRO0E00374r"
FT                   /old_locus_tag="Zyro0E.tGly_TCC_32"
FT   tRNA            complement(20280..20351)
FT                   /locus_tag="ZYRO0E00374r"
FT                   /old_locus_tag="Zyro0E.tGly_TCC_32"
FT                   /note="tRNA-Gly (TCC) cove score=71.59"
FT   gene            complement(<21090..>22190)
FT                   /locus_tag="ZYRO0E00396g"
FT                   /old_locus_tag="ZYRO-ORF4263"
FT   CDS_pept        complement(21090..22190)
FT                   /locus_tag="ZYRO0E00396g"
FT                   /old_locus_tag="ZYRO-ORF4263"
FT                   /product="ZYRO0E00396p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00396g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30709"
FT                   /db_xref="GOA:C5E3U8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3U8"
FT                   /protein_id="CAR30709.1"
FT                   /translation="MNMSFGSIPVIDLGQAFDNETKPKFLENLRHALITVGFLRLTNFG
FT                   NYGPTTQDFQNITQQGIEFFELPEEEKKKVEMINSPHFLGYTKLGNEITSGKIDWREQI
FT                   DLATELPAPTKDGPLYKQLEGPNLWPDERVLPYFKLTMTSYIDKMSRLSSIFTKLVAES
FT                   IGLSPNALDTYFKENQQCKMKIVAYPADTHYRNDVEAVQGVGPHKDSDFLTFVYQASDH
FT                   KDTLQVQNFKGEWISVDNIPGSLVVNVGQTLEAITCGVCKATIHQVLRPRKGSGTRLSI
FT                   PFFRTVDLESKESAVSNISHDVWKLKEERDKTIDRWGIDTGFQYRPDFSQHPAGYAVFR
FT                   NRIKSHRDVAAKWYPELLAKVLTEIA"
FT   gene            <25673..>27175
FT                   /locus_tag="ZYRO0E00418g"
FT                   /old_locus_tag="ZYRO-ORF4260"
FT   CDS_pept        25673..27175
FT                   /locus_tag="ZYRO0E00418g"
FT                   /old_locus_tag="ZYRO-ORF4260"
FT                   /product="ZYRO0E00418p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00418g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30710"
FT                   /db_xref="GOA:C5E3U9"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3U9"
FT                   /protein_id="CAR30710.1"
FT                   /translation="MEGIKRHFDKWKITNRFGYTAMWKNSDLESEADLVSLSKREGDKE
FT                   NFEAKDLDEVSSTLDDDGKAYGEQYRTCSWLHTTGLILSEYIVLAIMSFPWSYSVLGLF
FT                   PGLLLTVFVALTTLYTGLIIAEFCEKFPHLRNICDIGQVLFGGYRWAWYATAICFLLNN
FT                   ALIQGLHVLVGAKYLNTITNHSVCTVGFAGITAIISLVFSLPRKFISMSFLGYFATITM
FT                   FVSVILAMVFAGVQSHPYGYDGTPVVYKAFPVKGTTYVSGMGAFLNIIYTFVGQVTYPQ
FT                   FIAEMKNPKDFKKVLWVVCISQIVLYGLVGSIVYVYVGEKYMSAPAYGSLIRAFKIISF
FT                   SFCVPTIVYAGALYANVSAKFLFFTFFENKPGYVYSYSLKSWLVWFVILVVLWAVAFVI
FT                   AEVIPFFSDLLSLMSSLFDCWFGFVFWGLAYIRLRKHEYGEAFSFRNLTFKQKINFILS
FT                   YCLIGIGLYILGPGLYASVQSIINSYKADLYGTVFSCASNGI"
FT   gene            <28214..>29269
FT                   /locus_tag="ZYRO0E00440g"
FT                   /old_locus_tag="ZYRO-ORF4257"
FT   CDS_pept        28214..29269
FT                   /locus_tag="ZYRO0E00440g"
FT                   /old_locus_tag="ZYRO-ORF4257"
FT                   /product="ZYRO0E00440p"
FT                   /note="weakly similar to uniprot|P38723 Saccharomyces
FT                   cerevisiae YHL048W COS8 Nuclear membrane protein member of
FT                   a family of conserved often subtelomerically-encoded
FT                   proteins regulation suggests a potential role in the
FT                   unfolded protein response"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00440g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30711"
FT                   /db_xref="GOA:C5E3V0"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3V0"
FT                   /protein_id="CAR30711.1"
FT                   /translation="MTTTGIYRSSKHKPKLNVEMPTGHGEGDPILPVYSFRNSFTWTLH
FT                   EASRNSPLIFALPFLLGIALASFGRKEAICLIVIGLLIIILADWPPLHKNYVLSQNKEL
FT                   FSTIVLAVDPGVEATKWREAASKMNTALYEQGFWKTLNFFFNEKECRDGFREHVLKLLP
FT                   SSEASKRYQQAISKLFMSFLEDVPSEFDILPRYRFYEYFSNKCFMFGVLMLAISSAIGI
FT                   PDEAKRTMYSIYAYGTVKYLYGAIQGKQFSFLDVVPRVKFLATIMHFAPGSDISKCDEI
FT                   AGHMNYYLSSKKDWDIPRGCFNEGKDCLNFYKTAFEPLINRNKRGGYLELEDIVLETNK
FT                   LCGKNTTKIIE"
FT   gene            complement(<29301..>30023)
FT                   /locus_tag="ZYRO0E00462g"
FT                   /old_locus_tag="ZYRO-ORF4256"
FT   CDS_pept        complement(29301..30023)
FT                   /locus_tag="ZYRO0E00462g"
FT                   /old_locus_tag="ZYRO-ORF4256"
FT                   /product="ZYRO0E00462p"
FT                   /note="similar to uniprot|P36087 Saccharomyces cerevisiae
FT                   YKL070W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00462g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30712"
FT                   /db_xref="GOA:C5E3V1"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3V1"
FT                   /protein_id="CAR30712.1"
FT                   /translation="MYIPKQYNVDDIEKQVQIIKDYPLGTLFSSRPVSKGLFGFGKGDE
FT                   SEQPDSDMCASHIPFFFVESPEGKHKLIAHLSAKNQHANQLENTSKCLVTFQSVDSYIS
FT                   PSWYPLKEKTHKFVPTWDFAAVHVYGTPKIIRGDKEWLLKMLNLLTNQEEGKRPEGEEF
FT                   KAKWKVSDAPESFLDGKLKGIIGLEIDITHMESKFKFDQDSSQINVDGVISNLENEVGG
FT                   DKGGDMAKFTKECYPDRK"
FT   gene            <30607..>31947
FT                   /locus_tag="ZYRO0E00484g"
FT                   /old_locus_tag="ZYRO-ORF4254"
FT   CDS_pept        30607..31947
FT                   /locus_tag="ZYRO0E00484g"
FT                   /old_locus_tag="ZYRO-ORF4254"
FT                   /product="ZYRO0E00484p"
FT                   /note="similar to uniprot|P18544 Saccharomyces cerevisiae
FT                   YOL140W ARG8"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00484g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30713"
FT                   /db_xref="GOA:C5E3V2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3V2"
FT                   /protein_id="CAR30713.1"
FT                   /translation="MQQNCIQMNDSLELYKNYPQKNLQENCKNLLGYGPNFVPAVITRA
FT                   KGSFIYAGDEKILDFTSGQMSTLLGHGQPEVSETIARHAYQLDHLYSGMLSPPVLELAE
FT                   KLTGLLPGGLERAMFLSTGSEANEAAIKLAKTYTGKFEIVGLSLSWHGMTGASNATTYQ
FT                   DGRKNQGPMIPGNLVLPAPNTYRSIFRKPDGSYDWETEMDYGFGLIDAASVGSLAAVIV
FT                   EPVLSSGGMLVLPDGYLKRLKMHCERRGMLLIVDEAQTAFGRCGALFGFEAHGVVPDIL
FT                   SLSKTLGNGIPLSAVVTSNKIADKTASEHFLFYTTHVNDPLPCAVGSKVIDIVIRDNLV
FT                   QNSTNMGDLFRSEIALLQKKYDQIGDIRGRGLMTGVEIIDPKTKEADVKLAGQLADKMM
FT                   ELGLSANLIRVPAFGGVFRIAPPITISREEIMLGASIFAQSFKEVLG"
FT   gene            complement(<32250..>32349)
FT                   /locus_tag="ZYRO0E00506r"
FT                   /old_locus_tag="Zyro0E.tSer_GCT_31"
FT   tRNA            complement(join(32250..32294,32313..32349))
FT                   /locus_tag="ZYRO0E00506r"
FT                   /old_locus_tag="Zyro0E.tSer_GCT_31"
FT                   /note="tRNA-Ser (GCT) cove"
FT   gene            complement(<32878..>33987)
FT                   /locus_tag="ZYRO0E00528g"
FT                   /old_locus_tag="ZYRO-ORF4252"
FT   CDS_pept        complement(32878..33987)
FT                   /locus_tag="ZYRO0E00528g"
FT                   /old_locus_tag="ZYRO-ORF4252"
FT                   /product="ZYRO0E00528p"
FT                   /note="highly similar to gnl|GLV|KLLA0B03564g Kluyveromyces
FT                   lactis KLLA0B03564g and similar to YPR191W uniprot|P07257
FT                   Saccharomyces cerevisiae YPR191W QCR2 40 kDa ubiquinol
FT                   cytochrome-c reductase core protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00528g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30714"
FT                   /db_xref="GOA:C5E3V3"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3V3"
FT                   /protein_id="CAR30714.1"
FT                   /translation="MLSSATRLQFAKQAARRYTVSATDGAGKVSSLAVKVHGGSRYATK
FT                   DGISHLLSRFNFHNTSGKSALRLVRESELLGGGFESKVDREFITLSATFLKEDLPYYVN
FT                   ALGNVLYKTSFRPYELPESVLPAAKHDLELHNICPVRRAEDLLYNITYRRGLGNPVHYD
FT                   GVEKVTLDDIKEFASKVYTKENIDIVGEGVNESDLKKFVADSLLNSLPSGTSLVSTATP
FT                   KTSINKENRARHAGQSAAAIAIPVSKQDFAQYEALARYLTSPLSQLAPSIFKAKLDKQS
FT                   TTGLFVLSVKGADADTVSANIKNVVSQLKQGVNLSSAKDYVSLQYAIEADTVVSPTPLN
FT                   FDSIKNFKLGDFNYVAVGDVSKLPYADEL"
FT   gene            complement(<34682..>35206)
FT                   /locus_tag="ZYRO0E00550g"
FT                   /old_locus_tag="ZYRO-ORF4251"
FT   CDS_pept        complement(34682..35206)
FT                   /locus_tag="ZYRO0E00550g"
FT                   /old_locus_tag="ZYRO-ORF4251"
FT                   /product="ZYRO0E00550p"
FT                   /note="highly similar to uniprot|P30902 Saccharomyces
FT                   cerevisiae YKL016C ATP7 Subunit d of the stator stalk of
FT                   mitochondrial F1F0 ATP synthase which is a large
FT                   evolutionarily conserved enzyme complex required for ATP
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00550g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30715"
FT                   /db_xref="GOA:C5E3V4"
FT                   /db_xref="InterPro:IPR008689"
FT                   /db_xref="InterPro:IPR036228"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3V4"
FT                   /protein_id="CAR30715.1"
FT                   /translation="MSLAKPAASKLDWAKVISTLKLTGKTATELSGFKKRNDEARRVLF
FT                   ELQAQPVDVDFSHYRSVLKNRAVVDQIEQSVKAFKPVTVDASKQLSTIEAFEAQALNNA
FT                   KETETLVAKELKDLQETLKNIESARPFDDLTVDDLAKVRPEIDAKVEEMVKKGKWDVPG
FT                   YKEKFGDLTVM"
FT   gene            <35940..>38456
FT                   /locus_tag="ZYRO0E00572g"
FT                   /old_locus_tag="ZYRO-ORF4248"
FT   CDS_pept        35940..38456
FT                   /locus_tag="ZYRO0E00572g"
FT                   /old_locus_tag="ZYRO-ORF4248"
FT                   /product="ZYRO0E00572p"
FT                   /note="similar to uniprot|P25502 Saccharomyces cerevisiae
FT                   YKL015W PUT3 Positive regulator of PUT (proline
FT                   utilization) genes zinc-finger transcription factor of the
FT                   Zn(2)-Cys(6) binuclear cluster domain type"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00572g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30716"
FT                   /db_xref="GOA:C5E3V5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3V5"
FT                   /protein_id="CAR30716.1"
FT                   /translation="MQREYLGEEIGEKYDTGDEDTPSSSGSAGYVRKPPRRSTLACVRC
FT                   RRKHVKCPGGDPCSKCSAARIACEYLEPNKKLTVSMKYLQQLQENLADLKRENVKLQSI
FT                   VNTVNSDVTESKIKERATTNGDETAIDASSYKEVPLDEGHGAYDIEKETTDDVDPPVSG
FT                   DEMELVSNFAQRSGRLVESRTGQRYFVGSSSMTLFGLEIQSLLSKYLSHKGGNEDENTL
FT                   PNNEDYNENPLLQGPQSNLDQIDVLQEEGNAYKIVLNKNEGNDDISVNFTLPSYSYAIF
FT                   LVDTFITYNDGCFYFFNEGMVKHGLKIAYEGGAFYNDRTLQTIWFCKVLLIFAIGEMYL
FT                   GTSNNVNGNKIKDTAKLPGSGFFEEASQIFSCLFSSGRIESVTKEGGIEVMLLYAFYLQ
FT                   VADCTVASYFYFGQALRACLISGMHVDAQRDNLTRFELEHRRRLWWTVYMFERMLSSKA
FT                   GLPLSFTDNTISTELPGDFDMSKPPPGCEHYIFPEAEYIINCVKIVRINAQILNKLYQR
FT                   QPNTNILAALKSVVKQLLQWRNNLPSFLQVDFTEKHLKISRLCANLFTEYFQGMNLAIR
FT                   PLLFHFASVQLKKFRGSNTYINLQNYSSTISALLNCSLQASVNTIRSLWALMDQNMVAL
FT                   FGYMDREYLFTASCTLVLFNAAFGIHEQTYEHLDHALNIFTKMRNLGNNPAGLRRSQLL
FT                   TLMANFDFHGIMKDMICAHNDSLKPDTQYDAHNFRNVNIVSQTMTDSASLSDIINATLA
FT                   KSSQINLTKKETQIIEKNSNQFDPLNTADDGELQVLLDKMTKVSQTDNKLWKEISDQAM
FT                   WLGSAMDPAIAPGNEMDFGQGKGSNF"
FT   gene            complement(<38569..>43626)
FT                   /locus_tag="ZYRO0E00594g"
FT                   /old_locus_tag="ZYRO-ORF4247"
FT   CDS_pept        complement(38569..43626)
FT                   /locus_tag="ZYRO0E00594g"
FT                   /old_locus_tag="ZYRO-ORF4247"
FT                   /product="ZYRO0E00594p"
FT                   /note="similar to uniprot|P34241 Saccharomyces cerevisiae
FT                   YKL014C URB1 Nucleolar protein required for the normal
FT                   accumulation of 25S and 5.8S rRNAs associated with the
FT                   27SA2 pre-ribosomal particle proposed to be involved in the
FT                   biogenesis of the 60S ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00594g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30717"
FT                   /db_xref="GOA:C5E3V6"
FT                   /db_xref="InterPro:IPR021714"
FT                   /db_xref="InterPro:IPR032436"
FT                   /db_xref="InterPro:IPR039844"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3V6"
FT                   /protein_id="CAR30717.1"
FT                   /translation="MKSQDIPLVDHEKSAGRNKYKQSGNVDDEVLVNLSNLVHSLENED
FT                   DSKDFGPLLEFFHKNYISQAVQSWSYYAQVNNHAKLTESTILLTRTLVVLRSNANALEY
FT                   GGILIKLILDNYMKVLYRSLNNIKASLTIPTIHLMKEMIDFNSGQYIEEFTSSFDFSLR
FT                   SLPKILTVNKNDISSFNPTNKNHRLHIRFEFIRFWLSLISHCTPLLRRDLVIQNSKIMG
FT                   AWFKQMDKADTAELMEETVEVLCTKFVQEKAFKKMTKTQILNELALSKIYSYFYSSNKS
FT                   LVKKVNEFFIAYGADPESSVAFPDNLPWYQESPFNTSLKGVPVTVNQKDFRIHNKLLFN
FT                   ALKNFKPWESDMQASTVLKILDHVPELVPPYCHYLASHGTHDPKMTSYWFGCTMLLGRI
FT                   INLKIPTSMANIQSETAPSLDLVIQAILPAPLTKISLTKALQHEKMIITQLACQLLVFS
FT                   FQKLSKVLKLYESKGWGSASAPLRNSFYQSIPDLTIITSVMNQSYLTAKNNKVMQLSLT
FT                   LLLKYYSTTFPNFFSINMPSSNIYMDIMRKDEFSGIDLAIVDNFLQFQELNGTQTKWWN
FT                   APAGQNSLFTSLLKMASSKNSTNAVASKISQLLQHMFHGTVAFNEVLCSPLWILIYSLQ
FT                   VLSFEDHKNDEVNKIWKLLDETISRCMKMPYRYVDSSKDYEKISPFLVVLCDQWKFIDG
FT                   QGSLESAAKWICILLRTFIICGESAEGIRRLAESFVGVPKEYLDIYLTFENYETKTKKL
FT                   CSDESFKLANFQGASFFQHITITPYSKLTKVVRYPVNELDAVGLIWRLQNLVRDRAITF
FT                   NGMFKEVTDTLLAKLANFSNSNVSFRLISPEVIKNLLPVSGYLDNENMKSYFASQALFQ
FT                   LYHESNLNNPAFEQFIFAWLKDHMDILQSDEPNAMMFASAICTCLQTIHAPTILENYKQ
FT                   INPQSLDIILQKVWEIPNQKVSFKIFEYAMKVPSSNLDQLLAKFIAEDKIIDFQPENFV
FT                   AQSLEKFPIAFETFARSKWFDFDLLLSYLPRIQGTEVALVAALSLPESNDSRLQEFLQN
FT                   VINDCCEKLDRQEISSGALKLFCSRPEMLTKNQQLSAVRHITTNYHEKYSSEVIKFVRS
FT                   VNNYDDPNVIAWLNKTILYGTKYFSNATELSPDFSLYLSELEKLTASVNIWSKVNHTYL
FT                   QAQHEVILTGFWVNNSRVLQYMIHLLMNGKGKDVQCTRMLQGILNNEKNALKVENNDNF
FT                   LRFVTAATIFTLFMMDPQQNSTNIVQSKLIELYGGTMSCEDRMILKIIGEIETITSSSW
FT                   INESCSLELLEEENETAGEYGSRKIVALEREGTFITLDKNTILNTVNNFPLNRPIIPGQ
FT                   FNWEALFSFYSDNTVYLSNTVGAIYDPEFLMLMSLQSGAGLVTSSTAEDGSTTYKFEIQ
FT                   RYLMSDIFQIILLSLAESGDLQKISLRIIYGMLSSLEEDSQFKYGHIIAVLLKKIVFSF
FT                   EKAKLEDKPFRIASCIWFAISRLSGLLVNPGSLLHETAFRWVLNSPFIMPNDFPLLQDL
FT                   TTPNEKFRGYENFYRQLAWVLECLDLGTKTDEDVHFMKQRSILEWLSNLKNLPYLNARL
FT                   YTMIDSIFYKVQRLEDGGSTLLTRFASASTLELQDLFLQQQLKRNASSIAKNKNDKRLI
FT                   RNKLVLETHRVNTSEILLGHTEIMNSQKRVRLWAEDDQENISKRIKN"
FT   gene            <43920..>44621
FT                   /locus_tag="ZYRO0E00616g"
FT                   /old_locus_tag="ZYRO-ORF4245"
FT   CDS_pept        43920..44621
FT                   /locus_tag="ZYRO0E00616g"
FT                   /old_locus_tag="ZYRO-ORF4245"
FT                   /product="ZYRO0E00616p"
FT                   /note="similar to uniprot|P40576 Saccharomyces cerevisiae
FT                   YIR024C (putative) involved in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00616g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30718"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3V7"
FT                   /protein_id="CAR30718.1"
FT                   /translation="MFARFTRPLQKVAAARFYSQVSASATSKQANSKFDKSIIKPILVV
FT                   IVFGTMLSHVMNQQRLAGEMERRYVLKMEILKDLIERARKGEINIDVQEELKLVNKLFE
FT                   RNKEARFLNDKEAEKLSQISSSQNYSEAEVLQSMNNSTRALEKESLDDLLKSIMDEVSD
FT                   EPKSSARKSNPKPKQQQSGEFITDRDTLREKAEYERELLQYKPSTDVHLIVENPGELSS
FT                   AAGDTKVSKFL"
FT   gene            complement(<44716..>48036)
FT                   /locus_tag="ZYRO0E00638g"
FT                   /old_locus_tag="ZYRO-ORF4244"
FT   CDS_pept        complement(44716..48036)
FT                   /locus_tag="ZYRO0E00638g"
FT                   /old_locus_tag="ZYRO-ORF4244"
FT                   /product="ZYRO0E00638p"
FT                   /note="similar to gnl|GLV|CAGL0F06743g Candida glabrata
FT                   CAGL0F06743g and similar to YIR023W uniprot|P21657
FT                   Saccharomyces cerevisiae YIR023W DAL81 Positive regulator
FT                   of genes in multiple nitrogen degradation pathways contains
FT                   DNA binding domain but does not appear to bind the
FT                   dodecanucleotide sequence present in the promoter region of
FT                   many genes involved in allantoin catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00638g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30719"
FT                   /db_xref="GOA:C5E3V8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3V8"
FT                   /protein_id="CAR30719.1"
FT                   /translation="MSSGTDRQKESDDMSGDKNQNLYDKSNGNHEMLSFNDNYAMILQK
FT                   LANDNSHLLTQDLNLNSMGVGPSTSDNNNDNSNNSNNGNSANFPSTRPSDIGNSGNGGD
FT                   RQNLDALLQHYQSLLTRSASQYPESSAGASVGENNNNINNRNNCSNNTVENNVSGNSVK
FT                   NSEADTSGKVDSNNNTSTNNNNNGNNNSHNTTTSNNAHNSNNKSMITERPCDHCRRRQT
FT                   KCVLVPDLADCVQCETKGIKCTFSDLPNNVNKFMGVADTMNPNGKHQRQDNGVDLEGLL
FT                   KRAKINNNDNVAQYYAELLQNLHESMNNNNNNNNNGSSSIHASAASSAPTPTTMHNNGF
FT                   VNMLQQGQQQQQPPVSLPPQQQPPPFPSQPSGQYPRSSLYVGPTSSYDLNLINHIKLDN
FT                   IDQIQLLPSVSLRKVAPDVLFVLRDNFNEQAFLKQEQEVDMVERLVYPHGKVLIDIFFK
FT                   LIHPCFPILHERVFLEKYSRSYRELTAPLLASIYSLSIQWWDFHPKLIGFAKPDVVEQL
FT                   NEIAYRTFFQMIERPKLSIVQTGLLMLQCRSEYPNNWVLCSALVALCEELGLGIDCQDW
FT                   RLPRWERGLRRRLAWAVWTQEKWTALVESRNSHLILGRNWMVKLLTEEDFPQNSPVISG
FT                   SQDTTSRNSMGPENSMGNISLIDMSPTDEDFVSGNLMFQQLVSLTVILGEIMDTFYTEG
FT                   ATKITTRIEQVLKLAKPLQLKLREWYHSLPPQLSMNKFVPRKFNPNATLTLAYFAAEIT
FT                   LHRKIISTLKQDTPKELVQVCRTAAKTRLVAAIEFVRDLKSEHINAFWYTCSTGNLMLI
FT                   AIFAALLYVTAQTRDEAVVVRDYLRNYIWILRVGSKSFDKSGHALKSIHVLLSQIPGLL
FT                   TDELPREFVPTRSQSPMYPASQQWKVPPMMTGPSSMDSQQISPNLSQLRSVPTEILQNL
FT                   SGLPGDSPRFPMNRSTAQSSPVNISGDVNGSGGSNTYGSGNESEHSIKASMDQSNSSPK
FT                   DGQLTSKEESVDTEHPSPDPIMNTSSVGGVDRNLIDPSTLTQNPRGKPITPQSVNGNNE
FT                   AKDNAPASNADALDKSTTSGGGSSVSPSSIHGKEDTHNASNEDLNESSPKNLDLENKD"
FT   gene            complement(<48313..>48828)
FT                   /locus_tag="ZYRO0E00660g"
FT                   /old_locus_tag="ZYRO-ORF4242"
FT   CDS_pept        complement(48313..48828)
FT                   /locus_tag="ZYRO0E00660g"
FT                   /old_locus_tag="ZYRO-ORF4242"
FT                   /product="ZYRO0E00660p"
FT                   /note="highly similar to uniprot|P33204 Saccharomyces
FT                   cerevisiae YKL013C ARC19 Subunit of the ARP2/3 complex
FT                   which is required for the motility and integrity of
FT                   cortical actin patches"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00660g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30720"
FT                   /db_xref="GOA:C5E3V9"
FT                   /db_xref="InterPro:IPR008384"
FT                   /db_xref="InterPro:IPR034666"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3V9"
FT                   /protein_id="CAR30720.1"
FT                   /translation="MSQSLRPYLTAVRYSLEAALTLSNFSSQEVERHNRPEVEVPNTSA
FT                   ELLLQPIHISRNENEQVLIESSVNSVRVSIKVKQADEIEQILVHKFTRFLEQRAESFYI
FT                   LRRSPMPGFSISFLITNKHTETMKTGKLVDFIIEFMEEVDKEISEMKLFLNARARFVAE
FT                   AYLDQFVY"
FT   gene            <49836..>51548
FT                   /locus_tag="ZYRO0E00682g"
FT                   /old_locus_tag="ZYRO-ORF4240"
FT   CDS_pept        49836..51548
FT                   /locus_tag="ZYRO0E00682g"
FT                   /old_locus_tag="ZYRO-ORF4240"
FT                   /product="ZYRO0E00682p"
FT                   /note="similar to uniprot|P33203 Saccharomyces cerevisiae
FT                   YKL012W PRP40 U1 snRNP protein involved in splicing
FT                   interacts with the branchpoint-binding protein during the
FT                   formation of the second commitment complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00682g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30721"
FT                   /db_xref="GOA:C5E3W0"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="InterPro:IPR036517"
FT                   /db_xref="InterPro:IPR039726"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3W0"
FT                   /protein_id="CAR30721.1"
FT                   /translation="MSSESLWKEAKDTSGRIYYYNAKTGESKWEKPRELLSEQELILAK
FT                   HGWKSSKTSDGKLYYYNAQTKTSRWELPDLPEFKKEVKKEDTTITPEDKEPAHETADRY
FT                   ANPSQILHTSKKPKEEAAKEFIQMLKDNQVDSIWSFSRIISELGSRDPRYWMVEDDPLY
FT                   RQQLFEEYFTSRSEEQLLKERMETSKFNEAFWKMLKTKPQIQYYTRWSTAKRLIANEPI
FT                   YKHSVVKESAKKQRFLEYVANLREEHEKSQRQLKSQALKELQDYLENILLSSDTGTNGN
FT                   NTDFPLMKWQSLANNYLFEKNKRYMANKHFKILTHEDVLQVYMDIAKKVEKNLEDKLAA
FT                   LQKVNYTKDRVARDGFKELLRSPDIKIRANSKWHDIYPLIKNDPRFLQMLGTSGSSPLD
FT                   LFLDVVEEKSITVAAQRSIAQNVLIEKSFQWDESDVNNSRQTIKGHLRDNEQFTNVDDY
FT                   DMDLIIDQLEQLQGEKQRKQKLLEQRAFEEKKHFFKLMLRRIYGVVKPKPETWEAALKD
FT                   IQHTREYRELTDEYVKRQLFDEFNPEIPHARPRPSVPYNPKKRPLGPDIELDY"
FT   gene            complement(<51585..>52088)
FT                   /locus_tag="ZYRO0E00704g"
FT                   /old_locus_tag="ZYRO-ORF4238"
FT   CDS_pept        complement(51585..52088)
FT                   /locus_tag="ZYRO0E00704g"
FT                   /old_locus_tag="ZYRO-ORF4238"
FT                   /product="ZYRO0E00704p"
FT                   /note="highly similar to uniprot|P15367 Saccharomyces
FT                   cerevisiae YIR022W SEC11 18kDa catalytic subunit of the
FT                   Signal Peptidase Complex (SPC Spc1p Spc2p Spc3p and Sec11p)
FT                   which cleaves the signal sequence of proteins targeted to
FT                   the endoplasmic reticulum"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00704g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30722"
FT                   /db_xref="GOA:C5E3W1"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E3W1"
FT                   /protein_id="CAR30722.1"
FT                   /translation="MNLRLELTRFLKLCFVLSSAFMFWKGLSIATNSHSPIVVVLSGSM
FT                   EPAFQRGDVLFLWNRNERSKVGDVVIYEVQDKSIPIVHRVLREHHNDKNKQLLLTKGDN
FT                   NAGDDIPLYGRKKIYLQKERDIVGTVKGYVPQLGYVTIWISENKYAKLALMGFLGISAL
FT                   LSNE"
FT   gene            complement(<52308..>53504)
FT                   /locus_tag="ZYRO0E00726g"
FT                   /old_locus_tag="ZYRO-ORF4237"
FT   CDS_pept        complement(52308..53504)
FT                   /locus_tag="ZYRO0E00726g"
FT                   /old_locus_tag="ZYRO-ORF4237"
FT                   /product="ZYRO0E00726p"
FT                   /note="weakly similar to uniprot|Q03702 Saccharomyces
FT                   cerevisiae YKL011C CCE1 cruciform cutting endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00726g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30723"
FT                   /db_xref="GOA:C5E3W2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015242"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR039197"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3W2"
FT                   /protein_id="CAR30723.1"
FT                   /translation="MGRASGSRTAVEAIDLYCRKSNGRALKRLGSCMGANIGKNKSEGR
FT                   TSIVDQAEKLEKLRLRKLQDGETSITAIDAGVSNFAYSVFKWYKGDELPTLVDWNKINL
FT                   CQRFLGKHRLKMSLDPMDTWKVGHGLLDMLTSELAISDLYVLEKQRMRSLSSKNVIESV
FT                   LLSNVMEHILFSNLRNKQIHGNLNTDYVVHSSSPQKMAQYWCDLKSLKTLYNRFTQSTG
FT                   LQPQKDLPFNDADNFHAAKTSKTIRINLVKTILKNAIAPQGYKKCNLTPHWRSNVEQQL
FT                   NSQKRFKLLDCIGSGPELGTRKDDDLADSFLHGLAWMHWSKTYEGASEIVMKNGGVFDQ
FT                   EILKDFNDYCMSLNTEWSLMSSQMKGELAELNLANDLETSEEEEYTNSARSRKRESKF"
FT   gene            <53722..>54555
FT                   /locus_tag="ZYRO0E00748g"
FT                   /old_locus_tag="ZYRO-ORF4236"
FT   CDS_pept        53722..54555
FT                   /locus_tag="ZYRO0E00748g"
FT                   /old_locus_tag="ZYRO-ORF4236"
FT                   /product="ZYRO0E00748p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00748g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30724"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3W3"
FT                   /protein_id="CAR30724.1"
FT                   /translation="MSSYGRSKKDHFWRKCYRKLAEVSDDSRRQSVRHHSIRRWKNVQD
FT                   PRHVEKPIAFDYWAALTPKSRSKPFMPTSISKPRPKRTVSGAATAPASGCSYSKDSLSP
FT                   QTYSTAETSIPNNDFEPRPTLDPRSNGSFRSNIKSNRFNKVGEMEPGFCLGFMSDSATG
FT                   ASATSASVYSGGEKSDDSQTSLDSGIFDSRSFESLINSFDWYATNVFKRLETSVLSFLN
FT                   SKEPNEDKSSAMCSTVSPLRSELPDSVLTPCTGAATQWDYAIDEAIYGQHAKCFI"
FT   gene            <54938..>56386
FT                   /locus_tag="ZYRO0E00770g"
FT                   /old_locus_tag="ZYRO-ORF4235"
FT   CDS_pept        54938..56386
FT                   /locus_tag="ZYRO0E00770g"
FT                   /old_locus_tag="ZYRO-ORF4235"
FT                   /product="ZYRO0E00770p"
FT                   /note="similar to gnl|GLV|CAGL0L05302g Candida glabrata
FT                   CAGL0L05302g and some similarites with YKL088W
FT                   uniprot|P36076 Saccharomyces cerevisiae YKL088W Protein
FT                   required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00770g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30725"
FT                   /db_xref="GOA:C5E3W4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3W4"
FT                   /protein_id="CAR30725.1"
FT                   /translation="MVSMDEQGVSRPETKPVSILNSKPSVIRKDNSVKIGNGNANEEKK
FT                   LDSQLEQVKLTDNHEDMRPRPGASKNSSFENGSFIAGTSANGSVDSSPQKQSGGGGGGT
FT                   SAVSFTVSEDQKISQHRYSINSKPAKPTDPSSGGQDTALAAKQDHDSPAAEKSSIVHMP
FT                   GDFIYFDSQASENKAPTPREHPQQHQQQHPKKELIVPNSGPQVPFTEFFQKQDDKKFHI
FT                   LLGATGSVATIKVPQIIDKLFKLYTREKVSIQLIVTKPAEHFLRGLKISTDVKIWREED
FT                   EWSGFKKMGDPVLHHELKRWADIFLVAPLSANTLAKIAYGICDNLLTCVLRDWTPSIPV
FT                   MVAPAMNTFMYINPMTKRHLSILKEDAPYVEVLKPVEKVLICGDIGMGGMREWNDIVEI
FT                   LRRKISEIYRARDEKDVAMQAEEEEEEEEDEDEDDDEDEDEDEQGKKNLEDDEDEDEDE
FT                   DEDDDDDDDDDDEDDEDDDDEVAQ"
FT   gene            <56602..>56886
FT                   /locus_tag="ZYRO0E00792g"
FT                   /old_locus_tag="ZYRO-ORF4231"
FT   CDS_pept        56602..56886
FT                   /locus_tag="ZYRO0E00792g"
FT                   /old_locus_tag="ZYRO-ORF4231"
FT                   /product="ZYRO0E00792p"
FT                   /note="similar to uniprot|P87108 Saccharomyces cerevisiae
FT                   YHR005C-A MRS11 Essential protein of the mitochondrial
FT                   intermembrane space forms a complex with Tim9p (TIM10
FT                   complex) that mediates insertion of hydrophobic proteins at
FT                   the inner membrane has homology to Mrs5p which is also
FT                   involved in this process"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00792g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30726"
FT                   /db_xref="GOA:C5E3W5"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR027100"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3W5"
FT                   /protein_id="CAR30726.1"
FT                   /translation="MSFLGFGGGGQSQVSSQQKVQAAEAELDLVTDMFNKLVDNCHKKC
FT                   ISSSYSEGDLNKNESNCLDRCVAKYFETNIKVGENMQQIGQNFQAAGRL"
FT   gene            complement(<56974..>57702)
FT                   /locus_tag="ZYRO0E00814g"
FT                   /old_locus_tag="ZYRO-ORF4230"
FT   CDS_pept        complement(56974..57702)
FT                   /locus_tag="ZYRO0E00814g"
FT                   /old_locus_tag="ZYRO-ORF4230"
FT                   /product="ZYRO0E00814p"
FT                   /note="similar to uniprot|Q00873 Saccharomyces cerevisiae
FT                   YKL087C CYT2 Cytochrome c1 heme lyase involved in
FT                   maturation of cytochrome c1 which is a subunit of the
FT                   mitochondrial ubiquinol-cytochrome-c reductase links heme
FT                   covalently to apocytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00814g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30727"
FT                   /db_xref="GOA:C5E3W6"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3W6"
FT                   /protein_id="CAR30727.1"
FT                   /translation="MSSSPIDESNDSKCPVDHNSREVWLKHAAMKQQQQEQEQQQESKC
FT                   PVDHESREVWLSQAKQDVECSSEQLAATPEYHTNVALPENRQISSIPRTGSEANWIYPS
FT                   QKQFYEAMLRKNWDPHAQDMQTVVPLHNSVNERVWNYIKFWEKDQGGESCGGIQLTSFK
FT                   GDSKKLTPRAWLRSQFLGFSKPFDRHDWSINRCGKSIDYVIDFYSDDDQEKGPQIYLDV
FT                   RPKLNSVEGIRLRMLKSLGF"
FT   gene            <58372..>59811
FT                   /locus_tag="ZYRO0E00836g"
FT                   /old_locus_tag="ZYRO-ORF4229"
FT   CDS_pept        58372..59811
FT                   /locus_tag="ZYRO0E00836g"
FT                   /old_locus_tag="ZYRO-ORF4229"
FT                   /product="ZYRO0E00836p"
FT                   /note="highly similar to uniprot|P08539 Saccharomyces
FT                   cerevisiae YHR005C GPA1 GTP-binding alpha subunit of the
FT                   heterotrimeric G protein that couples to pheromone
FT                   receptors negatively regulates the mating pathway by
FT                   sequestering G(beta)gamma and by triggering an adaptive
FT                   response activates the pathway via Scp160p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30728"
FT                   /db_xref="GOA:C5E3W7"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR002975"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3W7"
FT                   /protein_id="CAR30728.1"
FT                   /translation="MGCTASTHVFENYGEDDPFLQSQKANDAIEQSLQLGKQNDKNETK
FT                   LLLLGAGESGKSTVLKQLKLLHKGGFTHQERLQYSQVIWADAIQSMKILVIQARKMEIP
FT                   LDCDDPINKRPLFECKRILLKAKALDHIDAGMAGGSDFLNDYVLKYSERHETKRKVQST
FT                   GQARAFDEDENSWLHENKDRAMSGQTIIDDEDGVAQDGKLDLQQILQDLDEDSSNDNMF
FT                   LKERLQQQWQEQQLRQQQHISNQDIAHAIDQLWKNDRGIKQCFARSNEFQLEGSAPYYF
FT                   DSIMKFADPQYVCTDEDILRGRVKTTGITESDFTIGSSKFKVLDAGGQRSERKKWIHCF
FT                   EGITAVLFVLAMSEYDQMLFEDERVNRMHESIMLFDALLNSKWFRDTPFILFLNKMDIF
FT                   EEKVKRMPIRKFFPDYQGRVGNSEAGVKYFENLFLSLNRSNNKPIYVKRTCATDTQNMK
FT                   FVLTAVTDLITQQNLKRSGII"
FT   gene            <60005..>60388
FT                   /locus_tag="ZYRO0E00858g"
FT                   /old_locus_tag="ZYRO-ORF4228"
FT   CDS_pept        60005..60388
FT                   /locus_tag="ZYRO0E00858g"
FT                   /old_locus_tag="ZYRO-ORF4228"
FT                   /product="ZYRO0E00858p"
FT                   /note="similar to uniprot|P36077 Saccharomyces cerevisiae
FT                   YKL086W SRX1 Sulfiredoxin contributes to oxidative stress
FT                   resistance by reducing cysteine-sulfinic acid groups in the
FT                   peroxiredoxins Tsa1p and Ahp1p that are formed upon
FT                   exposure to oxidants conserved in higher eukaryotes"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00858g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30729"
FT                   /db_xref="GOA:C5E3W8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR016692"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3W8"
FT                   /protein_id="CAR30729.1"
FT                   /translation="MSLQTSNLNRIVEIPLSQIRRPIAPVLDFGKIDAMVSTMEGKPMA
FT                   SATCSLEQAEDFKGQLPPVDVLCIRENGQTYYFAFGGCHRFQAYDRKAASEQSDVLVRA
FT                   KLVPATRHQLKLYVGSSVDEMFR"
FT   gene            <60873..>61871
FT                   /locus_tag="ZYRO0E00880g"
FT                   /old_locus_tag="ZYRO-ORF4226"
FT   CDS_pept        60873..61871
FT                   /locus_tag="ZYRO0E00880g"
FT                   /old_locus_tag="ZYRO-ORF4226"
FT                   /product="ZYRO0E00880p"
FT                   /note="highly similar to gnl|GLV|CAGL0L05236g Candida
FT                   glabrata CAGL0L05236g and similar to YKL085W uniprot|P17505
FT                   Saccharomyces cerevisiae YKL085W MDH1 Mitochondrial malate
FT                   dehydrogenase catalyzes interconversion of malate and
FT                   oxaloacetate involved in the tricarboxylic acid (TCA)
FT                   cycle"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00880g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30730"
FT                   /db_xref="GOA:C5E3W9"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3W9"
FT                   /protein_id="CAR30730.1"
FT                   /translation="MFTRVARRAFTTTRVNPYKVTVLGAGGGIGQPLSLLLKLNHKVTD
FT                   LRLYDLKGAPGVAADLSHIPTNSKVSGFAPDNNGLSQALSNTDVVLIPAGVPRKPGMTR
FT                   DDLFSINASIVRDLASAAGEAAPNAKILVISNPVNSTVPIVAESLKKKGVYSPNRLFGV
FT                   TTLDSIRASRFISEVQGTNPTQEHVNVVGGHSGITILPLISQTKYSNMDKATKDALIHR
FT                   IQFGGDEVVKAKDGAGSATLSMAQAGAVFANAVLSGLAGERDVVANSFVDSPLYKSEGI
FT                   DFFSSPITLGPEGVTKIHPIGEISSEEAELLAKAKETLKKNIEKGVQFVNN"
FT   gene            <62013..>62324
FT                   /locus_tag="ZYRO0E00902g"
FT                   /old_locus_tag="ZYRO-ORF4223"
FT   CDS_pept        62013..62324
FT                   /locus_tag="ZYRO0E00902g"
FT                   /old_locus_tag="ZYRO-ORF4223"
FT                   /product="ZYRO0E00902p"
FT                   /note="similar to uniprot|P36078 Saccharomyces cerevisiae
FT                   YKL084W HOT13 Mitochondrial intermembrane space protein
FT                   first component of a pathway mediating assembly of small
FT                   TIM (Translocase of the Inner Membrane) complexes which
FT                   escort hydrophobic inner membrane proteins en route to the
FT                   TIM22 complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00902g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30731"
FT                   /db_xref="GOA:C5E3X0"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3X0"
FT                   /protein_id="CAR30731.1"
FT                   /translation="MSIRGLLVDDQSRCEHWHLPLDVIALRFRCCDEYYACYSCHQQCT
FT                   NHEVEKYSLENSQSSPLIMCGICKLQMSFEQYRQLECPRCHSPFNPGCKLHYHLYFDP"
FT   gene            complement(<62334..>63560)
FT                   /locus_tag="ZYRO0E00924g"
FT                   /old_locus_tag="ZYRO-ORF4222"
FT   CDS_pept        complement(62334..63560)
FT                   /locus_tag="ZYRO0E00924g"
FT                   /old_locus_tag="ZYRO-ORF4222"
FT                   /product="ZYRO0E00924p"
FT                   /note="similar to uniprot|Q04749 Saccharomyces cerevisiae
FT                   YMR068W AVO2 Component of a complex containing the Tor2p
FT                   kinase and other proteins which may have a role in
FT                   regulation of cell growth"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00924g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30732"
FT                   /db_xref="GOA:C5E3X1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3X1"
FT                   /protein_id="CAR30732.1"
FT                   /translation="MLVDPSVRLRDAIIEGNLLVVKRLLKRFPELLTNIDPTNGWSSLH
FT                   YASYYGRYLVCVYLIQCGHDKQEVHTTFKGNTCAHLSLMNGHEQTTHLLLQYFPQLIDW
FT                   RGHEGKTPVHIACQHDYFQCFNLLMGVGANLTIKDDYGDTPLHVCLEYGSINCMKMLIL
FT                   QGGIVDDHVKNKKGWKPSDVASTYETTKLYTKVLKEAQMPGNVTKPNFGSYRTPTQSSR
FT                   AVFDDGPSPILALNSPYSLYSQNGAGGSGGSAIGSGFPHLPRISTSRRPSLATSSKSPV
FT                   GNIASRFASKESSLSNSSSSLQGRDTLNSSMDKQTRSSAEISPSKRDNRRSSGSGGRTS
FT                   SGSHTLTNSHGNTADLVNKYLMTENHENRIAGHGEEVSESTPTSPKGIRGRVSLLNIPI
FT                   AKLRSHDSD"
FT   gene            <63743..>64987
FT                   /locus_tag="ZYRO0E00946g"
FT                   /old_locus_tag="ZYRO-ORF4220"
FT   CDS_pept        63743..64987
FT                   /locus_tag="ZYRO0E00946g"
FT                   /old_locus_tag="ZYRO-ORF4220"
FT                   /product="ZYRO0E00946p"
FT                   /note="similar to uniprot|P54730 Saccharomyces cerevisiae
FT                   YMR067C UBX4 UBX (ubiquitin regulatory X) domain-
FT                   containing protein that interacts with Cdc48p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30733"
FT                   /db_xref="GOA:C5E3X2"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR021569"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3X2"
FT                   /protein_id="CAR30733.1"
FT                   /translation="MSTVTVSYNFSQFRVKVTPSMVLNDVLSQSLQHFRLLQEGGSGKW
FT                   GLTHNDKPVELDLPWRLMNLPTGVKLELKPLSDDGGDKIIKVRVQAPGYSAKVESVSIN
FT                   ANLRTFLQQLSESANWPIQDPGAKLQFFTKTIPISELNDQTLKSLGIMESLSIRLIFPS
FT                   STTTDASASMPIPAGTTPAREQEDTHRKVESRKIHQLHQVSAYIPSEKTIASQLNIQEE
FT                   NDDPELTVAHARRYQQMVLRQTGGLGGPMVPRRIKEQQEAAAARRKLVEECLVRVRFPD
FT                   RTHIEVAFKNDDTMSTIYQIISSSLLNEQLQFKLYQSHPHVELPPSDQKLVEDLEFGSK
FT                   TLLLFESNGKGPFLKGSILKDAKDLADAEDVKLDRSDKVETNDQAEKQDLEPAQPEPKK
FT                   STPGKYPKWLKLSKK"
FT   gene            complement(<64996..>67635)
FT                   /locus_tag="ZYRO0E00968g"
FT                   /old_locus_tag="ZYRO-ORF4219"
FT   CDS_pept        complement(64996..67635)
FT                   /locus_tag="ZYRO0E00968g"
FT                   /old_locus_tag="ZYRO-ORF4219"
FT                   /product="ZYRO0E00968p"
FT                   /note="similar to uniprot|Q04748 Saccharomyces cerevisiae
FT                   YMR066W SOV1 Synthesis Of Var (putative) involved in
FT                   respiration"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00968g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30734"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3X3"
FT                   /protein_id="CAR30734.1"
FT                   /translation="MFRFTSTLRNVVRIQARFYRRRRLPTGTHIPALQQNGLLRDAGEI
FT                   SLKAKDSHETEENLKKMGFEEWNSNKYMEELILQYLKHANSGVRQSAKNLSNLSKELKT
FT                   DTLGPNERLQILFDYLLKECEIEIKMLNQLGPDQLKKSKEVKDKPSDLPIETPEQLEDA
FT                   VFSDLFDSAENSQNYLNHTDLVYQILTDLNDRKSQGLSVLTLEQLVQVFELAKLIGIEG
FT                   RRKRGIFLAGNLLYSLGTVRMDPVNESFYIDSLVNYGFYKRAFELFESNRVKVDERWWY
FT                   ELGMMVALRANYLNKFDKLFIATDLRFGMYPYVSTQVLRLAVRRKLLIGDIKSANRLTD
FT                   RFLEMVSVYGCKRFDEAPGNDGKQMINFTTEDQADEFLNEMTPPSDYDFITLIEYHLFR
FT                   KNIHTAMKLVAKYLETDGITDENYRFLIVQLKFNLLQSFEQLRNSLGPHLNPTTVQEKL
FT                   DELQKSFDEVRKEHDIDISFSQELLFNNVASLASFPELTKVMEDFVRKRATADEDLSPS
FT                   KKFHALLKILLATGKEKEAFFLLFKMEEALLKSRNSPELEGAQFYPEVQPHHYAVFVEY
FT                   FTLSKDRFPKSMHSDLEKKVQRIVERMENHGVPYNSVLLAKLLIFYRDFNNFNKCFEII
FT                   NQVMKEKLVKQLVTDSGHTRFYNRRDVTRPLYVEMWRAYGKYYKIFNKELERVEKKSNY
FT                   SGWKTQVAKIIKRTRVHPEFPVRTLFTAMIQLDNVLPDTKMYYMILTTLMRSRDWAIVP
FT                   GVLCTMTELHGFPLETQFIVYVTKGLEKELLVVISKKHQADGKSVEESNAQAMAKVKEL
FT                   KLRGLILTPRMDHQYSVDDLLPQILMLLKFKNPQDIQFNDVYGAMNELKIEKDNLSELI
FT                   NRVNSEIL"
FT   gene            complement(<67851..>69179)
FT                   /locus_tag="ZYRO0E00990g"
FT                   /old_locus_tag="ZYRO-ORF4218"
FT   CDS_pept        complement(67851..69179)
FT                   /locus_tag="ZYRO0E00990g"
FT                   /old_locus_tag="ZYRO-ORF4218"
FT                   /product="ZYRO0E00990p"
FT                   /note="similar to uniprot|P36080 Saccharomyces cerevisiae
FT                   YKL082C RRP14 Required for normal pre-rRNA Processing
FT                   Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E00990g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30735"
FT                   /db_xref="GOA:C5E3X4"
FT                   /db_xref="InterPro:IPR007019"
FT                   /db_xref="InterPro:IPR029188"
FT                   /db_xref="InterPro:IPR029190"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3X4"
FT                   /protein_id="CAR30735.1"
FT                   /translation="MANLLEERLRSNSNAFEGLLSLIPAKYYYDDQTQEQWKAKKKSKT
FT                   QSKEDKQKKLDPEQQGENSLSTLEVMKEREKDAKPVVLPGEKLKKLKDEEKEREQEVKE
FT                   DEPSEEIDGTEDIDVVFDDEGNEINLKEDEEEEEEEEHQEEPEEPEKSPAVEEESEEEH
FT                   KEGSVEQENKESQKSQNKPNLEALRSKLQAKIQDMKERRRAPGTRVRGAPSSREAIIEE
FT                   RKQRLDLRKQKNDSQKQQNNKSGDESESDEDDSDIETQPPTKKAKIEVDANDIMYQNIE
FT                   FDDGNKITSNLQHLKRGPKKKGPAKNDIRAHLKLLEAKKAKLESKEEMDQINAKEKEKW
FT                   QRAMLQAEGIKLKDDEKLLRKALKRKEAKKRRSEQEWRDRKLAVTTSKADKQKRREENL
FT                   KIRKQNKGVKRSKQQKMKSAYKGNSTMVKRAGFEGRLKSGKKK"
FT   gene            <69922..>71353
FT                   /locus_tag="ZYRO0E01012g"
FT                   /old_locus_tag="Zyro0E.mRNA.168.p"
FT   CDS_pept        join(69922..70129,70320..71353)
FT                   /locus_tag="ZYRO0E01012g"
FT                   /old_locus_tag="Zyro0E.mRNA.168.p"
FT                   /product="ZYRO0E01012p"
FT                   /note="similar to uniprot|P36008 Saccharomyces cerevisiae
FT                   YKL081W TEF4 Translation elongation factor EF-1gamma"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01012g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30736"
FT                   /db_xref="GOA:C5E3X5"
FT                   /db_xref="InterPro:IPR001662"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR036433"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3X5"
FT                   /protein_id="CAR30736.1"
FT                   /translation="MSSTLYIIEKSPRGQLVSDLVKYLNLDVKIVTDRESDSTFKKNFP
FT                   LGKIPAFLGKNGFKLTETIAVIYYLVTLTNDEKIQNQLAGSTAEEKASILKWVSFANSD
FT                   AARAAASAVFLLVGLKPFNKKELDTSLEALEQYAQAFEQRLSEYTYLATENVTLADIVS
FT                   YYIWAFSFSSALGADFRKKHPQLTRWFNTIGAHPSVQFSHKGFKPVEKALEPPQGKKKE
FT                   QKKEQKKEQPKQEAAQKAPAAQQPAQEKKPKHPLEVLGKSSFPLEDWKRKYMNEDTRPS
FT                   SLPWFWENYNPEEWSLWKVEYKYNDELTLTFMSNNLIGGFFTRLFASVKYMFGCLVVYG
FT                   ENNNNGIIGAIMVRGQDYAKAFDVAPDWESYNFTKLDATKPEDKAFVEDMWAWDKPVIV
FT                   NGEPREISDGKVLK"
FT   gene            <70174..>70267
FT                   /gene="SNR38"
FT                   /locus_tag="ZYRO0E01034r"
FT                   /old_locus_tag="Zyro0E_snoRNA_164"
FT   ncRNA           70174..70267
FT                   /gene="SNR38"
FT                   /locus_tag="ZYRO0E01034r"
FT                   /old_locus_tag="Zyro0E_snoRNA_164"
FT                   /product="snR38"
FT                   /note="C/D snoRNA intronic SNR38"
FT                   /ncRNA_class="snoRNA"
FT   gene            <71583..>72761
FT                   /locus_tag="ZYRO0E01056g"
FT                   /old_locus_tag="ZYRO-ORF4212"
FT   CDS_pept        71583..72761
FT                   /locus_tag="ZYRO0E01056g"
FT                   /old_locus_tag="ZYRO-ORF4212"
FT                   /product="ZYRO0E01056p"
FT                   /note="highly similar to uniprot|P31412 Saccharomyces
FT                   cerevisiae YKL080W VMA5 Vacuolar H ATPase subunit C of the
FT                   catalytic (V1) sector"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30737"
FT                   /db_xref="GOA:C5E3X6"
FT                   /db_xref="InterPro:IPR004907"
FT                   /db_xref="InterPro:IPR036132"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3X6"
FT                   /protein_id="CAR30737.1"
FT                   /translation="MSTTLYTANDFILLSLPRNAAPANSSNSSADSWLQNELIGGRAFV
FT                   SDFQIPEFKIGSLDSLIVQSEELAKADNQIGSSIGKIVEILTSLNESGSNAYKTVPINN
FT                   VPVPEYLENFQWMTRKFRLDKSIEELMKLITDESTQLDSDVRATSTNYNNAKTNLATAE
FT                   RKKTGDLSIRSLHDIVKPEHFILNSEYLTTVLIAVPKSLKSNFEKTYETLAKNVVPGSA
FT                   GIISQDSEYILYNVHLFKKSVQDFNAAAREKKFTPREFDYSEELIDQLKQEHDSAAHLE
FT                   QSLRSQLVRLAKAAYADSFINWFHTKALRVFVESVLRYGLPPDFNTKIIAVPPKNLSKC
FT                   KAELTEAFGYLSGNAFARNKQGKIVKEDASLHQYAALVDTEYEPFVIYTISL"
FT   gene            <73042..>75048
FT                   /locus_tag="ZYRO0E01078g"
FT                   /old_locus_tag="ZYRO-ORF4211"
FT   CDS_pept        73042..75048
FT                   /locus_tag="ZYRO0E01078g"
FT                   /old_locus_tag="ZYRO-ORF4211"
FT                   /product="ZYRO0E01078p"
FT                   /note="similar to uniprot|Q759X8 Ashbya gossypii ADR145C
FT                   ADR145Cp and weakly similar to YKL079W uniprot|P32364
FT                   Saccharomyces cerevisiae YKL079W SMY1 not believed to act
FT                   as a kinesin colocalizes with Myo2p kinesin heavy chain
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30738"
FT                   /db_xref="GOA:C5E3X7"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3X7"
FT                   /protein_id="CAR30738.1"
FT                   /translation="MQSISNGCTDAIVQPTSIRVVLRLKPLIDEAAKLSYVEDGAGSLS
FT                   LQDFPQVAGKATFFSDANDTNKFRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIM
FT                   AFGSEGSGKTYTMFGNDHEEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENV
FT                   YDLLSLQKNSKVLKTSSDTKTHTLSVKGLRTVSVNSVYELLAYINEGHLRRCHSDSHYR
FT                   KSRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQ
FT                   NLHQVVYGLSELESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRE
FT                   NTVITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMSTREDSYLTRIKYLEDEVSK
FT                   LGGTIQQNKNQVSTNKSLTEKNMKLMDQLELYRKSQQTQKSGSEEENLTSQQNGRIQNE
FT                   MSEVLDNLMEKCERVIQLQMRLDEELRQKSQMSQQLNYKESKAQALEAMNVKLLEQLNT
FT                   NENEMRNVLNTNSILRKEMEKWMHVAKTRSEKIEELQNEIQERQVGNVPQNGLLFPPGE
FT                   LNHIRDASKNKKGNWLFGNSSNNALGTRKISNLSNSNNLGTRKVSNVSTSSAVTINSQE
FT                   SNSSKTSHRGLNLHAVRLPSGIENENSSDKNNP"
FT   gene            complement(<75069..>76568)
FT                   /locus_tag="ZYRO0E01100g"
FT                   /old_locus_tag="ZYRO-ORF4210"
FT   CDS_pept        complement(75069..76568)
FT                   /locus_tag="ZYRO0E01100g"
FT                   /old_locus_tag="ZYRO-ORF4210"
FT                   /product="ZYRO0E01100p"
FT                   /note="similar to uniprot|Q04746 Saccharomyces cerevisiae
FT                   YMR065W KAR5 Protein required for nuclear membrane fusion
FT                   during karyogamy localizes to the membrane with a soluble
FT                   portion in the endoplasmic reticulum lumen may form a
FT                   complex with Jem1p and Kar2p expression of the gene is
FT                   regulated by pheromone"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30739"
FT                   /db_xref="GOA:C5E3X8"
FT                   /db_xref="InterPro:IPR007292"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3X8"
FT                   /protein_id="CAR30739.1"
FT                   /translation="MRSLLHFLSWNLLLLVIQCHTAEVVESVQQRLLSSNFRDDIVSDE
FT                   TLQRNFPFLKSSCVRDALRTFLPICLKQGVESIESSFKVETAVKLSICEFQVAGLGHIP
FT                   DSCKNTQTDSMMDCMIQLESSAQWWTTYSGNYQRLSSICFENSLPYEKEQILSLFLNIT
FT                   NIQSEINDNFTRHFYNMMSNVESSSDEHLQTIAQLFKEYLKQFDETFKDKQTEFEGYQD
FT                   DMQSLIVQNSQFIKKQNVGFMQSMDSLQHMIDGIIMDLKNDEISQQIVEVQNENLDSLK
FT                   QMKNLMQEIYQFQRHGQTQMNDEMQLFFENTKKNMDLVTDDVKQSQLRAVEELRVSLLP
FT                   SIIEELAPQLSNIKEDLLEDWKSATYLMNTDFQSWNNQINDTFQQISLKLNTTLGAIDN
FT                   IDRSLSKFEKILTRVSQLITCISTFTQYTFSAVYHFSTSKYVWRFFFITFAIKRFSLQF
FT                   SWGKLLSPIAAYAQVMAKFCLLIFAIYGGSKLGNIIMSVGT"
FT   gene            complement(<76768..>78504)
FT                   /locus_tag="ZYRO0E01122g"
FT                   /old_locus_tag="ZYRO-ORF4209"
FT   CDS_pept        complement(76768..78504)
FT                   /locus_tag="ZYRO0E01122g"
FT                   /old_locus_tag="ZYRO-ORF4209"
FT                   /product="ZYRO0E01122p"
FT                   /note="weakly similar to uniprot|P32493 Saccharomyces
FT                   cerevisiae YMR064W AEP1 Protein required for expression of
FT                   the mitochondrial OLI1 gene encoding subunit 9 of F1-F0 ATP
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01122g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30740"
FT                   /db_xref="GOA:C5E3X9"
FT                   /db_xref="InterPro:IPR031467"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E3X9"
FT                   /protein_id="CAR30740.1"
FT                   /translation="MPTKPRHIPRNFFLDQKSRYQKNGLTPLPHQIIHPFYTPTRAAEL
FT                   SACSKEVRGKLLEGLKVVPALVTDWKGKPLLRNRFIKFDTVKGVNVWLQGYASRRKEAE
FT                   GVIYRTLEGQPEKLITPSKLHRSNVPLVDKVTELFGSERTKHLNSAALDSIVDELVNDR
FT                   EKNLFCEDVYIYLLQHHVNSEGKLIAIIESIKSHMEADIDQLKVAETLILQLVLSMQRN
FT                   RLPVTKELVNAYHQLIDAVNQKFYTNACELQFDPLVTQCILEFHIMSGDLNHSKKLLSH
FT                   LILNGWALREDLSVKYLQLVESKVRDEDIDTRTLKRFAYISDFRPLLQRAQTPLFFAAL
FT                   VPYCRHFGELYSLLTVITEKVHNTREVFDVTLLSMIEATTHMGKNNRYKSANLYELHRT
FT                   VLPYYDNNLPAKFVKAFALQFAKFNNWSAIAGFFKQYPSYFTPNSIASLLSASQEGVTD
FT                   STNYPGGVVQMRKIFIWEYVLPLYSKMSLRARSSISATFDTPKLFTEAIKQELKLVSAG
FT                   QADVMNELIAMGYESNLLRFIPATTWEDIFRVPHLVAALKPFSQEIESLSGKAAGATES
FT                   SQ"
FT   gene            complement(<78626..>79330)
FT                   /locus_tag="ZYRO0E01144g"
FT                   /old_locus_tag="ZYRO-ORF4208"
FT   CDS_pept        complement(78626..79330)
FT                   /locus_tag="ZYRO0E01144g"
FT                   /old_locus_tag="ZYRO-ORF4208"
FT                   /product="ZYRO0E01144p"
FT                   /note="weakly similar to uniprot|Q04734 Saccharomyces
FT                   cerevisiae YMR063W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01144g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30741"
FT                   /db_xref="GOA:C5E3Y0"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Y0"
FT                   /protein_id="CAR30741.1"
FT                   /translation="MKLAVKFCLALLTVSLIFQLFAIISTPLSSIPLSTSPGFEYGVFG
FT                   YCNTNIHKCSSRKIGYSLEFAPHPMPPNKVPTLPSGLKYSVTKLLVVHPLSFAITLTLY
FT                   VLIFLMSHQQLANSPMFLLSIALFSLPTFLICLLSFLVDLLVFSSDLCWPGWLMLPATI
FT                   VIAVCCSLLWNLRSTVSIKNYETLQSSRANTIETHSMHDWRDRTRIPSIIRSDDHSKPL
FT                   LEPELTYTSTID"
FT   gene            <81297..>83180
FT                   /locus_tag="ZYRO0E01166g"
FT                   /old_locus_tag="ZYRO-ORF4206"
FT   CDS_pept        81297..83180
FT                   /locus_tag="ZYRO0E01166g"
FT                   /old_locus_tag="ZYRO-ORF4206"
FT                   /product="ZYRO0E01166p"
FT                   /note="similar to uniprot|P36009 Saccharomyces cerevisiae
FT                   YKL078W DHR2 Predominantly nucleolar DEAH-box RNA helicase
FT                   required for 18S rRNA synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30742"
FT                   /db_xref="GOA:C5E3Y1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Y1"
FT                   /protein_id="CAR30742.1"
FT                   /translation="MLLPVQVHSDEILSHILSHDTTILIGETGSGKSTQIPQLLLKYGK
FT                   IAITQPRRVAAINLATRVAQETNSRVGDTIGYSVRFDHRTSSKTRCKYVTDGMLLREMI
FT                   NDKELKNYDTVIIDEAHERTVLTDLIIGFLKELQGRRKLRIVIMSATLNAESFSRFFHN
FT                   APILHVRGRRFPVQQLYLREPCDDLVEIAIRCVVQINAGEPLGDVLCFLPGQEEIDRAV
FT                   TFLERIGPEIRSRGFPVMVGMPLYASLPPSEQLKVFQRIKGKQQSRKIIFCTNVAETSI
FT                   TVPGVKYVVDSGLRRVKVWRHALNLSTLLTVPVSRASAQQRSGRAGRECAGKCYRLFQE
FT                   SDFEKMPAVTEPEIARCDVTEPLLLLKRHGVDDVLNWSWFEHPGKESILQALGELLLLG
FT                   ALDAKGSLTPLGYRMSSLPLPPQLGVVLIAAEDKQKHCLDTCIDIVACLSVENVLLSPP
FT                   WEQRDIVNERRTAICHRASRWGDLVLYKELWDHYFRTSLTGDEKKTFCQELYVNQRAMR
FT                   QVQKVRGQLRSLFRLHEDPDPTAHHALETEEIPAVITCFLSGYPKNLAILHPDRSHKIV
FT                   TTGETVQPHPASTLFTQRKTDCPAILYTEYVYTSKGYARNVSRLELSWLSS"
FT   gene            <83763..>85724
FT                   /locus_tag="ZYRO0E01188g"
FT                   /old_locus_tag="ZYRO-ORF4203"
FT   CDS_pept        83763..85724
FT                   /locus_tag="ZYRO0E01188g"
FT                   /old_locus_tag="ZYRO-ORF4203"
FT                   /product="ZYRO0E01188p"
FT                   /note="similar to uniprot|P39932 Saccharomyces cerevisiae
FT                   YDR536W STL1 Glycerol proton symporter of the plasma
FT                   membrane subject to glucose-induced inactivation strongly
FT                   but transiently induced when cells are subjected to osmotic
FT                   shock"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30743"
FT                   /db_xref="GOA:C5E3Y2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Y2"
FT                   /protein_id="CAR30743.1"
FT                   /translation="MAASSVSEKDIPPDNRHTMGDLEKGSLIESASSSRERYSTIAKKE
FT                   DGNEKQTYGGETPPSSDSPVVRGNGAESLPRDLPEGDSYDQLGFEPPKGIKAYMFSRTA
FT                   HAGARGLRLRVLCSATAVIAFLLFGYDQGLMSGVISGDEFNNEFPATKEKATHKRTTVV
FT                   IQGAVTACYELGCFVGSVFVMFFGEKIGRKPCIIMGALITIVGATISTVAFHHAWGLGQ
FT                   FVVGRVVTGVGTGLNTSSIPVWQSEMAKPNVRGRLINLDGSTIALGTMIAYWLDLGFSF
FT                   IKNSVQWRFPVSLQILFALVLFFGIIQMPESPRWLIGQKRVQEAKYILACLNDCSMDDD
FT                   EIVAEVTMLIDTARRFENKKRSIKDLLTNGKTQNMNRAIIAASTQFMQQFTGCNAAIYY
FT                   ATILFQQTLKRSRTVALIVGGAFSTVYFFSTIPTFYLVENLGRRPMFLIGVTGQCLSFV
FT                   ITFACLTHPTPEHGKGAAVGLFLFIVFFGLAMLPLPWIYPPEVASMRVRAATNALSTMC
FT                   NWLTNFAVVMFTPVFIQTSQWGTYFFFALMNFIYIPVVFLFYPETAGRSLEEIDVIFAK
FT                   AHVEHAQPWRVAAKLPKLSMTEVEDYSSALGLYDDENEKEGIEGGEGDEEPQENALFTA
FT                   EPLNGSSSSRESERAPHA"
FT   gene            <86975..>88753
FT                   /locus_tag="ZYRO0E01210g"
FT                   /old_locus_tag="ZYRO-ORF4202"
FT   CDS_pept        86975..88753
FT                   /locus_tag="ZYRO0E01210g"
FT                   /old_locus_tag="ZYRO-ORF4202"
FT                   /product="ZYRO0E01210p"
FT                   /note="similar to uniprot|P39932 Saccharomyces cerevisiae
FT                   YDR536W STL1 Glycerol proton symporter of the plasma
FT                   membrane subject to glucose-induced inactivation strongly
FT                   but transiently induced when cells are subjected to osmotic
FT                   shock"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01210g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30744"
FT                   /db_xref="GOA:C5E3Y3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Y3"
FT                   /protein_id="CAR30744.1"
FT                   /translation="MGKRTQGFMDYVFSRTSTAGLKGARLRYTAAAVAVIGFALFGYDQ
FT                   GLMSGLITGDQFNKEFPPTKSNGDNDRYASVIQGAVTACYEIGCFFGSLFVLFFGDAIG
FT                   RKPLIIFGAIIVIIGTVISTAPFHHAWGLGQFVVGRVITGVGTGFNTSTIPVWQSEMTK
FT                   PNIRGAMINLDGSVIAFGTMIAYWLDFGFSFINSSVQWRFPVSVQIIFALVLLFGIVRM
FT                   PESPRWLMAKKRPAEARYVLACLNDLPENDDAILAEMTSLHEAVNRSSNQKSQMKSLFS
FT                   MGKQQNFSRALIASSTQFFQQFTGCNAAIYYSTVLFQTTVQLDRLLAMILGGVFATVYT
FT                   LSTLPSFYLVEKVGRRKMFFFGALGQGISFIITFACLVNPTKQNAKGAAVGLYLFIICF
FT                   GLAILELPWIYPPEIASMRVRAATNAMSTCTNWVTNFAVVMFTPVFIQTSQWGCYLFFA
FT                   VMNFIYLPVIFFFYPETAGRSLEEIDIIFAKAHVDGTLPWMVAHRLPKLSMTEVEDYSQ
FT                   SLGLHDDENEKEEYDEKEAEANAALFQVETSSKSPSSNRKDDDAPIEHNEVQESNDNSS
FT                   NSSNVEAPIPVHHNDP"
FT   gene            <89104..>90417
FT                   /locus_tag="ZYRO0E01232g"
FT                   /old_locus_tag="ZYRO-ORF4201"
FT   CDS_pept        89104..90417
FT                   /locus_tag="ZYRO0E01232g"
FT                   /old_locus_tag="ZYRO-ORF4201"
FT                   /product="ZYRO0E01232p"
FT                   /note="highly similar to uniprot|Q04728 Saccharomyces
FT                   cerevisiae YMR062C ECM40 Mitochondrial ornithine
FT                   acetyltransferase, catalyzes the fifth step in arginine
FT                   biosynthesis; also possesses acetylglutamate synthase
FT                   activity, regenerates acetylglutamate while forming
FT                   ornithine"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30745"
FT                   /db_xref="GOA:C5E3Y4"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E3Y4"
FT                   /protein_id="CAR30745.1"
FT                   /translation="MKFSSVLKQSAKYAAHVPKSGVFPRGFQVGSIASGVKKNGNLDLG
FT                   VLVNTNKSYESSAASVFTTNKFKAAPVILSQRVLEEKNGKGINAIVVNSGCANSVTGEV
FT                   GLQDATQMAKLIDEKLGATSPSTLIMSTGVIGQRLQMDKISKGVSQLFANNSFGSDFNS
FT                   WLNIAKSICTTDTFPKLITSNFTLKNGTQYTLTGMAKGAGMICPNMATLLGFIVTDLPI
FT                   ESKALSKMLKFATDRSFNCISVDGDMSTNDTINMIANGAVKTDEITEDSPEFLQVRDQV
FT                   TQFAQKLAQLVVRDGEGATKFVTVKVQNSSTFADAKIIAESISNSMLVKTALYGKDANW
FT                   GRILCAIGYAKLDNLDSLQTDKLNVSFVATDNSEPRELKLLVNGVPQLNIDEERASQIL
FT                   ALPDLEVLVDLGTGNEEAQFWTCDLSHEYVTINGDYRS"
FT   gene            complement(<90540..>92498)
FT                   /locus_tag="ZYRO0E01254g"
FT                   /old_locus_tag="ZYRO-ORF4200"
FT   CDS_pept        complement(90540..92498)
FT                   /locus_tag="ZYRO0E01254g"
FT                   /old_locus_tag="ZYRO-ORF4200"
FT                   /product="ZYRO0E01254p"
FT                   /note="similar to uniprot|P25298 Saccharomyces cerevisiae
FT                   YMR061W RNA14 Cleavage and polyadenylation factor I (CF I)
FT                   component involved in cleavage and polyadenylation of mRNA
FT                   3' ends bridges interaction between Rna15p and Hrp1p in the
FT                   CF I complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01254g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30746"
FT                   /db_xref="GOA:C5E3Y5"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Y5"
FT                   /protein_id="CAR30746.1"
FT                   /translation="MSSAATPELSVGTNQPNGLPGNEGDNDIVNGIRRKIELNPADILP
FT                   YLELVQYYESKDSFQESREVYNSLHDKFPTYSPLWTLQLKGELQRDEFEFVEKMLAQCL
FT                   SGKLANNDLPLWSTYLDYVRRRNNLITGGQEARAVVVKAFELVMDKCAIFEPKSSQFWN
FT                   DYLSFLEQWKPVNKWEEQQRLDMIRTLYKRMLCVPFENIEKMWNRYTEWEQDVNSLTAR
FT                   KFIGELSSEYMKARSLYQEWSHITKGLRRSYPVSVSTANKNNVPQTGEGMDPSQLQIWL
FT                   NWIHWEKENKMSLNQDLLNRRITYIYKQSVQYMLFAAEMWYDYAMYIPDVSERQQILYT
FT                   AVLANSDSPSLTFKLAESYETDNKFDEVKRCFEDCTNALLQGYQAMANEQDDDSMPVFK
FT                   QRKKLTFVFCVYMNAMKRLAGLSAARMVFGKCRKLKRILTHDIYIENAYLEFQNQNDYK
FT                   TPCKVLELGLKYFQTDALYVNKYLDFLILLNRDSQIKTLFETSVEKIQDLTGLKSIYKK
FT                   MISYESKFGNLQNVYSLENRFFERFPQENMIEIFTDRYRIQEENLIKELELTYLADDLL
FT                   SSSDLTELTGSSLKRTRETQDKLQSNKKQKNKIGIPEDIINVLAILPKRQYFKAPLLDP
FT                   QSLINYLNDQVELPSPK"
FT   gene            <92776..>93699
FT                   /locus_tag="ZYRO0E01276g"
FT                   /old_locus_tag="ZYRO-ORF4199"
FT   CDS_pept        92776..93699
FT                   /locus_tag="ZYRO0E01276g"
FT                   /old_locus_tag="ZYRO-ORF4199"
FT                   /product="ZYRO0E01276p"
FT                   /note="similar to uniprot|P50110 Saccharomyces cerevisiae
FT                   YMR060C SAM37 Component of the mitochondrial outer membrane
FT                   sorting and assembly machinery (SAM) complex required for
FT                   the sorting of some proteins to the outer membrane after
FT                   import by the TOM complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01276g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30747"
FT                   /db_xref="GOA:C5E3Y6"
FT                   /db_xref="InterPro:IPR019564"
FT                   /db_xref="InterPro:IPR031317"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Y6"
FT                   /protein_id="CAR30747.1"
FT                   /translation="MSEFSISVYLWGETGKPSLVSPESIALFWFLNSYYGDYKSIEVVF
FT                   ANNTDLSPNEELPLLVENGKKWSGFVDIVSYLMEKMQNNDDVETTLLKDGLLEFTGELS
FT                   VLTEYQMYLNKINYETFTRKAFSQLLHWPMWYNTPMNYRTRARQRCSNTLGYLMHDDDP
FT                   DSLESLELESTRLPQSKAFQATQDRKMRSKEELQNVKHNLQYLTRLKDYLRTWSQVRNS
FT                   IPHQNDTIPADFLLWANLFVQLNLPDGEKVGQQVKDAVNDDFHQLVQSKIDQLSSLEPR
FT                   VFQRDPIFQEQGNVIMSIYHYVHKFV"
FT   gene            complement(<93711..>94115)
FT                   /locus_tag="ZYRO0E01298g"
FT                   /old_locus_tag="ZYRO-ORF4198"
FT   CDS_pept        complement(93711..94115)
FT                   /locus_tag="ZYRO0E01298g"
FT                   /old_locus_tag="ZYRO-ORF4198"
FT                   /product="ZYRO0E01298p"
FT                   /note="similar to uniprot|Q04675 Saccharomyces cerevisiae
FT                   YMR059W SEN15 Subunit of the tRNA splicing endonuclease
FT                   which is composed of Sen2p Sen15p Sen34p and Sen54p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01298g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30748"
FT                   /db_xref="GOA:C5E3Y7"
FT                   /db_xref="InterPro:IPR018593"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Y7"
FT                   /protein_id="CAR30748.1"
FT                   /translation="MDSDYTDVTNRIGESTFRLVWDNLAYAQLWEQLRTRDEQVEWQGQ
FT                   TLQIIEGKPPHKLSNDDDGGNENDHGIEYVLPIEMSQYKAGKLTFKCLDLIFDQLCPPD
FT                   ARRITLALANSDGTVMFYFVYKGIHKPKRN"
FT   gene            <94332..>95522
FT                   /locus_tag="ZYRO0E01320g"
FT                   /old_locus_tag="ZYRO-ORF4197"
FT   CDS_pept        94332..95522
FT                   /locus_tag="ZYRO0E01320g"
FT                   /old_locus_tag="ZYRO-ORF4197"
FT                   /product="ZYRO0E01320p"
FT                   /note="similar to uniprot|P36081 Saccharomyces cerevisiae
FT                   YKL077W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01320g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30749"
FT                   /db_xref="GOA:C5E3Y8"
FT                   /db_xref="InterPro:IPR028000"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Y8"
FT                   /protein_id="CAR30749.1"
FT                   /translation="MRSRFQILASFLLFLLHINWVNGYRPIVQPGEKLTTSEEPKPWYR
FT                   TIYGDKVEIVTPTVVAGVTFSRKPLETPDPLEPWVSLNKNGIPKTIKPEIKNGRTKNGH
FT                   PDYSTFFKEVHTKTLGYDDLKAENMDYGDVHEEEVFEDEDETYTSLNPIVRCTPKRYFN
FT                   KGHSKNIPSEPFCTPHEDSIWNVGKTYFLTWYTHFFRDEHSNEVVERVRIHMAYIREKS
FT                   NEKGVLKRDAPSATFFHSEWIKNADGVYPIEILHEWLQGVRTRKIVISVQPETVSDAEF
FT                   DPLTHGVFVYLDEGSRVYKQTNKELALNDAGITDDKWYYVVVSIPTAVIVALVLMYFFI
FT                   IANRRYSDFSEVTNKAWQKKHRVLGKVTDFKKYKNMKNRPYSELPMHNKGNPGKQS"
FT   gene            complement(<95551..>96861)
FT                   /locus_tag="ZYRO0E01342g"
FT                   /old_locus_tag="ZYRO-ORF4195"
FT   CDS_pept        complement(95551..96861)
FT                   /locus_tag="ZYRO0E01342g"
FT                   /old_locus_tag="ZYRO-ORF4195"
FT                   /product="ZYRO0E01342p"
FT                   /note="similar to uniprot|P36083 Saccharomyces cerevisiae
FT                   YKL075C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01342g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30750"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Y9"
FT                   /protein_id="CAR30750.1"
FT                   /translation="MLSSDEVRREECTCNCGLPPCKTNDRKPRNLVRGNMHRHRRPKTT
FT                   RPKKRFRFSKCMDFEGTDYNLITSVEYLNEKYDIRKSHYIEKFIKCIHKKIDHDVNKIS
FT                   DNYVHSLGPWVKIKFFLLLVTLSQRGGPEYWMDKDQNDDSATTNIDEDKDNKTHSNRHN
FT                   HNKTENDTKKNAIFSLTEHIMRQNINQDFTESTYDENYVFSSIWANFMEGLMNHYLEQV
FT                   IVPHSEMKVCQQLYKPMMKIISLYNEYNELMEKSEHNGFLPAPGDTKDPLKLGKSVAET
FT                   YEVGDCVTQERLQRAQKLLWQARQDIPKTISKELTLLSEMYSTLSADEQDYELDEFVCC
FT                   AEEYVELEYLPSLIDVLFQNCGSINFWKIMIVLEPFFYYIEDVGDDGDTESQNGTNDEM
FT                   LDESGGDGGELLHSFKPDPRVIILEKICEVAARQKWI"
FT   gene            complement(<97201..>99147)
FT                   /locus_tag="ZYRO0E01364g"
FT                   /old_locus_tag="ZYRO-ORF4194"
FT   CDS_pept        complement(97201..99147)
FT                   /locus_tag="ZYRO0E01364g"
FT                   /old_locus_tag="ZYRO-ORF4194"
FT                   /product="ZYRO0E01364p"
FT                   /note="similar to uniprot|P38993 Saccharomyces cerevisiae
FT                   YMR058W FET3 Ferro-O2-oxidoreductase required for high-
FT                   affinity iron uptake and involved in mediating resistance
FT                   to copper ion toxicity belongs to class of integral
FT                   membrane multicopper oxidases"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01364g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30751"
FT                   /db_xref="GOA:C5E3Z0"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Z0"
FT                   /protein_id="CAR30751.1"
FT                   /translation="MILSLALVFLLFQQVLGATHVYNWTTGWGYANPDGIKRREVVTCN
FT                   GEFPWPSVRVTKGDRVIINLTNGFNDSNTTLHVHGMFQNGSTQMDGPPFLTQCPISPND
FT                   TFTYNFTVSDNAGAYWYHSHTDAQYEDGMRGLFIIDDGENNKNFPYDYDEEVLLEIGEW
FT                   YDQTVAKLKPAFLSLTNPTGAEPIPQNLLINNTRNLTWNVEPNKTYLLRIVNTGGFVSQ
FT                   YFWLEDHEMEVVEVDGVVTEKNATDMLYITVAQRYSVLVRTKDNKDKNYAIMQKYDDSM
FT                   LDKIPKHLLLNQTSYMTYDSSKPKPEEAYVNSLDNFLDDFYLVPYHKQELLPEPDHRIE
FT                   LTVAMDNLISGKNYAFFNNITYTTPKVPTLMTVLSAGKYASNSYIYGTNTNTFVLKRNE
FT                   IVEIVLNSQDTGTHPFHLHGHVFQTIARAGAVDDNDPPLPFDPKNHTSFPEYPMLRDTI
FT                   YVRPQSNFVIRFRADNPGVWFFHCHIEWHLIQGLAIVLVEDPEGIQSNPSQYLTDSHKR
FT                   VCKNSGVPIEGNAAGTTDWFNLALENKQEKSIPSGFTAKGYVAFVFSCVAGVLGLITIT
FT                   IYGLMDLQNVEEKVIEDLQIPATDLLEEDDDEEIETNQVYAKSGKSEGGTLEEEQKLRD
FT                   HETTKEVSKTSSK"
FT   gene            complement(<100442..>100702)
FT                   /locus_tag="ZYRO0E01386g"
FT                   /old_locus_tag="ZYRO-ORF4191"
FT   CDS_pept        complement(100442..100702)
FT                   /locus_tag="ZYRO0E01386g"
FT                   /old_locus_tag="ZYRO-ORF4191"
FT                   /product="ZYRO0E01386p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01386g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30752"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Z1"
FT                   /protein_id="CAR30752.1"
FT                   /translation="MISTEYTGPYLTRYEGVGRPLDNSEKLVLYELVTPQDSQVMPTDN
FT                   YEHADTTTISRTFRSFRGGSAKRSTNRGNNGIVKRVKKLFA"
FT   gene            <101663..>102559
FT                   /locus_tag="ZYRO0E01408g"
FT                   /old_locus_tag="ZYRO-ORF4190"
FT   CDS_pept        101663..102559
FT                   /locus_tag="ZYRO0E01408g"
FT                   /old_locus_tag="ZYRO-ORF4190"
FT                   /product="ZYRO0E01408p"
FT                   /note="similar to uniprot|P18238 Saccharomyces cerevisiae
FT                   YBR085W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01408g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30753"
FT                   /db_xref="GOA:C5E3Z2"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002113"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Z2"
FT                   /protein_id="CAR30753.1"
FT                   /translation="MQQDFLVNFLMGGVSAAVAKTCAAPIERVKLMMQNQGEMMKQGAL
FT                   DRRYAGIAECFTRTIKTEGLLSLWRGNTANVLRYFPTQALNFAFKDKIKAMFNVGRDQG
FT                   YGRWLSANIASGGAAGGLSLGFVYSLDYARTRLAADASHHGAERRFKGLADVYKQTYAT
FT                   DGILGLYRGFAPSVVGIMVYRGLYFGLYDSIKPVLLTGKWERSFPASFLLGWVVTTAAS
FT                   TASYPLDTVRRRMMMTSGQQIKYTGAWHCLTSIYEQEGFRAFFKGCGANIVRSIAAAGV
FT                   ISLYDQLQLLMFGKTFK"
FT   gene            <102660..>103598
FT                   /locus_tag="ZYRO0E01430g"
FT                   /old_locus_tag="ZYRO-ORF4189"
FT   CDS_pept        102660..103598
FT                   /locus_tag="ZYRO0E01430g"
FT                   /old_locus_tag="ZYRO-ORF4189"
FT                   /product="ZYRO0E01430p"
FT                   /note="highly similar to uniprot|P26448 Saccharomyces
FT                   cerevisiae YMR055C BUB2 Mitotic exit network regulator
FT                   forms GTPase-activating Bfa1p-Bub2p complex that binds
FT                   Tem1p and spindle pole bodies blocks cell cycle progression
FT                   before anaphase in response to spindle and kinetochore
FT                   damage"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01430g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30754"
FT                   /db_xref="GOA:C5E3Z3"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Z3"
FT                   /protein_id="CAR30754.1"
FT                   /translation="MSSIERFLSQPPLIIQSSLAQLRYLVLSEGLPTGNDKNIQRTRCY
FT                   TWSVLSRTSMERCTQIYISYVQLGSAPQPIYHKIKNDTFRTLQTDPKFITTVSEDALLR
FT                   CLSSFAWQCIELKNVQDPRLPPQLSTYVQGMNVLLAPLLYSCPSEPMAFQLFSTLCYQI
FT                   IPTYLNSNLTGVHNGAKLLDICLKIIDPKLSKFLSDNLLTAEIYGIPSILTLCSCNRPL
FT                   DQVCKLWDFMFAYGFHMNILFVVAILVTIRHQILRSESPMNLLTRQLPEFDADEIIKLG
FT                   VGFLAKIPQSVYSLLVEHLTNLNIKIPYNDY"
FT   gene            complement(<103615..>105072)
FT                   /locus_tag="ZYRO0E01452g"
FT                   /old_locus_tag="ZYRO-ORF4188"
FT   CDS_pept        complement(103615..105072)
FT                   /locus_tag="ZYRO0E01452g"
FT                   /old_locus_tag="ZYRO-ORF4188"
FT                   /product="ZYRO0E01452p"
FT                   /note="some similarities with uniprot|P36084 Saccharomyces
FT                   cerevisiae YKL074C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30755"
FT                   /db_xref="GOA:C5E3Z4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Z4"
FT                   /protein_id="CAR30755.1"
FT                   /translation="MGNDDNEHALEDLRSKIIASMSNEPSSNKRTALAGDEMHNNKRQR
FT                   NRDDGSRGYKNGYSGPNYPKRHQSNPRSRYQAQQQQKRFPPRPQYSRYQGNAASNTSVG
FT                   KFREEDLAHVVPLGERKRMRPTKWDITPKGFESVPTERAKLSKLFPQPGKPHELDRDKL
FT                   EKVIAQGGTNNRRTRILFEDADGNHLIFSRMSCRIIVRGTTDSMDLNRIEAYLNGFVQA
FT                   IDREYHVKEVVQGPSHLVLEFNDAVCTTIVLSCRSFISKELDFDGSDWQRPQEYVQQVD
FT                   SSERLCGPEILAVEGLVHGEEKELTDQGFKVVFMEPIFTISQENQERLFTGCALVEVEE
FT                   EPSANGSLRWFKPNESHMKQNISYMTFQGLPKLATDQVRVPSRVLLLMNLVDPLDLKLE
FT                   AFAQEVKTTLESTLHKVESVRMKKPSADFRLNLERIGEGVGNVYVKFQDVESAEAAMEN
FT                   LPHRKFNGRSVLCCYVAESDFETLGIL"
FT   gene            <105281..>107998
FT                   /locus_tag="ZYRO0E01474g"
FT                   /old_locus_tag="ZYRO-ORF4187"
FT   CDS_pept        105281..107998
FT                   /locus_tag="ZYRO0E01474g"
FT                   /old_locus_tag="ZYRO-ORF4187"
FT                   /product="ZYRO0E01474p"
FT                   /note="similar to uniprot|P36016 Saccharomyces cerevisiae
FT                   YKL073W LHS1 Molecular chaperone of the endoplasmic
FT                   reticulum lumen involved in polypeptide translocation and
FT                   folding member of the Hsp70 family localizes to the lumen
FT                   of the ER regulated by the unfolded protein response
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01474g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30756"
FT                   /db_xref="GOA:C5E3Z5"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Z5"
FT                   /protein_id="CAR30756.1"
FT                   /translation="MRNSIVLLLISIWSIWCHFTLAAVVGVDYGQQFIKAMVVSPRAPM
FT                   ELIFTPEAKRKEISGLAIKSLGGDKGEIERIYGSALGSMATRFPKNTLLHVKSLLGKTI
FT                   NDEGEISTYLNEHPGIDIVPNKRNSLSFVVGDEQYPVEEVTAMNLQETINRANLLLREK
FT                   DPSGSDLVDKLALTVPEYFDQYQRRALLDSGSLTTDALDTYLVPDGLSVVINFVLKKRD
FT                   FKGKSYYVVYDMGGGSTKASLFSIEQPENETEPLRIEFGGYGYDSQLGGSNFTLQVASL
FT                   IENKFLSKRKDITAEKLHRNPKAVAKIVQAAEKAKLILSANSEASISIESVLEDVDFKT
FT                   KITKQEFEDSLSDSASEIVKPIKVALDGQFWDEKIDPKQVSGIILTGGSSRVPIVQYKL
FT                   AEYMGENKILKSVNADEAAVDGATIRGIKLFEAFRTKPLNITERSISDYAVTLNQKGEN
FT                   VVVFPKGTVFPTKRTLELGNAKDLPKDFDIKLWENGLPFQSVKTKTSGADDIYSPEKCP
FT                   NGVIYNATFSISQNRLFNLDKVEAICLKDGSSSVEKPQNETGKKSNLGSSKRSVKLTIS
FT                   SEGSNIKAMSSDEQLRLREYIRILDQKDAARFELEEAKNLLEALLYDARSYLELEEVVE
FT                   KGPQSYLGKLSEAVTKHLSWLEDEADETTKLEVIQRSSEVQQLRDKLEAYLQSLSEPLD
FT                   SKQFQSILNNATKLLEQIDLTQINQQEQVASLKDKFEELGHNVEEQYAKIKLPHHIAAP
FT                   LSSWNDTVSAFKEVIKLVEYAKSSAFKKMGREQLFEIKSAFDIASAELESIIDYFGKAR
FT                   DYRLHELQAWIQKAEKTKKRKEERLKKKMEDKEKEKESKSSSTVSGNPSTAESESSTVP
FT                   TTTTTASASASTTSPQNKQGTSSSTATTPLHDEL"
FT   gene            complement(<108148..>110847)
FT                   /locus_tag="ZYRO0E01496g"
FT                   /old_locus_tag="Zyro0E.mRNA.5101.m"
FT   CDS_pept        complement(join(108148..110756,110823..110847))
FT                   /locus_tag="ZYRO0E01496g"
FT                   /old_locus_tag="Zyro0E.mRNA.5101.m"
FT                   /product="ZYRO0E01496p"
FT                   /note="similar to uniprot|P37296 Saccharomyces cerevisiae
FT                   YMR054W STV1 Subunit of vacuolar-ATPase V0 domain one of
FT                   two isoforms (Stv1p and Vph1p) Stv1p is located in V-
FT                   ATPase complexes of the Golgi and endosomes while Vph1p is
FT                   located in V-ATPase complexes of the vacuole"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01496g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30757"
FT                   /db_xref="GOA:C5E3Z6"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="InterPro:IPR026028"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Z6"
FT                   /protein_id="CAR30757.1"
FT                   /translation="MVREEAIFRSADMTYVQLYIPLEISREIACLLGNLGTLMFRDLNK
FT                   DLTAFQRGYVGQIRKLDEVERLVLYMQEVSDKHAEATWKYILHTDEQGNDIQRPSVTQL
FT                   VSEMQTHSHDIINAAMGEIHEFEGRVKRLDDSLTNLKEKLNGLLEQRYVIFEVTRFLQS
FT                   HPGLFGRMGREERELRDVDEFRLNLDELSETLSDTFSFEDGTEPTDEQQQQQEALNDQM
FT                   EFEADQNLLEIGFHDRFMIAGSIRRDKVEVLNRILWRLLRGNLIFQNFAIDEPLLENGE
FT                   KVEKDCFFVFTHGEYLLQKVQRVVDSLNGRVVSLAHCTHREIQKLNDRISEIQQIAYAT
FT                   ESTLHAELLVVSDQLPVWNAMVKREKYIYATLNLFKQETHGLVAEGWLPTLELTTISDA
FT                   MKDYSETVGSEYSTVVSVIHTNRAPPTYHRTNKFTQAFQSICDAYGTATYKEVNPGLAT
FT                   IVTFPFMFAIMFGDLGHGFILMLIGVFLLMMEKKFETMQRGEIFDIVFTGRYVITLMGA
FT                   FSVYTGLLYNDIFSKSMTIFKSGWKWPSNFKKGESIVAEQTGTYPFGLDHAWHGTDNGL
FT                   IYTNSYKMKLSVIMGFLHMTYSFMFSLVNYRYKKSRVDIIGNFLPGLIFMQSIFGYLTW
FT                   AILYKWSKDWIKDNKPAPSLLNMLINMFLSPGHIDDQLYSGQNVLQILLLLAALACIPW
FT                   LLLYKPLTLKKQHSGVSLNGYESVNRSEGVDELTADLQATEGDGMIVTDYHGHEENEEF
FT                   NFGEVMIHQVIHTIEFCLNCISHTASYLRLWALSLAHAQLSSVLWDMTIKNAFSPKNSG
FT                   SPLAVTRVVLLFAMWFVLTVCILVLMEGTSAMLHSLRLHWVEAMSKFFEGDGYPYEPFT
FT                   FKNLVE"
FT   gene            <111190..>113505
FT                   /locus_tag="ZYRO0E01518g"
FT                   /old_locus_tag="ZYRO-ORF4182"
FT   CDS_pept        111190..113505
FT                   /locus_tag="ZYRO0E01518g"
FT                   /old_locus_tag="ZYRO-ORF4182"
FT                   /product="ZYRO0E01518p"
FT                   /note="similar to and similar to YMR053C uniprot|P46679
FT                   Saccharomyces cerevisiae YMR053C STB2 Protein that binds
FT                   Sin3p in a two-hybrid assay and is part of a large protein
FT                   complex with Sin3p and Stb1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01518g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30758"
FT                   /db_xref="GOA:C5E3Z7"
FT                   /db_xref="InterPro:IPR038919"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Z7"
FT                   /protein_id="CAR30758.1"
FT                   /translation="MTLETPTSNVFQSPKAVDSKKTTHKTSTVEPLVSFIFPDVRALHE
FT                   IRLESFVELQYKEITVHGFEIYVVEQWAAERKLSTVITSYTGNSQDTIHAVQVVLPKDP
FT                   EKWPGRFKEYYEDLSIFAKARVMPKGSIFITNLATVPSTLNLLHVECGDVRAIWKDFEV
FT                   NFDLKRLRCGGRSALLLGGTSTAAEDKFGQLYKISIDFGERKVLLKELEQCEHFPHLQR
FT                   NYHPVIELVTMIQVCLSYFNLYHSAKDGLLCDKTEAAVANFWSKLAKYYFGIERPKNEG
FT                   ISGPATVAALISLVLSCYYKLQVEDCISSKDPFEEEEFFAGIYSFQKKHGITRGTNPVY
FT                   LDDLTLQRLFEVSAKTSSSDIFKFKKVVKSTVSDITGKGNPMHLCNEILTTDLDVMVKN
FT                   IHSGSIGLLWRGKGRLRRNFYKGYDNFCEIKFSRGDPELLLEKQANEMQGDGSESQEST
FT                   SSADQEKNVFDNNLVRYSTSSSSVSASSMFCNYDKTTYATNFGLNKLYHGEYFRRNSMP
FT                   FLSDGTHDPMLETKKNDDTVKGLHRSNSLSQVQDVVEPWSLPFDPSVVRMARDLLKINN
FT                   LIQVQEREEKEKQTYMRENEVCHAGHGESFDTDFDHVLSGLQGCHQVYNHKVKKLEENN
FT                   KEVEKKQLLLFGEMRALSSLTSKFKYDMGILDMRMRDVEESISQFDKKLAAVQKLLVDQ
FT                   GLGKALGTELLVDKEQLESCLKDFLEAENTKYEGLCCRMCSKKYFKQIHNDLKAWTSWA
FT                   FNKFFNKDTKLTENEEIM"
FT   gene            complement(<113522..>114142)
FT                   /locus_tag="ZYRO0E01540g"
FT                   /old_locus_tag="ZYRO-ORF4180"
FT   CDS_pept        complement(113522..114142)
FT                   /locus_tag="ZYRO0E01540g"
FT                   /old_locus_tag="ZYRO-ORF4180"
FT                   /product="ZYRO0E01540p"
FT                   /note="similar to uniprot|P46671 Saccharomyces cerevisiae
FT                   YMR052W FAR3 Protein involved in G1 cell cycle arrest in
FT                   response to pheromone in a pathway different from the
FT                   Far1p-dependent pathway interacts with Far7p Far8p Far9p
FT                   Far10p and Far11p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01540g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30759"
FT                   /db_xref="GOA:C5E3Z8"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Z8"
FT                   /protein_id="CAR30759.1"
FT                   /translation="MDGSSSDNFEYILQLTKILSAECRANRQERDKVEHLFKRLAKQSY
FT                   VNYEQLSGNVSPRKKELFDKISTPTEEDQLIMQNYELVKQIELQEYMNNKVWLLINEIN
FT                   EHLSSIRNFVIERKLAASKDVTNFIDEKFTVNGQRLDMSCQVLRNEINVSKGKSELVIQ
FT                   EFKHLVQEIDWNLVPKNSKDFIKFQSKLKMLENRYNISIDLPI"
FT   gene            <114351..>114451
FT                   /locus_tag="ZYRO0E01562r"
FT                   /old_locus_tag="Zyro0E.tTrp_CCA_1"
FT   tRNA            join(114351..114386,114416..114451)
FT                   /locus_tag="ZYRO0E01562r"
FT                   /old_locus_tag="Zyro0E.tTrp_CCA_1"
FT                   /note="tRNA-Trp (CCA) cove"
FT   gene            complement(<114616..>116364)
FT                   /locus_tag="ZYRO0E01584g"
FT                   /old_locus_tag="Zyro0E.mRNA.5081.m"
FT   CDS_pept        complement(join(114616..115953,116050..116364))
FT                   /locus_tag="ZYRO0E01584g"
FT                   /old_locus_tag="Zyro0E.mRNA.5081.m"
FT                   /product="ZYRO0E01584p"
FT                   /note="similar to uniprot|P27697 Saccharomyces cerevisiae
FT                   YGL119W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01584g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30760"
FT                   /db_xref="GOA:C5E3Z9"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:C5E3Z9"
FT                   /protein_id="CAR30760.1"
FT                   /translation="MSTRRTLYHIYCLGSSARSVLSGSWDIGKESLGSWINTSTLTRPI
FT                   LNEYQWFYDPKWEEAKKLAEDTRNLHSGKPHLKKSRKKVGPTTKGTREYSTSTKVPPEE
FT                   EESQRPQRELQSSEVPSSRLARLFHYGSLAAGVGIHAATEGITEVAKGRTPTWKQLILS
FT                   DSNVERITKTFSQMRGAALKVGQILSFQDDKVLPRDLYEILSRVQNSAHYMPQRQLDKV
FT                   LKAEFGDNWKSNFAKFDRIPIAAASIGQVHNAVLPNGDKVVVKIQYPGVKDSIDSDLNN
FT                   IMMVLGASRLLPKGLFLDKTIDNARKELKWECDYVREAQCLQQFEKLLEDDPVFEVPHV
FT                   YPDLTTSNVITMSRMEGIEIMKLAPSTPQHLKDYIAGNIMKLCLQEIAVFHCMQTDPNW
FT                   ANFLYNHKTHKIELLDFGASRVFPDEFISDYRKLLTYATLGDHEMVRKLSQDLGYLNGL
FT                   ESQAMVDAHVRSVITLGEPFSGPIDKPFSFRDQTVSDRIRANIGLMLDERLCPPPEETY
FT                   SLHRKFSGIFLLCARMGATIPCSKYFHDFFHLE"
FT   gene            <116792..>119119
FT                   /locus_tag="ZYRO0E01606g"
FT                   /old_locus_tag="ZYRO-ORF4176"
FT   CDS_pept        116792..119119
FT                   /locus_tag="ZYRO0E01606g"
FT                   /old_locus_tag="ZYRO-ORF4176"
FT                   /product="ZYRO0E01606p"
FT                   /note="highly similar to uniprot|P53131 Saccharomyces
FT                   cerevisiae YGL120C PRP43 RNA helicase in the DEAH-box
FT                   family involved in release of the lariat-intron from the
FT                   spliceosome"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01606g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30761"
FT                   /db_xref="GOA:C5E400"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E400"
FT                   /protein_id="CAR30761.1"
FT                   /translation="MGTKRRLSEKAEHVSALESSVPERAAEIAEELNKKHPHQTEEKLV
FT                   HHDLGEFNSMVRHHTNASQAQKLEDGKVNPFTGRPFTAKYVDILKIRRELPVHAQRDEF
FT                   LKIYQENQIMVFVGETGSGKTTQIPQFVLFDEMPHLQNTQVACTQPRRVAAMSVAQRVA
FT                   EELDVNLGEEVGYSIRFENKVSNKTILKYMTDGMLLREAMEDHDLKRYSCIILDEAHER
FT                   TLATDILMGLLKQVVVRRPDLKLIVMSATLDAKKFQSYFHSAPLLAVPGRTFPVELYYT
FT                   PEFQRDYLDSAIRTVLQIHATEGAGDVLLFLTGEDEIEDAVRKIQLEGDQLVREEGCGP
FT                   LTVYPLYGSLPPHMQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFS
FT                   KQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEDAFKKELIEQSYPE
FT                   ILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLNDDGDLTPLGR
FT                   LASQFPLDPMLAVMLIGSFEFHCSQDILIIVAMLSVPSVFIRPTKDKKRADEAKNQFAH
FT                   PDGDHITLLNVYYAFKSDEVYEYGVQKWCRDNYLNYRSLAAADNIRVQLERIMVRYNLE
FT                   LNTTDYESPKYFDNIRKALASGFFMQVAKKRSGGKGYITVKDNQDVLVHPSTVLGHDAE
FT                   WVVYNEFVLTTKNYIRTVTSVRPEWLIELAPAYYDIHSFQKGDVRYSIERVKERMEQMQ
FT                   ELHNDKHKKKGKKEGKEKHKHT"
FT   gene            <119378..>119770
FT                   /locus_tag="ZYRO0E01628g"
FT                   /old_locus_tag="ZYRO-ORF4174"
FT   CDS_pept        119378..119770
FT                   /locus_tag="ZYRO0E01628g"
FT                   /old_locus_tag="ZYRO-ORF4174"
FT                   /product="ZYRO0E01628p"
FT                   /note="similar to uniprot|P53130 Saccharomyces cerevisiae
FT                   YGL121C GPG1 Proposed gamma subunit of the heterotrimeric G
FT                   protein that interacts with the receptor Grp1p involved in
FT                   regulation of pseudohyphal growth requires Gpb1p or Gpb2p
FT                   to interact with Gpa2p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30762"
FT                   /db_xref="GOA:C5E401"
FT                   /db_xref="UniProtKB/TrEMBL:C5E401"
FT                   /protein_id="CAR30762.1"
FT                   /translation="MTGLSESFLQLTMLGDGSPNEDVLQLLMYSNFREQLSESAQELHN
FT                   ITDRILVHRASRSVTSIEAHGLILPLMAMLIESRERAKRIYRDALSSRMSTTTDWNIDP
FT                   LCDEVHEELIRTNDLLKLYPRRESLW"
FT   gene            <120273..>121784
FT                   /locus_tag="ZYRO0E01650g"
FT   CDS_pept        120273..121784
FT                   /locus_tag="ZYRO0E01650g"
FT                   /product="ZYRO0E01650p"
FT                   /note="similar to uniprot|Q75E99 Ashbya gossypii AAR178C
FT                   AAR178Cp and some similarites with YGL122C uniprot|P32505
FT                   Saccharomyces cerevisiae YGL122C NAB2 Nuclear
FT                   polyadenylated RNA-binding protein related to human hnRNPs
FT                   has a nuclear localization signal sequence that binds to
FT                   Kap104p required for both poly(A) tail length control and
FT                   nuclear export of mRNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01650g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30763"
FT                   /db_xref="GOA:C5E402"
FT                   /db_xref="InterPro:IPR021083"
FT                   /db_xref="InterPro:IPR040366"
FT                   /db_xref="InterPro:IPR041044"
FT                   /db_xref="UniProtKB/TrEMBL:C5E402"
FT                   /protein_id="CAR30763.1"
FT                   /translation="MSSEQYTENLKIIVAEKLGTLENFNEDIKYVAEYIVLLMVNGGTL
FT                   ENVVHELSTLFDSVSTEALTDVVQTAFFALEALQQGETVDSIVGKIRGVLQQPVQQEQQ
FT                   PQPPQQEQQQQQQPPQPPAPMSAFGGIVSTEPPAKLNTTDFQPNFQQRNGAVGKGGRGG
FT                   RGGRGATRGAGRGASRNGNARFNPLAKALGINGEGAGNLNFVHSKKEGRCKVFPRCPLG
FT                   KSCPHAHPTKVCNDYPNCPKPPGTCEFLHPSEDEELMREIERTREEFQQRKAALLAAKA
FT                   KPVQTGIVICKFGILCSNPLCPFGHPTPANEDAKVLELMWCANNLTCQDPSCTRAHSSL
FT                   SKIRDVTPLGGPKKPPVVMAPRPVEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANC
FT                   TRIDCLFGHPINEDCKFGIDCRNPNCLFRHPTGRNIDANTNSGNGGAANAENTGVGEGF
FT                   STSQRLFAIPEGPHIEQSQAQGGGGLPSIYAPANAQNMDQDTDMN"
FT   gene            complement(<122203..>122961)
FT                   /locus_tag="ZYRO0E01672g"
FT                   /old_locus_tag="ZYRO-ORF4170"
FT   CDS_pept        complement(122203..122961)
FT                   /locus_tag="ZYRO0E01672g"
FT                   /old_locus_tag="ZYRO-ORF4170"
FT                   /product="ZYRO0E01672p"
FT                   /note="highly similar to uniprot|P25443 Saccharomyces
FT                   cerevisiae YGL123W RPS2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30764"
FT                   /db_xref="GOA:C5E403"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C5E403"
FT                   /protein_id="CAR30764.1"
FT                   /translation="MSAAAPEQRRGGFAGRNRGRFQRRGRNVEEKGWVPVTKLGRLVKA
FT                   GKLTTIEEIFLHSLPVKEFQIIDTLLPGLSDEVMNIKPVQKQTRAGQRTRFKAVVVVGD
FT                   SNGHVGLGIKTAKEVAGAIRAGIMIAKLSVIPIRRGYWGNNLGEPHSLATKTSGKCGSV
FT                   TVRLIPAPRGSGIVASPGVKKLLELAGLEDVYTQSTGSTRTLENTLKAAFAAIGNTYGF
FT                   LTPNLWAEHALPVSPLDIYADEAAVQKKRF"
FT   gene            <123505..>124060
FT                   /locus_tag="ZYRO0E01694g"
FT                   /old_locus_tag="Zyro0E.mRNA.266.p"
FT   CDS_pept        join(123505..123512,123613..124060)
FT                   /locus_tag="ZYRO0E01694g"
FT                   /old_locus_tag="Zyro0E.mRNA.266.p"
FT                   /product="ZYRO0E01694p"
FT                   /note="weakly similar to uniprot|P38325 Saccharomyces
FT                   cerevisiae YBR230C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01694g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30765"
FT                   /db_xref="GOA:C5E404"
FT                   /db_xref="InterPro:IPR039454"
FT                   /db_xref="UniProtKB/TrEMBL:C5E404"
FT                   /protein_id="CAR30765.1"
FT                   /translation="MSENEEKFSQKARAEARKTADQLKKDGEAAKDTVESWTEQLKKCV
FT                   ETASTSVSNGVSQAVSQARSATATAAAKARSIAGRSWEELHNPVVLLNFLLGSGALAGL
FT                   IAGYAQYDTRYLKGKSDGVILATVSGASAIVAIDALLSAKYYNKYRK"
FT   gene            <124257..>125786
FT                   /locus_tag="ZYRO0E01716g"
FT                   /old_locus_tag="ZYRO-ORF4168"
FT   CDS_pept        124257..125786
FT                   /locus_tag="ZYRO0E01716g"
FT                   /old_locus_tag="ZYRO-ORF4168"
FT                   /product="ZYRO0E01716p"
FT                   /note="similar to uniprot|P53129 Saccharomyces cerevisiae
FT                   YGL124C MON1 Protein required for fusion of cvt-vesicles
FT                   and autophagosomes with the vacuole associates as a complex
FT                   with Ccz1p with a perivacuolar compartment potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30766"
FT                   /db_xref="GOA:C5E405"
FT                   /db_xref="InterPro:IPR004353"
FT                   /db_xref="UniProtKB/TrEMBL:C5E405"
FT                   /protein_id="CAR30766.1"
FT                   /translation="MDLDESYVDDRRERANEPLYIPPIAAEPTTSINLAQTLFQPSEFD
FT                   ESLEDQLAQSISSCDRRHPLVSTEIPNVFPHRYDKNFLILTSAGKPIYAMKDGDGTIAY
FT                   MGVIHTIMNYFKLKEDQDLRCIENGDVRFAFLDREPIVLVAYSARGETSNELFSQLDFL
FT                   HSYLLSSLSERQLSKIFSKRQNFDLRNFLESTDFENLDEICSLLCERLYPDALLGALRS
FT                   LSMKKSHRAQLHEAMSQQLTKEKDLPRGTLLYGLIVAPENKLCSVLRPKGHTLHTTDLH
FT                   LLFCLIFHRFQNLDDSQELWVPICFPKFNANGFLYGYIKFLPKCNSILVLISAQKDAFF
FT                   NLKSFADHLIKDISSNGLLEEIHKAKGFKISDIPAPLVHHFIYKSKKHVQYVMPELELH
FT                   SDTEPEQLIELERKFMTYYQQIHNSVVRDDGLAFNKSCLNFIRWDSDAIEPSEEPIAML
FT                   GLGWITPKFELYLICNNGVDDKHVIFESAKRIISWCRKHESRLFVNEGAIF"
FT   gene            complement(<125883..>127247)
FT                   /locus_tag="ZYRO0E01738g"
FT                   /old_locus_tag="ZYRO-ORF4165"
FT   CDS_pept        complement(125883..127247)
FT                   /locus_tag="ZYRO0E01738g"
FT                   /old_locus_tag="ZYRO-ORF4165"
FT                   /product="ZYRO0E01738p"
FT                   /note="some similarities with uniprot|P40209 Saccharomyces
FT                   cerevisiae YMR136W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01738g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30767"
FT                   /db_xref="GOA:C5E406"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:C5E406"
FT                   /protein_id="CAR30767.1"
FT                   /translation="MRRKFNGMEHYHWIQSISSSIMTTETAETNVACKNLCNDAKGAQS
FT                   ALTLPTPPPLQPPPPTPTSTRANSTPVPPNSVIFQVVNRDNSSSLTHGFTPRVVPEFNS
FT                   STHGAVRNSAIRSTLNRETTRSTPAIVGHVRHASAPSAMMERSVPSRDSVFAPSPPSRK
FT                   PISDLLKIAKYMDDRGRNDLEDHEKDAALALLVLKECSRQVFDMSKGWSNLDSVPLCDF
FT                   VVAQRKCQTMLNSIENLKEMKIQARDTNGDVQISNAVEKPSTREKNVKFHEESYKSRSS
FT                   SVVSIVNVTTPLPEAPSAQREKAIAPRSSSMSSERTLTYSPLSSDRSTPTPVPLEKNNN
FT                   NNYSPYRPSSSPNTKSDSVFISLSDDDRKHMGKIGKTSKSGKNRNAHMRCLHCSSTETP
FT                   EWRKGPSGPTTLCNACGLFYKKLIKKFGEEVATSIMKSRQTEDPQNRKIPRFARL"
FT   gene            <127610..>130372
FT                   /locus_tag="ZYRO0E01760g"
FT                   /old_locus_tag="ZYRO-ORF4164"
FT   CDS_pept        127610..130372
FT                   /locus_tag="ZYRO0E01760g"
FT                   /old_locus_tag="ZYRO-ORF4164"
FT                   /product="ZYRO0E01760p"
FT                   /note="similar to uniprot|P38138 Saccharomyces cerevisiae
FT                   YBR229C ROT2 Glucosidase II catalytic subunit required for
FT                   normal cell wall synthesis mutations in rot2 suppress tor2
FT                   mutations and are synthetically lethal with rot1 mutations"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01760g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30768"
FT                   /db_xref="GOA:C5E407"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:C5E407"
FT                   /protein_id="CAR30768.1"
FT                   /translation="MQLSWFLQLLLFWCHLHLVSAFDRSVLKTCSSAGFCKRNRYYGES
FT                   IQGNNTSSSYYVIDESSVRYDGDEYSLHANVIKSIPSGIKVELPFTLQLLQDGNVVRFT
FT                   IDESRPHKDYLPKVLNQRRYNETSKWAFADVPSKVPIAKPRKIGNKIIVGSNSTDCRVE
FT                   ISLDSFLINVYWKNELSMVVNERSFLNYEHLRSEDENSKNLLPEESDFDMFHDSFNYSQ
FT                   SDTIPFGPESVALDFTFNEFENLYGLPEHPASFRIEETCGGEPYRLFAADVPRYDVGTR
FT                   MPTYGNIPFVIGNNEKSAAGLFWVNAADTWIDFKYPEGKAQSHWMSETGIIDVVMFLGD
FT                   TPMEIVDKYTNLTGRPALPKEAAVGHHQSRWNYYNESDVMNVDSNMEKGNFPYDIIWLD
FT                   LDYTDEKKFFTWKPDAFPNPARLLKKLGDLGRGLVVLIDPHLKKDYYYSNTVIKNEVAI
FT                   KNRTGDTFFGTCWPGVSVWIDTFSDLGSKVWGNFYNNFVNGTENLGIWNDMDEPSVFDG
FT                   IETTAPKNLIHAGGFEHRALHNAYSLTVHQATYNGLSNIFNGTARPFVLTRSHFAGSQR
FT                   TAGTWTGDNVASWNYLQISIPMVLTSNAAGMPFTGADIAGFLDNPEDELIVRWYQAGLW
FT                   YPFFRAHAQNETRRREPFLFKDPIKSYVRNAIQLRYHLLPTFYTAFFNSNLKGSPIMKP
FT                   MIFEKPKYTNFAAVDDQFYVGDSGILVKPITEKNVSFAYVQVADGVYYDFHDLKPQQTS
FT                   SKNDSSGIKCIGIEAGLDKIPALLEGGHIITKRDTYRKSSVYYRNDPYTLVIAPDAFGN
FT                   AQGELYADDGKTWDHKSGQYLHSVFSFQDFKSISGNTSNVPSNGEAAGNTLIDKIVIAI
FT                   GNNNSSIGDTVKVNRNGELHTVNVNKTSPFEAVISNPMVYANETWKIEL"
FT   gene            <130893..>133712
FT                   /locus_tag="ZYRO0E01782g"
FT                   /old_locus_tag="ZYRO-ORF4161"
FT   CDS_pept        130893..133712
FT                   /locus_tag="ZYRO0E01782g"
FT                   /old_locus_tag="ZYRO-ORF4161"
FT                   /product="ZYRO0E01782p"
FT                   /note="similar to uniprot|P38138 Saccharomyces cerevisiae
FT                   YBR229C ROT2 Glucosidase II catalytic subunit required for
FT                   normal cell wall synthesis mutations in rot2 suppress tor2
FT                   mutations and are synthetically lethal with rot1 mutations"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30769"
FT                   /db_xref="GOA:C5E408"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:C5E408"
FT                   /protein_id="CAR30769.1"
FT                   /translation="MLLHWFLQVLFFWSQLQTVSGFTQYLLKRCDQAGFCTRNRYYAEN
FT                   IQKTRASYYTIEDSSVHYDESDKTLYATIIKSIPPSEDKDSITKIELPFALQLLQDGSS
FT                   VRFIIDENRPHKDYLPEALNQRRYNETSKWAFTNLHKKIPYVKKGTTFNKHKIIVEEDP
FT                   DYVGNLSLELFTDSFLIKVYWKDELAMVVNERSLLNYEHLRAETENEQNLLPEESDFNM
FT                   FHDNFKYSKADTLPFGPESVALDFAFNGIENLYGLPEHPDSFRLKDTTDGEPYRLYSTD
FT                   VFRYDIGTKMPMYGNIPFVIGNNPKAAVGLFWVNAADTWVDLKYQKSKTQTHWMSETGV
FT                   IDVVLFFADTPDQILNKYTNLTGRPMLPKQAAVGYHQCRWNYNDELDVLTVDSNMDKGH
FT                   FPYDIIWLDIDYTDEKKFFTWKPSAFPNPARMLKKLAKLGRELVVLIDPHLKAGYEISD
FT                   EIIENDVAIKNQKGKTFYGTCWPGRSVWIDTFSELGRKVWGSFYDAFLNGAKNLNIWND
FT                   MNEPSIFDGPETTAPKNLIHDGGFEHRALHNAYSLTVHEATHDGLLEINNNSVRPFIIA
FT                   RGYFTGSQRTAGTWTGDNVATWDYLRVSLPMILSSNVAGMPFTGADIAGFFENPEDELV
FT                   VRWYQAGLWYPFFRAHAHIDSNRREPFLFKDPIKSYVRDAIQLRYTLLPTFYTAFFRSS
FT                   IDGTPIMKPMIFEKPQYPDLAAVDDQFYLGNTGILVKPILEKDVSITEIKVSEGVFYDY
FT                   YDLKPHYVNTFREGEDVVQKKRAHVVESISVRAGLDKIPILLEGGHIITKRDNYRRSSK
FT                   LYRNDPYTLVIAPDSFGDAEGELYADDGETLAHKNGEYLHTVFTLQHHELITGHPKNVP
FT                   SDHRTAGNTMINKIVIATGNKNRFNIKDTVKINRNGNFHTAKVIRTSPFEAVILHPMVY
FT                   ANETWQIDF"
FT   gene            complement(<133797..>134696)
FT                   /locus_tag="ZYRO0E01804g"
FT                   /old_locus_tag="ZYRO-ORF4159"
FT   CDS_pept        complement(133797..134696)
FT                   /locus_tag="ZYRO0E01804g"
FT                   /old_locus_tag="ZYRO-ORF4159"
FT                   /product="ZYRO0E01804p"
FT                   /note="similar to uniprot|P38324 Saccharomyces cerevisiae
FT                   YBR228W SLX1 Subunit of a complex with Slx4p that
FT                   hydrolyzes 5' branches from duplex DNA in response to
FT                   stalled or converging replication forks function overlaps
FT                   with that of Sgs1p-Top3p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01804g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30770"
FT                   /db_xref="GOA:C5E409"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR027520"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:C5E409"
FT                   /protein_id="CAR30770.1"
FT                   /translation="MDQQSSKPVPVFYCCYLLQSICKRQSFYIGSTPNPVRRLRQHNGI
FT                   LTRGGAYRTRREGTRPWEVIMVVYGFPSKITALQFEHAWQHGYKTHYIADDERIVRNKN
FT                   GGRTIHHKLGTARLLAKNIYFQRMDLVVHFFNADVESIWIQNKYNINDMGLITVENSPS
FT                   PTIAPTVENAVDYSESNLKLVEQFLNGFFDRDMGVCQIYRERLTFGEIPCGICQTTFDY
FT                   TSDNPQLKPFIAFCVHEDCSFVAHLGCLHRYFLDEEQLQDGIRNLIPRYGKCPDCSQIV
FT                   KWTHLVKYSSMLKSSHGT"
FT   gene            <134806..>136320
FT                   /locus_tag="ZYRO0E01826g"
FT                   /old_locus_tag="ZYRO-ORF4158"
FT   CDS_pept        134806..136320
FT                   /locus_tag="ZYRO0E01826g"
FT                   /old_locus_tag="ZYRO-ORF4158"
FT                   /product="ZYRO0E01826p"
FT                   /note="similar to uniprot|P38323 Saccharomyces cerevisiae
FT                   YBR227C MCX1"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01826g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30771"
FT                   /db_xref="GOA:C5E410"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E410"
FT                   /protein_id="CAR30771.1"
FT                   /translation="MIRSSLGSFKRFYSASPSAIASQKLAQGRLPSIPTPRNIKAHLDD
FT                   YIVGQDKSKKVLSVAVYNHYLRNHDKSRKSELQKARTLIWEETQRREKERQDKLGYESS
FT                   ESKAGLKNLQQQLLAHPDDDLVLSKSNLMMIGPSGSGKTLMATTLAKMLDVPIAITDCT
FT                   QLTQAGYIGDSVEVCIERLLVNADFDVSKAERGIIVLDEVDKLAKPAANIGTKDVSGEG
FT                   VQQALLKIIEGHNVEVTVKRPVKQGTDNKNNQTAAKKDETFVIDTSNILFMIMGAFVGL
FT                   DKRIVKRVKGDRGLDESKEEKDSKEEIEKLRFSNTIEQIDLGNGKKETALNLVTPTDLI
FT                   SFGLIPELIGRVPIITALQPLERDDLYHILKEPKNALLEQYRYIFKQFGVQLCITEKAL
FT                   QRVAQFALREGTGARGLRGIMERLLLNVNYECPDSGISYALVTEETVNSLQEKDYSLST
FT                   NVDVKYYSRGERDQFIEDTYKEDPKLGKELDSQFGRISTREKEGKL"
FT   gene            complement(<136541..>138976)
FT                   /locus_tag="ZYRO0E01848g"
FT                   /old_locus_tag="ZYRO-ORF4155"
FT   CDS_pept        complement(136541..138976)
FT                   /locus_tag="ZYRO0E01848g"
FT                   /old_locus_tag="ZYRO-ORF4155"
FT                   /product="ZYRO0E01848p"
FT                   /note="similar to uniprot|P38321 Saccharomyces cerevisiae
FT                   YBR225W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01848g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30772"
FT                   /db_xref="GOA:C5E411"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E411"
FT                   /protein_id="CAR30772.1"
FT                   /translation="MGSDGFKTSRDNVYGSGGSAKNTSIGNSDVGSIGSRTSRESTGSH
FT                   RDKMRGEISKLQEEIASVKGDDLQDLMSNKDKSVSSSSTISPKPSRRRNMHPTDFNDTK
FT                   SSKLNQVQSMDTIDSDAFDNTESSSDNNTNNNNNDNEDKDFGLTPAFSIHGNTSKVAAN
FT                   LHRRRVVDWNMLPRLGSSVLVKHQSFNVINIPIDGELKQILYTPSYNENFKPMNIFLSF
FT                   NMDSKSKEAQLYSKKRLNSFGAYIGHYLKSRLYAYQRFPFYQQDAPIDRNYASYDASKD
FT                   YSEIETVISLWYMQSQRCISQSNSTFFSADVVQHLLQRKANTRHQASQPTAIYVPQTGA
FT                   TLMTSKPSMIETTDDIDILLLRPYQEARLGWQLAYDEPNLKIADYPIDVSPWMMDESDT
FT                   RAVLGSDNSKSTSSMVNIVNDEAELVEVTNENAGRYLLDCMGRRSGSLYMDEMSSPITK
FT                   GFGQTPGNEVTPTNSLDSSADRESPSSSAYPEPSRKKVASKLGKKTGLSSLFKRKHQAP
FT                   TTPSAGSSSAAAAAASAATSSSSSATKKDHPTTDGQGHPVENAWLESYFSRYLSNYKRI
FT                   DLPTQFLLPKEAQDTPKTTSSSTSNNQDISDSRNALLYSKESLQLRLPFADDSIPAIFC
FT                   PRVWMGLAFNKWRNLLREMHRVLLPGGYALASVIDIGILNSFASATDESMQEFPTTQER
FT                   DRILDAISLAAIEKGVHIHPTQHLAQAFKDVGFTNLRYSVLSLKTGDCATEMGCLYEIY
FT                   SEITWDLLFRKFLPDPTAPPKGTDPTTLFRRFIKEHMGKVDDTAGSLKVLYLVAQKAR"
FT   gene            complement(<139487..>141286)
FT                   /locus_tag="ZYRO0E01870g"
FT                   /old_locus_tag="ZYRO-ORF4152"
FT   CDS_pept        complement(139487..141286)
FT                   /locus_tag="ZYRO0E01870g"
FT                   /old_locus_tag="ZYRO-ORF4152"
FT                   /product="ZYRO0E01870p"
FT                   /note="highly similar to uniprot|P53128 Saccharomyces
FT                   cerevisiae YGL125W MET13 Isozyme of
FT                   methylenetetrahydrofolate reductase catalyzes the reduction
FT                   of 5 10-methylenetetrahydrofolate to 5-
FT                   methyltetrahydrofolate in the methionine biosynthesis
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30773"
FT                   /db_xref="GOA:C5E412"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C5E412"
FT                   /protein_id="CAR30773.1"
FT                   /translation="MRISEKLQNHRSKSTKPTFSFEYFVPKTTQGVQNLYDRMDRMYQS
FT                   TLPQFIDVTWNAGGGVLSQLTTDLVETSQSVLGLETCMHLTCTNMPVSQIDDALESARL
FT                   SGCQNILALRGDPPVNSDSWQPVEGGFQYAKDLVRYIRDKYGDYFDIGVAGYPEGHPET
FT                   AGDDETLLDHLKEKVDAGANFIITQMFYDADLFIKWCQRVRAKGVDVPLIPGIMPITTY
FT                   AAFLRRANWCDVHIPQEYFDRLDPIKDDDQLVREVGTDLIVSLCQKLLDSGYVSHLHIY
FT                   TMNLEKAPQMILDRMELLPSHDEPLDNHLAILPWRKSLNPQRRNEEVRPIFWQRRPYSY
FT                   VARTSQWSVDEFPNGRFGDSSSPAFGDLDLCGASLIRQSGKKSLELWSAPNSMEDIAQL
FT                   VINYLRGELKYLPWSDTSLNHEVDDILPELVTLNQKLIITINSQPQLNGVKSSHPVHGW
FT                   GPRDGYVYQKMYLEFLLPKEKLSKLHDCLVNDVMLTYFAVDHNGNLTTNHQDGTRANAV
FT                   TWGIFPGREVLQPTIVEKVSFLAWKQEFYHICEEWKLNFINHRCDQSVKLLQHLIDDYV
FT                   LVNIVDNDFISPENRIFNLLSSI"
FT   gene            complement(<141666..>141857)
FT                   /locus_tag="ZYRO0E01892g"
FT                   /old_locus_tag="ZYRO-ORF4151"
FT   CDS_pept        complement(141666..141857)
FT                   /locus_tag="ZYRO0E01892g"
FT                   /old_locus_tag="ZYRO-ORF4151"
FT                   /product="ZYRO0E01892p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30774"
FT                   /db_xref="UniProtKB/TrEMBL:C5E413"
FT                   /protein_id="CAR30774.1"
FT                   /translation="MSGLSKCVVTLLGQPGVDERDHRTSHPSHTLRFITPKSKLVEADE
FT                   IPLKESIFLQTELNCVYR"
FT   gene            <142718..>144259
FT                   /locus_tag="ZYRO0E01914g"
FT                   /old_locus_tag="ZYRO-ORF4149"
FT   CDS_pept        142718..144259
FT                   /locus_tag="ZYRO0E01914g"
FT                   /old_locus_tag="ZYRO-ORF4149"
FT                   /product="ZYRO0E01914p"
FT                   /note="similar to uniprot|P38319 Saccharomyces cerevisiae
FT                   YBR223C TDP1 Tyrosine-DNA Phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01914g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30775"
FT                   /db_xref="GOA:C5E414"
FT                   /db_xref="InterPro:IPR010347"
FT                   /db_xref="InterPro:IPR027415"
FT                   /db_xref="UniProtKB/TrEMBL:C5E414"
FT                   /protein_id="CAR30775.1"
FT                   /translation="MVSDTRKRVAERWSRVDYRSGAIEPAVKKPKSEVIDLTGSDSDNS
FT                   DNGDQEEQGPPVKPNYPFKLVKSQIFDKNLKNSHHLIDLRDVLHDPSLRKSFLFSFQYE
FT                   LDFLLEQFHPNVQKIVLVAQEGTVLPPTTPKALSWVGKTHLCEFRMPPFTCHHSKLIIN
FT                   VYQDGSLQLFMPSNNFTYAETNYPQQVCWVSPRLSACASPASSSFQSDLLNYLKSYDLR
FT                   EINRYIIPEVEKFNFEPLEGTEFVYSTPSKDYLSGFQLLAQKLRYKKENGDTSIKHHLS
FT                   HYLCQSSSVGNSLSRKEPCNLLTHMIIPVLEGIIPKDSKKLPSTSQLLEDYRSHHIVPY
FT                   LLYPTVQEIVDSPVGWLCSGWFNFNYNKDMAHYNMLRDEFNIFHKQKKSQLSPQRRATP
FT                   SHSKFYMKSTTRNPNEKPFRELDWCLFTSANLSFSAWGKTSAKPRNYEVGILLKSPDLR
FT                   CQSFVDLIYNTKLQNDSENTNGTTVAVPWTPDLEPYEKIDETFCISKDYSQLSSS"
FT   gene            <144459..>146066
FT                   /locus_tag="ZYRO0E01936g"
FT                   /old_locus_tag="ZYRO-ORF4148"
FT   CDS_pept        144459..146066
FT                   /locus_tag="ZYRO0E01936g"
FT                   /old_locus_tag="ZYRO-ORF4148"
FT                   /product="ZYRO0E01936p"
FT                   /note="highly similar to uniprot|P38137 Saccharomyces
FT                   cerevisiae YBR222C PCS60"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01936g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30776"
FT                   /db_xref="GOA:C5E415"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5E415"
FT                   /protein_id="CAR30776.1"
FT                   /translation="MAPSFNETFAVSDNVAVIVPETGVQVTYRELSHQVGHFQNVFNDP
FT                   ESPLYNVIGRQSPVAISLRNGLEFIVSFLGTTMDGKVGAPLNSNYREQEFNFYLEDLKA
FT                   KAVVVPKGTVKETPTAEIVKSAKKFECFIVEVFFDVKRFRLEYDVYSAKDGYSKVQYSS
FT                   LNNAVFFNLDDKKFPGFARSNDVALVLHTSGTTSRPKTVPLLHLNIVRSTENISNTYKL
FT                   TPQDRSYVIMPLFHVHGLIGALLSTFRTQGSVVVPEKFGAKRFWDDFVKYGCNWFSCVP
FT                   TISMIMLSMPRPTPFPNIRFIRSCSSALAPTTFQKLEQAFQAPVLEAYAMTEAAHQMTS
FT                   NNLPPGKRKPGTVGQPQGVEIVILDEKDNKLPQGKIGEVSIRGENVTPGYANNAKANLE
FT                   NFTRRENYFRTGDQGFFDQEGFLVLTGRIKELINRGGEKISPIELDGAMLSHPAVKEAV
FT                   SYGVPDEKYGQAVHAAVVLESGKTLTPQDLADHMKQRVSAYKVPVEFNFADKLPKTATG
FT                   KIQRRIIAEAFSKKQSKL"
FT   gene            complement(<146255..>147184)
FT                   /locus_tag="ZYRO0E01958g"
FT                   /old_locus_tag="ZYRO-ORF4146"
FT   CDS_pept        complement(146255..147184)
FT                   /locus_tag="ZYRO0E01958g"
FT                   /old_locus_tag="ZYRO-ORF4146"
FT                   /product="ZYRO0E01958p"
FT                   /note="similar to uniprot|Q12289 Saccharomyces cerevisiae
FT                   YOR100C CRC1 Mitochondrial inner membrane carnitine
FT                   transporter required for carnitine-dependent transport of
FT                   acetyl-CoA from peroxisomes to mitochondria during fatty
FT                   acid beta-oxidation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01958g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30777"
FT                   /db_xref="GOA:C5E416"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E416"
FT                   /protein_id="CAR30777.1"
FT                   /translation="MSEPESPVVQEETREETRKEIPAASALMQNAKSLTAGAVGGVFAV
FT                   LTGHPFDLLKVRCQSGQASSMSHAVKEILQESRGSLVASVRGFYRGVIPPLLGVTPIFA
FT                   VSFWGYDMGKKIVAYDQPLSQQPLTTSQLATAGFISAIPTTLVMAPTERVKVVLQTTEG
FT                   YTFGSAAKKLVQDGGVQSLFRGSLATLARDGPGSALYFAAYEVTKKALAKPGEEEFSVT
FT                   KTSIAGGMAGVAMWTGVFPIDTVKTKLQAGEERSSFKNAVKQIYVTRGGLKGFFPGLGP
FT                   ALLRSFPANAATFVGVELTHSTFKKMNI"
FT   gene            complement(<147587..>148774)
FT                   /locus_tag="ZYRO0E01980g"
FT                   /old_locus_tag="ZYRO-ORF4145"
FT   CDS_pept        complement(147587..148774)
FT                   /locus_tag="ZYRO0E01980g"
FT                   /old_locus_tag="ZYRO-ORF4145"
FT                   /product="ZYRO0E01980p"
FT                   /note="similar to uniprot|P27810 Saccharomyces cerevisiae
FT                   YOR099W KTR1 Alpha-1 2-mannosyltransferase involved in O-
FT                   and N-linked protein glycosylation member of the KRE2/MNT1
FT                   mannosyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E01980g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30778"
FT                   /db_xref="GOA:C5E417"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5E417"
FT                   /protein_id="CAR30778.1"
FT                   /translation="MKPAGDRRRLNRLLGYAAIALITIYVLYKGAQRNGNGFYGSSAAT
FT                   RQVEKDGNIYRELVSSNNGALDRSGLEKATFVTLVRNSDLYGLIPSIKSVEDRFNHKYG
FT                   YDWVFLNDEPFTEEFINVTSALVTGETKYGFIEKKDWDFPPWIDQNRAAGTRDRMGKEG
FT                   IIYGNSISYRFMCRYESGLFYRHPIFNDYEWYWRVEPDVKLHCDVNYDVFKFMRENNKK
FT                   YGFTISIKEYSATIETLWDATLSFLEKHPEHVNKNCMLDFISDDGGSSYNLCHFWSNFE
FT                   IASLDLWRSDAYRDYFDFLDQWGGFFYERWGDAPVHSIAASLFLDRDEIHHFGDFGYFH
FT                   VPFHQCPVDDETRLSLKCDCNPNEDFTWHSYSCTTKYYTVNQLRKPSNWLDHATS"
FT   gene            <148958..>151744
FT                   /locus_tag="ZYRO0E02002g"
FT                   /old_locus_tag="ZYRO-ORF4143"
FT   CDS_pept        148958..151744
FT                   /locus_tag="ZYRO0E02002g"
FT                   /old_locus_tag="ZYRO-ORF4143"
FT                   /product="ZYRO0E02002p"
FT                   /note="some similarities with uniprot|P14907 Saccharomyces
FT                   cerevisiae YJL041W NSP1 Essential component of the nuclear
FT                   pore complex which mediates nuclear import and export"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30779"
FT                   /db_xref="UniProtKB/TrEMBL:C5E418"
FT                   /protein_id="CAR30779.1"
FT                   /translation="MSLAASERPKRSISSTIKEFIWGKPSRNQFTAFPERSEQEKPSQN
FT                   DVPKNVEPIGLSEPREGFPEFVIVYEGNSQVRPPVLPILPVQRLRLLRQKQEWRKRHDL
FT                   NLLYLSPSNVASSSPSKLNISNLSYKSSSTPSPTKMNHVVAPPLKRKKTSNNGGKGTKW
FT                   SAEFEYDLAEYDTVERPGTPPVQNELPFDQVSAHKTVVGPLKTSLLDQDVNSNQLSSIQ
FT                   RKVLLNGPQSILPRRDSDKKENVEKPVKMGEKVILPSVGFDFIKSSDTPSKVKTQQRDE
FT                   EDEEEEPKRKRKLTEPAQPSFKFGTGPAEKKDEKKQLTGFGAKKDEQSKPSFSFGEKKD
FT                   EQPKPAFSFGAKKDEQPKPAFSFGAKKDEPPKPAFSFGAKKDEQPKPAFSFGAKKDEPP
FT                   KPAFSFGEKKDEPAKPSFSFGTKKDELAKPSLSFGDKKDEPAKPSFSFGAKKDESAKPS
FT                   FSFGAKKDENETSKPTLNFGAKKDDNEPAKPSFSFGAKKDDNEPTKPSFSFGAKDDEKS
FT                   KPTASFGAGVTTAPSFDLGSKKDEPAEKPKPAFSFGTRPNEKPSFAFGAKDDDPAKKKP
FT                   AFSFGAKQDESKQDDKADSKPPFSFGAGADGPSKPTFSFGAKKEGTVFDKPTPPLAQDA
FT                   SKQDGKSSGFSFNRLSQGAQPPSLGASAPVAAPSAPTFSFGSGANDKPPASNGPSVFAP
FT                   TPQAAEKPFPFSRPNSNPSWPSQPGSAASAPGDNPPSMNFKFGSGSGSSMPAAAPPPAS
FT                   TNPLVSNPFVNKPSGFAFGSNSAAPFGASQAPSPSPGAPAPAFGNAASVSPAFGKSASP
FT                   PVMPNFDPTKRAFTPSNSINLNFGGNAASTDPSRIFSGGSTNSQPMPGTASTPQQVFGG
FT                   SQPPAPIFGNGPQPPVGAAGFNGAAPGMPSNPPQPPMSNFQLPPGRRLARMRQSRRA"
FT   gene            <151924..>152469
FT                   /locus_tag="ZYRO0E02024g"
FT                   /old_locus_tag="ZYRO-ORF4137"
FT   CDS_pept        151924..152469
FT                   /locus_tag="ZYRO0E02024g"
FT                   /old_locus_tag="ZYRO-ORF4137"
FT                   /product="ZYRO0E02024p"
FT                   /note="some similarities with uniprot|Q12274 Saccharomyces
FT                   cerevisiae YOR097C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02024g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30780"
FT                   /db_xref="GOA:C5E419"
FT                   /db_xref="UniProtKB/TrEMBL:C5E419"
FT                   /protein_id="CAR30780.1"
FT                   /translation="MEKFKPLIDEWAAKVSAKVRTEPTNVIHLPSFLLGCFVTVTIFSL
FT                   IPVMKLFLGSLLSTVVTLLKYLVIGGGIIACIMVITTRGGEDTSKSKSLRHDKQELLPK
FT                   KEQIPKVKPTAVPQPLPQATVYPPHDGSGLVKDDFEGIRHCDISIASSQHQNRRKVPTD
FT                   ERAYNSFINRAAMKNVAG"
FT   gene            complement(<152683..>153252)
FT                   /locus_tag="ZYRO0E02046g"
FT                   /old_locus_tag="ZYRO-ORF4135"
FT   CDS_pept        complement(152683..153252)
FT                   /locus_tag="ZYRO0E02046g"
FT                   /old_locus_tag="ZYRO-ORF4135"
FT                   /product="ZYRO0E02046p"
FT                   /note="highly similar to uniprot|P26786 Saccharomyces
FT                   cerevisiae YOR096W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02046g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30781"
FT                   /db_xref="GOA:C5E420"
FT                   /db_xref="InterPro:IPR000554"
FT                   /db_xref="UniProtKB/TrEMBL:C5E420"
FT                   /protein_id="CAR30781.1"
FT                   /translation="MSTHTKILSQAPTELELQVAHAFTELENSSPELKAELRPLQFRSI
FT                   REIEVAGGKKALAIFVPVPSLNAYHKVQTKLTRELEKKFPDRHVIFLAERRILPKPSRR
FT                   SRQLQKRPRSRTLTAVHDKILEDMVFPTEIVGKRVRYLVGGNKIQKILLDSKDVQQVDY
FT                   KLESFQAVYNKLTGKQIVFEIPGETH"
FT   gene            <154407..>155312
FT                   /locus_tag="ZYRO0E02068g"
FT                   /old_locus_tag="ZYRO-ORF4132"
FT   CDS_pept        154407..155312
FT                   /locus_tag="ZYRO0E02068g"
FT                   /old_locus_tag="ZYRO-ORF4132"
FT                   /product="ZYRO0E02068p"
FT                   /note="highly similar to gnl|GLV|CAGL0L03740g Candida
FT                   glabrata CAGL0L03740g and similar to YOR095C uniprot|Q12189
FT                   Saccharomyces cerevisiae YOR095C RKI1 Ribose-5-phosphate
FT                   ketol-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02068g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30782"
FT                   /db_xref="GOA:C5E421"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5E421"
FT                   /protein_id="CAR30782.1"
FT                   /translation="MIIPSITKGLVFRSLTSISALSCSSKRLMASIKIPKISELPSLGL
FT                   PLENAKRAAAYRAVDENLDVYQHRVIGIGSGSTVIYVAERIGQYLRDDEYRDYVSKFKC
FT                   VATGYQSKQLIMDNGLTYAILEQHPHIDIAFDGADEIDCNLDLIKGGGGCLFQEKLIST
FT                   SAKIFVVVADTSKKSPRRLGSHWVQGVPIEVVPAAYNRVQDDLLNLLGAKTATLRQGGK
FT                   VKMGPVVTDNNNFILDTHFGDIDDPKKLHDNIKALVGVVETGLFIGNAAKAYLGSPDGD
FT                   VLITSRENPAELQNETIMEQ"
FT   gene            complement(<155560..>156105)
FT                   /locus_tag="ZYRO0E02090g"
FT                   /old_locus_tag="ZYRO-ORF4131"
FT   CDS_pept        complement(155560..156105)
FT                   /locus_tag="ZYRO0E02090g"
FT                   /old_locus_tag="ZYRO-ORF4131"
FT                   /product="ZYRO0E02090p"
FT                   /note="highly similar to uniprot|P40994 Saccharomyces
FT                   cerevisiae YOR094W ARF3 Glucose-repressible ADP-
FT                   ribosylation factor GTPase of the Ras superfamily involved
FT                   in development of polarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02090g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30783"
FT                   /db_xref="GOA:C5E422"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E422"
FT                   /protein_id="CAR30783.1"
FT                   /translation="MGNSVSRALGKLFGSREMKILMLGLDNAGKTTILYKLKLNKIRTS
FT                   APTVGFNVETVSYKNVKFNMWDVGGQERLRPLWRHYFPATTALIFVIDSHDKERLQEAK
FT                   EELYAIISEKEMENVVLLVWANKQDLKGSLKPQEVSDYLELGQNLKNQLWCVVGSNALT
FT                   GQGLVEGLSWISNNTPKK"
FT   gene            <156455..>156527
FT                   /locus_tag="ZYRO0E02112r"
FT                   /old_locus_tag="Zyro0E.tLys_CTT_2"
FT   tRNA            156455..156527
FT                   /locus_tag="ZYRO0E02112r"
FT                   /old_locus_tag="Zyro0E.tLys_CTT_2"
FT                   /note="tRNA-Lys (CTT) cove score=75.47"
FT   gene            <157127..>162079
FT                   /locus_tag="ZYRO0E02134g"
FT                   /old_locus_tag="ZYRO-ORF4129"
FT   CDS_pept        157127..162079
FT                   /locus_tag="ZYRO0E02134g"
FT                   /old_locus_tag="ZYRO-ORF4129"
FT                   /product="ZYRO0E02134p"
FT                   /note="similar to uniprot|Q12275 Saccharomyces cerevisiae
FT                   YOR093C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30784"
FT                   /db_xref="GOA:C5E423"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010506"
FT                   /db_xref="InterPro:IPR037337"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5E423"
FT                   /protein_id="CAR30784.1"
FT                   /translation="MPDLSVPPNLPIHLRNQISELVRDYKEENLTLKGYEAKRKHLLDQ
FT                   YANGQRFPLAPLRSPTRRPPAFHKRNQSWGSSIWSHGGSFFNDTNSIASSVYQGNPADH
FT                   NSDGGSEAPYMFQRGQSGRQSVYRVTTVNSNSGYSTPRARHNESSVHLSIPSNEISGVP
FT                   YNPMIPLLPREENPTNSDSLTSVLRGRFENYPGETAMISVNEKGKETYISWDKLYLRAE
FT                   KVAHILSKEKLYKMDKVLLWYNKNEIIDFTVALLGCFIASMVAVPVSFEIYSLGEITEI
FT                   IKLTSSKSVLISEDCYEQLENLYSTSNHNRIKVIRSEFFSQISFIKTDDLGQYSKAKKT
FT                   TPTFDIPNISYIEFTRTPLGRLSGVVMKHKILSNQNNIFTNILNSRAMPHWKKGNVKKA
FT                   FKKRDSSERYNILNSLDPTRSTGLVLGVFFNIFSGNLLISVDHRLLQKPGAYENLIEKY
FT                   KADILLNEQLQLKQVVINYLEDPQSTISKKHRIDLSCIKCCLTCCTTIDTDVLDMIVQK
FT                   WLKNLGCIDASTCYSPILTLPDFGGVFLSVRDQLGKLDNFQIHESKLRLQDELFINKEK
FT                   LRGNIVEPSITAMINSSSSFKDYLRVTSFGFPIPDAMLCVVNPDDNTLVPDLTVGEILV
FT                   RSDSLTDEFYQMDRVNNFVFKARLNYPKMYSFLTSEITSPTAGDRLSTIMNICPSTIFF
FT                   LRTKLMGFVHNGKIYVLSMVEDMFLQNQLIRLPNWAHTSDVRKARKPSSEGDKGSDTMS
FT                   LASTNLKTGKDEKDIRRVVQTYYLQQVTETLVRTVSTVYEVSAFELNHNKDEHFLVVVV
FT                   ESSLSKLPTSHSTSVTEAESQKKTTEKKMNELIDQVYRILWIFHKIQPTCVMVVPLESL
FT                   PRRYCSLEIANSTVEKKFLNGELPATFVKFQFDNVILDFVPHSVFYNESIFSEHLSNMR
FT                   RTAFLEEYRATHPNFSLDQQYPLPDETPWQSSGIDYRETSIDLRTHKSLASFPSILDIL
FT                   EWRIRETGNEFAFSDGVTIGYSSNNENAHKKVSWKAFERIIAAFLKKIVESKTPLKRGD
FT                   KVVIVCENSVEYTAIVIACMYCNLVIIPYPIFREENIEEDVSYLVKVIRAYGVKRIFMD
FT                   LTTHNIFEDNPILTKILKRCKHDIPKITVFSKVKKKNNLTINMFASQLRTKFGPKPGLN
FT                   HNSHPCVIWIDDEFDIKKDIHVVMNHASLMNSLKILKETLGLSSENPIFSLCSYTVGMG
FT                   FMMSCMVGIYVGCTTSLFSLDEVYSNPSGFLIGLQNMNVKDLYLNFETFCILTEKANEL
FT                   VEGNKGKLSSLEKSSKKHTPTPTLLKPDFLRNVQNLMIPFSGRPNTKRIEELLRRNTNI
FT                   TISRAQINYLYRNHLNPHISLRSYLGSPPVDMYLDSIALREGIIKTVNPAEVSPRGYIR
FT                   VQDSGIVAVCTDVSIVNPETNLPCSNGELGEIWCCSEGNVHDYYICQDANDVTGKPTLT
FT                   NDPFITNQFKSKLQTDVDNGLTYLRTGDLGFIKRVTCADSAGNSLDLNLLFVLGSINET
FT                   VEILGLAHFVRDLEKTIRHTHPSIQKCIVSKAGGLLVCLVKCRDNSNAKFANLAALIVS
FT                   ELLKNHGVILDLCAFVSQDPSQVNLPSEWDKNRLTVMESWLDQKLKIEAQFGINYGENI
FT                   SIYLLSEFERNS"
FT   gene            complement(<162220..>163944)
FT                   /locus_tag="ZYRO0E02156g"
FT                   /old_locus_tag="ZYRO-ORF4127"
FT   CDS_pept        complement(162220..163944)
FT                   /locus_tag="ZYRO0E02156g"
FT                   /old_locus_tag="ZYRO-ORF4127"
FT                   /product="ZYRO0E02156p"
FT                   /note="similar to uniprot|Q99252 Saccharomyces cerevisiae
FT                   YOR092W ECM3 Non-essential protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02156g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30785"
FT                   /db_xref="GOA:C5E424"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR040254"
FT                   /db_xref="UniProtKB/TrEMBL:C5E424"
FT                   /protein_id="CAR30785.1"
FT                   /translation="MSVPLGDIIWTCFKPMIKIYLIIGTGFGLAKINILSVEATRAISD
FT                   IVLTLLMPCLAFSKIVGNIQDSDIKNVAIVCLSSLLIFGTGLFGAFVISKTMPVPKQWR
FT                   GGILAGGMLPNISDLPIAYIQTLDQGLVFTEEEGNKGVANVIIFLTMFLLCLFNLGGFR
FT                   LIESDFKYNDEESGSTEADNYEPTQQLSIPDENSSSELSGKEAYGQVQKPPSSASPLEN
FT                   LSRSPSHNHPPSIASNPTTVASSPNGYNNPERSQPLAYTQNSQTGSLRMRRPSVSESIR
FT                   TIDRREMPPEDVTHLIREYSNVDQYGHRRRSTTARSTSNDFGELPRTSTRGQSSMERIR
FT                   SSTLTRMLTSDATVGKEDIEDSGKGSLPKWMRKVRITKYFIFFLKNCLRPCSLAVIVAL
FT                   TIAFIPWVKALFVSGPGIPHINQAPDQQPPLSFIMDYTSYIGAASVPFGLLLLGATLGR
FT                   LKIKKLYPGFWKSALLLVCLRLCIMPILGVLWCNRLVRAGWLHYDEDKMLLFVIVLDWG
FT                   LPTMTTIIYFTASYTPPDAKETVQMDCVSFFLMIQYPILAISLPFLASFYIKVKLKA"
FT   gene            <164488..>164840
FT                   /pseudo
FT                   /locus_tag="ZYRO0E02178g"
FT                   /old_locus_tag="pseudo-Zyro0E-164488-164840"
FT   gene            complement(<165393..>167327)
FT                   /locus_tag="ZYRO0E02200g"
FT                   /old_locus_tag="ZYRO-ORF4122"
FT   CDS_pept        complement(165393..167327)
FT                   /locus_tag="ZYRO0E02200g"
FT                   /old_locus_tag="ZYRO-ORF4122"
FT                   /product="ZYRO0E02200p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30786"
FT                   /db_xref="GOA:C5E425"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E425"
FT                   /protein_id="CAR30786.1"
FT                   /translation="MTYEKGPILEQFTHEELANQVTPDSEQLDKEAGKVERGNKLSKLS
FT                   PEVVAQMGREFAEEFELPNDDDIFARAAMLARNPDGFNDFDFLSDEEKQACWAEEYKPW
FT                   SSMTRQLIAIICAAAMSAAVQGMDETVINGAMLFYPEVLGLGSGSKRDSWIEGLINGAP
FT                   YLCCAGFSCWTTDWLNNRLGRKNVIFVTCGISAVTCFLQGFAPTGVRGWHYLFAFRFLL
FT                   GLGIGPKSATTNVYLAECATRQIRGCTTIFWQFFTAFGIMWGYVFTLIFYRVKPNGVHG
FT                   GLNWRLTLGSAMLPALLVMIQIPFCPESPRWLMGKNRYREALENTIKIRPHKILACRDI
FT                   FYQHVLLAEEESLQLPFWIRLKQMVTVRRNRNGLLASCICAFMQQFCGINVIAYYSSSI
FT                   FVESGFSEISALCSSLGFGLINFFFAIPTFFMIDKRGRRYLLLRTFPWLALFLLIAGFA
FT                   FWIPGTQARIGVVTMGIYVFSAIYSFSCGPVPFLIAAESANLASRSLNSSIFTVVLWGF
FT                   NFILSVTWPSMVRAMKPQGAFGFYAFWNAAGFFMVYFCVPETKQYTLEELDEVFEVPLR
FT                   TRIKYNFQEIWPNIQYHILRRRKIKRRTPLGPSVGFSDLEEKPEQEHVERVDTSDSSSD
FT                   VDPTAGGGL"
FT   gene            <167692..>168384
FT                   /locus_tag="ZYRO0E02222g"
FT                   /old_locus_tag="ZYRO-ORF4120"
FT   CDS_pept        167692..168384
FT                   /locus_tag="ZYRO0E02222g"
FT                   /old_locus_tag="ZYRO-ORF4120"
FT                   /product="ZYRO0E02222p"
FT                   /note="similar to uniprot|P38172 Saccharomyces cerevisiae
FT                   YBL095W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02222g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30787"
FT                   /db_xref="GOA:C5E426"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C5E426"
FT                   /protein_id="CAR30787.1"
FT                   /translation="MMLKIINRALILPLAGLTLGTASFLKVWPDTINDYDEPMRTDPEL
FT                   LRRWRRTNLYEELKHLTQWRQSEKIPPAHRSNHVGQGLLSGVGKLENDPVVFHDEVQNS
FT                   ISVVYQLGKKLGDSNGYVDNGVLSVLLDEALCYCGFPLLPSKRGVTARLDLEFVGKIPV
FT                   DSTIVLKAKVVEHKGRKCVISGTLESVPGMEKNWWGRLRSVWGAECYARAKCVLVEPKW
FT                   FKWLPGDA"
FT   gene            complement(<168858..>168944)
FT                   /locus_tag="ZYRO0E02244r"
FT                   /old_locus_tag="Zyro0E.tLys_TTT_30"
FT   tRNA            complement(join(168858..168893,168908..168944))
FT                   /locus_tag="ZYRO0E02244r"
FT                   /old_locus_tag="Zyro0E.tLys_TTT_30"
FT                   /note="tRNA-Lys (TTT) cove"
FT   gene            complement(<169081..>170601)
FT                   /locus_tag="ZYRO0E02266g"
FT                   /old_locus_tag="ZYRO-ORF4118"
FT   CDS_pept        complement(169081..170601)
FT                   /locus_tag="ZYRO0E02266g"
FT                   /old_locus_tag="ZYRO-ORF4118"
FT                   /product="ZYRO0E02266p"
FT                   /note="weakly similar to uniprot|P12630 Saccharomyces
FT                   cerevisiae YIL015W BAR1 Aspartyl protease secreted into the
FT                   periplasmic space of mating type a cells, cleaves and
FT                   inactivates alpha factor allowing cells to recover from
FT                   alpha-factor-induced cell cycle arrest and to YLR121C
FT                   uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
FT                   Aspartic protease, attached to the plasma membrane via a
FT                   glycosylphosphatidylinositol (GPI) anchor and to YLR120C
FT                   uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
FT                   Aspartic protease, attached to the plasma membrane via a
FT                   glycosylphosphatidylinositol (GPI) anchor and to YDR144C
FT                   uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7 GPI-
FT                   anchored aspartyl protease (yapsin) involved in protein
FT                   processing; shares functions with Yap3p and Kex2p and to
FT                   YIR039C uniprot|P40583 Saccharomyces cerevisiae YIR039C
FT                   YPS6 Putative GPI-anchored aspartic protease, member on
FT                   vGLC.1466."
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30788"
FT                   /db_xref="GOA:C5E427"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033876"
FT                   /db_xref="UniProtKB/TrEMBL:C5E427"
FT                   /protein_id="CAR30788.1"
FT                   /translation="MKFSSNILKYGIVAAGAAKVALAGGVDGVGKIPFSKRYGKSFDES
FT                   RQISFSEKGTGGDDQEIDISNQNVYYSASIYLGTPGQELTLLLDTGSSDLWIPQKGGYH
FT                   CQSDSDDATKGKSSGIASQLFSIASAEGGPSPSLTTTLIGSSGGSHPDPLEPTNRNVQP
FT                   PAAITASALEESCQSSSGNFDPNSSSSFNKNDTVDGFFIEYGDNSYASGYWATDDLTVG
FT                   DISVKDMTIAVADDTNSSVAVFGISYRGLESSVFGDNLQDPHEYENFPYLLKDQGIVKR
FT                   NAYSLYLNSAGASDGNILFGGVDHNKYSGDLYTLPVLKGQEDSDPWERFVVTVQGIGIK
FT                   GSETQNTLTTTPFIGLLDSGTTAVYLPEPVADMVANAYGGSFDDDPEVQSYVISCPSDD
FT                   EKIVFNFGGFNIETSLSNYITDNGNGQCILNISPTSDYMGILGDSFLRDSYVVYDMDNN
FT                   EISLAQANFDSTEDVEAITGPVPGATKAPGYSSTYSGPQTFQTGGNIF"
FT   gene            complement(<171852..>173489)
FT                   /locus_tag="ZYRO0E02288g"
FT                   /old_locus_tag="ZYRO-ORF4116"
FT   CDS_pept        complement(171852..173489)
FT                   /locus_tag="ZYRO0E02288g"
FT                   /old_locus_tag="ZYRO-ORF4116"
FT                   /product="ZYRO0E02288p"
FT                   /note="similar to gnl|GLV|KLLA0D12606g Kluyveromyces lactis
FT                   KLLA0D12606g and some similarities with YNR055C
FT                   uniprot|P53389 Saccharomyces cerevisiae YNR055C HOL1
FT                   Putative ion transporter similar to the major facilitator
FT                   superfamily of transporters; mutations in membrane-
FT                   spanning domains permit nonselective cation uptake"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30789"
FT                   /db_xref="GOA:C5E428"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E428"
FT                   /protein_id="CAR30789.1"
FT                   /translation="MATNVIDFEVVPGDARLVEGEEREVVLLPKPSKDPEDPLNWSRPR
FT                   KWLATACVIVVTIGIGIPSAAIYSVLPNIAEERNLSLADLNQGTGYLFLFYGLGCLVFQ
FT                   PLALQYGKRPVYLFSMLATSLICVWPPYTRSNGEWIASKILQGLFGSCVESLPEISMSD
FT                   LFFEHERSLGLSLYALTLMGVSYSAPLVAGFISAGQGWQWVMWWCSILAAVCFVILFFA
FT                   MEETSYTRRVQDEASLDPEIDGEEVHESNVENGEVENDKAEKAKDDLVKIRSDYSAHSL
FT                   SEGSISWPQTSYMQKISLTRGFKSKFMLHYYMFMPFRMAQFPVILWAGFLYGSSLVWFN
FT                   VLNATEAMVLAGKPYNFSSSMCGLAYVSPLVCTFIVFPIAGFCSDKLKVYFARKRNGFS
FT                   IPEDRLWLLFVYAILGCAASLLWGIGAYYQIHWFPLVLALGILGGCGVFGPVSSAAYVV
FT                   DTYRELDAEAMVVVILIRNLMSFACSYGITHWVENLGYKRCFIGVAFCCLATNSSFLVM
FT                   IFTGPWWRKKQRHAYWSLVQRCRSLGMH"
FT   gene            <175207..>176652
FT                   /locus_tag="ZYRO0E02310g"
FT                   /old_locus_tag="ZYRO-ORF4114"
FT   CDS_pept        175207..176652
FT                   /locus_tag="ZYRO0E02310g"
FT                   /old_locus_tag="ZYRO-ORF4114"
FT                   /product="ZYRO0E02310p"
FT                   /note="similar to uniprot|P38682 Saccharomyces cerevisiae
FT                   YER122C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02310g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30790"
FT                   /db_xref="GOA:C5E429"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:C5E429"
FT                   /protein_id="CAR30790.1"
FT                   /translation="MSAEEGELVASKEVTQQVFQRLASKLENRVCFDCGNKNPTWTSVS
FT                   FGVMLCIQCSATHRNLGVHITFVKSSSLDKWTVDNLRRFKVGGNHRARDYFMKNNGKHL
FT                   LSTSNVDARAKYTSAVAKNYKKHLDHKVTKDIEQNPDGIVVDEETGNDSSNSSRTGSKE
FT                   GSVDDFFANWQKPQASNGSIASRGSSAAPSPKPSTSSSFTNGSADKSKSSILSGSRKKP
FT                   SVSNTSSQANGAKKHSILASSRKPTRLAANKVDKSEANDLFDQFEKEAEQEKVEKKSKD
FT                   FGSSRKPRTSYKSSSAFDDDKDYNADQASAFGKQSKKDDFFDDDEFDEPATQTGPVEEL
FT                   QPKFAKLGFGMTMNDADQLAKKQKETRVAAAGPKYTGKIAARYGGQKAISSDQLFGRGS
FT                   YDEEASREARDKLKTFDNATSISSSSYFGEEQEDEENLMEAQANNGFIDFNLGEDDDMQ
FT                   MLKNAIEQGAQKLGSYLRDFQRR"
FT   gene            complement(<176775..>177383)
FT                   /locus_tag="ZYRO0E02332g"
FT                   /old_locus_tag="ZYRO-ORF4112"
FT   CDS_pept        complement(176775..177383)
FT                   /locus_tag="ZYRO0E02332g"
FT                   /old_locus_tag="ZYRO-ORF4112"
FT                   /product="ZYRO0E02332p"
FT                   /note="similar to uniprot|P25046 Saccharomyces cerevisiae
FT                   YBL093C ROX3 RNA polymerase II holoenzyme component"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02332g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30791"
FT                   /db_xref="GOA:C5E430"
FT                   /db_xref="InterPro:IPR013942"
FT                   /db_xref="UniProtKB/TrEMBL:C5E430"
FT                   /protein_id="CAR30791.1"
FT                   /translation="MTTVNEQILPPYYYYVDPDTTYQTQRPNPLDDLISVYGLQDLSHQ
FT                   VARTNQDGTRAIKLRKSYKNQIQDLSGKFATIPTRENGKGGEISHILFQNNPDMIPQVR
FT                   REPGMTDEQYNAAVADRDRALFESPNMDWDVCKAVLSQFERSYPSEFQGQGFQVDDLAF
FT                   DLDGTGKINQKKRKVKSNGSSMATPNSDMQEDVKRRRLD"
FT   gene            <178826..>180592
FT                   /locus_tag="ZYRO0E02354g"
FT                   /old_locus_tag="ZYRO-ORF4110"
FT   CDS_pept        178826..180592
FT                   /locus_tag="ZYRO0E02354g"
FT                   /old_locus_tag="ZYRO-ORF4110"
FT                   /product="ZYRO0E02354p"
FT                   /note="similar to uniprot|P40077 Saccharomyces cerevisiae
FT                   YER124C DSE1 Daughter cell-specific protein may participate
FT                   in pathways regulating cell wall metabolism deletion
FT                   affects cell separation after division and sensitivity to
FT                   drugs targeted against the cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30792"
FT                   /db_xref="GOA:C5E431"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E431"
FT                   /protein_id="CAR30792.1"
FT                   /translation="MNERPRSINIFYFQCAYIIVQLMETNYYQPVKVFRQPAMIVKTRD
FT                   ASRRKSGEHHAKSWLHDTSRIGSPLLKKVSEEFNDHYTTRKLKSEYWKVNHDNNSTSLP
FT                   TDLSVVRDTLLVSNMNERDNLKLFNISQDRHGEPTKLYELQSISVPGKPITSACLLSPL
FT                   EYPAEYVEGHDQLLLTGHQDGIVNLISTSRENGNAKIVRRYNHGKYLSRNMPATLDNWL
FT                   QSYASLPIRRLKPWAGSGFASIINDSLFIYELNRPKSPQYLQSFPGLESFAINDFRNPY
FT                   LMALCGSQFGDSGIALLDLRSDRRGGNLYIPDGNKNANSSSSLRTPMHSHVSRDCIWID
FT                   EFHVVNCFNDVARIWDIRSTDGENQCEIMPMKGCIESLTYHEPTKTLYTGDDQGYVVSW
FT                   DLHRLSGIKKCIPSQGFNSILLESVEQETLHEINQCGSIVVNGGQKKFTESTDRVHGSL
FT                   LMDTLGNGSLATVDSQELGLHKICQVECPLQNVKHDNSSKEYNFGPIYHYEGEKTQGES
FT                   DSTLMSSEVSSISSSPSSVGLEGSSSFTLSSESEHEPLEYNKQYMLQSHDPNGSNFTLE
FT                   GPISRVSTSEIL"
FT   gene            complement(<181177..>182817)
FT                   /locus_tag="ZYRO0E02376g"
FT                   /old_locus_tag="ZYRO-ORF4108"
FT   CDS_pept        complement(181177..182817)
FT                   /locus_tag="ZYRO0E02376g"
FT                   /old_locus_tag="ZYRO-ORF4108"
FT                   /product="ZYRO0E02376p"
FT                   /note="some similarities with uniprot|P39962 Saccharomyces
FT                   cerevisiae YER123W YCK3 plasma membrane-bound casein kinase
FT                   I homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02376g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30793"
FT                   /db_xref="GOA:C5E432"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5E432"
FT                   /protein_id="CAR30793.1"
FT                   /translation="MSRSSQHVVGIHYAVGAKIGEGSFGVIFEGENILNSGSSGREDDF
FT                   GRRPSAPVAIKFEPRRSDAPQLRDEFRAYRILNNCRGIPHAYYFGQEGMHNVLILDLLG
FT                   PSLEDLFEWCGRKFSIKTTCLVAKQMIDRVRIIHEHDLIYRDIKPDNFLISEFQRTLPD
FT                   RQIVKDVALSAGGDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHF
FT                   GREQSRRDDLESLGHVFFYFLRGSLPWQGLKALNNKLKYEKIGLTKQKLNPDELLMDFI
FT                   PAQFGAYLKYARSLRFEEEPDYDYLISLMDDTLHCMGMEDDGHYDWMDLNDGQGWNIKV
FT                   NKRANLHGYGNAVPRHDHQQNVNNNNANANANANANVNANENSNLNLAQGNSPYVNNTN
FT                   GNGNLVGNNNNLQNSNAAMAASLGNTPKSRPHSSHRNSLTYAKQKLKLANSSPIAGVNP
FT                   TSQPPNRNRTYDSMGSHALKSQTNGMYNDYRGGGGMRVDDPNAMYYHRQMLQRQQRAQQ
FT                   HQQLIQRSQEDEGLYEDAGFCSRVCCGWC"
FT   gene            <183200..>184300
FT                   /locus_tag="ZYRO0E02398g"
FT                   /old_locus_tag="ZYRO-ORF4107"
FT   CDS_pept        183200..184300
FT                   /locus_tag="ZYRO0E02398g"
FT                   /old_locus_tag="ZYRO-ORF4107"
FT                   /product="ZYRO0E02398p"
FT                   /note="similar to gnl|GLV|KLLA0E13541g Kluyveromyces lactis
FT                   KLLA0E13541g and some similarites with YPR023C
FT                   uniprot|Q12432 Saccharomyces cerevisiae YPR023C EAF3 Esa1p-
FT                   associated factor nonessential component of the NuA4
FT                   acetyltransferase complex homologous to Drosophila dosage
FT                   compensation protein MSL3"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30794"
FT                   /db_xref="GOA:C5E433"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008676"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR025995"
FT                   /db_xref="InterPro:IPR026541"
FT                   /db_xref="InterPro:IPR038217"
FT                   /db_xref="UniProtKB/TrEMBL:C5E433"
FT                   /protein_id="CAR30794.1"
FT                   /translation="MLEVGGKCLAYHGPMLYEAKVLRIWNPTTQSVSVVQDGQEVSVSM
FT                   KKDKEELSEDTKALGGVPESLAGQECYFVHYQGWKSTWDEWIGLDRIREYNDENLGLKK
FT                   RLIEEAKEAKKQQQEQKKRKENVLKRGRPSETGTVPRTSSSGRSSSNPGENGNTTTSGN
FT                   NGTSSTKQGSHGPTTAGTVPLPQGSAPKITLHIPVKLKSLLVDDWEYVTKDKKVCKIPS
FT                   PVLTVQQLLEEYEASASNELESPAQQSQLSEYCMGLRLYFERSLPLLLLYRLERLQYEE
FT                   LLQKEKYANTSVLHLYGPIHLLRLLSILPDLMATTTMDGQSCQLIVRRTEHLFEWIVTN
FT                   MERLFNGKEETYVNTSSQYEGVALGL"
FT   gene            <184575..>187247
FT                   /locus_tag="ZYRO0E02420g"
FT                   /old_locus_tag="ZYRO-ORF4105"
FT   CDS_pept        184575..187247
FT                   /locus_tag="ZYRO0E02420g"
FT                   /old_locus_tag="ZYRO-ORF4105"
FT                   /product="ZYRO0E02420p"
FT                   /note="similar to uniprot|Q12482 Saccharomyces cerevisiae
FT                   YPR021C AGC1 Mitochondrial transporter acts both as a
FT                   glutamate uniporter and as an aspartate-glutamate exchanger
FT                   involved in nitrogen metabolism ornithine synthesis and the
FT                   malate-aspartate NADH shuttle"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02420g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30795"
FT                   /db_xref="GOA:C5E434"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E434"
FT                   /protein_id="CAR30795.1"
FT                   /translation="MEQVNSFSEKKLQQVEIFQKFATDLATEQGKGTSGQLILTYNDFI
FT                   NLISSSKTLYSKFTDHSFNLNQIPPNAFGCIFFALDETNKGYLNINDWFHFNNLLEYDN
FT                   YHLIILYEFFRKFDVERIRANRRQQLQDAVKQSNVKPGMAADDARVKSINYGSKFLSFD
FT                   DLLLNLTQFKSTIKLLHSCSKDEFALTNDLFLDWDKFKFLKFYECYPYSFEEGPFLSLN
FT                   SIVTILQNDLKNEKLYVGFSKLAHMDPIKKCLALNKNQLVYLLKLFYSHRISTDVFESL
FT                   NLTNTDLIKSNNNAIAFNVFKDLFYLFQNFDLLNQALIRYATVNDFTERDLRERPITKM
FT                   DLLQILNTQYNKVNNIIEFSPSQINLLFSIVANSKENNTRKKLQMHHEDSQIDNFIHNE
FT                   YVHGISGRRKQLETFNDTYQELVEGFHQSAVVHNSLSTKPTSFFDFFIPRSDLASFWYN
FT                   LTTEDFMKILNPNYLNDVVHQMELRRIQKDSLYTNYYFYPIFDSIYNFSLGSVAGCIGA
FT                   TAVYPIDLVKTRMQAQRSLSQYTNSFDCFSKVLSRDGVKGLYSGLGPQLLGVAPEKAIK
FT                   LTVNDLMRKTLSDKKGKITLTSEVLAGASAGACQVIFTNPLEVVKIRLQVKSEYALENL
FT                   AQSEMTAFSIVRKLGFSGLYKGLTACLLRDVPFSAIYFPTYSHVKRDVFNFDPQSNTGR
FT                   SRLKTWELLFSGALAGMPAAFLTTPCDVVKTRLQIAPRKGEMKYHGIKDAIKTILKEES
FT                   FKSFFKGGGARVLRSSPQFGFTLAAYEMFKDLVPKPNKTFRSPTHDFDEEIPTVANSFT
FT                   SFFRKLKSSSQPITVEDSYQTDFFSPTVDPYSSNYLNYYYKSCQVAKLFIDLDNNFSHF
FT                   NYDVYTKFQDSLKSIASGK"
FT   gene            complement(<187334..>188347)
FT                   /locus_tag="ZYRO0E02442g"
FT                   /old_locus_tag="ZYRO-ORF4103"
FT   CDS_pept        complement(187334..188347)
FT                   /locus_tag="ZYRO0E02442g"
FT                   /old_locus_tag="ZYRO-ORF4103"
FT                   /product="ZYRO0E02442p"
FT                   /note="similar to uniprot|P46946 Saccharomyces cerevisiae
FT                   YGL175C SAE2 Protein with a role in accurate meiotic and
FT                   mitotic double-strand break repair phosphorylated in
FT                   response to DNA damage and required for normal resistance
FT                   to DNA-damaging agents"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02442g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30796"
FT                   /db_xref="GOA:C5E435"
FT                   /db_xref="UniProtKB/TrEMBL:C5E435"
FT                   /protein_id="CAR30796.1"
FT                   /translation="MQLQSNLAVLLEFDLNRLLAVQSDVTLLISRRVRELLDRSKELVD
FT                   EHSTINDKDEDKGDTSIGIVGGDRSNHQVDDGDDSDDFILTQLGEHTGEKIWTHENEDL
FT                   VTLRAELPKADISSPLKESQSLPDSYNHMKNDSRELDVQVEEDELPSANNNSRKELSQV
FT                   TKKLCVRFPDNKPVVPRTNFNINPYTGKPWILEDFKRNEDINSVKKRQQNMKAQKIYAE
FT                   GFPPPEAGRQSLIDKEISKGVENNFYEFENLRDRSHSPPGFGRLDFPNTQERFDDKQKS
FT                   QNIIFHKTKWRFRKATCNAVPPYEREFLFKNDKLNEIVDDGTFEWNDAELQIYTRK"
FT   gene            <188500..>189342
FT                   /locus_tag="ZYRO0E02464g"
FT                   /old_locus_tag="ZYRO-ORF4102"
FT   CDS_pept        188500..189342
FT                   /locus_tag="ZYRO0E02464g"
FT                   /old_locus_tag="ZYRO-ORF4102"
FT                   /product="ZYRO0E02464p"
FT                   /note="weakly similar to uniprot|P46947 Saccharomyces
FT                   cerevisiae YGL174W BUD13 Protein involved in bud-site
FT                   selection diploid mutants display a unipolar budding
FT                   pattern instead of the wild-type bipolar pattern"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30797"
FT                   /db_xref="GOA:C5E436"
FT                   /db_xref="InterPro:IPR018609"
FT                   /db_xref="UniProtKB/TrEMBL:C5E436"
FT                   /protein_id="CAR30797.1"
FT                   /translation="MSLNNYLNDLYGTGSDKSKKKKKSSDKKVKQDSGSQLNITESSQR
FT                   RFTKNASTFNATKDKTSKPKTLWKNLDTNEVIDRKSSREDHGDVGQVNNKAKLSSGAHA
FT                   GLQTAEQMDSQITQKELDQRRQIQKSQKSQETVFRDEKGNKIANYEEILNKEEKEKDLR
FT                   EVVRQRRIRELNMGEVQLFMVQNGLTRIPKERTKEQSESFDDPARTFGISSHNHKEPVS
FT                   LMGRKLYANVYPENRFGISPGCRWDGVDRSNGFERKWFAKQNELNEKKQQEYALREDY"
FT   gene            complement(<189383..>193963)
FT                   /locus_tag="ZYRO0E02486g"
FT                   /old_locus_tag="ZYRO-ORF4101"
FT   CDS_pept        complement(189383..193963)
FT                   /locus_tag="ZYRO0E02486g"
FT                   /old_locus_tag="ZYRO-ORF4101"
FT                   /product="ZYRO0E02486p"
FT                   /note="similar to uniprot|P22147 Saccharomyces cerevisiae
FT                   YGL173C KEM1 5'-3' exonuclease involved in mRNA decay
FT                   evolutionarily conserved component of cytoplasmic
FT                   processing (P) bodies plays a role in microtubule-mediated
FT                   processes filamentous growth and ribosomal RNA maturation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30798"
FT                   /db_xref="GOA:C5E437"
FT                   /db_xref="InterPro:IPR004859"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR016494"
FT                   /db_xref="InterPro:IPR027073"
FT                   /db_xref="InterPro:IPR040486"
FT                   /db_xref="InterPro:IPR040992"
FT                   /db_xref="InterPro:IPR041106"
FT                   /db_xref="InterPro:IPR041385"
FT                   /db_xref="InterPro:IPR041412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E437"
FT                   /protein_id="CAR30798.1"
FT                   /translation="MGIPKFFKYIAERWPMILQLIEGQHIPEFDNLYLDMNSILHTCTH
FT                   GNDDDVTKRLTEEEVFGKIFVYIDHLFHTIKPKKVFYMAIDGVAPRAKMNQQRARRFRT
FT                   AMDAEKALKKAIENGEEIPKGEPFDSNSITPGTEFMAKLTKNLQYFIHDKITNDSSWRD
FT                   VKIIFSGHEVPGEGEHKIMDFIRNIRGQGDYNPNTRHCIYGLDADLIMLGLSVHAPHFA
FT                   LLREEVVFGKRGKKSTALEHQNFYLLHISLLREYMELEFEEIADELQFEYDFERILDDF
FT                   ILIMFVIGNDFLPNLPDLHLNKEAFPLLMKTFKEALLHADGYINYNGQINLKTLRLWLH
FT                   YLSQFELMIFEKNDIDVQWFHQRLENISLEGADQRERSGKKLLVKQQKKIAGYVKPWIL
FT                   DVAAKRYSADIPEEQIPTLKLTDEETKENLDFLKQFAFDLGLFVAHSKSDDRYSLKLDV
FT                   DAINPQESEEEHEERQRTIRRTLKKYQQAILVEDKEELDKEKETYNARFEDWKDRYYKE
FT                   KLGFSIHDTEKLTDITENYVEGLQWVLYYYYRGCASWGWYYHYHYAPRISDLQLGLDQI
FT                   LEFEKGIPFTPFQQLMAVLPERSKNLIPAPFRPLMYDEKSPIIDFYPAEVDTDKNGKTA
FT                   DWEAVVLISFVDEKRLQDAMAPLMSKLTPDEKARNTAGTDLIYSFNPQVDDIYKSPLKG
FT                   LFSDIEHNHCVEREFNPPKVEESQFRYGLLPNAKTGINLLAGFPTLKTLPFTFELLLNE
FT                   TRIFTSPSKRESMVLHMKDIYSENNLSLDVLAKRYMDKVVYTRWPYLMESKLVSISDGE
FT                   NIFESSNSGSGKNSKFINRPLDEGEKRLFRTMAAKLKNEYQSAKAVDVGDVSVIVKVLP
FT                   GADLVRDARGAYRKSFQNEPKYYPLQLMVETVANEDERYKEKDPVPIDQEFPQGSQVIF
FT                   LGDYAYGGETTIDGYSNATRLKLTVKKMSMRSEPAIGKERYKIDTALVKYFPSYIVSKR
FT                   LQLHPLFLSRITSRFMISDQAGKNVNVGITVKFEARHQKVLGYARRNPKGWEYSNLALD
FT                   LINEYRKLFPKFFNKLATIQGSNMPSIDQLFPELSSEQCAKLLQDVTAWLKSVTEKFVN
FT                   VSLESDSLTKVSMQAVEDYIEKYSSYLDQTEKKQLAKVPCEAVLDPKSSYALLRSQRFE
FT                   LGDRVVYIQDSGKVPLFSKGTVVGYTTLGMSLSIQVLFDNEIVAGNNFGGRLRTNRGLG
FT                   LDASFLLNLTNRQFVYHSKASKQVSKKPVSNAAPKQHVVDIKRKRAHDLLSHIKKNDKE
FT                   TEEKSDPVKAAGEKQGKSPEEQGPNFAFVKGANPTLNPDPASMIYNAVLNQYVPNNANF
FT                   GASGGPKASGIPYQAQPGYPPPPPFVHMPPPPMGMPMPPPYGGPMPPPHMGGFVPPPIP
FT                   DVAFQGLKIEEKETDGLKQMLQAGASDKPNNGKSANAKLHQGGKPHGGKPHNGKPNGDK
FT                   PFGSKTGSNGKPTGNGKPGGGNWNKDKDGSSKPHFSKGNPNGNRKFSRGGKSKSKPRTP
FT                   VGEVST"
FT   gene            <195237..>196880
FT                   /locus_tag="ZYRO0E02508g"
FT                   /old_locus_tag="ZYRO-ORF4097"
FT   CDS_pept        195237..196880
FT                   /locus_tag="ZYRO0E02508g"
FT                   /old_locus_tag="ZYRO-ORF4097"
FT                   /product="ZYRO0E02508p"
FT                   /note="some similarities with uniprot|Q02199 Saccharomyces
FT                   cerevisiae YGL172W NUP49 Subunit of the Nsp1p-Nup57p-
FT                   Nup49p-Nic96p subcomplex of the nuclear pore complex (NPC)
FT                   required for nuclear export of ribosomes"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30799"
FT                   /db_xref="GOA:C5E438"
FT                   /db_xref="InterPro:IPR024864"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="InterPro:IPR039079"
FT                   /db_xref="UniProtKB/TrEMBL:C5E438"
FT                   /protein_id="CAR30799.1"
FT                   /translation="MFNFGKPASAGSSASGGLFGQNNNTGNTGLGGGFSFGQPNNNTAS
FT                   GGNTGGGFSFGNQNQGSTTGGGLFGAKPADSGTTGTGFSFGKPAQPNTGGGGLLGGSSG
FT                   ANNTGSGGLFGNTNNSGGGLFGNTNTNNTGGGGLFGNTSSNNNTTGGGLFGGANTNNNN
FT                   NNTNTGGGSLFGNTNNSTNTGGGGLFGNTNNSTNTNTGSGGLFGSTNTNTGGGGLFGNT
FT                   SNNNSSTGTGGGLFGSKPAGTSLFGNTNNNSSTTGGGLFGSNAGGSAGGGSSLFGNPSN
FT                   TSNTNTMGGGLFGSKPAGSSLFGNNPSNAGSGGLFGTQQQQQAPPQAAINSISQLPITT
FT                   MTRIIDLPPQLRQEIEQLDQYVQRQVQISQHLKADTEEHMELIGSVPRDIAYLLKFESL
FT                   ANQSLAQDLRKLTSIKEITDANLTDTQTFAIILQQLLTPGSKISSMELDKFFHHKLQSY
FT                   QSKLDEYFRVLSDIESAVNGIDSDVFGSKADGFQGGTSNDSLDVFAVKTGLNALVSTVV
FT                   EEFQLFMDTAERIAELHQKMKEVTADRLLV"
FT   gene            <197126..>198796
FT                   /locus_tag="ZYRO0E02530g"
FT                   /old_locus_tag="ZYRO-ORF4094"
FT   CDS_pept        197126..198796
FT                   /locus_tag="ZYRO0E02530g"
FT                   /old_locus_tag="ZYRO-ORF4094"
FT                   /product="ZYRO0E02530p"
FT                   /note="highly similar to uniprot|P45818 Saccharomyces
FT                   cerevisiae YGL171W ROK1 ATP-dependent RNA helicase of the
FT                   DEAD box family required for 18S rRNA synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02530g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30800"
FT                   /db_xref="GOA:C5E439"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E439"
FT                   /protein_id="CAR30800.1"
FT                   /translation="MDIFRVLTRGASLRKGQKGSAKSADFSMADDTAKKDKKLDDVHIT
FT                   KELDFFHNKRIMKNVENAKKEEKPEESGDESNEDEVIDTIQPRITNEEEAKALRKSYKG
FT                   NISGNDLIFPIGSFEDLISRFSFDKRLLNNLIDNDFTEPTPIQCEGIPLALHGRDLLSC
FT                   APTGSGKTLAFLIPLLQQIIDSKDVQGLKGLIISPTKELASQTFVECVKLSRKIFLDKK
FT                   RPLQVAILSKSLSAKLRNKVVSDKKYDIIISTPLRLIDLVKNEALDLSNVRHLVFDEAD
FT                   KLFDKTFVEQTDDILSACSDPRLRKSMFSATIPSNVEEIAQSIMTDPVRVIIGHKEGAN
FT                   ANIDQRLVYCGNEEGKLIAIRRMVQEGEFKPPVIIFLESITRAKALYHELMYDGLNVDV
FT                   LHAERTQMQRDKIIERFKTGDLWCLICTDVLARGIDFKGINLVVNYDVPQTAQAYVHRI
FT                   GRTGRNNRQGKAVTYYTRQDSLAIKPIINVMRQSGCEVAEWMDKISKLSKREKESLRKG
FT                   KSRVDRNPISTVPKVDKLKRKRRQSMIGASKRRKQQSED"
FT   gene            complement(<198939..>199298)
FT                   /locus_tag="ZYRO0E02552g"
FT                   /old_locus_tag="ZYRO-ORF4092"
FT   CDS_pept        complement(198939..199298)
FT                   /locus_tag="ZYRO0E02552g"
FT                   /old_locus_tag="ZYRO-ORF4092"
FT                   /product="ZYRO0E02552p"
FT                   /note="similar to uniprot|Q12233 Saccharomyces cerevisiae
FT                   YPR020W ATP20 Subunit g of the mitochondrial F1F0 ATP
FT                   synthase which is a large enzyme complex required for ATP
FT                   synthesis associated only with the dimeric form of ATP
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02552g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30801"
FT                   /db_xref="GOA:C5E440"
FT                   /db_xref="InterPro:IPR006808"
FT                   /db_xref="UniProtKB/TrEMBL:C5E440"
FT                   /protein_id="CAR30801.1"
FT                   /translation="MLGRIQSVTTGLLSKSTLLATKTIYYGKVGAELSKQIYLREKLQP
FT                   PSIDEFKRAYIGLYQRGFYYASRPKDIVNLVKAFKKDDYIKYTAFFVQLLGFYSVGEII
FT                   GRRKLVGYKDYNNHH"
FT   gene            complement(<199677..>202463)
FT                   /locus_tag="ZYRO0E02574g"
FT                   /old_locus_tag="ZYRO-ORF4090"
FT   CDS_pept        complement(199677..202463)
FT                   /locus_tag="ZYRO0E02574g"
FT                   /old_locus_tag="ZYRO-ORF4090"
FT                   /product="ZYRO0E02574p"
FT                   /note="highly similar to uniprot|P30665 Saccharomyces
FT                   cerevisiae YPR019W CDC54 Essential helicase component of
FT                   heterohexameric MCM2-7 complexes which bind pre-
FT                   replication complexes on DNA and melt the DNA prior to
FT                   replication accumulates in the nucleus in G1 homolog of S.
FT                   pombe Cdc21p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30802"
FT                   /db_xref="GOA:C5E441"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008047"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:C5E441"
FT                   /protein_id="CAR30802.1"
FT                   /translation="MSDQPSSPAHHSDQIPPESSSPAPNPASEIGRPSSPAQPSSPALF
FT                   YHTSSSAQDTFGQDGSQSQNGRVGAAMGSSPFKYPSSQNQSSDNYPSQARNDPRITSTY
FT                   SNRSDRLMPASTSSQGSRHGHRAMMRRNDIHASDLSSPRRFIEFDHPSHMSTSSSSSAP
FT                   PSEAGGEPLRIIWGTNVSIQECANNFRNFLMSFQYKYRKALDGREQFIDDTTDEESYYV
FT                   RQLTEMRELGTTNLNLDARNLLAYKPTEELYHQLLNYPQEVISIMDQTIKDCMVSLVVD
FT                   NNIDYDLDDIETKLYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRCTAVIPDMKVA
FT                   FFKCNVCDHTMAVEIDRGVIQEPARCERVDCNEPNSMSLIHNRCSFADKQVIKLQETPD
FT                   LVPDGQTPHSVSLCVYDELVDSCRAGDRIEATGTFRSIPMRVNPRQRVLKSLYKTYVDV
FT                   VHIKKVSDKRLGVDTSTVEQELLQNKMNHSEVEETRRVTDQDIAKIREVAQREDLYEVL
FT                   ARSIAPSIFELDDVKKGILLQLFGGANKTFAKGGRYRGDINVLLCGDPSTSKSQILQYV
FT                   HKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDS
FT                   TRSVLHEVMEQQTISVAKAGIITTLNARASILASANPIGSRYNPNLPVTENIDLPPPLL
FT                   SRFDLVYLVLDKVDENMDRELAKHLTSLYLEDRPQNASNDDVLSIEFLTMYINYAKENI
FT                   NPTITKDAKTELVRAYVGMRKIGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSNAV
FT                   EIDDVQEAIRLIRSAIKDYATDPKTGKIDMQLVQTGKSVIQRKLQEDLAREVLRVLGDY
FT                   SSDSMTFNELSRQINEHSQDRVDSSEISEALSRLQQEDKLIVLGEGVRKSIRLNSRV"
FT   gene            complement(<202673..>204409)
FT                   /locus_tag="ZYRO0E02596g"
FT                   /old_locus_tag="ZYRO-ORF4086"
FT   CDS_pept        complement(202673..204409)
FT                   /locus_tag="ZYRO0E02596g"
FT                   /old_locus_tag="ZYRO-ORF4086"
FT                   /product="ZYRO0E02596p"
FT                   /note="some similarities with uniprot|Q12495 Saccharomyces
FT                   cerevisiae YPR018W RLF2 Chromatin Assembly Complex subunit
FT                   1: largest (p90) subunit of three-subunit protein complex
FT                   (yeast CAF-I) involved in DNA-replication-linked nucleosome
FT                   assembly. Homol. to p150 subunit human Chromatin Assembly
FT                   Factor-I (CAF-I) p90 subunit of yeast Chromatin Assembly
FT                   Factor-I (CAF-I)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30803"
FT                   /db_xref="GOA:C5E442"
FT                   /db_xref="InterPro:IPR022043"
FT                   /db_xref="UniProtKB/TrEMBL:C5E442"
FT                   /protein_id="CAR30803.1"
FT                   /translation="MTTPGSVEDSSSNNPAGKQGILSFFQNIKTKEEEEVIEVVDSDDE
FT                   KRTVAKQEPESKPQSQLEVEKEEQDKDVNVKDEPSNTMKQLKEVVVFPESTTEEKRKQK
FT                   AEQSQKREDMKRQKDADKQRREELKRQKDADKQRREEEKLKKEDEKKLKKENEKKAKEE
FT                   ERLKKEEEKKLKKESEKKAKEEEKMKKENEKKAKEEAKERSQARIGNFFKKVTDSNKPT
FT                   NVRSDYEKFFLPFYSKEGVVVSRSGQLSSAEINENRTRIDSLLNQREDDNQVLEWLDSG
FT                   QNSVKTSLPIAYQAVSLLQQMTSKEKSDQELQSLLSLIPHKYIKFYENVRPPYMGTYSK
FT                   DIILPVDNPFSTRDTGYNYDYDSDLEWVNEEEEEVEGGVENLESGEEDEDDDEEEASEG
FT                   EFDGFLDAEDNGDQSGSGKKRFIGPLIPTVCLRKNQDQMEEDDKQYFNMVAVQCLIEEQ
FT                   PFPIEPNQYVKPQVENVKKISTDSQPQDASSPSVSPEKKSKSLISEPKDLLKLFDEIQD
FT                   STFSLGTVTEIAQKNLPLYSKQMIKNTVKEYAVKTTWGTSRKWAIKDPQHWEKLRSACN
FT                   NN"
FT   gene            complement(<204601..>205905)
FT                   /locus_tag="ZYRO0E02618g"
FT                   /old_locus_tag="ZYRO-ORF4083"
FT   CDS_pept        complement(204601..205905)
FT                   /locus_tag="ZYRO0E02618g"
FT                   /old_locus_tag="ZYRO-ORF4083"
FT                   /product="ZYRO0E02618p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30804"
FT                   /db_xref="UniProtKB/TrEMBL:C5E443"
FT                   /protein_id="CAR30804.1"
FT                   /translation="MISAAERKLNTNSTHLHIHTYTQESKRTMQSTRTTLNDDDVKEME
FT                   QKLDEVSISDSSRSSSNEEELCKVKNENYHLKLAIGEKNDEILRLHHMLHKEAYLENLH
FT                   KVLPSLQNGPLLYPASSSSQGEQQDGEPSIIDSEVATHISASPYKGNRARSTRTESSLA
FT                   TTTISRSKKRSKILEEHLIPFLQRSIQTFHASSIFQKESVELRELWQFFEENNGEDETL
FT                   LVNVLENLTYLQQQSTTLLNRELHFKKLSQRLEYLFTVFLNPKEYDMAPQEHIEKLKND
FT                   LLNILIKLFDRIPANQENNRELSRKEIRAQKIADLEKGIDLCTEAMNNAYGSSKTAAES
FT                   EKHSDNEEHMPDLSHFSNQEKQRLKKNRTSLEFIPIGYDENMLNTRTPQRPLKHKKQDL
FT                   DVTPVAQFRKDENDPLQKFFQEQDGYSVRSLSARR"
FT   gene            complement(<205928..>206000)
FT                   /locus_tag="ZYRO0E02640r"
FT                   /old_locus_tag="Zyro0E.tVal_CAC_29"
FT   tRNA            complement(205928..206000)
FT                   /locus_tag="ZYRO0E02640r"
FT                   /old_locus_tag="Zyro0E.tVal_CAC_29"
FT                   /note="tRNA-Val (CAC) cove score=75.70"
FT   gene            <206336..>207073
FT                   /locus_tag="ZYRO0E02662g"
FT                   /old_locus_tag="ZYRO-ORF4082"
FT   CDS_pept        206336..207073
FT                   /locus_tag="ZYRO0E02662g"
FT                   /old_locus_tag="ZYRO-ORF4082"
FT                   /product="ZYRO0E02662p"
FT                   /note="highly similar to uniprot|Q12522 Saccharomyces
FT                   cerevisiae YPR016c TIF6 translation initiation factor 6
FT                   (eIF6) singleton"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30805"
FT                   /db_xref="GOA:C5E444"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:C5E444"
FT                   /protein_id="CAR30805.1"
FT                   /translation="MAARAQFENSNEIGVFSKLTNSYCLVAVGGSENFYSAFEAELGDS
FT                   IPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSAL
FT                   GNVICCNDYVALVHPDIDRETEELIGDVLGVEVFRQTISGNILVGSYCALSNQGGLVHP
FT                   QTSVQDQDELSSLLQVPLVAGTVNRGSNVVGAGIVVNDYLAVTGLDTTAPELSVIESIF
FT                   RLHDAQPESIQGNLRDTLIETYS"
FT   gene            <208420..>208821
FT                   /locus_tag="ZYRO0E02684g"
FT                   /old_locus_tag="ZYRO-ORF4080"
FT   CDS_pept        208420..208821
FT                   /locus_tag="ZYRO0E02684g"
FT                   /old_locus_tag="ZYRO-ORF4080"
FT                   /product="ZYRO0E02684p"
FT                   /note="weakly similar to uniprot|Q6Q5F4 Saccharomyces
FT                   cerevisiae YPR015C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30806"
FT                   /db_xref="GOA:C5E445"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5E445"
FT                   /protein_id="CAR30806.1"
FT                   /translation="MAVKVEMSSSQREIPQQVRLPPISMLVPATYVQEQLYLPPLAAQQ
FT                   QQQQQKQDVKDGLNPVIRLRKQCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQKS
FT                   FNVKSNMLRHLKSHERRLAKQTSQTNQRF"
FT   gene            complement(<209886..>209971)
FT                   /locus_tag="ZYRO0E02706r"
FT                   /old_locus_tag="Zyro0E.tTyr_GTA_28"
FT   tRNA            complement(join(209886..209921,209933..209971))
FT                   /locus_tag="ZYRO0E02706r"
FT                   /old_locus_tag="Zyro0E.tTyr_GTA_28"
FT                   /note="tRNA-Tyr (GTA) cove"
FT   gene            <210318..>211271
FT                   /locus_tag="ZYRO0E02728g"
FT                   /old_locus_tag="ZYRO-ORF4075"
FT   CDS_pept        210318..211271
FT                   /locus_tag="ZYRO0E02728g"
FT                   /old_locus_tag="ZYRO-ORF4075"
FT                   /product="ZYRO0E02728p"
FT                   /note="similar to uniprot|Q12251 Saccharomyces cerevisiae
FT                   YPR011C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02728g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30807"
FT                   /db_xref="GOA:C5E446"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E446"
FT                   /protein_id="CAR30807.1"
FT                   /translation="MADVVVALEQPSRIKKGLQNDASVAFLAGGLAGAVSRTVVSPFER
FT                   VKILLQVQSSSESYSGGVSSAVKQLYKEEGVKGLFRGNGLNCIRVFPYSAVQFLVYEGS
FT                   KNFIFHVDGVNGNGRLTTFQRLFSGALCGGASVMATYPLDLVRTRLAIQTANLRKLQKA
FT                   KATSMAKPPGVWQLLRNTYLQEGGIKGLYRGVWPTSLGVVPYVALNFCVYEQLRELVPS
FT                   QSAYMLAIGALSGGIAQTATYPFDLLRRRFQVLAMGQSELGFHYSGVADALITIGKTEG
FT                   LRGYYRGLQANLFKVIPSTAVSWLVYELTRDFIKAL"
FT   gene            <211486..>211787
FT                   /locus_tag="ZYRO0E02750g"
FT                   /old_locus_tag="Zyro0E.mRNA.304.p"
FT   CDS_pept        join(211486..211518,211605..211787)
FT                   /locus_tag="ZYRO0E02750g"
FT                   /old_locus_tag="Zyro0E.mRNA.304.p"
FT                   /product="ZYRO0E02750p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02750g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30808"
FT                   /db_xref="GOA:C5E447"
FT                   /db_xref="UniProtKB/TrEMBL:C5E447"
FT                   /protein_id="CAR30808.1"
FT                   /translation="MRPTQLLLNQAKKSSSVVPLELTPLFIAMGAAVASASYFTYKKFA
FT                   HDRSLRITKNPELSEVQKAIDSEKSQ"
FT   gene            complement(<212005..>213804)
FT                   /locus_tag="ZYRO0E02772g"
FT                   /old_locus_tag="ZYRO-ORF4074"
FT   CDS_pept        complement(212005..213804)
FT                   /locus_tag="ZYRO0E02772g"
FT                   /old_locus_tag="ZYRO-ORF4074"
FT                   /product="ZYRO0E02772p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30809"
FT                   /db_xref="GOA:C5E448"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C5E448"
FT                   /protein_id="CAR30809.1"
FT                   /translation="MSSPRMDSALEEGQKTPSEQIKTTLFWLRWKFTTKEGLLGDYDYK
FT                   YLFTPTYPFKNFIDRRRGIEPVVYDQPFFGLNEEVPVLLGLILGLQHALAMLAGVITPP
FT                   MIIGGIANLDGVHVNYLVSASLITSGILSAVQITRFRIPKTPFHVGSGVLSIVGTSFSV
FT                   IGIVSKSVPLMYKTGYCPGGANSKEPCPDGYGALLGTAACCALLEILLSFMPPDILQRI
FT                   FPKQVTGPVVLTIAVPLIQTGFQDWVGGSGCVGEICPSKGAPQAAPWGSAKFIGLGFLV
FT                   YVTIILCEKYGPPILKSCAVIVGLLVGCIVAAACGYFQHDMIDQSPAATFLWKHTFKLR
FT                   VYGPAVLPFLVLFIVLTQETIGDITATSDVSRLEVEGKAFESRIQGAVLSDGLGGILSS
FT                   LFTVTPMSTFAQNNGVISLTKCASRQVGYWTCFYMLVMGIFAKFGAAIVQIPKPVLGGM
FT                   TTFLFTTVAVAGIAIISQIPFTRRDRFILTGALLPGFAAILVPNWFDYVFTYEGDNNAL
FT                   KGFLNAIVLIMETSFTICGIVAIILNLLIPQELDEELYDDIEVQQENLSVLEGRKSPTF
FT                   KPVMSGKEVEAFELTSEQRTSEP"
FT   gene            <214242..>214314
FT                   /locus_tag="ZYRO0E02794r"
FT                   /old_locus_tag="Zyro0E.tLys_CTT_3"
FT   tRNA            214242..214314
FT                   /locus_tag="ZYRO0E02794r"
FT                   /old_locus_tag="Zyro0E.tLys_CTT_3"
FT                   /note="tRNA-Lys (CTT) cove score=75.47"
FT   gene            complement(<215111..>215183)
FT                   /locus_tag="ZYRO0E02816r"
FT                   /old_locus_tag="Zyro0E.tLys_CTT_27"
FT   tRNA            complement(215111..215183)
FT                   /locus_tag="ZYRO0E02816r"
FT                   /old_locus_tag="Zyro0E.tLys_CTT_27"
FT                   /note="tRNA-Lys (CTT) cove score=75.47"
FT   gene            <215374..>218964
FT                   /locus_tag="ZYRO0E02838g"
FT                   /old_locus_tag="ZYRO-ORF4070"
FT   CDS_pept        215374..218964
FT                   /locus_tag="ZYRO0E02838g"
FT                   /old_locus_tag="ZYRO-ORF4070"
FT                   /product="ZYRO0E02838p"
FT                   /note="highly similar to uniprot|P22138 Saccharomyces
FT                   cerevisiae YPR010C RPA135 RNA polymerase I subunit A135"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02838g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30810"
FT                   /db_xref="GOA:C5E449"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR009674"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:C5E449"
FT                   /protein_id="CAR30810.1"
FT                   /translation="MGKVIKPPTAARTAHFRTLERESRFQNPPKDKSAYPLLYEAVQPH
FT                   IGSFNALTEGPEGGLLNQGIKDIGEKVIFDGKRSDSIQLGNRLSVSVEQASITKPMFND
FT                   GVASGVERRVFPSEARQRLSSYKGKLVIKLRWEVNNGEETFTEVRDCGAVPIMLQSNRC
FT                   HLYNMPPSELVKHKEESDEFGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGAAY
FT                   SQFGVQIRSVRPDQTSQTNVLHYLHDGQVTFRFSWRKNEYLIPVVMIIKALCDISDREI
FT                   FDGIIGPDLSNSFLTDRLELLLRGFKKRYPQLRNRTQVLQYLGDKFRIVFQAPPDKSDL
FT                   DVGKEVLHRIVLVHLNGDTNEDKCRLLLFMIRKLYSLVAGACSPDNPDATQHQEVLLGG
FT                   FLYGMILKEKVDEYMQSIIAQIRTDINRGIPANFKDRKYMTRVLMRVNDNIGSKMQYFL
FT                   STGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPES
FT                   WGFLCPVHTPDGAPCGLLNHFAHKCRISTKQSDVSQIPSILYSLGVSPASQAFAAGPSL
FT                   CCVQIDGKIVGWTSHEQGRIIADTLRLWKVEGKTPGLPLDLEIGYVPLSSRGQYPGLYI
FT                   FGGHSRMMRPVRYLPLDKEDIVGPFEQVYMNIAVTPQELQNNVHTHVEFTPTNILSILA
FT                   NLTPFSDFNQSPRNMYQCQMAKQTMGTPGVALCHRSDNKLYRLQSGQTPVVKANLYDDY
FT                   GMDNFPNGINAVVAVISYTGYDMDDAMIINKSADERGFAYGTMYKTEKVDLSLNRSRGD
FT                   PISQHFGFGNDEWPKEWLEKLDEDGLPFIGTYVEEGDPIVAYFDDTLNRTKVKTYHSTE
FT                   PAYIEEVNLIGDESNKLQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMP
FT                   FSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGTLHGVAQDASPWVFDENDTPADYF
FT                   GDQLLKSGYNYHGNEPMYSGASGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSL
FT                   TMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQTNVCRECGSILATQ
FT                   QSVPRIGSISSLRCRRCAINFDEAKKTLAKFEGSDNVFIDDSHIWEDGQGNKFVGGGET
FT                   TTVAIPFVLKFLDSELAAMGIRLRYNVDPR"
FT   gene            <219672..>222503
FT                   /locus_tag="ZYRO0E02860g"
FT                   /old_locus_tag="ZYRO-ORF4066"
FT   CDS_pept        219672..222503
FT                   /locus_tag="ZYRO0E02860g"
FT                   /old_locus_tag="ZYRO-ORF4066"
FT                   /product="ZYRO0E02860p"
FT                   /note="highly similar to uniprot|P13586 Saccharomyces
FT                   cerevisiae YGL167C PMR1 High affinity Ca2 /Mn2 P-type
FT                   ATPase required for Ca2 and Mn2 transport into Golgi
FT                   involved in Ca2 dependent protein sorting and processing
FT                   mutations in human homolog ATP2C1 cause acantholytic skin
FT                   condition Hailey-Hailey disease"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30811"
FT                   /db_xref="GOA:C5E450"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E450"
FT                   /protein_id="CAR30811.1"
FT                   /translation="MSENPFESRIGAEIDNESEMIFDATNEALSKPNPSLEYCTLTVEE
FT                   TLDKLRTSAEFGLDSIAETSRRRLEFGVNEVVSEDNESIWRKFVMNFVEDPLILLLIGS
FT                   AVVSFIMGNIDDAVSITLAIVFVVTVGFVQEYRSEKSLEALNRLVPAECHLVRCGQESH
FT                   VLASGLVPGDLVNFKFGDRIPADIRIVESVGLSIDESNLTGEQEPVHKTSQEVSKESYN
FT                   DQPFSIVPISDRTCIAYMGTLVKEGHGKGIVVGTGKNTSFGSVFEMMSTIEKPKTPLQM
FT                   SMDKLGKDLSLVSFILIGLICLIGVFQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLA
FT                   LGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLDSMESKSNAL
FT                   VLDKPRSTNYRNYLTEDVKATLTVSNFCNNASFSQEHCKHLGNPTDIALLENLSKFELQ
FT                   DLRSQTKKVHEIPFNSRKKFMAVQLIDLDGKCSLYVKGAFEKVLEQCSTFLNKKGKPEK
FT                   LSDSHRELITETANSLASDGLRTLAFAKAELPNGKNKVDEDSISGLTFTGLIAMSDPPR
FT                   PTVKPAVERLLRGGVHVIMITGDSENTAVNIAREVGIPIINPELSVLSGEKLNEMTEEQ
FT                   LANVIDHVSVFARATPEHKLNIVSALRKRGDIVAMTGDGVNDAPALKLADIGVSMGTMG
FT                   TDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTTFK
FT                   LPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTNEVLKRLSLSA
FT                   FVIIIGTVYVFIKEMAEDSQVTSRDTTMTFTCFVFFDMFNALACRHATKSVFETGLFAN
FT                   KMFNYAVGLSLLGQMCAIYVPFFQQVFKTESLSLGDLFFLLIISSTVLIADEVRKLWNK
FT                   RNALNDPYLYSNV"
FT   gene            complement(<222715..>223959)
FT                   /locus_tag="ZYRO0E02882g"
FT                   /old_locus_tag="ZYRO-ORF4063"
FT   CDS_pept        complement(222715..223959)
FT                   /locus_tag="ZYRO0E02882g"
FT                   /old_locus_tag="ZYRO-ORF4063"
FT                   /product="ZYRO0E02882p"
FT                   /note="similar to uniprot|P32579 Saccharomyces cerevisiae
FT                   YGL169W SUA5 Protein required for respiratory growth null
FT                   mutation suppresses the Cyc1p translation defect caused by
FT                   the presence of an aberrant ATG codon upstream of the
FT                   correct start"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02882g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30812"
FT                   /db_xref="GOA:C5E451"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:C5E451"
FT                   /protein_id="CAR30812.1"
FT                   /translation="MIKRFISKMSNVLETKILKVDPASIHFPEDAHLNGSLPTITDPIS
FT                   EKNLLEAAKIIRGNLEPVAFPTETVYGLGGSSLSDEAVKSIYRAKNRPSDNPLITHVSS
FT                   IDQLNRKIYQEKHSSLFQNIPNSYHPLISKLWPGPLTILLPVPLKTSALSKLTTADQPT
FT                   FAVRIPSNPIARALIALSDTPIAAPSANASTRPSPTMASHVYHDLKGRIPLILDGGPCK
FT                   VGVESTVVDGLSKPPLLLRPGGFTYEQIVELGGQDWKDCRVERRKVVAEGEQVRTPGMK
FT                   YKHYAPSAKVILLVPKPQRTDSDRIEELKRLISQELQNEDANTIKKLAILTSLHLGATE
FT                   IQDLTVGDSKIKPIVVKLGNTGEEIQANLFAALRQVDEIDNVNLIFVEGISEDREGLAI
FT                   MNRLRKAAGDHCVSF"
FT   gene            <225026..>225097
FT                   /locus_tag="ZYRO0E02904r"
FT                   /old_locus_tag="Zyro0E.tiMet(CAT_4"
FT   tRNA            225026..225097
FT                   /locus_tag="ZYRO0E02904r"
FT                   /old_locus_tag="Zyro0E.tiMet(CAT_4"
FT                   /note="tRNA-iMet (CAT) cove score=75.85"
FT   gene            complement(<225197..>225643)
FT                   /locus_tag="ZYRO0E02926g"
FT                   /old_locus_tag="ZYRO-ORF4061"
FT   CDS_pept        complement(225197..225643)
FT                   /locus_tag="ZYRO0E02926g"
FT                   /old_locus_tag="ZYRO-ORF4061"
FT                   /product="ZYRO0E02926p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30813"
FT                   /db_xref="UniProtKB/TrEMBL:C5E452"
FT                   /protein_id="CAR30813.1"
FT                   /translation="MRLTLILILTHLSICMAGANKLPSFVTDFLNGAESNGNWNEDTAQ
FT                   NYVNQLIEKHGAKVQEQINQITEDEKVAYAQSLQEETKDCGKRWHVGDATLTKLDNSVI
FT                   GSAFNKLRDSLPSWVSWDQTSLQDYGVYFFSVSDTNIFEGLEEG"
FT   gene            <225906..>226940
FT                   /locus_tag="ZYRO0E02948g"
FT                   /old_locus_tag="ZYRO-ORF4059"
FT   CDS_pept        225906..226940
FT                   /locus_tag="ZYRO0E02948g"
FT                   /old_locus_tag="ZYRO-ORF4059"
FT                   /product="ZYRO0E02948p"
FT                   /note="similar to uniprot|P47110 Saccharomyces cerevisiae
FT                   YJR043C POL32 Third subunit of DNA polymerase delta
FT                   involved in chromosomal DNA replication required for error-
FT                   prone DNA synthesis in the presence of DNA damage and
FT                   processivity interacts with Pol31p PCNA (Pol30p) and Pol1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02948g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30814"
FT                   /db_xref="GOA:C5E453"
FT                   /db_xref="UniProtKB/TrEMBL:C5E453"
FT                   /protein_id="CAR30814.1"
FT                   /translation="MEEAIEFINEKLFTEEKPVLFTDLIHKFHIGPSRAKKTMYAYYRS
FT                   NKTLKYNCIIVCCYKDRIKVVHDVNHVDSQESLIDCFIYAFNPMEEFIPVNLAVDQREY
FT                   LSILNPHKLVLPELRSKTVEEETTIKAVPKPSARSKTVPQTTKDEKPKPVPPKKQQQPA
FT                   KSKDGALKSTALLAKMRADREAKEAQRQKELAQRREKELQEKKSKNDAQMKELNQMFVD
FT                   DSDEDDGNDDNQRQESEKPTSTVEPDELEEILDSTAEESLLKQSQSQDEQPKVKQEPQD
FT                   TSYVDEDGYIVTNRPANNSSTSTPSQSRKRPGNSTPISHQQAKKPAPRKKTQGTLESFF
FT                   KKSK"
FT   gene            <227141..>227623
FT                   /locus_tag="ZYRO0E02970g"
FT                   /old_locus_tag="ZYRO-ORF4057"
FT   CDS_pept        227141..227623
FT                   /locus_tag="ZYRO0E02970g"
FT                   /old_locus_tag="ZYRO-ORF4057"
FT                   /product="ZYRO0E02970p"
FT                   /note="similar to uniprot|P25515 Saccharomyces cerevisiae
FT                   YEL027W CUP5 Proteolipid subunit of the vacuolar H( )-
FT                   ATPase V0 sector required for vacuolar acidification and
FT                   important for copper and iron metal ion homeostasis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02970g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30815"
FT                   /db_xref="GOA:C5E454"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:C5E454"
FT                   /protein_id="CAR30815.1"
FT                   /translation="MSELCPVYAPFFGAIGCAAAIIFTSFGAAYGTAKSGIGICVTCVL
FT                   RPDLLFKNIVPVIMAGIIAIYGLIVSVLIVYSLGQKQALFTGFIQLGAGLSVGLSGLAA
FT                   GFAIGIVGDAGVRGNSQQPRLFVGMLLILIFAEVLGLYGLIVALLLNARATQDVVC"
FT   gene            complement(<227763..>230000)
FT                   /locus_tag="ZYRO0E02992g"
FT                   /old_locus_tag="ZYRO-ORF4056"
FT   CDS_pept        complement(227763..230000)
FT                   /locus_tag="ZYRO0E02992g"
FT                   /old_locus_tag="ZYRO-ORF4056"
FT                   /product="ZYRO0E02992p"
FT                   /note="similar to uniprot|P46673 Saccharomyces cerevisiae
FT                   YJR042W NUP85 Subunit of the Nup84p subcomplex of the
FT                   nuclear pore complex (NPC) required for assembly of the
FT                   subcomplex and also for formation of the nucleocytoplasmic
FT                   Gsp1p concentration gradient that plays a role in nuclear
FT                   trafficking"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30816"
FT                   /db_xref="GOA:C5E455"
FT                   /db_xref="InterPro:IPR011502"
FT                   /db_xref="UniProtKB/TrEMBL:C5E455"
FT                   /protein_id="CAR30816.1"
FT                   /translation="MTVETTSDSQNLLMDVDTMDFVMEGNTGDTYSDDENETFDYDEVI
FT                   DRDPKSGAPVMSLSKNNAPLPTNGKGKLKYKLGPLSSQNMAYLDESNQYQLLPVKLARV
FT                   DTSEEYVHYVSKLFEIYRDLGYDRVYSVPTMGVINTTATKEHAAAVNLATSALVTELDF
FT                   FIDSIKAKKNALTRFSELEECLTILKCLKTIHFTLDTPEDVSVRETFITNLINWINRSD
FT                   GEPNEEYIEQVFEPTADGKKVFETSFFWKLLNQLLLRGLFDQALGCLDRSQIMEHLNSQ
FT                   CEMSSNALRDLVALLKQYPMDSTDSFREWKSLALELAQTYSGSDTSVSGELRDYIEDTL
FT                   FLVGGHQSKILHYSTTWYESFCALLLYYIPSLELSEEYLELSLQNHPVDVTSGWEQACV
FT                   DLIRGRIYSILPVLESLDTCSAAFAAALCEAKGLLERIVDDMETDRDASYEGLEDLFSY
FT                   RNGMACYMLNNFAFELCSQGDKRLWPIAIGLITLSPVNSTSAKKMAIAELLPHYPFKTN
FT                   DDIEWMLSILAKWKLPQVAKAVYVTLGNKLLYESNTIEAMANFSKAGKFEWVKRYSWIM
FT                   FEAAVMQGTPLDDVVLNAIVADEGDSIVPDEILSSLVTSAMKQTLSPYAVLYRFYQAQT
FT                   SNNWSEALTLLLALIEFPYLPNCYLVMLMARFMYPIFLENDSRHIDESTILRIMESLEN
FT                   KWDDTDAKSINIYSTMLEEGIIRQNSIPPDLTSFLKLIRQKLNLKLCQEFM"
FT   gene            <230333..>233779
FT                   /locus_tag="ZYRO0E03014g"
FT                   /old_locus_tag="ZYRO-ORF4054"
FT   CDS_pept        230333..233779
FT                   /locus_tag="ZYRO0E03014g"
FT                   /old_locus_tag="ZYRO-ORF4054"
FT                   /product="ZYRO0E03014p"
FT                   /note="similar to uniprot|P47108 Saccharomyces cerevisiae
FT                   YJR041C URB2 Nucleolar protein required for normal
FT                   metabolism of the rRNA primary transcript proposed to be
FT                   involved in ribosome biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03014g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30817"
FT                   /db_xref="GOA:C5E456"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018849"
FT                   /db_xref="UniProtKB/TrEMBL:C5E456"
FT                   /protein_id="CAR30817.1"
FT                   /translation="MEIPTSTEALTKLLRSKGTTTSQIVEITSHFDELDLYFPNKEIFI
FT                   LELIQDRWNDQKLVNFKKDYKIWKLYNDMFSKVTDDTIRKKLLKDLRFVPHLMKTLEVL
FT                   DSDIPEILIELERMCVLINSMIRVDVSAENAITILGKTLSLIQRTDADHETLVLQVINL
FT                   TDITNFAQVSAKMSDCYCRELLLPTVKYFVKFGSELTLLSDFLSKFLFEPSVDLVQLLE
FT                   SFVDGNRSQLESQDCILIFEKSMQSLSKQNFSMLEKIFTIITSAKKQLAPSLLKKLSIS
FT                   KKTMSQEFLDNLLSESLRDSKYDQPFWSLILHILDLDVEIGIQNFDQLIKLVVERKSEN
FT                   IESVEMLWEKLIQCFINAREFVGFLEKIQTYCGDQRESAIFLLQDPLFADKISSNISTL
FT                   SVVQLKFLITNLVDQILKGSSDTSDIGGSVLKLILKGLSRLSYISLPELKPAVAKVFEV
FT                   HADHPSKLWEIWYLAMEVYDDIVPLDSLESIEKQLSLFFSLPIKPKELFYYFFKLREYT
FT                   TFDLVQLSDALLQFLQESTTETKRVVLKDIFSNWYSLLNSAFSRKALEQLTNFLVSEEC
FT                   IDLLDEIFEDDNIFEEPNVIFFLVQKLQERSEQQEYVLKLQKIPIQCINKSTRSDLINS
FT                   LSSKKVITKKDIELIGHLLSNPTFKSNIERQADSLYSVLSHATEKLTYENVAVEKVWQN
FT                   HLGQMKEASSIDFIREGGQFISRGMNEDPNEIGYFQMAFLALKVCRSNALDPLKKDFVG
FT                   KCLKRLSNAEKEDIEIIIWFLRALYYVFKLDNNCISKDESARQTVSNLYRSIKTSDKEM
FT                   QKKLLTNIFLLYSTTYADKLEYLYAHYMVLRNCDIESEEILPAIEDVLSDSSKTNLVEF
FT                   NQAFANLTFSLGSCKSNFNEGLLELYRVQIEHLEKDNIIGTHLFAKSLSEFYTNCENFK
FT                   SARVPVLRLLTTLQSLLVSKPWLFSQYCTEMLFPFCLKLMSTFFEGSGANDDLFTAIVK
FT                   VISNILLAQGVKLTNRHHLMNSFICVCLELIADYKNTGLSSQSAKSLSRLISNFVEPSS
FT                   SGNNYSNKYSKNNLSSTVGLQKKLLRKYVPVLLIRFIHLSIYRPFESPARKELASGVYA
FT                   IFDLISQAELNMINSILDHAGRQYFKSLYAEYKKVGKWDAN"
FT   gene            complement(<233916..>236231)
FT                   /locus_tag="ZYRO0E03036g"
FT                   /old_locus_tag="ZYRO-ORF4051"
FT   CDS_pept        complement(233916..236231)
FT                   /locus_tag="ZYRO0E03036g"
FT                   /old_locus_tag="ZYRO-ORF4051"
FT                   /product="ZYRO0E03036p"
FT                   /note="similar to uniprot|P37020 Saccharomyces cerevisiae
FT                   YJR040W GEF1 Chloride channel localized to late- or post-
FT                   Golgi vesicles involved in iron metabolism highly
FT                   homologous to voltage-gated chloride channels in
FT                   vertebrates"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03036g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30818"
FT                   /db_xref="GOA:C5E457"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:C5E457"
FT                   /protein_id="CAR30818.1"
FT                   /translation="MSSSNKGVSNSDRFNDIPETANFNQFLTIDWLNEKNKLVSDGSSK
FT                   DYRNKDLRNLKYRRFKVAIWSRCQTIITLTAIGVTIGCIAGFLQIFTETLVNWKTGHCT
FT                   RNWLLNKSFCCSGFANDGEHKDTRSPLSKREEFECVSNGVWTPWSSTPIPFLIFMGLSV
FT                   TFALFSTLMVNYIAPMATGSGISEIKVWVSGFKYRDDFLNGLTLIVKSIALPLAISSGL
FT                   SVGKEGPSVHYATCCGYVITNWLMKDVLTYSKQSEYLTAASGAGVAVAFGSPIGGVLFS
FT                   LEEIASSVEFSASTLWKSFYVALCATSTLEYINPFRSGKIVLFNVTYDRDWKVQEIPVF
FT                   IILGIFGGLYGKYVSKWNINYVHFRKVCLSNWPIREVVFLAFITALICYTNEFLKLDMT
FT                   ESMGILFHECQSNDKASSFTHRLCQLDENTHVVSFLRILSSLFIATLVRAFLVVISYGA
FT                   KIPAGIFVPSMAVGATFGRAISLLVERFISGPGVITGGTYAFLGAAATLCGITQLTLAV
FT                   VVIMFELTGAFMYIIPTMIVVAVTRMVMASSGVPGGISDQMIKVNGFPLVESEDGDEFM
FT                   DDTIAEEIMSPNLVTINEKMTLSSLESLIYNSETIAVNGFPVVKEDYDMRTGKKCIGYV
FT                   LRRDILTKLLMIESDSRGANSTILDFGGSDLSFATELEGTQHMSFRDIVIPFPVSVKMG
FT                   APASLLFRMFKQLGCKVIIVENDGMLRGLITRKDIVRLQRTKKRELYGPPYICNTFLDE
FT                   KILFVMKSIVNKFKRTEN"
FT   gene            <236699..>237079
FT                   /locus_tag="ZYRO0E03058g"
FT                   /old_locus_tag="ZYRO-ORF4049"
FT   CDS_pept        236699..237079
FT                   /locus_tag="ZYRO0E03058g"
FT                   /old_locus_tag="ZYRO-ORF4049"
FT                   /product="ZYRO0E03058p"
FT                   /note="highly similar to uniprot|P39990 Saccharomyces
FT                   cerevisiae YEL026W SNU13 RNA binding protein, part of U3
FT                   snoRNP involved in rRNA processing, part of U4/U6-U5 tri-
FT                   snRNP involved in mRNA splicing, similar to human 15.5K
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03058g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30819"
FT                   /db_xref="GOA:C5E458"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C5E458"
FT                   /protein_id="CAR30819.1"
FT                   /translation="MSAPNPKAFPLADETLTQQILDVVQQSSNLRQLKKGANEATKTLN
FT                   RGISEFIIMAADCQPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASVTT
FT                   NDASSIKNQIYAVKDKIETLLI"
FT   gene            complement(<237145..>240105)
FT                   /locus_tag="ZYRO0E03080g"
FT                   /old_locus_tag="ZYRO-ORF4048"
FT   CDS_pept        complement(237145..240105)
FT                   /locus_tag="ZYRO0E03080g"
FT                   /old_locus_tag="ZYRO-ORF4048"
FT                   /product="ZYRO0E03080p"
FT                   /note="weakly similar to uniprot|P39991 Saccharomyces
FT                   cerevisiae YEL025C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03080g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30820"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E459"
FT                   /protein_id="CAR30820.1"
FT                   /translation="MDDLKYLSDELKFRKDLELPLREYRLDPYGDFPSGRVIGYQKLNN
FT                   DNLHLLCFNNGLYVFDLDHLVYHEKASPLSSFVAYLYLENFQGTNGECFPAHVFFKSDG
FT                   IILFYRINLSTLKFSPVFISERGDFSVLNFQSITASSKNGIYISQAGKTIYKWSYFDPR
FT                   ESLGVFLPVERQPLQYSTFMLNDSIFLCVYKSVFNGDVFVEFSKHCSRTGIFKPLKRAT
FT                   LGNLDFKSVIIEKINDQLVLCVTSNKTWNFTSDLKVFQRKNKGLPNDAQFFSISWNSMM
FT                   NSIRLHTSSDVFETTDLDIHLAKPPIRWSSKKIHSISSYSASMVDYSYELRENLYVIIY
FT                   ARGLVVLVNSSTLQSSVLKCDNENRSYFAGQIAANKGSDLNTVLLCGASGDRHGFFEKR
FT                   FLQYPPCKRVFPFSKRLIHTPVTNLWSTKDGIFYESLGTIYNSDSDSDNGQDGIWVSKT
FT                   GEVLKDADDETLFKESVASSWGDEAEEVSGAMSWERNTDYIATICANGVLELLKYTEES
FT                   APQKILQLQLGEWLNEATVVSACYNYRKKILHVAAFVDYRKIFYCDNRNKSFEIPVEHD
FT                   FQVAGLQIIDNYVNLARGFTDRLVSNVLIVATSFDGRIRIYSMLNEKVILEIKSPQNSE
FT                   FQMVKFFNFIIFHNAFEVILLRTCDLVYGNLPLPEIPYKIIHLKNNEICILDRCWNLQF
FT                   LEISASVEKQLMIHEPEYQSQFYNFGDYLPLQMSLMPGSDNLVAMALKNYSNSAGLQLV
FT                   LFDHINMKTVKSQEWDEVASGVLLVSYFNHLLLSYYKDDHSIVKIFDFHLKLIRRMSFD
FT                   HRIPSLYFTTPGLESIRSGLRIKDCEEFTSGLPENIIENLCRHFNDPRNSKYRTIYETA
FT                   KRPQLVTWHHGKEDEYQATDTDILIDFVEDRREPTISRPKNYKLHLTFNNHISIDDFKK
FT                   LIPYEILSVSPIDEFIYNIQDGIQRTSYIRPLFLITCSHNAIYILSAKYIEPDEWK"
FT   gene            complement(<240333..>243686)
FT                   /locus_tag="ZYRO0E03102g"
FT                   /old_locus_tag="ZYRO-ORF4047"
FT   CDS_pept        complement(240333..243686)
FT                   /locus_tag="ZYRO0E03102g"
FT                   /old_locus_tag="ZYRO-ORF4047"
FT                   /product="ZYRO0E03102p"
FT                   /note="weakly similar to uniprot|P47107 Saccharomyces
FT                   cerevisiae YJR039W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03102g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30821"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:C5E460"
FT                   /protein_id="CAR30821.1"
FT                   /translation="MEDHVVLGELSKSKCMIDSFILRDGTLLVVEPEQICRAVYSSELV
FT                   YEQMETIVTTGYNIGASAYWEPLTGVEYLILLKDCGALELLNSQCERIDLLETGMEQDD
FT                   EKKFFAFDERDNQIFINLRKNTIFAIEYQLKNKVMYFVKRDEGPRCIFEDVDTIIGMEI
FT                   SWNIDYMSGRDFPTISILLLNIFSQNYYFQVIRQAPKEVRKGRQPWETFISHSKLEVQF
FT                   EDNRAVLRAISNVGFFIFGPRQVLFIKLPGGYEQTVKDVEFQQFQSFEGCYMSYDLTED
FT                   DKINLDGGIILRRNVNSLEFAAFNSQNRLLKIWLKVIFEDPDELIYHWDALSTEIITIE
FT                   GLTSDRQIITRTILLSNAMAILLCEPENEIIFLDLNQIQVVKRVPYNLSKMFSSDIIGT
FT                   DFHKLVNCGGSVNNKGFVESKFWGHSNFFSLVESFDSEYQVMQLWNNNKGVWWKDSRGQ
FT                   IFCNGELIDTCMSPIHVTLDGTIVKDTSIITWSNIFNDPSGNYAYVSKVGHIGWSDETE
FT                   TVLLDKLRSSSLVKYILTCTKLENGSKITVLSVDNKLTILQDTHILKKDIDVSTELDSI
FT                   ACMNVISWRGSLRLLITDIDGKLCELDIKNVKICTKHKIGAQRAEICAVTDRGFFLIYT
FT                   RDDLLLLSSTETGKFELTRIDMKTRISKIAAKDGSAISILDDDSKIHQYTIANEIPQPN
FT                   VINKRIDSNLYIHTKFISLSCSTRYVLTSSLRSAYSDLLQRVKYYTEIQLHDLETQKTV
FT                   SQYDLSEKYPQALVSDIVALPFNRESFMSDGMNQNNIYAMQLAFDRVFIVSLNYEMAED
FT                   ESLDNLLLFSIDDNNGTIELLQGVNTSHPITALLNYHNRTLITAGEVLQAYKIDYLLKE
FT                   NTFKIDLVSNDVRCGGLVNTIVRLPRTYPPGMVPEGKKRKLQEGSFVNERLLILNILRG
FT                   LREYVLTQKSNSAQENLRITPITTSEKSLFGDHPNANGLITHLSMCRMGETTWLITGDT
FT                   ERSIFLYRTSIDDEPSLIQLKLPGDIVSICSFSKSHESSYLIREESLIQCERKPISILF
FT                   TISTSKGEYLIGILEDSKLLRKLKTTVGKKMEEQFKFIQLEDEQSDLIFTDTRISTDSS
FT                   FKKSFEKSML"
FT   gene            <244074..>246614
FT                   /locus_tag="ZYRO0E03124g"
FT                   /old_locus_tag="ZYRO-ORF4045"
FT   CDS_pept        244074..246614
FT                   /locus_tag="ZYRO0E03124g"
FT                   /old_locus_tag="ZYRO-ORF4045"
FT                   /product="ZYRO0E03124p"
FT                   /note="similar to uniprot|P40985 Saccharomyces cerevisiae
FT                   YJR036C HUL4 Protein with similarity to hect domain E3
FT                   ubiquitin-protein ligases, not essential for viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03124g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30822"
FT                   /db_xref="GOA:C5E461"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR005735"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:C5E461"
FT                   /protein_id="CAR30822.1"
FT                   /translation="MPQLFRRFSSKKSSDIQIVSHSKGKSQGKRENRQRADSDSSENGL
FT                   DSFKEIKCPCCGTLLQFPSDVKRLKCAVCQVTTVVPMKGDSRVSSSGKSNITISFSELQ
FT                   TIVDKCCAKRAKMKAATKEELCAIYDPVAAYLNEGFHDIDILNNSFKTSHRRQLIDYYE
FT                   LMNFYQLVMELPTRNPFYRMLCASNDLLKNPPYTGGDVRWILIIWANPSIKRSLVGQKK
FT                   NGYDAPKILAVAYELTKRCIGYLANIESQAQYGKLMKHLKYISLNEFQSQVELLNIYIT
FT                   FQFSRILYRDLKASVNPHKRTLVDNSPLVQPSPTGSELLSNEDKNDSLNLKHGKPAVVQ
FT                   DFKFKPYEYELDWHIRCAAKLMQTMNKVNDKRYTITKTTNLSSLEFYNVMLDFIDYRQD
FT                   FENWRTDNKKSSKETPVTLTDFPGMPMRRFTLCSYPFLLSLGVKISIMEHEVRRIMEYE
FT                   AENAFLTSLDKGKAVSVYFKIRVRRSNITNDSLRSIENHQRDLMKSLRVEFVNEPGVDA
FT                   GGLRKEWFLLLTRSLFNPLNGLFSYVEESRLSWFAIIPIRSGSQDGCPDHSQLYYLFGI
FT                   VIGLAIFNSTILDLEFPRAFYKKLCGELLNFDDYMQLYPETGQNLIKMLDYNKEDFTDV
FT                   FALTFEATYEDRSKELLGHKPCIVSVELCRNGRYRKVTQENKYEFVQLWQDFFMNKSVE
FT                   AQFKQFASGFRQVFVLCESIRLFNHEELARLICGNREKNCFEFQMLRSVTRYVGGFNDK
FT                   SRVVVWFWEILQGWDFRLQRKLLQFATGSDRVPPGGMSTLPFKISRLGSKDSDKLPLAH
FT                   TCFNEVCLWEYSSKEKLEQKLWWAVTQSEGYGFK"
FT   gene            <247502..>248152
FT                   /locus_tag="ZYRO0E03146g"
FT                   /old_locus_tag="ZYRO-ORF4041"
FT   CDS_pept        247502..248152
FT                   /locus_tag="ZYRO0E03146g"
FT                   /old_locus_tag="ZYRO-ORF4041"
FT                   /product="ZYRO0E03146p"
FT                   /note="highly similar to gnl|GLV|DEHA0F12771g Debaryomyces
FT                   hansenii DEHA0F12771g and similar to YEL024W uniprot|P08067
FT                   Saccharomyces cerevisiae YEL024W RIP1 oxidizes ubiquinol at
FT                   center P in the protonmotive Q cycle mechanism transferring
FT                   one electron to cytochrome c1 and generating a
FT                   low-potential ubisemiquinone anion which reduces the low-
FT                   potential cytochrome b-566 heme group Rieske iron-sulfur
FT                   protein of the mitochondrial cytochrome bc1 complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30823"
FT                   /db_xref="GOA:C5E462"
FT                   /db_xref="InterPro:IPR004192"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR037008"
FT                   /db_xref="UniProtKB/TrEMBL:C5E462"
FT                   /protein_id="CAR30823.1"
FT                   /translation="MLSLRSSLRTSLKSLAPSTRMLSGSAVAAKSTYRTPNFGDSIKEN
FT                   NDPDRSRSYAYFMVGSLGLLSSAGAKSTVDSFISSMSASADVLAMAKVEVSLAAIPEGK
FT                   NVVVKWQGKPVFIRHRTSAEVQEANEVQMAALKDPQTDADRTKDPQWLIMLGICTHLGC
FT                   VPIGESGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFEEDGQKVIVG"
FT   gene            complement(<248494..>250518)
FT                   /locus_tag="ZYRO0E03168g"
FT                   /old_locus_tag="ZYRO-ORF4039"
FT   CDS_pept        complement(248494..250518)
FT                   /locus_tag="ZYRO0E03168g"
FT                   /old_locus_tag="ZYRO-ORF4039"
FT                   /product="ZYRO0E03168p"
FT                   /note="similar to uniprot|P39992 Saccharomyces cerevisiae
FT                   YEL023C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30824"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniProtKB/TrEMBL:C5E463"
FT                   /protein_id="CAR30824.1"
FT                   /translation="MSTSESHSGQEEGSGKNIVLCFDGTCENFGPNPITNVLKIFQLLE
FT                   TQDDKIQMCYYQPGVGTEANFDPVVDMRRNFSTASIMNKIDALFASSIDHHIVSGYLFL
FT                   MNYYEKGDKVYMFGFSRGAYVARALAGMLERVGLLNRGLDDMVSMAWKIYESWEFAEQP
FT                   SESSYNTTLAEEFKRTFSRPYEIRVFFQGLFDSVNSVGILRDRLFPCTQRSGIVDHIRH
FT                   AVSLDERKGKFKQQTFAINLDAPKLFSLNYNSYLVETASEVSEEQTLDDTNPNLSHSLI
FT                   ELMLNKGSGSVKQASDSSESNSSAKAENLTQKINKQLQKLRSSNLQNTKNVNENVEGFF
FT                   EYEPFSNSVRTVNSLMTSDLVEKWFPGDHSDVGGGYHSDCETREVLSGLSLRWMIAEAV
FT                   KHGLIFKKHSIHKLASKQTSLGSLFSTIHDKLSFNQVRHPDLDEPYEQIEDNNTDSREQ
FT                   LLSELESANWLQTTWNNFKEMRINEILTEREAAREKYTFDCTSASKFQIALWWLLELIP
FT                   IGLRMESGSGKWRSVYIPNLGQPRYVPDYGNIHWSVYWRIRYDNSYRPKNLPNYCRKLL
FT                   KGYADINMEPSKGRSAHAIASPIKSYPTDLDHRSNNNLPSDNNNSTSTNGREMNKMIVN
FT                   DIAEVQCFETGVKFSEWAAHHWREIPDDLEPWLLKFPDL"
FT   gene            complement(<250709..>253867)
FT                   /locus_tag="ZYRO0E03190g"
FT                   /old_locus_tag="ZYRO-ORF4038"
FT   CDS_pept        complement(250709..253867)
FT                   /locus_tag="ZYRO0E03190g"
FT                   /old_locus_tag="ZYRO-ORF4038"
FT                   /product="ZYRO0E03190p"
FT                   /note="similar to uniprot|P40352 Saccharomyces cerevisiae
FT                   YJR035W RAD26 Protein involved in transcription-coupled
FT                   repair nucleotide excision repair of UV-induced DNA lesions
FT                   homolog of human CSB protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03190g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30825"
FT                   /db_xref="GOA:C5E464"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C5E464"
FT                   /protein_id="CAR30825.1"
FT                   /translation="MDGSEKQLQDLGLVNVLSQSTLEQRIQNDATSLINQQLLEQEQGR
FT                   LERAQNAVEKCNDKIGLLTRRWNNASRISARQKLQEQIDEIKNNELPPILSDIKDIRKR
FT                   LRDLKKSQKSDATRDSSQDEGKKPGESERDYLVRTGQVTAFGSKRGFEVANDSEEGEEE
FT                   NQEQEENDVAKKSPPSNDDDDDYKDEDMDDEENDLDVSQGEDVKEENDIVLQPGAVKDD
FT                   GDEYFYQKRLRQWCNRRAQGRKTDNNPDWPEWRKKHQEFPDAKLDDEFRIPGEIYSLLF
FT                   NYQRTCVQWLYELYQQKCGGIIGDEMGLGKTIQVIAFLAALHHSNQLDGPVLIVCPATV
FT                   MKQWCTEFHHWWPPFRTVILHSIGAGMASKKKMSEDELEDMIMSGDPNQFSYGDLENSS
FT                   KTKAQVESDNLLQTLIDKVAKDGHVLITTYVGLRIHADKLLKINWAYGILDEGHKIRNP
FT                   DSDISLTCKKLKTPNRLILSGTPIQNNLTELWSLFDFIFPGKLGTLPIFQQQFVQPINM
FT                   GGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPEKKEMVLFCKLTQVQRR
FT                   KYLEFLHSRELEDIKGGKRRVLYGIDILRKICNHPDLLDRDERSKEASYGDPKRSGKMQ
FT                   VVKQLLLLWRKEGHKALLFTQSRQMLDILQEFIAFKDQELTGLKFLRMDGTTTISIRQS
FT                   LVDEFNRGDYNVFLLTTRVGGIGVNLTGANRIIIFDPDWNPSTDMQARERAWRIGQKRE
FT                   VSIYRLMVTGSIEEKIYHRQIFKQFLTNKILSDPKQKRFFKMNELHDLFTLGGENGHAT
FT                   EELESEVQQRTEGLKNSKSDESDDFEKVVNLIGVSKLESFYTGKESQENSKKDDDRLIE
FT                   GLLGESGLAGAATHESMMSSHSNGSSDIITREASKLADAAVNALRKSRRARKKFDVGTP
FT                   TWTGKFGQAGKIRKKRDKDVPGSSAILANIRNAQKQAENIPSQESTSEEVEEKQVILRQ
FT                   IENYLHKCPDYFATSSDVINNIKVNLSTKEDVIKIRALLKVIATFDKTRKGWKLNEEFI
FT                   NSEY"
FT   gene            complement(<254321..>254392)
FT                   /locus_tag="ZYRO0E03212r"
FT                   /old_locus_tag="Zyro0E.tPro_TGG_26"
FT   tRNA            complement(254321..254392)
FT                   /locus_tag="ZYRO0E03212r"
FT                   /old_locus_tag="Zyro0E.tPro_TGG_26"
FT                   /note="tRNA-Pro (TGG) cove score=66.07"
FT   gene            complement(<254683..>254754)
FT                   /locus_tag="ZYRO0E03234r"
FT                   /old_locus_tag="Zyro0E.tPro_TGG_25"
FT   tRNA            complement(254683..254754)
FT                   /locus_tag="ZYRO0E03234r"
FT                   /old_locus_tag="Zyro0E.tPro_TGG_25"
FT                   /note="tRNA-Pro (TGG) cove score=66.07"
FT   gene            complement(<254862..>255188)
FT                   /locus_tag="ZYRO0E03256g"
FT                   /old_locus_tag="ZYRO-ORF4036"
FT   CDS_pept        complement(254862..255188)
FT                   /locus_tag="ZYRO0E03256g"
FT                   /old_locus_tag="ZYRO-ORF4036"
FT                   /product="ZYRO0E03256p"
FT                   /note="similar to uniprot|Q02772 Saccharomyces cerevisiae
FT                   YJR034W PET191 Protein required for assembly of cytochrome
FT                   c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03256g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30826"
FT                   /db_xref="GOA:C5E465"
FT                   /db_xref="InterPro:IPR018793"
FT                   /db_xref="UniProtKB/TrEMBL:C5E465"
FT                   /protein_id="CAR30826.1"
FT                   /translation="MGASCKDQHKAVAVCLQRSPCVMIERHTPQECFEDPELKKELPLL
FT                   CISQMKAFLDCKRGMVDMTKRIRGNGPLSTGRYDQQYDKLCSGDFDPREELKKLELLDN
FT                   NKKD"
FT   gene            <255578..>259558
FT                   /locus_tag="ZYRO0E03278g"
FT                   /old_locus_tag="ZYRO-ORF4034"
FT   CDS_pept        255578..259558
FT                   /locus_tag="ZYRO0E03278g"
FT                   /old_locus_tag="ZYRO-ORF4034"
FT                   /product="ZYRO0E03278p"
FT                   /note="similar to uniprot|P47104 Saccharomyces cerevisiae
FT                   YJR033C RAV1 Subunit of the RAVE complex (Rav1p Rav2p
FT                   Skp1p) which promotes assembly of the V-ATPase holoenzyme
FT                   required for transport between the early and late
FT                   endosome/PVC and for localization of TGN membrane proteins
FT                   potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30827"
FT                   /db_xref="GOA:C5E466"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022033"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E466"
FT                   /protein_id="CAR30827.1"
FT                   /translation="MSLTYLPGRPNDTQQSTCQSSWQGRIVFAYCSGNNLIILSNGFQR
FT                   LQTIYLESDSVAVDINPRNGFIAIGYGNKVGIYKPKHQVMKAPSWVFCCEIVHDDSKVN
FT                   SLSWGNFNDLTVGSNYLSFWKINDEFGVYKPVLQWNKKQPKPVYLCITSQCSQMIASFG
FT                   KYDTSVKLWKRISISGDQVLFNLTLLPHPAPICTMRWRKSGRCEPSENPNGLQAIYTLC
FT                   ADQKLRVWLCYELDSLHNVQHWATLQLEDAQRYCFTIDNWLLKDQRDLVLIADREGNLV
FT                   IYSLSHLSSDPPRPIAKEKLSTKSFSYSSFVTKPDFLYFAELQPCDDNTDDLSLIIHDL
FT                   RGVIRQSRITVSQLLERNHSQIGTLEHKFTGHNKSVQKLIRSSDGEAMLTISRFLECCV
FT                   WCPQRLSDESSLKLRGVIITEAPVKHAIIHEKGKLVICLLENSKLQAWECAGIEGKCDL
FT                   KRSHLKFEQQLEASTAEHGEPLLMLNTPESVHNHDRHFVALIYKDGAIRAFEISSDQGI
FT                   QEIYSESLEIPDNQIHHIATIDPVHQNFFSDRPLISLMSKNATAITYKAVVDCEKKLIH
FT                   WHKSCEFKTGMKDVVALRGSSTGKLCTVHCKGKKMSLWDLNKRVLEYEESFDDEIKDVD
FT                   WTSTEYGQSIVSIGFSGYALLYTQLRYDYTNHNPSYLPIEKIDITSHTAHQIGDSIWLK
FT                   DGMFVVASGNQFYIKDKFLDLNDPFTRRSIGSRKILSNDILHLSSVLNGPLPVYHPQFL
FT                   IQAVYANKLQLVKELLLRLFLELRKLTFENENYSKLTSDLKTNYNKFLTAQDNQFERDQ
FT                   FPDPYPEFNRTVALALCEQLTKITLPYLTRHQQITLSTVVEAVEEILRNESVVDYNGIR
FT                   FLLGVKLYASHKNVQKTILMRDVNWALHSDNKELLLSILDSHITSWAAACEYRISFWAK
FT                   EDDLITKFEQIAKFEFSKDDKRDPSRCGIFYLALKKKKILFSLWKISIGHPEQQKMIKF
FT                   LSNDFSEARWRKAALKNAFVLLSKHRYMDAACFFLLAECLKDCVNVLFKQVKDLDLAIG
FT                   VCRVFEGDNGPVLGEFLTQQILPNAILQNDRWISSFVYWKLRRHDKAIRTLVMDPFDLE
FT                   KDTGLVDMDGGVSKSFLAEDPALLMLYSHLRKRNIKYFLGSLKVEGELEYSLIGRVADI
FT                   LRRMGCDYLALSLVRNWEFIGVHEKLISSKNEQKSSELFSNVTNSHPTNKMKPGMFEKF
FT                   ENDSPDVTSRRKTKNLLDDFFTDLPSESSASPAPTQETHDDLPASADETKPSTTASRSL
FT                   LDDFGSQEPSVPRDTSATSSTTIEPVKRTPPSQPRNLLDDFM"
FT   gene            complement(<259634..>260827)
FT                   /locus_tag="ZYRO0E03300g"
FT                   /old_locus_tag="ZYRO-ORF4033"
FT   CDS_pept        complement(259634..260827)
FT                   /locus_tag="ZYRO0E03300g"
FT                   /old_locus_tag="ZYRO-ORF4033"
FT                   /product="ZYRO0E03300p"
FT                   /note="similar to uniprot|P47103 Saccharomyces cerevisiae
FT                   YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
FT                   (cyclophilin) catalyzes the cis-trans isomerization of
FT                   peptide bonds N-terminal to proline residues binds to
FT                   Hsp82p and contributes to chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03300g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30828"
FT                   /db_xref="GOA:C5E467"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C5E467"
FT                   /protein_id="CAR30828.1"
FT                   /translation="MSLNPKTFFDISIGDSPIGRIVFELYEKEAPKTVDNFVILCTAAD
FT                   SYLEDTPLKFRNNYFHRVVKNFAIQAGDVFHCSDKYEKNDNTGKGGCSIYASTEDLIKR
FT                   DAESLCFGDFEDENLKNFDKPFLLAMANKGEPNTNSSQFFITTSPAPHLNGKHTLFGRV
FT                   VHGKSVVRTIERCSVDSDGFPESCIRIVSSGKWSEGDPLPLHNASNDTIGGDIYEEYPD
FT                   DNENFDEDNFTLAFKVANTIKESGTLLYKKKDFQNAYYKYIKSLRYVNEFIPEESVDKA
FT                   NRINFINLKSKLYLNLSLVLYYLQNYDESIKYATYLLEMENIPDADQAKALYRRGNSYS
FT                   AKRKWEEALKDYKSCQEKNDQDKVVVEKIEGVEKELEKKKEKAKQTMSKFFTESTEE"
FT   gene            <260990..>265570
FT                   /locus_tag="ZYRO0E03322g"
FT                   /old_locus_tag="ZYRO-ORF4032"
FT   CDS_pept        260990..265570
FT                   /locus_tag="ZYRO0E03322g"
FT                   /old_locus_tag="ZYRO-ORF4032"
FT                   /product="ZYRO0E03322p"
FT                   /note="similar to uniprot|P39993 Saccharomyces cerevisiae
FT                   YEL022W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03322g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30829"
FT                   /db_xref="GOA:C5E468"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="InterPro:IPR032691"
FT                   /db_xref="InterPro:IPR035999"
FT                   /db_xref="UniProtKB/TrEMBL:C5E468"
FT                   /protein_id="CAR30829.1"
FT                   /translation="MNKKCYSVESCYEPIEGKQDQVGFWISGSLLFQFSVSHLLKMNSD
FT                   YVVAVDPVTIVIKECINLSTAMRKYSKFRSQSGVAALLSSSEIFTNQDDSLAVTFNNLS
FT                   SNKHNDPLLSGFVQLRLMLNNLQNLEEIDSLTLLQPFLLTISTSSISGYITSLALDSLQ
FT                   KFLTMNIINETSKNHVAAIREAVNALTHCRFERSEQLSDDAVLLKVVILLQGVTHSRYG
FT                   ELISDSIMYDVLQTVLSLACNKKRSEVLRRAAETTMVSITASLFYKLKNIEPTDLTQKY
FT                   INDEGYANSILQEDLIGTPDGSQEEDYTRDEPTTLSGGEEVATNTSQLLEQSQEEKDEK
FT                   DSTHVMESQRSESKDSKSSEVLEDNHGIPVIRHYLNLLLSLIVPENQAKHTNSVRIFGL
FT                   QLINTAIEVSGNTFPQHPRLFSLVSDPIFKHVLFIIQNGSKLSLVQAALQLFTTLVIIL
FT                   GDHLKVQIELTLNRIFDILLNNANEITSEGRPRPAAVKELLIEQISLLWTRSPSFFTST
FT                   FIEFDCNLDRADVSINFLSALTKLALPESALTSTESVPPICLEGLISLIDDIYSRLQRV
FT                   DREKFLQDKGNVSRLKQKERKTEFIKCAKIFNEKPKKGVPLLIEKKFITSDSEEDIAQF
FT                   LFENNGRLNKRTIGLFLCDPSHTSLLKQFIDLFDFKDLRVDEAIRILLTKFRLPGESQQ
FT                   IERIIEAFSARYVDSQKYDPSKANNNNDDEDLSTIQPDADSVFILSYSVIMLNTDLHNP
FT                   QVKEHMSFDDYCSNLKGCYNQQNFPHWYLDRIYCSIRDKEIVMPEEHHGNDRWFEDAWN
FT                   NLISSTMVMTEIQEQCERDYDNLGLQEISQFDGAIFQHVGRSIVDTFFKIFEVASDDHI
FT                   SSRMLSSVDKCAFIASFLEIDNLFNEILYKIAVMTTLSDGTNRDPNENDEIPLVEITVE
FT                   DSNSKILVSSDACRLGRSFKAQLCVVIFFRVFRTNNFFTKLTPELWNKIVKILLLLFED
FT                   LMISPDIFPDLQQRLKLGNLPRPAPEVSLKKAKESRGILSAFASYLKGDEEPTEDEIDA
FT                   SAKAIDCVRSSNIPSSIFGNEKNITEELIRMLLNSIKLKKTPENSRFFEPEMLFIVELC
FT                   VALFLFCKDKKTLGSHILHKISEISKVSGLSKRCIRRLMAYNLLLISVVDEQQDMLHKL
FT                   INDELLKKNEVFTQKYFASEHGCEVLRRLLALTDIDNYRNTILQDEGFWKLLRLLASMK
FT                   EHTATIYNYLERSLYATNNILANENFMWILGLLDEISSLGAVGSQWEREYQRLLKTGHK
FT                   VDDKNPHQPLIDLSLKSIKLTSQIVEKKLASIHLSKNETIALIQALAHQCLNPCSQIRS
FT                   FSLECLENVLIKLDLPSAEISNLEELIEGGLLPLLDTMNSKEGSTVPVSEILAVISKIY
FT                   LYRLKQGITTDETFLKILNIYNRYVEVPEVEKQLQHLITDKKAIEKPTSSAAHEDESSN
FT                   NDSHQAPAEVPQSAVPESESSKDDPQQAPAETPSSATPPATALVAETSQISNGESAKEQ
FT                   ITEQVN"
FT   gene            complement(<265644..>266966)
FT                   /locus_tag="ZYRO0E03344g"
FT                   /old_locus_tag="ZYRO-ORF4027"
FT   CDS_pept        complement(265644..266966)
FT                   /locus_tag="ZYRO0E03344g"
FT                   /old_locus_tag="ZYRO-ORF4027"
FT                   /product="ZYRO0E03344p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03344g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30830"
FT                   /db_xref="GOA:C5E469"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E469"
FT                   /protein_id="CAR30830.1"
FT                   /translation="MTTGYDSIDGGESNATPSTAHRTSVIGALTAGGRSVVYQLTSFYL
FT                   RTPLKLFRPARFDYLHYLRVVLTGEERKPLHEVEKQQKLKRFRILNPKYMYYLENSSLG
FT                   ILTKALNKYGWKVIPDRILPPLVVNSAAGVILYTTYLSTLTHFAKLRAEKSQLNKPWDI
FT                   WRSGLLAGAAQALVSSPIDAIYTRSSTSELLSSAQKYDNLWLYGRDKLKEIGLIGCFGG
FT                   YGITLFKESLGFAVYFTTFELIKGQLCQSLINTIKHYDQLKYTIRNTKLTDILLRRSPQ
FT                   PHEFEKAPMKSMSPQEEKWFQRTFTFGGGVTAAFLLQVVQFPFSKIQKVHLSRLEAFDI
FT                   YNRTLFKNAEAAPVTTTPPSMKIRVRSPNSRRLHIYYNSYMDTFEHILFIHKNTNSLLK
FT                   WLYKGFMRNTLAIIPGTTAGLLLLDYMRSSVEETLIQTPLT"
FT   gene            <267206..>268003
FT                   /locus_tag="ZYRO0E03366g"
FT                   /old_locus_tag="ZYRO-ORF4026"
FT   CDS_pept        267206..268003
FT                   /locus_tag="ZYRO0E03366g"
FT                   /old_locus_tag="ZYRO-ORF4026"
FT                   /product="ZYRO0E03366p"
FT                   /note="highly similar to uniprot|P03962 Saccharomyces
FT                   cerevisiae YEL021W URA3 orotidine-5'-phosphate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30831"
FT                   /db_xref="GOA:C5E470"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:C5E470"
FT                   /protein_id="CAR30831.1"
FT                   /translation="MSHLTYQERAARHPSPVATRLLNLMHEKQTNLCASLDVNTTAELL
FT                   HLLDVLGPHICLVKTHVDILSDFSIEGTVKPLKELAAKHNFLIFEDRKFADIGNTVKLQ
FT                   YKSGVYQIAQWADITNAHGVTGPGIVQGLKQAAQETTQEPRGLLMLAELSSKGSLAHGE
FT                   YTTGTVDIAKSDKEFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDSLGQQYRTVDD
FT                   VVSTGSDIIIVGRGLFAKGRDPSVEGERYRKAGWQAYLKRCNK"
FT   gene            <268186..>268449
FT                   /locus_tag="ZYRO0E03388g"
FT                   /old_locus_tag="ZYRO-ORF4025"
FT   CDS_pept        268186..268449
FT                   /locus_tag="ZYRO0E03388g"
FT                   /old_locus_tag="ZYRO-ORF4025"
FT                   /product="ZYRO0E03388p"
FT                   /note="highly similar to uniprot|O74700 Saccharomyces
FT                   cerevisiae YEL020W-A TIM9 Mitochondrial intermembrane space
FT                   protein mediating import and insertion of polytopic inner
FT                   membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03388g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30832"
FT                   /db_xref="GOA:C5E471"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039094"
FT                   /db_xref="UniProtKB/TrEMBL:C5E471"
FT                   /protein_id="CAR30832.1"
FT                   /translation="MDSLNPREQQEFTRLIEQKQMKDFMRLYSNLVERCFSDCVNDFTS
FT                   NKLTSREQTCITRCSEKFLKHSERVGLRFQEQNAAMGQGLGR"
FT   gene            complement(<268553..>270388)
FT                   /locus_tag="ZYRO0E03410g"
FT                   /old_locus_tag="ZYRO-ORF4024"
FT   CDS_pept        complement(268553..270388)
FT                   /locus_tag="ZYRO0E03410g"
FT                   /old_locus_tag="ZYRO-ORF4024"
FT                   /product="ZYRO0E03410p"
FT                   /note="similar to uniprot|P25351 Saccharomyces cerevisiae
FT                   YCR023C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03410g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30833"
FT                   /db_xref="GOA:C5E472"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E472"
FT                   /protein_id="CAR30833.1"
FT                   /translation="MAPKLTFREQMDGFPWTQLLVVSLVRFSEPIAFTSLFPYVYFMVR
FT                   DFHIAPNDAEVSKYSGYLSSCFALCQVVSAYHWGHFSDIYGRKCALSLGLIGTCTSLMV
FT                   LGFSKNFYMALLARCMMGLLNGNVGVLRTMIGEIATERKHQALAFSTMPLLFQFGSVVG
FT                   PMVGGFLVFKQSHGENIPNFFPHWLRGLVHRYPYLLPNIVVSIFLMVGLFNAILFLEET
FT                   HPDLKYRRDYGVELGDFIKLHIFGIQPVSRPWNHLQLDTHNDDNPIIGDDSSVIHSDQD
FT                   TTTEAVDHDTAPLIPSSGDSSDSEESIRSFGPILTRRQSVGLIREYSLHEPTDIPDADL
FT                   ELAFDGCKEDSIYHHVFHTSVFYPISVNFIMSLHLIVYNEFLPVFLAYDLAQDDKGNLL
FT                   SKFPWKISGGIGYSPDQTGALLSSTGIFGCFVVIFIFPVVDRSFDCLTIFRTLVKLYPI
FT                   MYLMVPYVIFLQQDHIPRWCTIVYLYLITGTKTLCGALTSPQIMLLIHNCSPLSCRAVI
FT                   NGATISISALARFVGPLAWGYIMSWSQEFDVAWLSWWSLGLISLIALFQSYKIDPIDEE
FT                   DEEPGAASIEEARPHSRPSLSSFSNHRRPSELNNS"
FT   gene            complement(<270433..>270775)
FT                   /gene="RPR1"
FT                   /locus_tag="ZYRO0E03432r"
FT                   /old_locus_tag="Zyro0E_ncRNA_152"
FT   ncRNA           complement(270433..270775)
FT                   /gene="RPR1"
FT                   /locus_tag="ZYRO0E03432r"
FT                   /old_locus_tag="Zyro0E_ncRNA_152"
FT                   /product="RNase P RNA"
FT                   /note="RPR1 (RNase P RNA)"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(<270926..>272575)
FT                   /locus_tag="ZYRO0E03454g"
FT                   /old_locus_tag="ZYRO-ORF4023"
FT   CDS_pept        complement(270926..272575)
FT                   /locus_tag="ZYRO0E03454g"
FT                   /old_locus_tag="ZYRO-ORF4023"
FT                   /product="ZYRO0E03454p"
FT                   /note="similar to uniprot|P39994 Saccharomyces cerevisiae
FT                   YEL020C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03454g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30834"
FT                   /db_xref="GOA:C5E473"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5E473"
FT                   /protein_id="CAR30834.1"
FT                   /translation="MQFQDYFTRVLQNYGVDTVFGIVGIPIVELADTMIEHGIKFIACR
FT                   NEQSASYAASAYGYLTGKPGVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAGSSEAQHR
FT                   GGFQELDQVSLLKPYVKFSGQLNSSNIDVLTYDALRLVQYTTAGATYLDIPGNLIGSTV
FT                   KKDSLPPVKNIYVPKSSPDPSAVQEVTDLIRKNPENVLVVVGKGAVHASQEIRQFVDRF
FT                   QLPFLPTPMGKGVVPDSHPLNVSSARSRALQEAKVVLVLGARLNWILHFASAPKWNPDA
FT                   LFIQVDSDTTTLGHNNFKSQHLSLWGDIGLTVRLITASLGDYHSQGLSPSLQSNIARNA
FT                   AKLKSQESQQVSSRLNYNVVYAHLRPLINDESTIIVSEGANTMDKARVSFPTDYPLQRL
FT                   DAGTNATMGVGMGYALAAKVSNPDKTVLVIQGDSAFGFSAMDIETATRSGLALIVIVMN
FT                   NGGIYHGQNPTSSPSSSPSPLPSTALTEECRYDLVAKGLGAHGYLVQTLNDLRESFVKA
FT                   QEHAKKGQSTLLNVVLEPGEQKKISFGWQVRL"
FT   gene            complement(<272677..>274068)
FT                   /locus_tag="ZYRO0E03476g"
FT                   /old_locus_tag="ZYRO-ORF4022"
FT   CDS_pept        complement(272677..274068)
FT                   /locus_tag="ZYRO0E03476g"
FT                   /old_locus_tag="ZYRO-ORF4022"
FT                   /product="ZYRO0E03476p"
FT                   /note="similar to uniprot|P25345 Saccharomyces cerevisiae
FT                   YCR024C SLM5 Mitochondrial asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03476g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30835"
FT                   /db_xref="GOA:C5E474"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5E474"
FT                   /protein_id="CAR30835.1"
FT                   /translation="MFRGYHTIRALYDSGPQKFVDVNGWIQSIRQLKRIAFIDLRDGTS
FT                   TKSLKIAVPLCDQSLIESVKNLKTGQCVSISQAQWVPTPQREQPFELKVGDALKDIQIL
FT                   GNVTSQYPLQKKSHSLSFLRTLPHLKHRSNYLGSLLRFRSHVENTFIQFFAQNEFTKVT
FT                   PPLITSSDCEGGGELFKVDGSNDYFGRSAYLTVSAQLHLEALSLALNRCYTLSPSFRAE
FT                   KSDTNRHLCEFWMLEAEWCFVRDVNELTHFTQNLLKSVIKSCYDNRNELIPQIIPQESD
FT                   QVSTIIQRWENLLKNDNWPSITYTEAIKILREQHSNVKPFPNYEPQWGLALQSEHEKWL
FT                   AGEYFQSPVFVTDYPKDCKAFYMKHNDDGQTVACFDLLVPGMGEIVGGSVREDDYIKLV
FT                   TEMDRRQMNHNGDLDWYAALRQEGSAPHGGFGLGVERLVSYLYGNHNIRDAIPFHRAAT
FT                   GTIEL"
FT   gene            complement(<274104..>274835)
FT                   /locus_tag="ZYRO0E03498g"
FT                   /old_locus_tag="ZYRO-ORF4021"
FT   CDS_pept        complement(274104..274835)
FT                   /locus_tag="ZYRO0E03498g"
FT                   /old_locus_tag="ZYRO-ORF4021"
FT                   /product="ZYRO0E03498p"
FT                   /note="similar to uniprot|P38632 Saccharomyces cerevisiae
FT                   YEL019C MMS21 Protein involved in DNA repair mutants are
FT                   sensitive to the alkylating agent methyl methanesulfonate
FT                   and show increased spontaneous mutation and mitotic
FT                   recombination"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03498g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30836"
FT                   /db_xref="GOA:C5E475"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR026846"
FT                   /db_xref="UniProtKB/TrEMBL:C5E475"
FT                   /protein_id="CAR30836.1"
FT                   /translation="MISSAPLHLRCKEFHSLKVVEIDGFLQNSKKQLIRSLEQVVRDSD
FT                   PNELDSLIKDICQNYEELRTNEESSIKLQRQVSEAKQQYKQSSESLAPLTIETWDQYSQ
FT                   EPAPSLKDFISQDVEVQLPLTQEDRILRALPHIWQDPQCLLPDDTDGDDLQIRGGRIEL
FT                   ICPITCKPFENPMISKKCGHVFDNSGLNNYFESYPSRDCPQGACLQKLTLRDFKVDELM
FT                   KLRCLLHLKKVRQEETNLDVL"
FT   gene            <274837..>275502
FT                   /locus_tag="ZYRO0E03520g"
FT   CDS_pept        274837..275502
FT                   /locus_tag="ZYRO0E03520g"
FT                   /product="ZYRO0E03520p"
FT                   /note="similar to uniprot|P39995 Saccharomyces cerevisiae
FT                   YEL018W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30837"
FT                   /db_xref="GOA:C5E476"
FT                   /db_xref="InterPro:IPR026226"
FT                   /db_xref="UniProtKB/TrEMBL:C5E476"
FT                   /protein_id="CAR30837.1"
FT                   /translation="MIPQVSELVVLQTIYLLLQNGESVRVSLVKLTNEIRNSVLVRQLS
FT                   TGEPPLDINDILSIVKRVLPNQRISLVDGQLSFPHLQLNELKQEIQSRRQSLQSSQLQV
FT                   IKQLEEQILHPRKVDPKREKLLQLYRDTVLNKLNKSHTLDQLYTQVPQDTNVTKLHIAL
FT                   DNIKNDTPASVHELQLTLQLAICNAKACTRTGSKQWQLCTQAQIDLDETVQFMRRALE"
FT   gene            complement(<275553..>275912)
FT                   /locus_tag="ZYRO0E03542g"
FT                   /old_locus_tag="ZYRO-ORF4018"
FT   CDS_pept        complement(275553..275912)
FT                   /locus_tag="ZYRO0E03542g"
FT                   /old_locus_tag="ZYRO-ORF4018"
FT                   /product="ZYRO0E03542p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03542g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30838"
FT                   /db_xref="UniProtKB/TrEMBL:C5E477"
FT                   /protein_id="CAR30838.1"
FT                   /translation="MAKCLVRGPPDSCKYKEVCIDPQYCAVAATIQPRYTCDTHDYNTV
FT                   QYGTMPFFSKLRSNKPEEKKYISVEEFHKRNKEYEEAHEKRKNSVSEGYKDWSRDTPTS
FT                   SSATNGSGGWNTPWL"
FT   gene            complement(<276372..>277916)
FT                   /locus_tag="ZYRO0E03564g"
FT                   /old_locus_tag="ZYRO-ORF4017"
FT   CDS_pept        complement(276372..277916)
FT                   /locus_tag="ZYRO0E03564g"
FT                   /old_locus_tag="ZYRO-ORF4017"
FT                   /product="ZYRO0E03564p"
FT                   /note="some similarities with uniprot|P25353 Saccharomyces
FT                   cerevisiae YCR026C NPP1 Hypothetical ORF and to YEL016C
FT                   uniprot|P39997 Saccharomyces cerevisiae YEL016C NPP2
FT                   Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03564g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30839"
FT                   /db_xref="GOA:C5E478"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C5E478"
FT                   /protein_id="CAR30839.1"
FT                   /translation="MFLLPLSLVLSILLVVILTGLRDSYNNRYKPHGFDPSAKYSNGTH
FT                   EFYPITLVLSLDGFHPSLISKEATPFLHELYTLQQPNTSVAPFIVPSFPSQTFPNHWSI
FT                   VTGKYPSENGIVANWFWDHSLEKQFGPGNIDPELWETASEPIWSTLENAFFADTFKSAA
FT                   HMWPGCEVQGRTPHFFTAFNDSETLEEKSESIFRNYVDGKRDASERPQLILAYAPQPDA
FT                   YGHEYGYPAPHTPSFRELLNKIDSYVSRVFAALDQRHMRHFTNVVILSDHGMATVPSHN
FT                   VLLEKEILPDDLRTQHVSHSYLEGPALAIYTPNASHVERQLIKRLERLKIGKNFHVTRN
FT                   LQQEFGYKLSGERTADIWVLPDVHYAVAHQRRLLGTHGYNNSSPEMRALFIANGPAFTE
FT                   GYVEPFENVAIHGLLLELAGWKSEPHVGRPSHKIATADTKPQGLLVPLRSPPQDDLALL
FT                   SRIFGNGSSYNAVFHNETTKLDAVVPEKQQQDFSSLLGEIVGELQAELAEWGSNDK"
FT   gene            <278440..>279492
FT                   /locus_tag="ZYRO0E03586g"
FT                   /old_locus_tag="ZYRO-ORF4014"
FT   CDS_pept        278440..279492
FT                   /locus_tag="ZYRO0E03586g"
FT                   /old_locus_tag="ZYRO-ORF4014"
FT                   /product="ZYRO0E03586p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30840"
FT                   /db_xref="GOA:C5E479"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E479"
FT                   /protein_id="CAR30840.1"
FT                   /translation="MTRQSRQGSIIEGPHAVGAPNPAVVNAALAEELEAETRVGPDGIV
FT                   RSATPDTPSIPLVKDIVPTYRLDGHVTIVTGGSGGLAHTLSQALVAQGSQVALVDLAVE
FT                   KLARVERELQEFIKVNKLTPVNISTWECDISDPQEVEELINSIPRDHDGLIPDKLVHTA
FT                   GYCQNVPAHEYNARKAEHLVKVNLLGSLYICQAMTRQLIERSKRRRSIAALRGSVGEAV
FT                   PQFPNASFVLIGSMSGIIVNTPQPQVAYNMAKAGVIHMVKSLACEWARYGIRVNAISPG
FT                   YIATPLTKQVIGASPEGLALQEQWTSRIPMERMAEPKEFVGAMLYLLSRTASSYTTGEN
FT                   LVVDGGYTNF"
FT   gene            complement(<279670..>280272)
FT                   /locus_tag="ZYRO0E03608g"
FT                   /old_locus_tag="ZYRO-ORF4013"
FT   CDS_pept        complement(279670..280272)
FT                   /locus_tag="ZYRO0E03608g"
FT                   /old_locus_tag="ZYRO-ORF4013"
FT                   /product="ZYRO0E03608p"
FT                   /note="similar to uniprot|P25378 Saccharomyces cerevisiae
FT                   YCR027C RHB1 Putative Rheb-related GTPase involved in
FT                   regulating canavanine resistance and arginine uptake member
FT                   of the Ras superfamily of G-proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03608g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30841"
FT                   /db_xref="GOA:C5E480"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E480"
FT                   /protein_id="CAR30841.1"
FT                   /translation="MSYNQPSFQRKIAVLGARNVGKTTLTVRFVEEHFVESYYPTIEND
FT                   FTKIVQFKGNNYTLEILDTAGQDEFSLLNAKSLIGVKGIVLCYSVSNRPSFELIPVVWD
FT                   KLVDQLGRDDLPCVVVANKIDVRDSASSTEFISSQEGRELAKTIGSTDGKHKAGFVECS
FT                   AKQDVNVEGAYRAVLEKMRQQELGTGDSNGDSKCLMM"
FT   gene            <280468..>281946
FT                   /locus_tag="ZYRO0E03630g"
FT                   /old_locus_tag="ZYRO-ORF4012"
FT   CDS_pept        280468..281946
FT                   /locus_tag="ZYRO0E03630g"
FT                   /old_locus_tag="ZYRO-ORF4012"
FT                   /product="ZYRO0E03630p"
FT                   /note="similar to uniprot|P39998 Saccharomyces cerevisiae
FT                   YEL015W EDC3 Non-essential conserved protein of unknown
FT                   function plays a role in mRNA decapping by specifically
FT                   affecting the function of the decapping enzyme Dcp1p
FT                   localizes to cytoplasmic mRNA processing bodies"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30842"
FT                   /db_xref="GOA:C5E481"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR019050"
FT                   /db_xref="InterPro:IPR025762"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C5E481"
FT                   /protein_id="CAR30842.1"
FT                   /translation="MSQFVGFGVQVELKDGKRIQGRIAKATAKGLTLNDVVFGDGGTSQ
FT                   AFKVRASRLKDLKVLSVARKTHHTPKVSPPASQGQDWQNDDVNKLKQQDDFDFQGNLKM
FT                   FNKKDVFAQLKQQDDVQPQQRLVSHNKKPENIANDQSVIPNAKEDAWDVDDEKYYDAQL
FT                   LPVTKSINITHLLHNKGGDDQEADEEEEEEEESEEEKVIAKIKQALRSDRPALLRAKEI
FT                   NLQVLMANPVQLLEMERVSAEQYGIHAPIVVENFGNNASFVLKQKLGGRIRLRLDNMNP
FT                   GPLVVIMASDSYRSGARALSLGRHLCQTGHVRVVVVFISQDLQDNHVLQQMDLFRRSGG
FT                   KIVNGITQLESLVDKLNTPVECVIDAIQGFDCNLSDLYYNEALSPLENRVRSLIQWCNS
FT                   LHNVQIWSLDIPAGFDSTTGTQNFDDAVRATGVLSSGWPLAALHAVKDQLKDQLTEVVA
FT                   IDVGTPQGVYAQTSLRKFQSYDVFVTEGSLSLDI"
FT   gene            <282429..>284129
FT                   /locus_tag="ZYRO0E03652g"
FT                   /old_locus_tag="ZYRO-ORF4010"
FT   CDS_pept        282429..284129
FT                   /locus_tag="ZYRO0E03652g"
FT                   /old_locus_tag="ZYRO-ORF4010"
FT                   /product="ZYRO0E03652p"
FT                   /note="highly similar to uniprot|P39968 Saccharomyces
FT                   cerevisiae YEL013W VAC8 Phosphorylated vacuolar membrane
FT                   protein that interacts with Atg13p required for the
FT                   cytoplasm-to-vacuole targeting (Cvt) pathway interacts with
FT                   Nvj1p to form nucleus-vacuole junctions"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30843"
FT                   /db_xref="GOA:C5E482"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5E482"
FT                   /protein_id="CAR30843.1"
FT                   /translation="MGGCCSCLRDSSDEASVLPIADNEREAVTLLLGYLEDKDRFDFYS
FT                   GKPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRPVSRDVLEPILILLQSQDPQIQVA
FT                   ACAALGNLAVNNENKLLIVEMGGLEPLINQMMGNNVEVQCNAVGCITNLATQDDNKHKI
FT                   ATSGALVPLTRLAKSQHIRVQRNATGALLNMTHSEENRRELVNAGSVPVLVSLLSSADP
FT                   DVQYYCTTALSNIAVDESNRKKLAQTEPRLVSKLVALMDSPSSRVKCQATLALRNLASD
FT                   TSYQLEIVRAGGLPHLVKLIQSDSMPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVR
FT                   LLDFKESEEIQCHAVSTLRNLAASSERNRKEFFESGAVEKCKELALDSPVSVQSEISAC
FT                   FAILALADISKLDLLDANILDALVPMTYSNNQEVSGNAAAALANLCSRINNYTRIIEAW
FT                   GIPNGGIRGFLARFLHSDYATFEHIALWTILQLLESHNDKVAELVKNDKEIINGVKRMA
FT                   DITFERLQRSGSDGKNNDHDLADSKSSEAAEDASVELYNITQQILQFLN"
FT   gene            complement(<284600..>284671)
FT                   /locus_tag="ZYRO0E03674r"
FT                   /old_locus_tag="Zyro0E.tGln_TTG_24"
FT   tRNA            complement(284600..284671)
FT                   /locus_tag="ZYRO0E03674r"
FT                   /old_locus_tag="Zyro0E.tGln_TTG_24"
FT                   /note="tRNA-Gln (TTG) cove score=73.86"
FT   gene            complement(<285238..>285309)
FT                   /locus_tag="ZYRO0E03696r"
FT                   /old_locus_tag="Zyro0E.tiMet(CAT_23"
FT   tRNA            complement(285238..285309)
FT                   /locus_tag="ZYRO0E03696r"
FT                   /old_locus_tag="Zyro0E.tiMet(CAT_23"
FT                   /note="tRNA-iMet (CAT) cove score=75.85"
FT   gene            <285779..>286882
FT                   /locus_tag="ZYRO0E03718g"
FT                   /old_locus_tag="ZYRO-ORF4008"
FT   CDS_pept        285779..286882
FT                   /locus_tag="ZYRO0E03718g"
FT                   /old_locus_tag="ZYRO-ORF4008"
FT                   /product="ZYRO0E03718p"
FT                   /note="similar to uniprot|P23060 Saccharomyces cerevisiae
FT                   YCR019W MAK32 Protein necessary for structural stability of
FT                   L-A double-stranded RNA-containing particles"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03718g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30844"
FT                   /db_xref="GOA:C5E483"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C5E483"
FT                   /protein_id="CAR30844.1"
FT                   /translation="MRELQHLQETPMEPTSNELGPLVTTNGMFIIDEIHEQDGKVHTDI
FT                   PGGGGMFAMLGACIVTSSAQVSENLKWIIDRGHDFPPSLTSVIESWGTGVHFRDDNSRY
FT                   TTRGGNFYRNEDLREFEYLTPKKQITVQDWIDSWGLEVLSQLKCIHLLCSAERCLQILD
FT                   QLAEKQLGPKTFVWEPIPDLCNQEHAPQIMRVLQRPETVIFSPNAEEGARLLGDEEPLQ
FT                   LDQVLEYIWKFDNLISPHHSCVLRCGKMGSVALSSRDIHTRKRQVIHYPAYHSASPEKV
FT                   VDPTGGGNSYLGAFCLGYSLTQDLHVASICGNLAAGCVIEQVGIPHFDHSTRQWNGLTL
FT                   PQRIHHYLQTYHISQYTSLDMYQQLSP"
FT   gene            complement(<286885..>287529)
FT                   /locus_tag="ZYRO0E03740g"
FT                   /old_locus_tag="ZYRO-ORF4007"
FT   CDS_pept        complement(286885..287529)
FT                   /locus_tag="ZYRO0E03740g"
FT                   /old_locus_tag="ZYRO-ORF4007"
FT                   /product="ZYRO0E03740p"
FT                   /note="similar to uniprot|P25362 Saccharomyces cerevisiae
FT                   YCR020C PET18 Protein required for respiratory growth and
FT                   stability of the mitochondrial genome"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30845"
FT                   /db_xref="GOA:C5E484"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR026285"
FT                   /db_xref="UniProtKB/TrEMBL:C5E484"
FT                   /protein_id="CAR30845.1"
FT                   /translation="MTTTTESLLAKYGDLFEKATTHSLTKELCLGTLEDRKLFIYLAQD
FT                   LQFFEEGLRLMCKIASLAPAPESLITLAQKIGFFANDENTYFRDALKLLEPSVDESSTH
FT                   WMNNRLPQVETYVGQLIAMTRENNWQYPQLITYLWCAEIVYWQWAHNLPRSSNLHWKHQ
FT                   TWIDLHDGKHFQEWCDFLRDEVNQYPLKEVESTFEKILKFEYGFFDSCYNA"
FT   gene            complement(<287663..>287959)
FT                   /locus_tag="ZYRO0E03762g"
FT                   /old_locus_tag="ZYRO-ORF4006"
FT   CDS_pept        complement(287663..287959)
FT                   /locus_tag="ZYRO0E03762g"
FT                   /old_locus_tag="ZYRO-ORF4006"
FT                   /product="ZYRO0E03762p"
FT                   /note="similar to uniprot|P23059 Saccharomyces cerevisiae
FT                   YCR020C-A MAK31 Non-catalytic subunit of N-terminal
FT                   acetyltransferase of the NatC type required for replication
FT                   of dsRNA virus member of the Sm protein family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03762g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30846"
FT                   /db_xref="GOA:C5E485"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034110"
FT                   /db_xref="UniProtKB/TrEMBL:C5E485"
FT                   /protein_id="CAR30846.1"
FT                   /translation="MSKDLSQVSMEGLKLPDFVGCTLYVNLHNNRILKGSLMALDAQLN
FT                   LLLDHVQERAGDGNRRTLGLVSVPRKTIQAIKVPQAELNQLVQFKRNLLKNVV"
FT   gene            <288092..>288316
FT                   /locus_tag="ZYRO0E03784g"
FT                   /old_locus_tag="Zyro0E.mRNA.vl.363.p"
FT   CDS_pept        288092..288316
FT                   /locus_tag="ZYRO0E03784g"
FT                   /old_locus_tag="Zyro0E.mRNA.vl.363.p"
FT                   /product="ZYRO0E03784p"
FT                   /note="similar to uniprot|Q9URQ5 Saccharomyces cerevisiae
FT                   YCR020W-B"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03784g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30847"
FT                   /db_xref="GOA:C5E486"
FT                   /db_xref="UniProtKB/TrEMBL:C5E486"
FT                   /protein_id="CAR30847.1"
FT                   /translation="MSSASNSQRKYNNITLKTLTAYQLMSQRERMCELFQLLDDSERHE
FT                   HIVNPLKQENICNSMKENLRDIKNELGTN"
FT   gene            <288494..>289187
FT                   /locus_tag="ZYRO0E03806g"
FT                   /old_locus_tag="Zyro0E.mRNA.507.p"
FT   CDS_pept        join(288494..288498,288563..289187)
FT                   /locus_tag="ZYRO0E03806g"
FT                   /old_locus_tag="Zyro0E.mRNA.507.p"
FT                   /product="ZYRO0E03806p"
FT                   /note="highly similar to uniprot|P28263 Saccharomyces
FT                   cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme that
FT                   negatively regulates gluconeogenesis by mediating the
FT                   glucose-induced ubiquitination of fructose-1 6-
FT                   bisphosphatase (FBPase) cytoplasmic enzyme that catalyzes
FT                   the ubiquitination of histones in vitro"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03806g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30848"
FT                   /db_xref="GOA:C5E487"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:C5E487"
FT                   /protein_id="CAR30848.1"
FT                   /translation="MSGGNSKRRIETDVMKLLMSDHEVELVNDNMQEFHVKFHGPKDTP
FT                   YETGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLKNI
FT                   VEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYIDKYACAEKYEQLFGTDDE
FT                   DDDEDDDEDDEQENDEDDDEDVDGNGDEEVDGGSEELSDIEVSDEE"
FT   gene            <289636..>291756
FT                   /locus_tag="ZYRO0E03828g"
FT                   /old_locus_tag="ZYRO-ORF4002"
FT   CDS_pept        289636..291756
FT                   /locus_tag="ZYRO0E03828g"
FT                   /old_locus_tag="ZYRO-ORF4002"
FT                   /product="ZYRO0E03828p"
FT                   /note="highly similar to uniprot|P32775 Saccharomyces
FT                   cerevisiae YEL011W GLC3 Glycogen branching enzyme involved
FT                   in glycogen accumulation green fluorescent protein (GFP)-
FT                   fusion protein localizes to the cytoplasm in a punctate
FT                   pattern"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30849"
FT                   /db_xref="GOA:C5E488"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:C5E488"
FT                   /protein_id="CAR30849.1"
FT                   /translation="MGADSEIPENVRGVVEFDSWLKPFVHVLSERRYLGDKWHYDITHA
FT                   TPDGSYQSLSKFARDSYRSYGLHADWETGEIRYREWAPNAQKAFLIGEFNNWNESSHEL
FT                   KSKDEFGVFHITIPPNADGSFAIPHDSKIKVMFVKPDGSKIYRLPAWITRATQPDRETA
FT                   KAYGPGYEARFWNPEKPYEFKNKRPHFNQKVDSLRIYEAHVGISSPEPKVASYKEFTQN
FT                   VLPRIKHLGYDAIQLMAIMEHAYYASFGYQVTNFFAASSRYGTPEELKELIDTAHGMGI
FT                   LVLLDVVHSHASKNAEDGLNEFDGSDHQYFHSIDSGRGSHPDWDSRLFNYGSFEVQRFL
FT                   LANLAFYIDVYQFDGFRFDGVTSMLYLHHGVGPSGAFSGNYNEYLSKEKSGVDHEAVAY
FT                   LMLANDLVHELLPQSAITIAEDVSGYPTLCLPRAMGGIGFDYRLAMALPDMWIKLLKEQ
FT                   KDEDWEMGDIVHTLTNRRHGEKVVAYCESHDQALVGDKTLAFWLMDAAMYTDMSVLKPA
FT                   TLVIDRGMSLHKMIRLLTHSLGGEAFLAFEGNEFGHPEWLDFPNVNNGDSFHYARRQFN
FT                   LADDNLLRYRMLYEFDAAMQNCERKHQWLNTPQAYVSLKHEGDKVIAFERNGHLFMFNF
FT                   HPTKSYTDYRFGVDVAGTYKIVLNSDRKEYGGYDRVDESARFFTTDLAWNGRKNFIQVY
FT                   IPSRVALVCALE"
FT   gene            complement(<292308..>292380)
FT                   /locus_tag="ZYRO0E03850r"
FT                   /old_locus_tag="Zyro0E.tLys_CTT_22"
FT   tRNA            complement(292308..292380)
FT                   /locus_tag="ZYRO0E03850r"
FT                   /old_locus_tag="Zyro0E.tLys_CTT_22"
FT                   /note="tRNA-Lys (CTT) cove score=75.47"
FT   gene            <292938..>295847
FT                   /locus_tag="ZYRO0E03872g"
FT                   /old_locus_tag="ZYRO-ORF3998"
FT   CDS_pept        292938..295847
FT                   /locus_tag="ZYRO0E03872g"
FT                   /old_locus_tag="ZYRO-ORF3998"
FT                   /product="ZYRO0E03872p"
FT                   /note="similar to uniprot|P25618 Saccharomyces cerevisiae
FT                   YCR017C CWH43 Putative sensor/transporter protein involved
FT                   in cell wall biogenesis contains 14-16 transmembrane
FT                   segments and several putative glycosylation and
FT                   phosphorylation sites null mutation is synthetically lethal
FT                   with pkc1 deletion"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30850"
FT                   /db_xref="GOA:C5E489"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="InterPro:IPR027317"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C5E489"
FT                   /protein_id="CAR30850.1"
FT                   /translation="MVKINGKVVPLAHTVCASSAFLASLLAGCILHYDKIVRNSFFEYP
FT                   DEWFPSVSATIGSFYPERSIFQALIALAAIPRFLLILGHYYLSGSITTLIIGLVRTLSC
FT                   GGWVYITSTDDQDVHDLFMILYIALTLPWNVYVTKSSEKSKKWRKLISIGFFGTMVPLV
FT                   QHFVKHKVHMVPGAYSIYALLGWSLVALDIAFDAFSIKDFTSIEINLGLEPLQQGTWLF
FT                   KREETSSKPVNGVKDEKLVSNGKESKLATNSERDAPGLYPSTLPQVESYTYILTNTYNS
FT                   FIFWTAVTSITCSIWYFPLWNMGLSGYEAVMVYDLLPILLYIPYVPQIIHQHAVLLGGL
FT                   LVVGSHFVGLPESRLLVTGAGDALVVSAFVLNLKSIKRPEVNAAFTVTWLLGLVISVIL
FT                   KFACHGNNPLWPITKAENGGYHNIGLIFTTIFGILAPYVNSLHFAPKDSSKADGKTTES
FT                   IKSNKYKFFVGLGFGSIIFSLHRFFTDASALIYWSWEGWNQETQGPLAWPWSGLTCLVM
FT                   LLASLTSVRFSKNTWVPGILLLESTWVLCNRNITEWDNYLYGGLPYILGVIWTIPSYFA
FT                   ALSELQSVGVIILGFVTYAFISFATVWTVAYAFVPLGWLLRERIEVVIWFSTALIVIGL
FT                   FVIKVPADTVNSISSKPLGNAFFKRILILTSVIAAMIGGFTFENRPTGVPQPYHPESQM
FT                   ITAGIWTVHFGFDNNMWASEESMAFLLKSMELDVVGLLETDTQQIPMGNRDITSKLAHD
FT                   LNMYADYGPGPNKHTWGCVLLSKFPIVNSTHHLLPSPVGELAPAIHATLKTYNDTLVDV
FT                   FVFHGGQEEDELDRKLQSEVMAKLMGSTQRPTILLSYLVTDPHEGNYNTYVSETSGMRD
FT                   IDPSDYERWCEYILYKDLKKLGYARVSRGTVTDTELQVGKFQVIPETQVKKLGEKLYDT
FT                   VTLDTAEEDAHLFPEEFFDEGERGHYYHVFNRPRYFSLN"
FT   gene            complement(<295966..>296331)
FT                   /locus_tag="ZYRO0E03894g"
FT                   /old_locus_tag="ZYRO-ORF3997"
FT   CDS_pept        complement(295966..296331)
FT                   /locus_tag="ZYRO0E03894g"
FT                   /old_locus_tag="ZYRO-ORF3997"
FT                   /product="ZYRO0E03894p"
FT                   /note="similar to uniprot|P40342 Saccharomyces cerevisiae
FT                   YNR004W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03894g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30851"
FT                   /db_xref="GOA:C5E490"
FT                   /db_xref="InterPro:IPR031391"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E490"
FT                   /protein_id="CAR30851.1"
FT                   /translation="MDLKFVIDNLQDLGVLPPDQSLTLGSQYQLIARDEQLSQKAIDKC
FT                   EKVFLQWSLNRGVNIEVLKRFQNLWSVIKGKDFPLVGFPYSNLTIQQVDVNQYISNQSE
FT                   KLMKNLTVEEVEITDYV"
FT   gene            complement(<296502..>298217)
FT                   /locus_tag="ZYRO0E03916g"
FT                   /old_locus_tag="ZYRO-ORF3996"
FT   CDS_pept        complement(296502..298217)
FT                   /locus_tag="ZYRO0E03916g"
FT                   /old_locus_tag="ZYRO-ORF3996"
FT                   /product="ZYRO0E03916p"
FT                   /note="weakly similar to uniprot|Q12300 Saccharomyces
FT                   cerevisiae YDL138W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30852"
FT                   /db_xref="GOA:C5E491"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E491"
FT                   /protein_id="CAR30852.1"
FT                   /translation="MKIDKKQIGCALMGKRINYRVTIYDKFPKIYNIFVIGFTSCISGL
FT                   MFGFDVSSMSSMIGTDGYKEYFGTPGPTEQGGITACMPAGSFVASLIAPYFSDNFGRRV
FT                   SLHLCAIFWMIGAVLQCASQDLAMLCVGRVVSGLGIGFGSSVAPVYCSEIAPPKIRGAI
FT                   GGLFQFSVTLGIMILFFIGYGAHFINGAGSFRLTWGIELVPGACLLIAVFFLPESPRWL
FT                   ALHDYWEEAEDIVIRVAAKGNRENEQVMIQLEEIREQVEIDKEAEAFQLKDLFRPKTRV
FT                   KTMVGMMAQMWQQMCGMNVMMYYIVYIFTMAGFKGGAVLVSGSIQYVLNVVMTIPALFL
FT                   MDKCGRRPVLLIGGLLMCAWLFAVGGLLATYSDPYPHGFEGDETVRIAIPQSNKPAANG
FT                   VIACSYLFVCSYAPTWGVCIWIYCAEIFNNTERAKGSGLCTAVNWIFNFALALFVPSAF
FT                   KNLTWKTYIMFGVFCVALTINTFLLFPETKGKTLEEIDQMWEAHIPAWKTHSWVPTIPS
FT                   ASKFDQEMHKTDLEHVEDTGDSDRISPKDDSEKGSVTGLEEVAKSNPNSTSLSE"
FT   gene            complement(<299150..>300019)
FT                   /locus_tag="ZYRO0E03938g"
FT                   /old_locus_tag="ZYRO-ORF3993"
FT   CDS_pept        complement(299150..300019)
FT                   /locus_tag="ZYRO0E03938g"
FT                   /old_locus_tag="ZYRO-ORF3993"
FT                   /product="ZYRO0E03938p"
FT                   /note="similar to uniprot|P25617 Saccharomyces cerevisiae
FT                   YCR016W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30853"
FT                   /db_xref="InterPro:IPR019327"
FT                   /db_xref="UniProtKB/TrEMBL:C5E492"
FT                   /protein_id="CAR30853.1"
FT                   /translation="MSEHVPAWKRITIKKNQQRDSTNANEEEDDPLNITTHLATGSLTK
FT                   KQKQKIIRGEDREDTDLPSNKKTKSDKKKEKLPREERDARKQNVLKDQLRYLIEFYLNK
FT                   VNPKNLPDSLSSLTNVRNNYSEKFNNDDQDDDDNSSESEVIDIWKFSKQKQNWLIKHFF
FT                   NAEEIPVEYDELLLSYFKELKSPAIKDRVTAVCKANVSQWNEYIDQQDEKMRRIVEGEE
FT                   EQEVTKEDDAKEHDTKEDDMKEKEEKKKEEDELTPPDKRVVKRSQELLKLWQVEPLIEL
FT                   KRFNDDAF"
FT   gene            complement(<300551..>300634)
FT                   /locus_tag="ZYRO0E03960r"
FT                   /old_locus_tag="Zyro0E.tLeu_TAA_21"
FT   tRNA            complement(300551..300634)
FT                   /locus_tag="ZYRO0E03960r"
FT                   /old_locus_tag="Zyro0E.tLeu_TAA_21"
FT                   /note="tRNA-Leu (TAA) cove score=70.82"
FT   gene            complement(<301350..>301433)
FT                   /locus_tag="ZYRO0E03982r"
FT                   /old_locus_tag="Zyro0E.tLeu_TAA_20"
FT   tRNA            complement(301350..301433)
FT                   /locus_tag="ZYRO0E03982r"
FT                   /old_locus_tag="Zyro0E.tLeu_TAA_20"
FT                   /note="tRNA-Leu (TAA) cove score=70.82"
FT   gene            <301742..>302785
FT                   /locus_tag="ZYRO0E04004g"
FT                   /old_locus_tag="ZYRO-ORF3990"
FT   CDS_pept        301742..302785
FT                   /locus_tag="ZYRO0E04004g"
FT                   /old_locus_tag="ZYRO-ORF3990"
FT                   /product="ZYRO0E04004p"
FT                   /note="similar to uniprot|P25616 Saccharomyces cerevisiae
FT                   YCR015C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30854"
FT                   /db_xref="GOA:C5E493"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E493"
FT                   /protein_id="CAR30854.1"
FT                   /translation="MLKGNFSNFSSFVLRGIDIEVCKHLSSTCQCISTLKRIYTTMNNV
FT                   IIADFDETVTNRDTTCIVGQLPYTLDPKLKPAWSHFVDVYYEHYKKFQSNINSRVLPLL
FT                   PLGKETVITDTNFTQLFHAEVDFQTSKRLLELSSTTEIESRNVFKGVKHEQVRSFVENN
FT                   LQGADSLLRPGFSNFISLVPKDNFHVVSVNWSPEFIRHVIGDEKIHPHHIACNNLISDG
FT                   DEYTGQFTNDLLTGSDKIKVIQQILSYYDSKESDHCLWYVGDSDTDLLSVLFPNINGVL
FT                   LIDPIKESKKFQKLTVQLLGLPQKEMDEFAHDSSLGWYTCCTKQGGKTVYIVKSWNDLQ
FT                   RLIFGEN"
FT   gene            complement(<302794..>304305)
FT                   /locus_tag="ZYRO0E04026g"
FT                   /old_locus_tag="ZYRO-ORF3989"
FT   CDS_pept        complement(302794..304305)
FT                   /locus_tag="ZYRO0E04026g"
FT                   /old_locus_tag="ZYRO-ORF3989"
FT                   /product="ZYRO0E04026p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04026g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30855"
FT                   /db_xref="UniProtKB/TrEMBL:C5E494"
FT                   /protein_id="CAR30855.1"
FT                   /translation="MKISRNSSHRQNRQNSICRPSTVANAANADQIFWNTSTPVLTTDV
FT                   FEELELPTRRTHSNTNSFSFDQSCFTELPFNEAPEVLQSPDDCCLPQFEEVLELDKNLE
FT                   QMPAHKLKQFLFLHSVVNSSSDDSQFTDSGTESEEYWIDNPPSAGGGFYRFDVVEVPIP
FT                   LEGQGQQVQVDPEEDVKKMLTEPQVIFYSVPLSIKHLLCTHDNLMGLCENITLERIVRR
FT                   RTLSKIIPMSSEGVRRFFPLEVDFSSSKEGCNDVVNVCAFIQTLSNNFQRKLGSFFNTT
FT                   FQFSYKFNCGKFYIKYGIFDDNFDFTFGSNLIDLHAFSRYLPETDERLDDKGLNSRRKK
FT                   RCHKTSRAWKTFVTMAEVFTIIDYMLKGKFSWVQNNRKLLDYISKGGSIKVASKQYDTT
FT                   VRKNQQRILSNVRKYIRNKELMPLKEAKERNIMNDSQLEFHNGLYDQIIGFYENIGREL
FT                   PQSRVKMYVIELNDLEAVIAQILDKYVYEQYEVTADHDNASNYKT"
FT   gene            <304608..>306266
FT                   /locus_tag="ZYRO0E04048g"
FT                   /old_locus_tag="ZYRO-ORF3988"
FT   CDS_pept        304608..306266
FT                   /locus_tag="ZYRO0E04048g"
FT                   /old_locus_tag="ZYRO-ORF3988"
FT                   /product="ZYRO0E04048p"
FT                   /note="similar to uniprot|P25615 Saccharomyces cerevisiae
FT                   YCR014C POL4 Probable homolog of mammalian DNA polymerase
FT                   beta may function in double-stranded DNA break repair DNA
FT                   polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30856"
FT                   /db_xref="GOA:C5E495"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR018944"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR028207"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:C5E495"
FT                   /protein_id="CAR30856.1"
FT                   /translation="MAILKDHTFLFLPNVSSSTLDFLAGLIAKEGGKVIEDVNQLDPET
FT                   VVLINDSFVGEGENIIHEDILRRESDLDIDYIYDYITENSVKCVRASKVSRWLKDGQLV
FT                   ISKPELVQLIPTEEEKSAYENVSSDSESATDVEGTDGGERSPSKDQHEGQETPKGSDGE
FT                   DSRSLETNWSKNELVIKFLDILAHRYKVKGDNFRSRGYNLAKIGIQRLPHEIESGVQAQ
FT                   KEVSNVGSSIAKKIQTILDTGTLPGAYESPQFEESLQYLSKCHNVGTYTARRWTNLGLK
FT                   SFAEVSQKFPHELKTDWPILFGWSFYEDWSIPIPRQECSQIERIVNQELKSVDPACQVE
FT                   IQGSYLRGADYCGDLDMLFHKKNCNDTTELSSIMEEVAIRLYDKGYIKCFLQLTPRICE
FT                   LFAPKILDRFKKCNLQAKTITPSNERIKKFYFGFQIPGSTAKNGNPKSLLLSDDQFMSL
FT                   NTKVGNPCRRVDFFSCKWSELGASRLQWTGPKEFNRWLRMIAIEKGMKLTQHGLFDKND
FT                   VLIESFIDTKIFQALDQPYIGPEERNHVFKKRRSK"
FT   gene            complement(<306419..>307669)
FT                   /locus_tag="ZYRO0E04070g"
FT                   /old_locus_tag="ZYRO-ORF3986"
FT   CDS_pept        complement(306419..307669)
FT                   /locus_tag="ZYRO0E04070g"
FT                   /old_locus_tag="ZYRO-ORF3986"
FT                   /product="ZYRO0E04070p"
FT                   /note="highly similar to uniprot|P00560 Saccharomyces
FT                   cerevisiae YCR012W PGK1 3-phosphoglycerate kinase catalyzes
FT                   transfer of high-energy phosphoryl groups from the acyl
FT                   phosphate of 1 3-bisphosphoglycerate to ADP to produce ATP
FT                   key enzyme in glycolysis and gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04070g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30857"
FT                   /db_xref="GOA:C5E496"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:C5E496"
FT                   /protein_id="CAR30857.1"
FT                   /translation="MSLSSKLSVDNLNVQGKRVFIRVDFNVPLDGKTITSNQRIVAALP
FT                   TIKHVLSQNPRYVVLASHLGRPNGERVEKYSMEPVAGELQKLLDQPVTFVNDCVGPQVT
FT                   KAVEESKPGSVLLLENLRFHIEEEGSKKVDGQKVKASPESIEAFRKELSSLADVYINDA
FT                   FGTAHRAHSSMVGFDLPQRAGGYLLNKELTFFGKALENPERPFLAILGGAKVADKIQLI
FT                   DNLLDKVNILIIGGGMSFTFKKVLDNTQIGDSIFDQAGSELVPKLVEKAKKNNVEIVLP
FT                   VDWVVGDKFGPDANTKVVSEKEGIPAGWQGLDSGPESRKLFAAAVAKAKTIVWNGPPGV
FT                   FEFEKFAEGTKALLDEVVKASSAGVTVIIGGGDTATVAKKYGAADKISHVSTGGGASLE
FT                   LLEGKTLPGVAFLSNKN"
FT   gene            <308495..>311683
FT                   /locus_tag="ZYRO0E04092g"
FT                   /old_locus_tag="ZYRO-ORF3982"
FT   CDS_pept        308495..311683
FT                   /locus_tag="ZYRO0E04092g"
FT                   /old_locus_tag="ZYRO-ORF3982"
FT                   /product="ZYRO0E04092p"
FT                   /note="similar to uniprot|P25371 Saccharomyces cerevisiae
FT                   YCR011C ADP1 Shows homology to ATP-dependent permeases
FT                   Active transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04092g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30858"
FT                   /db_xref="GOA:C5E497"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E497"
FT                   /protein_id="CAR30858.1"
FT                   /translation="MLKVQLHVLLLLFSVQWTRVMGIGFDQVEFRTRTTLSRPDRDSAG
FT                   GDAAAGGNGDGDKCPPCFNCMLPIFECKQYSECNSNTGRCECIPGFAGDDCSIPVCGGL
FT                   DEPNGRRPQRDNGSDTCQCKAGWGGINCNICEEDFACDAFMPGPELKGTCYKNGMIVNK
FT                   SYQGCNVTNEKILQTLKGRIPQVTFSCDNHTKDCNFQFWIDRIESFYCGLDRCQFEYDL
FT                   KSNSSHYNCESARCKCVPNTTLCGAKGSIDISDFLTQTVKGPGDFVCDLQTKKCRFSEP
FT                   SMNDLISTIFGDPYIMLECRGGECLHYSEIPGYMPPDKDISMSWQANLILALTSVLVLL
FT                   LVTFVTFCISKSPLFKNDPLALEGDDFLSGGGGGGATSAQEPSDANFLKTDVEAVLTFK
FT                   DIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKKKAGKVSGQ
FT                   IKVNGKSISKKDYTKLIGFVDQDDYLLQTLTVFETVLNSALLRLPRALPFEAKRSRVYK
FT                   VLEELRILDIKDKIIGNEFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDANNAS
FT                   NVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGEMVYSGEAIRVNEFLRNN
FT                   GYQCPTEYNIADYLIDITFETQLQSKKRARAASSRSGMQVTPDVLQNPTSGIDANKNAI
FT                   HPALEEGSGSVPSVTQREWEHLAGHRDEIRTLLKDSVSQEHETVGSMNTRLLHNRFKDG
FT                   PYYAQLSHDIATILTNYATAQMELPSSMNSASFPQQLSILCSRTFKNIYRNPKLLLANY
FT                   LMTLLLGGFLGTLYYDVSNDISGFQNRLGLFFFIMTYFGFVTLTGLSSFAVERIIFIKE
FT                   RSNNYYSPLAYYFSKILSDVLPLRVIPPVILGLVVYPLVGLNMDNHAFFKFIGILVLFN
FT                   LGISLEILSIGIIFEDLSNSIIFSVLVLLGSLLFSGLFINTKEITSVAFKYLKNFSLFY
FT                   YAYESLLINEVKSLMLREKKYGLDIEVPGATILSTFGFSVQNLGLDIKILGVFSTVFLI
FT                   IGYVALKLIVVEQK"
FT   gene            <311897..>312835
FT                   /locus_tag="ZYRO0E04114g"
FT                   /old_locus_tag="ZYRO-ORF3980"
FT   CDS_pept        311897..312835
FT                   /locus_tag="ZYRO0E04114g"
FT                   /old_locus_tag="ZYRO-ORF3980"
FT                   /product="ZYRO0E04114p"
FT                   /note="highly similar to uniprot|P32910 Saccharomyces
FT                   cerevisiae YNR003C RPC34 RNA polymerase III subunit C34
FT                   interacts with TFIIIB70 and is a key determinant in pol III
FT                   recruitment by the preinitiation complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04114g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30859"
FT                   /db_xref="GOA:C5E498"
FT                   /db_xref="InterPro:IPR007832"
FT                   /db_xref="InterPro:IPR016049"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5E498"
FT                   /protein_id="CAR30859.1"
FT                   /translation="MGNLLENALQLSDQAKDLHTKMLDKGPSVLFTQPELQETSGIASL
FT                   NDLMPIVQELLDKNLIKLVKQNNELKFQAVDIFEAQKKSAMSAEESLVYSYIEASGREG
FT                   IWTKTIKAKTNLHQHVVLKCLKSLESQRYVKSVKSVKYPTRKIYMLYNLQPSIDVTGGP
FT                   WFTDSELDVEFINSLLTIVWRFASDRTFPNGFKNFSGNDKKELLYAPNVKNYSTIQDIL
FT                   DFIVASQVVNVELTPANIRSLCDVLVYDDKMEKISHDCYRVTLESVRQMTQYGGLISND
FT                   DDGEFSIFDYFNLIAPSQNDKEAVYFDEWIL"
FT   gene            <313002..>313727
FT                   /locus_tag="ZYRO0E04136g"
FT                   /old_locus_tag="ZYRO-ORF3979"
FT   CDS_pept        313002..313727
FT                   /locus_tag="ZYRO0E04136g"
FT                   /old_locus_tag="ZYRO-ORF3979"
FT                   /product="ZYRO0E04136p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04136g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30860"
FT                   /db_xref="UniProtKB/TrEMBL:C5E499"
FT                   /protein_id="CAR30860.1"
FT                   /translation="MGRRSIKQDTKGTVTTNTTDFSKRSKFASSLREYVHKIKEFCYPV
FT                   ECTTTQYFHHFRRWKNAKQSYTFVESIPRIGKEVVITPEKKEEKEKEYENDLQRMLSLR
FT                   KIKHQDPEQYRMGCMMLKWYFESKSRRNNHERINGDATGKLFNENEEQQKNASRHNHPT
FT                   FKPASEIANTQAFTNNLKLSINKHGRIPRQTKFRPLDRCGRHSQEPFELEVENDKGTAN
FT                   ERILDDLVHMIDDYLGDTN"
FT   gene            <314271..>315056
FT                   /locus_tag="ZYRO0E04158g"
FT                   /old_locus_tag="ZYRO-ORF3977"
FT   CDS_pept        314271..315056
FT                   /locus_tag="ZYRO0E04158g"
FT                   /old_locus_tag="ZYRO-ORF3977"
FT                   /product="ZYRO0E04158p"
FT                   /note="similar to uniprot|P25613 Saccharomyces cerevisiae
FT                   YCR010C ADY2 Accumulation of DYads member of the TC 9.B.33
FT                   YaaH family of putative transporters Protein involved in
FT                   Accumulation of DYads"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04158g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30861"
FT                   /db_xref="GOA:C5E4A0"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4A0"
FT                   /protein_id="CAR30861.1"
FT                   /translation="MMQAQSDAVGRIATEGDNNEYIRFGHQKYLKSDLYEAFGGTLQPG
FT                   LAPASEHRFANPAPLGLSAFAATTFMLSLINAKAQNVTIPNAIVGPAIFYGGIVQIIAG
FT                   IWEIALENAFGGTALCSYGGFWMSYAAIYIPWFGITKAYEGEESELSNAVGFFLLAMTI
FT                   FTLGITICTMKSTLMFFLLFFLLDITFLLLAISEFTGKFGVKRAGGILGVIVALLAWYN
FT                   AFAGLATRQNSYLTGHPVPLPTNEYTLTNITGRNRRRVN"
FT   gene            <315499..>316374
FT                   /locus_tag="ZYRO0E04180g"
FT                   /old_locus_tag="ZYRO-ORF3975"
FT   CDS_pept        315499..316374
FT                   /locus_tag="ZYRO0E04180g"
FT                   /old_locus_tag="ZYRO-ORF3975"
FT                   /product="ZYRO0E04180p"
FT                   /note="similar to uniprot|P32907 Saccharomyces cerevisiae
FT                   YNR002C FUN34 Putative transmembrane protein involved in
FT                   ammonia production member of the TC 9.B.33 YaaH family
FT                   homolog of Ady2p and Y. lipolytica Gpr1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04180g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30862"
FT                   /db_xref="GOA:C5E4A1"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4A1"
FT                   /protein_id="CAR30862.1"
FT                   /translation="MSFSDVEKRQSTDSDAAYEQPTGFSTGAYNVGDDNSSANEHGVHR
FT                   VFTAGDNDEYVVIGRRKFLKDDLFQAFGGTLNPGLAPPSEHKFANPAPLGLSGFALTTF
FT                   VLSMIKAKAQGLTIPNVVVGPAMFYGGIVQVIAGVWELALENTFGGTALCSYGGFWMSF
FT                   SALYIPWFGIVDAYKDDQDQLGNAVGIYLLGWAIFTYGLSVCTMKSTLMFFALYFLLGT
FT                   TFLLLAIGSITDNFGVNRAGGVLGIIVAFIAWYNAFAGLANKRNSYVQCKAIPLPNNDW
FT                   HFGRMVHHRR"
FT   gene            <316577..>317380
FT                   /locus_tag="ZYRO0E04202g"
FT                   /old_locus_tag="ZYRO-ORF3973"
FT   CDS_pept        316577..317380
FT                   /locus_tag="ZYRO0E04202g"
FT                   /old_locus_tag="ZYRO-ORF3973"
FT                   /product="ZYRO0E04202p"
FT                   /note="highly similar to uniprot|P25343 Saccharomyces
FT                   cerevisiae YCR009C RVS161 BAR adaptor protein subunit of a
FT                   complex (Rvs161p Rvs167p) that regulates actin endocytosis
FT                   and viability following starvation or osmotic stress"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04202g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30863"
FT                   /db_xref="GOA:C5E4A2"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR037429"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4A2"
FT                   /protein_id="CAR30863.1"
FT                   /translation="MSWEGFKKAINRAGNSVMIKNVDKTIDKDFDIEERRYRVLQKAGD
FT                   ALQKEAKGYLDSLRAVTASQVTVAEVISNLYDDSKFINSSTGGYNVGNYYLQCVQDFDT
FT                   ETVKQLDGPFRETVLDPVTKFSGYFKEINEAMKKREHKKQDYDAAKAKTRRLVDKPAKD
FT                   ATKLPRAEKELNLAKDVYENLNESLKQELPQLVALRVPYYDPSFEALVKIQLRFCTDGY
FT                   TRLAQIQQYLDQQSRDDYANGLLDDRIDSLLQQMQSLDICALGIK"
FT   gene            <317895..>321641
FT                   /locus_tag="ZYRO0E04224g"
FT                   /old_locus_tag="ZYRO-ORF3972"
FT   CDS_pept        317895..321641
FT                   /locus_tag="ZYRO0E04224g"
FT                   /old_locus_tag="ZYRO-ORF3972"
FT                   /product="ZYRO0E04224p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30864"
FT                   /db_xref="GOA:C5E4A3"
FT                   /db_xref="InterPro:IPR030225"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4A3"
FT                   /protein_id="CAR30864.1"
FT                   /translation="MRYMANETGRRGYYGNKSSAFLSLRKFKTFCSTVIRHPKINIVLP
FT                   LLIAVILSSKLFSIAISARQIWRELNGNQYISKVEILDDHNAGRIRENSHLVLLQVWMR
FT                   CVGENFDNILGKRTLLESLALQNKLLNNVSTAMMVKSPFQLWNHSLKNLRSDPAPLQTI
FT                   NSNLLSLPQYSFFGTWKINGLVSSAAGITISILVNSTDSQKLLDSLNYNVVHLNGMSNI
FT                   TNFHIFPPLNVNSAENESLRLYMIKLGSHYKTIFSLLHLAVFVYFVFSMKRLKKTVKSV
FT                   VGIILAMVAQLLFTIGSAITLTNFFYKSSNDNIPFRALSCAVIFFTMNEQIRLLDDTSG
FT                   STFESKALEDSEGFALTQAYDPGDVTADRSFPSCAALSQIKSTKSAFLLSIVITFLIPF
FT                   SRKATFFLLLSLWFGHFLGCTFFTAVLSLDHRRLEENDLISIDSNVLLDEEISSVSNYA
FT                   SLEQQLFRYLKSSCRNRYSVILTVLYLVIFNINFTVARSSSSLIFKVFRGGINKVFKFG
FT                   RPIPNVIFDQKFIADAAFNLIKNDENQGTSSLLANLTVKDPFLVLKYQEELNLNELGSQ
FT                   LSSIFDASAFTASYKLDFYYVFEFLLSVVLLLSCTLLVLQKLMEKLDHINSFQFTNGDS
FT                   LENSMTHAEAKRSKAGKNNYLQNLPHISEDTGSKLQSPNHFHAKELYRGGHSLDIVGIS
FT                   TSKCPFVVSVGLDYRVLVWSPLLKPIPNPTSIPLSRKFWPLSKVVLSNDGYYIAFFGKN
FT                   GSITCWSRRQMKFVWELQLKRDRQTKDPSIIAPPLEAFFRKITAPAFRRRRLPPAAALR
FT                   PDVNSRRSSVNSIDYAARLAEGGLDVAYEKVVFSQANPDEKDELVFVTPSGYLYSIQTD
FT                   GELHVEKLTSSKHSLKSCKLLSSPRVSDRLVACDDVGDLYVSTVVNNKWRPRTLTVNYN
FT                   RMLEPSTHFSKMEEDRSATPSVDEAQIMSKTDYTIELVSFVGLILRVIGKEAELIDAMT
FT                   GCVIRTFAIGLLKPNSLRVFHDNPTHCRFCGSASVASFSIAYTSFDNERVALHTFKLES
FT                   KTKNSICLRVERDPREIRCLGMESAFETVHYFYDAEDWCVTNNNMLIGIRRVPQNIKVK
FT                   TGTTSVDTRTGTADNESSGLIRRKYDKSERESKVNDSSDFRIHNIWEGWTMTASGKISL
FT                   QKIPIGVNGLLVNRLGPLTRYGAKAVIVGFSNIMNMFYVGHEELIFNPEKEDANKEELS
FT                   LRFVNKRRDRLSNKKLPLNYSSL"
FT   gene            complement(<322215..>324035)
FT                   /locus_tag="ZYRO0E04246g"
FT                   /old_locus_tag="ZYRO-ORF3970"
FT   CDS_pept        complement(322215..324035)
FT                   /locus_tag="ZYRO0E04246g"
FT                   /old_locus_tag="ZYRO-ORF3970"
FT                   /product="ZYRO0E04246p"
FT                   /note="similar to uniprot|P25333 Saccharomyces cerevisiae
FT                   YCR008W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04246g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30865"
FT                   /db_xref="GOA:C5E4A4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4A4"
FT                   /protein_id="CAR30865.1"
FT                   /translation="MISNSDHCMAPMAAVHAPASSTTGGVSRKNTLSKMAKLFGAGNST
FT                   KNLQHQQQQNHHHLHQENSNGKVRTDAAKSEYYQSTPALMPNGKSPLSPASSTSSIASS
FT                   VSAVSITSNSPSAATTPGATGAAPSLGSSKIRDHNNVNDPTISHTSSLSNISSAYSGSA
FT                   TNLASFQGPSGRFVVHEDGTHEHHLKNTKRQEKLTRMIKSMAVSQKVRGQAKSAVPEIM
FT                   IENKGNQQNQQNQQNQQGQQQRLDPPTLFAGLIKQMGSVNESERENTPFSGASYGPDKR
FT                   LYTPSLVGAAATPGATTTNNSTAAIAKRDSLCLAEKYGRCQEVLGKGSFGVVRVCHKKT
FT                   MNSAGNGKGEVLYAVKEFKKKPSEPAEKYAKRLTSEFCISSSLRHINIIMTLDLFQDVK
FT                   GDYCEVMEYCAGGDLFTLVITAGKLEYLEADCFFKQLIRGVVYMHDMGVCHRDLKPENL
FT                   LLTSDGTLKIIDFGNSECFQMAWEKDIHLSGGVCGSSPYIAPEEYTQEEFDPRPVDIWA
FT                   CGVIYMAMRTGRQLWKVAQKEDPFFAKYLRKRKEKGGFEPIENLKRARCRNVIYSMLDP
FT                   VASRRINGKQILNSEWGREIKCCNDGHSLD"
FT   gene            complement(<325279..>325352)
FT                   /locus_tag="ZYRO0E04268r"
FT                   /old_locus_tag="Zyro0E.tAsn_GTT_19"
FT   tRNA            complement(325279..325352)
FT                   /locus_tag="ZYRO0E04268r"
FT                   /old_locus_tag="Zyro0E.tAsn_GTT_19"
FT                   /note="tRNA-Asn (GTT) cove score=73.16"
FT   gene            <326162..>327577
FT                   /locus_tag="ZYRO0E04290g"
FT                   /old_locus_tag="ZYRO-ORF3965"
FT   CDS_pept        326162..327577
FT                   /locus_tag="ZYRO0E04290g"
FT                   /old_locus_tag="ZYRO-ORF3965"
FT                   /product="ZYRO0E04290p"
FT                   /note="highly similar to uniprot|P00890 Saccharomyces
FT                   cerevisiae YNR001C CIT1 Citrate synthase catalyzes the
FT                   condensation of acetyl coenzyme A and oxaloacetate to form
FT                   citrate the rate-limiting enzyme of the TCA cycle nuclear
FT                   encoded mitochondrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04290g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30866"
FT                   /db_xref="GOA:C5E4A5"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010109"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4A5"
FT                   /protein_id="CAR30866.1"
FT                   /translation="MSVLSQSTRTTLARHALKSARFQFIAQRYYSNAEKTLKERFAEIF
FT                   PAKAEEIKKLKKEHGQTVIDQVKLEQAFGGMRGIKGLVWEGSVLDPEEGIRFRGRTIPE
FT                   IQKQLPKAAGGDEPLPEALFWLLLTGEVPSESQVKAFSADLASRSELPKHVVELLDNLP
FT                   KDLHPMAQFSIGITALESESKFAKAYAQGVAKKDYWNYAFEDSLDLLGKLPVIAAKIYR
FT                   NVFKDGKLAAIDPNADYGSNLASLLGFENGQFVELMRLYLTVHSDHEGGNVSAHTTHLV
FT                   GSALSSPYLSLAAGLNGLAGPLHGRANQEVLEWLFKLREEVKGDYSPEVIEKYLWDTLN
FT                   SGRVVPGYGHAVLRKTDPRYTAQREFALKHFPDYELFRLVSTIYQVAPDVLTKHGKTKN
FT                   PWPNVDSHSGVLLQYYGLSEASFYTVLFGVARAFGVLPQLIIDRAIGAPIERPKSLSTE
FT                   KFINLVKSIENKN"
FT   gene            <328509..>329432
FT                   /locus_tag="ZYRO0E04312g"
FT                   /old_locus_tag="ZYRO-ORF3962"
FT   CDS_pept        328509..329432
FT                   /locus_tag="ZYRO0E04312g"
FT                   /old_locus_tag="ZYRO-ORF3962"
FT                   /product="ZYRO0E04312p"
FT                   /note="highly similar to gnl|GLV|DEHA0F18447g Debaryomyces
FT                   hansenii DEHA0F18447g and similar to YCR004C uniprot|P25349
FT                   Saccharomyces cerevisiae YCR004C YCP4 Protein of unknown
FT                   function, has sequence and structural similarity to
FT                   flavodoxins; green fluorescent protein (GFP)- fusion
FT                   protein localizes to the cytoplasm in a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04312g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30867"
FT                   /db_xref="GOA:C5E4A6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4A6"
FT                   /protein_id="CAR30867.1"
FT                   /translation="MGKVAIITYSMYGHIDTLAKAVQKGVEAAGGQADLYRVEETLPEE
FT                   ALEKMNAPEKNPDVPVATPETLLEYDAFLLGIPTRFGSLPAQWSAFWDHTGSLWAQGAL
FT                   AGKIAGAFVSTASPGGGQETTLRSALSYLTHHGIIYVPLGYRDVFAELGNVEELHGGSP
FT                   WGAGTLAGADGSRTPSALELRIAEIQGKSFYETSLRFETTSSHGSGAAAATESGAAGAT
FT                   TDSGAAGAATDSGASAATGAAATGKKASSPKGKSPSSNGAAAGSSDGAAKSGGKPSGSA
FT                   NGAQGTPDRPIPVQKDGKKKKKCIIM"
FT   gene            <330667..>331098
FT                   /locus_tag="ZYRO0E04334g"
FT                   /old_locus_tag="ZYRO-ORF3959"
FT   CDS_pept        330667..331098
FT                   /locus_tag="ZYRO0E04334g"
FT                   /old_locus_tag="ZYRO-ORF3959"
FT                   /product="ZYRO0E04334p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04334g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30868"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4A7"
FT                   /protein_id="CAR30868.1"
FT                   /translation="MCEIWYFKLKTTNNWIKRQYCKGSRIGDSNRGIYDKEMEHKYNEL
FT                   EKKDEELQKTRAKIILLQNEVESFLKESCLMKDTSIVVEEDLYFHMVNVILERKLQAEG
FT                   KNGHRQTESADTWKGLEKMQENIEQLKMKNNESLSKDSQ"
FT   gene            complement(<332059..>332619)
FT                   /locus_tag="ZYRO0E04356g"
FT                   /old_locus_tag="ZYRO-ORF3956"
FT   CDS_pept        complement(332059..332619)
FT                   /locus_tag="ZYRO0E04356g"
FT                   /old_locus_tag="ZYRO-ORF3956"
FT                   /product="ZYRO0E04356p"
FT                   /note="similar to uniprot|P25348 Saccharomyces cerevisiae
FT                   YCR003W MRPL32 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04356g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30869"
FT                   /db_xref="GOA:C5E4A8"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4A8"
FT                   /protein_id="CAR30869.1"
FT                   /translation="MSSIGFSMSRFYLSATTLLPWVKPLGGPMIGELPKQLPESLRKWI
FT                   DQRTKKNEEGSIVEEDFFSNNGRLLAVPKKKVTHQKKRQRLYAPGKKQLKFIHELNKCP
FT                   SCGHYKRANCLCMHCVQHVRHIWKTQTVKERQEPSQEQELSDLDKRILYPGKKETEYNK
FT                   KLKDKDSYLERRMRTLPVEEKDK"
FT   gene            <332944..>333924
FT                   /locus_tag="ZYRO0E04378g"
FT                   /old_locus_tag="ZYRO-ORF3955"
FT   CDS_pept        332944..333924
FT                   /locus_tag="ZYRO0E04378g"
FT                   /old_locus_tag="ZYRO-ORF3955"
FT                   /product="ZYRO0E04378p"
FT                   /note="highly similar to uniprot|P25342 Saccharomyces
FT                   cerevisiae YCR002C CDC10 Component of the septin ring of
FT                   the mother-bud neck that is required for cytokinesis
FT                   septins recruit proteins to the neck and can act as a
FT                   barrier to diffusion at the membrane and they comprise the
FT                   10nm filaments seen with EM"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04378g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30870"
FT                   /db_xref="GOA:C5E4A9"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4A9"
FT                   /protein_id="CAR30870.1"
FT                   /translation="MSAPPALAGIQPTSYVGFDTITSQIEHRLLKRGFQFNVMVVGHSG
FT                   LGKSTLINTLFASHLIDSATGTDITQVPVTKTTEMKVSSHTLLEDRVRLNINVIDTPGF
FT                   GDQINNNKVWEPIVKYIKEQYSQYLRKELTAQRDRYIRDSRVHAVLYFLQPNGKGLSAL
FT                   DIAALKKLTEIANVIPVIAKADTLTLEERAHFREIIQQEFKKHKFRIYPYDTDELTEEE
FT                   LELNESIRSIVPFAVVGSEREIEVNGETFRGRKTRWGAVNVEDINQCEFVYLREFLIRT
FT                   HLEDLIETTSYIHYEGFRARQLIALKENASSRTSAGPSNGGAYQR"
FT   misc_feature    complement(334844..335012)
FT                   /locus_tag="ZYRO0E04400s"
FT                   /old_locus_tag="centromere.zyro0E"
FT                   /note="Centromere Zyro0E"
FT   gene            complement(<335131..>336309)
FT                   /locus_tag="ZYRO0E04422g"
FT                   /old_locus_tag="ZYRO-ORF3953"
FT   CDS_pept        complement(335131..336309)
FT                   /locus_tag="ZYRO0E04422g"
FT                   /old_locus_tag="ZYRO-ORF3953"
FT                   /product="ZYRO0E04422p"
FT                   /note="uniprot|Q96WU4 Zygosaccharomyces rouxii el001w
FT                   Hypothetical protein el001w similar to YNL001W
FT                   uniprot|P33309 Saccharomyces cerevisiae YNL001W DOM34
FT                   Probable RNA- binding protein functions in protein
FT                   translation to promote G1 progression and differentiation
FT                   required for meiotic cell division"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04422g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30871"
FT                   /db_xref="GOA:C5E4B0"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4B0"
FT                   /protein_id="CAR30871.1"
FT                   /translation="MKLIKEVRPSNNSDEAHITLIPQEKEDLFTIHQLVGKGDELIFKR
FT                   KVTSSVKEDANKKKQQELKRLRIVVESEEFDMKEESLRYKGKTVRDNDVPDKDDYPVGV
FT                   FFSTNIDYTYPITIIKYDFNAYHKKLLKEATQPASRADTAAVVLQEGLAHVCVLTASST
FT                   ILKQKVEYTLPKKKRATDVAKFDEKTQKFYKAIYESIKRNFDFEKLKMIILCSPGFYAK
FT                   TLYDKIIQYAQEEQNKVLINNKGKFLVAHSSTGYIQGITEVLKNPSYASKLQDTKFSQE
FT                   VLIIDQFLQHLNDDDFKAWYGEAEVTKAVDLGAVNTLLITDTLMRSDDIDQRKKSLDLA
FT                   QQVERLGGKVAVFSALHNSGEELNRLTGIACILNYPIPDLDEDLEEDEEEDD"
FT   gene            complement(<336625..>337185)
FT                   /locus_tag="ZYRO0E04444g"
FT                   /old_locus_tag="ZYRO-ORF3952"
FT   CDS_pept        complement(336625..337185)
FT                   /locus_tag="ZYRO0E04444g"
FT                   /old_locus_tag="ZYRO-ORF3952"
FT                   /product="ZYRO0E04444p"
FT                   /note="similar to uniprot|P25560 Saccharomyces cerevisiae
FT                   YCL001W RER1 Protein involved in retention of membrane
FT                   proteins including Sec12p in the ER localized to Golgi
FT                   functions as a retrieval receptor in returning membrane
FT                   proteins to the ER"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04444g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30872"
FT                   /db_xref="GOA:C5E4B1"
FT                   /db_xref="InterPro:IPR004932"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4B1"
FT                   /protein_id="CAR30872.1"
FT                   /translation="MELEEGDRSQLNTLSPISVRYHRALTIYRYYLDKSVPLIKERWGA
FT                   LILLLFLFELRVVLTHKWYLSCYTHGIFLLNQFLAFLTPKFDLSLQQDEENKELEAGER
FT                   SEEFRPFIRRLPEFKFWHYSARATLVALVSTLFNITDVPVFWPILLVYFIIIFVLTMKR
FT                   QIQHMLKYRYIPLDIGKKKYGSK"
FT   gene            <337432..>338300
FT                   /locus_tag="ZYRO0E04466g"
FT                   /old_locus_tag="Zyro0E.mRNA.545.p"
FT   CDS_pept        join(337432..337467,337557..338300)
FT                   /locus_tag="ZYRO0E04466g"
FT                   /old_locus_tag="Zyro0E.mRNA.545.p"
FT                   /product="ZYRO0E04466p"
FT                   /note="similar to uniprot|P25565 Saccharomyces cerevisiae
FT                   YCL002C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04466g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30873"
FT                   /db_xref="GOA:C5E4B2"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4B2"
FT                   /protein_id="CAR30873.1"
FT                   /translation="MIFLQCISGFLSSIAILYQKRYNKLHHSVYGLSYDLYLLEIVGQF
FT                   LTIYCTINYRWSPLVRLQLSRRFPLFYPLDGSNIPISNPLLIKDVILTICGLLVLRQLM
FT                   LYQSTKHIYQGFSTTCMSIIGIFASFSMFTYFCACHNLPERDSGKFGVFYIDHVNYLWV
FT                   IGNTIRAFKFLPQITLNWMGFCTRGISSKYIIVNSLACLLILVGSLVSSPNKEFHQNAF
FT                   NNCPWVVTLVQFLSLCAILYQAQCLYVKKKPYLPRGE"
FT   gene            complement(<338396..>339943)
FT                   /locus_tag="ZYRO0E04488g"
FT                   /old_locus_tag="ZYRO-ORF3950"
FT   CDS_pept        complement(338396..339943)
FT                   /locus_tag="ZYRO0E04488g"
FT                   /old_locus_tag="ZYRO-ORF3950"
FT                   /product="ZYRO0E04488p"
FT                   /note="similar to uniprot|P25578 Saccharomyces cerevisiae
FT                   YCL004W PGS1 Phosphatidylglycerolphosphate synthase
FT                   catalyzes the synthesis of phosphatidylglycerolphosphate
FT                   from CDP-diacylglycerol and sn-glycerol 3-phosphate in the
FT                   first committed and rate-limiting step of cardiolipin
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04488g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30874"
FT                   /db_xref="GOA:C5E4B3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4B3"
FT                   /protein_id="CAR30874.1"
FT                   /translation="MRSSHRILLSCAVWRHTCSSKSIRFSSRTMSTHSYLDLVKEKLSV
FT                   LSTKFYFRRNEIDVLYSPSDFYETLKSKISKAERRIFLASLYLGKTEDELVDCIGKALE
FT                   NNPNLKVYFLIDGLRGTREAPSKCSATLLARLLEKYDNRVDIRLYKTPAVIGWKESVVP
FT                   KRFNEGLGLQHMKIYGFDDELLLSGANLSSDYFTNRQDRYYLFRSKPFADYYFQLHQLI
FT                   SKLSYKVKSTDTLQKFQLCWPQSNLAQEPKICKKTFIRHAADELQKFLKRVNSHQDAKE
FT                   AEVSQGGEFPTVVYPISQFTPLFTGLHDYSTEKPTLLDVLSTIKDPSINWTFTAGYFNM
FT                   FPAIMNQLISTPSEHATVITASPYANGFFESKGVSGNLPGAYLHLSKKFLQNVKRSGKE
FT                   SNIILKEWKRGVVNKPGGWSYHAKGIWISGMTEKDDRPLVTCIGSSNYTRRAYSSDLES
FT                   NALIVTRDEELRDKMRNELENLLKYTKSINLDDFKNDPGRKVGTGVKIATSILGSKL"
FT   gene            <341022..>341093
FT                   /locus_tag="ZYRO0E04510r"
FT                   /old_locus_tag="Zyro0E.tArg_TCT_5"
FT   tRNA            341022..341093
FT                   /locus_tag="ZYRO0E04510r"
FT                   /old_locus_tag="Zyro0E.tArg_TCT_5"
FT                   /note="tRNA-Arg (TCT) cove score=66.58"
FT   gene            complement(<341193..>342152)
FT                   /locus_tag="ZYRO0E04532g"
FT                   /old_locus_tag="ZYRO-ORF3948"
FT   CDS_pept        complement(341193..342152)
FT                   /locus_tag="ZYRO0E04532g"
FT                   /old_locus_tag="ZYRO-ORF3948"
FT                   /product="ZYRO0E04532p"
FT                   /note="some similarities with uniprot|P25587 Saccharomyces
FT                   cerevisiae YCL005W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30875"
FT                   /db_xref="GOA:C5E4B4"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4B4"
FT                   /protein_id="CAR30875.1"
FT                   /translation="MKSIEKVIALGKDFGLFLAYSCAYCISVFFEYTISWIPPLYGILK
FT                   RIITFFRALFFAPLRIIIKVVLQLFLLPVNVPLRLLLGTSLQQILLHTTSWTDGYVIVT
FT                   ILQYWLALTILGVLIGAICGTSLSVVHSIWGIPDIYIEIPIRFWKLIPSLSVWLKNHLP
FT                   LYNNVETQLNGKGPEFKGAPPSPLSTPSSPPPQTPIMVDSELSKMPATPKHQSNSKKCS
FT                   RPPSISKGSILKVASKLPSDFFQQVQSEGKFDEEIQRYMSPGESSQDTTQDSSAEFTDL
FT                   WDKVEESPTTLKTEDGLATLSRRRNFLDSDGNRKLDVK"
FT   gene            <343429..>344725
FT                   /locus_tag="ZYRO0E04554g"
FT                   /old_locus_tag="Zyro0E.mRNA.300RK.m"
FT   CDS_pept        join(343429..343509,343577..344725)
FT                   /locus_tag="ZYRO0E04554g"
FT                   /old_locus_tag="Zyro0E.mRNA.300RK.m"
FT                   /product="ZYRO0E04554p"
FT                   /note="similar to uniprot|P25604 Saccharomyces cerevisiae
FT                   YCL008C STP22 Component of the ESCRT-I complex which is
FT                   involved in ubiquitin-dependent sorting of proteins into
FT                   the endosome homologous to the mouse and human Tsg101 tumor
FT                   susceptibility gene mutants exhibit a Class E Vps
FT                   phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04554g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30876"
FT                   /db_xref="GOA:C5E4B5"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="InterPro:IPR037202"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4B5"
FT                   /protein_id="CAR30876.1"
FT                   /translation="MPPASNDESFVSIPQPVINWLFGVIQPIYHDKKTTFHDSVVVLSY
FT                   YKQLRPRTRVYTDSNGISELLLCIYGKPEIGSPVPLLIWIPKSYPLEHPIVYIDLESLK
FT                   DAKVSPGEHVDPNGLITLPIFGKWNADTCNLLHVVQECIKICRYDHVIDPVAPGDSNTY
FT                   LTLPPKLPPNPVEEIPKPPLPKKTGFLHSTSNDNILPSNIPSKATPEPRLAEVPPVLPK
FT                   KPQPAHSLDLLDSVATENADNTHKAVLGDLQHALNQMSEADLAYINENLQNRKLSIASA
FT                   QRQFESMYRYETDSLKNIRESIELTKASLQGEISLIKRHFDKIELYEKENGEEIDPSSL
FT                   VTAQNPALNQLYESVARDYALSDTMHVLARLLNRDAVNLDVFVKKTRQLGREQFFTRMH
FT                   IQNIIERLRQ"
FT   gene            <344989..>346485
FT                   /locus_tag="ZYRO0E04576g"
FT                   /old_locus_tag="ZYRO-ORF3946"
FT   CDS_pept        344989..346485
FT                   /locus_tag="ZYRO0E04576g"
FT                   /old_locus_tag="ZYRO-ORF3946"
FT                   /product="ZYRO0E04576p"
FT                   /note="similar to uniprot|P33322 Saccharomyces cerevisiae
FT                   YLR175W CBF5 Component of box H/ACA small nucleolar
FT                   ribonucleoprotein particles (snoRNPs) probable rRNA
FT                   pseudouridine synthase binds to snoRNP Nop10p and also
FT                   interacts with ribosomal biogenesis protein Nop53p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30877"
FT                   /db_xref="GOA:C5E4B6"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4B6"
FT                   /protein_id="CAR30877.1"
FT                   /translation="MSKDFVIKPDTSGPTPDTAEWPLLLKDYDKLLMRSGHYTPIPAGS
FT                   SPGKRDIKSYVNSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLIVC
FT                   VDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRSLESLTGALFQRPPLISAVKRQL
FT                   RVRTIYDSNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRVRSGA
FT                   LSENDNLVTLHDILDAQWVYDNTRDESYLRRVIQPLETLLVGYKRIVVKDSAVNAVCYG
FT                   AKLMIPGLLRYEDGIELYDEVVLITTKGEAIAVAIAQMSTVDLATCDHGVVAKVKRCIM
FT                   ERDLYPRRWGLGPVAQKKKQMKVDGKLDKYGRVNESTPEDWKKSYVPLDNAEAPAARES
FT                   APKESAPLVQEVDKKDEEEKKEEKKEEKKEEKEEKKEEAEESDDEEKSDKKSKKEKKDK
FT                   KEKKDKKEKKEKKEKKEKKEKKRKADDDEDGESKKKKSKK"
FT   gene            complement(<346758..>347831)
FT                   /locus_tag="ZYRO0E04598g"
FT                   /old_locus_tag="ZYRO-ORF3942"
FT   CDS_pept        complement(346758..347831)
FT                   /locus_tag="ZYRO0E04598g"
FT                   /old_locus_tag="ZYRO-ORF3942"
FT                   /product="ZYRO0E04598p"
FT                   /note="some similarities with uniprot|P25294 Saccharomyces
FT                   cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
FT                   suppressor dnaJ homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04598g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30878"
FT                   /db_xref="GOA:C5E4B7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4B7"
FT                   /protein_id="CAR30878.1"
FT                   /translation="MVKETKLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTEKF
FT                   KEISEAYEILSDSSKREIYDQYGLEAARNGGPAFGGASPGAGGFPAGGAGGFSSHAFSN
FT                   EDAFNIFSQFFGGSSPFGASSGMDDGFGFSGFPGGGSTRFASSNGFGGGGGMPGGMPGG
FT                   MPGGMPGGFRSGSASPPSAEEEIVPVNLPVSLEDLFAGRKKSFKIGRKNRGGSFEKTQI
FT                   DIQLKPGWKAGTKITYKNEGDYNPQTGGRKTLQFVLQEKSHPLYKRDGDNLIYSLPLSF
FT                   KESLLGFSKTIQTIDGRTLPISKIQPVQPTEVSSYPGQGMPVSKRPGQRGDLVVKYKID
FT                   YPLSLTEDQKRAIAENF"
FT   gene            <348647..>349558
FT                   /locus_tag="ZYRO0E04620g"
FT                   /old_locus_tag="ZYRO-ORF3939"
FT   CDS_pept        348647..349558
FT                   /locus_tag="ZYRO0E04620g"
FT                   /old_locus_tag="ZYRO-ORF3939"
FT                   /product="ZYRO0E04620p"
FT                   /note="highly similar to uniprot|P41318 Saccharomyces
FT                   cerevisiae YNL006W LST8 Protein required for the transport
FT                   of amino acid permease Gap1p from the Golgi to the cell
FT                   surface component of the TOR signaling pathway associates
FT                   with both Tor1p and Tor2p contains a WD-repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30879"
FT                   /db_xref="GOA:C5E4B8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037588"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4B8"
FT                   /protein_id="CAR30879.1"
FT                   /translation="MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKK
FT                   LLAAAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDV
FT                   RAPSIPRNYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQ
FT                   SLSLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHL
FT                   ATCSADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWDLST
FT                   REIVRQYGGHHKGAVCVALNDV"
FT   gene            complement(<349593..>352016)
FT                   /locus_tag="ZYRO0E04642g"
FT                   /old_locus_tag="ZYRO-ORF3938"
FT   CDS_pept        complement(349593..352016)
FT                   /locus_tag="ZYRO0E04642g"
FT                   /old_locus_tag="ZYRO-ORF3938"
FT                   /product="ZYRO0E04642p"
FT                   /note="some similarities with uniprot|P48743 Saccharomyces
FT                   cerevisiae YLR176C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04642g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30880"
FT                   /db_xref="GOA:C5E4B9"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039779"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4B9"
FT                   /protein_id="CAR30880.1"
FT                   /translation="MQQHQRPTAAAPSVPIVSTNTVVPGQVPGTALHGQESAPSHNGNN
FT                   YAPQTQSQQGTNATPAHNSQLSSVYRLLHTPDSAAQLQLWRYQLPSPQLTQSAYSYHDS
FT                   AQKAAVDRAGRFAQGPLPWRNGISPPDSSSGATAAAAAAAAAAAAAVNSANANKNVNVG
FT                   GVPTSSTSPVAAPTSFSHVPESNSNSNGVTPAVAPASGSISSSAASSNDTGFHNFPSET
FT                   RRNTQEAVARGIAERHRDRPIAEYAAIVKQAEIAVLNMDPQTHSKTLVQTAEQNRERER
FT                   QVYALLWLMKSCQAQPDSYVPRGRIFAQYAASCAQNGLKPLSQASLGKLIRAVFPDLTT
FT                   RRLGMRGQSRYHYCGLKLVGPAQNSSETDTPSSMTNKVGLSATAPHSPMPMHLFPQQPS
FT                   QVSTSASISASSPLLSLQQQQQQQYYQQQQHYQQHYQQQQQQQLYQQQQHQQHGLPHNV
FT                   NSQISLPSNDYYHPYTHTKSNPIGLEPLTTDRAFNDYESVFMENMYDHIFSNEVPIPSD
FT                   YALKFPKIPRSQLPAGTDEDIVSALESLYHVHCNTIFEHIRFMRFDQLPNCLVLFGSGS
FT                   ISPQMYNLFTHESLHYWVYECDLITHVSLIKCLSRMVLDFDKVPASSIVKLEEFAKAYD
FT                   EIISESTIDLPVVMVAHKTEIVKNFSRLVRKLIQLIKYLRETSKILPNFQHMSKDWLSY
FT                   DNLDDVLYVINRNGYEKIVPMIRQFMSVDVTRFVDELASGVVRLDVFVRRFCEIISSVR
FT                   DVPAYKIMECIMMFSKVFMADTNIEMQQKGYPWYVLDMLFNLLIGYCYELNRFI"
FT   gene            complement(<353061..>353133)
FT                   /locus_tag="ZYRO0E04664r"
FT                   /old_locus_tag="Zyro0E.tVal_CAC_18"
FT   tRNA            complement(353061..353133)
FT                   /locus_tag="ZYRO0E04664r"
FT                   /old_locus_tag="Zyro0E.tVal_CAC_18"
FT                   /note="tRNA-Val (CAC) cove score=75.70"
FT   gene            <353639..>354439
FT                   /locus_tag="ZYRO0E04686g"
FT                   /old_locus_tag="ZYRO-ORF3935"
FT   CDS_pept        353639..354439
FT                   /locus_tag="ZYRO0E04686g"
FT                   /old_locus_tag="ZYRO-ORF3935"
FT                   /product="ZYRO0E04686p"
FT                   /note="similar to uniprot|P40693 Saccharomyces cerevisiae
FT                   YNL002C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04686g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30881"
FT                   /db_xref="GOA:C5E4C0"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4C0"
FT                   /protein_id="CAR30881.1"
FT                   /translation="MNMENPEILLKRRRNADETRLAKQQLAGQRKHREKKNRFVRAESI
FT                   VAKTLATQREKERVKRINKSVKNHHGDNEKILDETKDGAKITYDGKPQLLFVVRVKGPH
FT                   AVNIPQRVFKVLQILRLEQVNTGVFFRLNPTTFQLLKIIAPYIVVGKPSLSTVRSLIQR
FT                   RSRVNWKGSQINLNDNNIVEEALGEQGIICMEDIVHEISTMGETFKQCCYFLLPFQLAR
FT                   QVSGFSALKKLKKLEQRQKERHLSNAGNAPLVEIDIDQLLSEMN"
FT   gene            complement(<354494..>356329)
FT                   /locus_tag="ZYRO0E04708g"
FT                   /old_locus_tag="ZYRO-ORF3934"
FT   CDS_pept        complement(354494..356329)
FT                   /locus_tag="ZYRO0E04708g"
FT                   /old_locus_tag="ZYRO-ORF3934"
FT                   /product="ZYRO0E04708p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04708g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30882"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4C1"
FT                   /protein_id="CAR30882.1"
FT                   /translation="MSVSVDFGTRPSSVEELPTTRNESGGKLVEEAFDYFTCMEIGKSI
FT                   EQKAAKTKKIDEETLSNEIIGQFSKLQAPKGNVKFGDKEIVIFNEDERIGHSMKANSSV
FT                   DNVILPLPILKISQKGASDIKYMEPDNKMATQQERLFEVFRRCYTLCNLPMSQFDENNP
FT                   FKSLKKLCEGIKKSFKAKDECYKYIRYEENRRLSQEIRKLKDTIQELKDDRHNSLVLLQ
FT                   INKLQKHNNEYRNEIKDLTAQVTSTNYENSELRSNISELQTTKNQLMEKLGTALARSVE
FT                   LENNQEEKIELTKQNTKLNNDHGKLNDEHERLTKKYESLEEEYTKVTHSNESLTAKVDA
FT                   LTTTVQGWTHDHSELKSAHDILKSINKDLNSKLSKESTNVGELEAENSKLQRDSQDSKI
FT                   AFKTKLQELIDENIDLKSQVEKWRVEFEQVQTKYDKLNLEQREIVKQREKFRRDSDQTF
FT                   KKTVELQLQLDQHVKYREQAIKFNAEREACLITLKKLDFEYCHLQKSFEQACVHNRELL
FT                   EFQQAAERVVQDMNSKIVNLEKSKKTDAFKIDTLTRQVLKQTDKLDELQLQLTSWKQRQ
FT                   RLNGRKASGKRDILRSLANTKTLLEDPMTLSKNVC"
FT   gene            <357303..>357421
FT                   /locus_tag="ZYRO0E04730r"
FT                   /old_locus_tag="Zyro0E.tLeu_CAA_6"
FT   tRNA            join(357303..357340,357378..357421)
FT                   /locus_tag="ZYRO0E04730r"
FT                   /old_locus_tag="Zyro0E.tLeu_CAA_6"
FT                   /note="tRNA-Leu (CAA) cove"
FT   gene            complement(<357586..>358830)
FT                   /locus_tag="ZYRO0E04752g"
FT                   /old_locus_tag="ZYRO-ORF3932"
FT   CDS_pept        complement(357586..358830)
FT                   /locus_tag="ZYRO0E04752g"
FT                   /old_locus_tag="ZYRO-ORF3932"
FT                   /product="ZYRO0E04752p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30883"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4C2"
FT                   /protein_id="CAR30883.1"
FT                   /translation="MKFFKNNNNRGFFCTARKRKSEIVLDLNAASPSHNLESPLFESTS
FT                   KQESAEATEINFKEVKINSDSSDTCGNSDDGKISKHLSLCKHDKAPRERTSGMKESSKM
FT                   KFYGQLDLENSSVESSGEDHSDRSIPPINKNIDHGGSGTNREGICFNYNLDNFLGKRKS
FT                   SPKIVTNISKAGCKVSATTKSAMLKIFPGFTSPRSTRHQYGTVWTTASASKVHRLDVGG
FT                   NEPPTFESLSSSAHEKTKKLILSPGRRLTCKGTNSKFGTNVGSEPTIKTKVKRVKHKHQ
FT                   KKTVRQRKERQENVADQISKSTELVHMQPKSSSQKHLKRSTREGETSLQENKTKVKDEN
FT                   IKDANLEKTIITLWTLQNCVQHQTHCQSPIYQQLLQLNNQSSSKSTCRKSSKLKPRAWG
FT                   FKSIELDGTFSVFLY"
FT   gene            complement(<359351..>361777)
FT                   /locus_tag="ZYRO0E04774g"
FT                   /old_locus_tag="ZYRO-ORF3930"
FT   CDS_pept        complement(359351..361777)
FT                   /locus_tag="ZYRO0E04774g"
FT                   /old_locus_tag="ZYRO-ORF3930"
FT                   /product="ZYRO0E04774p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04774g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30884"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4C3"
FT                   /protein_id="CAR30884.1"
FT                   /translation="MDEDLVLISHSVCKKRTAAEAQLSPISPNGEFVTTYYTPTTKTKT
FT                   SKRQKFRSKLLKCFSKSEDSASAFGDTDWTIQLNNNVGNSQMPESLLGSRVHNGSGITM
FT                   TSNHNSGEENLACSLDKPHDSSNPFYIASISSSKHEAYSSGLAPVFGAQEAYVPRSVNK
FT                   IPMTSNTSAGRGDQESPKKHRFRIWLNENCPRSSDRKVTMALKDIFAAIAEEAAKFASI
FT                   RGKSKAAVEAGAVTTAAYARVNAATFRPSFNNGDAAKIIKEACQDVLTVSLVPKWKNID
FT                   YVKLFSIYQYELNLREAQANESLRRSSLKSGIDGLTIENSIGETFSEKELEPGRRVQFV
FT                   NLEEGFEKESNSSALNSECDSPSEAFVEDFESNFLDEGDYALSTRTKKWMNLLMSRIDF
FT                   FGKTTDIVRTFGDGIDNRSIGTNGMNNQKNLPFELECPNADELDDGFNPCMLDNSLIDA
FT                   LLPHIESGLSPSHRISDEISAAMTTEISTTNPGFCVYFGNASEGSSATLESNFEVKTKK
FT                   AAEDIGVRTDERNTLESLAFREVATPRDTSFSSCDNHSVDFSKAYLRIEILNSHFDQIS
FT                   SQVEKIVSGAVRDDISNELPLKNYQSPFIAADGSCDAPVPFKNNYSALNTSADVVGSSD
FT                   RKYSIEDLSPTATADPKMQVKELLSQIDSMLNTTKMGQYQANRENSSTSRENRLHLDID
FT                   TEQTIPQIDELLSLIDVAMVPATSENSKIDTQCIPNLNVRDTIIGKAPLDSLIPRVDCR
FT                   LFDTDCVDSPATKIEDPIDSLSCEYGKQDSTNSGPQVNALLAQIDSVITNFDSND"
FT   gene            <362881..>363969
FT                   /locus_tag="ZYRO0E04796g"
FT                   /old_locus_tag="ZYRO-ORF3926"
FT   CDS_pept        362881..363969
FT                   /locus_tag="ZYRO0E04796g"
FT                   /old_locus_tag="ZYRO-ORF3926"
FT                   /product="ZYRO0E04796p"
FT                   /note="uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
FT                   isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30885"
FT                   /db_xref="GOA:Q96WI0"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96WI0"
FT                   /protein_id="CAR30885.1"
FT                   /translation="MSKNIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIG
FT                   GAAIDATGSPLPDDALAAAKKADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANL
FT                   RPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYTKP
FT                   EVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLKLNHQLI
FT                   DSAAMILVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGL
FT                   YEPCHGSAPDLPKGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVLDSGVRTGDL
FT                   GGSNSTSEVGDAIAKAVKEILA"
FT   gene            complement(<364119..>365612)
FT                   /locus_tag="ZYRO0E04818g"
FT                   /old_locus_tag="ZYRO-ORF3925"
FT   CDS_pept        complement(364119..365612)
FT                   /locus_tag="ZYRO0E04818g"
FT                   /old_locus_tag="ZYRO-ORF3925"
FT                   /product="ZYRO0E04818p"
FT                   /note="highly similar to uniprot|P25374 Saccharomyces
FT                   cerevisiae YCL017C NFS1 Cysteine desulfurase involved in
FT                   iron-sulfur cluster (Fe/S)biogenesis required for the post-
FT                   transcriptional thio-modification of mitochondrial and
FT                   cytoplasmic tRNAs essential protein located predominantly
FT                   in mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30886"
FT                   /db_xref="GOA:C5E4C5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4C5"
FT                   /protein_id="CAR30886.1"
FT                   /translation="MLRQGITGLTRVSRLLRVGANSRPALSGGIRLYSKAASNAALKFA
FT                   DDAALETHTDTEAAAREQTVTRAAATSSPSEVIGSSTSALQNAYAENTGFGTRPIYLDM
FT                   QATTPTDPRVLDTMLKFYTGLYGNPHSNTHAYGWETNKEVENARKNVANVINADPKEII
FT                   FTSGATESNNMVLKGVPRFYKRSKKHIITTRTEHKCVLEAARAMVNEGFDVTFLNVDNE
FT                   GLVNLKELEEAIRPDTCLVSVMAVNNEIGVMQPLKEIGSICKKHKVYFHTDAAQAYGKV
FT                   PIDVNEMNIDLLSVSSHKIYGPKGAGAVFVRRRPRVRLDPIFSGGGQERGLRSGTLPPP
FT                   LVAGFGEAARLVVQENDADIAHIKRLSEKLTKGLLSIPDTSLNGSAEHRYPGCVNVSFA
FT                   YVEGESLLMAMRDIALSSGSACTSASLEPSYVLHAIGKDDALAHSSIRFGIGRFTTEEE
FT                   VEYVVDAISKRVKFLRELSPLWEMVQEGIDLNSIEWSGH"
FT   gene            <365995..>366834
FT                   /locus_tag="ZYRO0E04840g"
FT                   /old_locus_tag="ZYRO-ORF3923"
FT   CDS_pept        365995..366834
FT                   /locus_tag="ZYRO0E04840g"
FT                   /old_locus_tag="ZYRO-ORF3923"
FT                   /product="ZYRO0E04840p"
FT                   /note="similar to uniprot|P38921 Saccharomyces cerevisiae
FT                   YNL003C PET8 S-adenosylmethionine transporter of the
FT                   mitochondrial inner membrane member of the mitochondrial
FT                   carrier family required for biotin biosynthesis and
FT                   respiratory growth"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04840g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30887"
FT                   /db_xref="GOA:C5E4C6"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4C6"
FT                   /protein_id="CAR30887.1"
FT                   /translation="MDSNGFFVSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFANGG
FT                   YRGIYKGLGSAVVASAPGASLFFVAYDSMKSFLKPKFQQLMPKANEPLIDVVTQMASSS
FT                   IGEISACMVRVPSEVIKQRTQTHISNSSLQTFKNLLKNENGEGLRRNFYRGWSTTIMRE
FT                   IPFTCIQFPFYEFLKKSWAQWENAKEIPPWKGAICGSIAGGVAAASTTPLDVLKTRLML
FT                   SNKSMPVWQLASTLYKEEGPKVFFSGVGPRTMWISAGGAIFLGVYELAHSMLTRPTL"
FT   gene            complement(<366864..>367988)
FT                   /locus_tag="ZYRO0E04862g"
FT                   /old_locus_tag="ZYRO-ORF3921"
FT   CDS_pept        complement(366864..367988)
FT                   /locus_tag="ZYRO0E04862g"
FT                   /old_locus_tag="ZYRO-ORF3921"
FT                   /product="ZYRO0E04862p"
FT                   /note="similar to uniprot|P25559 Saccharomyces cerevisiae
FT                   YCL016C DCC1 Subunit of a complex with Ctf8p and Ctf18p
FT                   that shares some components with Replication Factor C
FT                   required for sister chromatid cohesion"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30888"
FT                   /db_xref="GOA:C5E4C7"
FT                   /db_xref="InterPro:IPR019128"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4C7"
FT                   /protein_id="CAR30888.1"
FT                   /translation="MSLNLHERLSTDGSFRLLHLTPELLEVLKDSNSKLQFKAAGNDED
FT                   DGDVVLCSRDKTWLLRQKNHSNTVMLMHEFTPEQETSLETTFGLPNPTSDFAGFARTTF
FT                   EYETKKVSGIINLDSVPVHNGSLDFPPADGQDLPVKSMDDLLASSACSEKECLSQWNQL
FT                   GGCTVKGYPCILSSDFLSKALHVTLMSAMAESLDFSRLKLDETFDAVNKDMDQDSNPYT
FT                   REVIKTTLEKYGKRVKDDDDCWQLDQKKVAEWYGIRALRKYASQSSIPPAEFLIKWKST
FT                   FPPYAPFDIEIEMLRGWFFRPTGSNLQYLSKNTLPSDIKERFKMLFKLQSQWDMDDIAP
FT                   FVEELNTKGLKIDVFIMKYARKRRVGKKFIISSR"
FT   gene            <368266..>373518
FT                   /locus_tag="ZYRO0E04884g"
FT                   /old_locus_tag="ZYRO-ORF3919"
FT   CDS_pept        368266..373518
FT                   /locus_tag="ZYRO0E04884g"
FT                   /old_locus_tag="ZYRO-ORF3919"
FT                   /product="ZYRO0E04884p"
FT                   /note="weakly similar to uniprot|P25558 Saccharomyces
FT                   cerevisiae YCL014W BUD3 Protein involved in bud-site
FT                   selection and required for axial budding pattern localizes
FT                   with septins to bud neck in mitosis and may constitute an
FT                   axial landmark for next round of budding"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30889"
FT                   /db_xref="GOA:C5E4C8"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR021895"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4C8"
FT                   /protein_id="CAR30889.1"
FT                   /translation="MYDDVSSSLDSVATDNGHADPPKKDIIQLFNNILRAQLGNNPSLQ
FT                   RLGTPAEWVDIIFKKSNVFYGCDELMWGAFIACIYRDPQDSQLSCILIDKVGVSHFSPI
FT                   DVTGESQYYPAIENLVPAHKNSESRQCIAVTFLQRFAQLSDKDVRRVHPDTFKFDYDPT
FT                   HAGDLASACIQMEGENKLVNIGRKLLSLGFFQDRLVSSTLLDVVYEYNEAVSEPNNKLV
FT                   FYLGKQLEQLFNPLTEYSPEQTEHTYKAPSDETPTEEDDALVKAISRELLELQTNFTLN
FT                   LVEFLQKFVIVLRIRVLNGEIEGLSTVKLNRLFPPTIDEVTRINCIFLDSLKSATPFGS
FT                   LEVLKACSVTIPYFYKAYTRHEAATKNFNKDIKLFLKSFYNQIPLSDVFTEMKIDSLIK
FT                   GPQEKLMKIKLIIDRLYASKKWDPKNEGEAKKCYDNVIEIIDSFGRLEGPLNSYNSRVF
FT                   TPSGKILTELAKGWPAELQYKWLKRRVVGVFDMIDPKDPTNEKLLVIFSDYLMFLDVVE
FT                   DRTNYGSAQFKKPSISDILMNSLVNEVPLPPKMPQLRVDGHCYIDEVFVTLFGNNCIRF
FT                   DAFRDKNPFAVTLKVQRKPFSAYTVADLVTKAKILEKDTAFHLFKATHDDITVYSTAHE
FT                   MEAYSNETIKSKFALFLNMNPTEKVIMQHKLHVAMFAKFVPGVLDTELVQLDILTSDGG
FT                   FRSIRTAIEELIPSVLRQLSFEIPVCFSSIYSPLLPGILAANESIIKGLECFDSANAVT
FT                   SRPVSKTRGEKEPRPMSSSVTKGPESHSRHRPAKSYATITTFRSNISDTKTAGNRQSED
FT                   RFDFEEMDQPQKAQVESHEPQEKKDRMKLFPQAPAPSLAARQESQPASKKAGRHQKRRS
FT                   ISNIFKSIFSKKKENDSSISTIKDKTKKKSNEGRPNESQKHYFTSNNKSRSDNGSQRKR
FT                   SSVLQNNYPKPVNDARNSLNGRSPNESLAPVEPPNTRNKAVEEKRHQSIQLGQFDTDNT
FT                   VGTNDKRFSTVSDFAGPARNTSTTNNRDSALYRKSQISEMMNEEIGQPERSDSRELKEL
FT                   PKEPPIDASKDGKENHGSPPQPSVNEVREHNQTMASQANNLSDSKLAGVQENIVAEDLE
FT                   GKPSRESQVFNDDLFGDVIPDPKKGPSTINETGTMQSNKRNSAVQNNSQAVNGSSVPGP
FT                   FDNKKVENFDAEIKPQENVQQNENEPEATHIEATQPTDNFQDNFSQKKSVNPRIQNLKA
FT                   SKIDFEKSSSFVELFQGMRLVLDESDAKYNWKSLPSEYSLRDTSPVNFVEEPTPQPQHQ
FT                   HAFKSIAFAGINIPPKPRAESAVRRPPQAKPESINSFSPGARQSKLVSGTNQNVAQESG
FT                   KKVFNASQQNRESGINQNATQGQKAGFINQRIPRERSIPEIRYGGMNRQSRTGVNSNAF
FT                   VSPGNPTLSADGTGNTLEEEQEENQRDVANKLFENTLRKDSDLAPPPKLSQQSSPERPA
FT                   RKKIPTFKVINNSPTRIIQRISPDRAASPYNIPSDISISSDLDEHTNKRLFELKFSSKD
FT                   DINDSGSSPVESAAKPSMPDATTQDVGNASETSAPSVHNNDDSNTTPEDSLPEGKPLQG
FT                   EDGGLLDDLDFSSFNVTFDTFNRDRDVSQRSITRGPSVIIKDQEPLSTTVENPRSEEPL
FT                   IYRLPKSNENSTRKSYLNRPSNTRQVHNDDDPIWISPSKLDYYDINKFTGPAFKDAKEM
FT                   IRTATNENMHKIIAENPTSMNELSYAYLASIIDDDDDQPLNSNDRPIRLTFKE"
FT   gene            complement(<373554..>374017)
FT                   /locus_tag="ZYRO0E04906g"
FT                   /old_locus_tag="ZYRO.mRNA.223AT.m"
FT   CDS_pept        complement(join(373554..373925,373973..374017))
FT                   /locus_tag="ZYRO0E04906g"
FT                   /old_locus_tag="ZYRO.mRNA.223AT.m"
FT                   /product="ZYRO0E04906p"
FT                   /note="similar to uniprot|Q8J0M4 Saccharomyces cerevisiae
FT                   YCL012C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04906g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30890"
FT                   /db_xref="InterPro:IPR018559"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4C9"
FT                   /protein_id="CAR30890.1"
FT                   /translation="MLELLHAKFIIGILVYVILVDELNVNSFVTNKCFPAYRFKERYIR
FT                   LRRGLGHRIGLNDDFADDLESGLSSRHFDIISRNASDERHGLDPAAKEEIRNIMERENM
FT                   GFDKARLLYTERVFGQNNIAPDGTPLDPKAITFQ"
FT   gene            complement(<374326..>375727)
FT                   /locus_tag="ZYRO0E04928g"
FT                   /old_locus_tag="Zyro0E.mRNA.4064.m"
FT   CDS_pept        complement(join(374326..375537,375710..375727))
FT                   /locus_tag="ZYRO0E04928g"
FT                   /old_locus_tag="Zyro0E.mRNA.4064.m"
FT                   /product="ZYRO0E04928p"
FT                   /note="similar to uniprot|P38922 Saccharomyces cerevisiae
FT                   YNL004W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30891"
FT                   /db_xref="GOA:C5E4D0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4D0"
FT                   /protein_id="CAR30891.1"
FT                   /translation="MSQLERHRSRSPARVRDERDYGRSGYGPRPRGGGGRHSRYDRRGR
FT                   GSYAGGAGGAGGAGGASGAGGAGGRYSRFRKNKGDYGPVLARELDSTYDEKVNRNYANS
FT                   VFVGNLTYDCAPEDLKDYFSQIGNVVRADIITSRGHHRGMGTVEFTNTEDVDEAIRRFD
FT                   GAYFMDRQIFVRQDNPPPESNSHERVQERRKERTFAGASSGSNNGTNAGGNSNGPIYEV
FT                   FVANLPYSINWQALKDMFKECGNVIRADVELARNGYSRGFGTVIYGTPEEMQDAIARFH
FT                   GYELEGRILEVREGRKSAVDPPPQEPIDDSSNFNSEFTEGVTDGGERNNLIYCANLPFS
FT                   TATSDLYDLFETIGKLNNAELRFDSKGAPTGVAIVEYENVEDADVCIDRLNNYNYGGCD
FT                   LEISYGKRET"
FT   gene            complement(<375954..>376940)
FT                   /locus_tag="ZYRO0E04950g"
FT                   /old_locus_tag="ZYRO-ORF3910"
FT   CDS_pept        complement(375954..376940)
FT                   /locus_tag="ZYRO0E04950g"
FT                   /old_locus_tag="ZYRO-ORF3910"
FT                   /product="ZYRO0E04950p"
FT                   /note="similar to uniprot|P25554 Saccharomyces cerevisiae
FT                   YCL010C SGF29 SaGa associated Factor 29kDa Probable 29kKDa
FT                   Subunit of SAGA histone acetyltransferase complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30892"
FT                   /db_xref="GOA:C5E4D1"
FT                   /db_xref="InterPro:IPR002999"
FT                   /db_xref="InterPro:IPR010750"
FT                   /db_xref="InterPro:IPR037802"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4D1"
FT                   /protein_id="CAR30892.1"
FT                   /translation="MDEQWDLVISSLQDIYNANAVMAYDDDVQLKEIELNTLSDEKLRE
FT                   HLDHYSSHLHNIRRAQRLIDSVGENVKLVLEHAQERERMASKVPPPASPSAAKIESNTG
FT                   EDTTNATVTENEPPKAPAEATAEAPAEAPIEAPTEAPSETSVEAPTEAPTREALDTQAH
FT                   PQPQFQQTARPLGRSGWISQYNPNGPISIGSEVAFKPKKGGEGEWFQCVVVKVSADGLR
FT                   FEVRDPEPDELGNPGKTFKCNWRDIIFIPPEGTDPKSQTPNYPPGTKVLARYPETTTFY
FT                   PAVVIGSKRDGTCRLRFDGEEEVDKETEVLRRLVLPCPTISSIMAKK"
FT   gene            <377214..>378326
FT                   /locus_tag="ZYRO0E04972g"
FT                   /old_locus_tag="ZYRO-ORF3909"
FT   CDS_pept        377214..378326
FT                   /locus_tag="ZYRO0E04972g"
FT                   /old_locus_tag="ZYRO-ORF3909"
FT                   /product="ZYRO0E04972p"
FT                   /note="similar to uniprot|P12687 Saccharomyces cerevisiae
FT                   YNL005C MRP7 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30893"
FT                   /db_xref="GOA:C5E4D2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="InterPro:IPR041244"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4D2"
FT                   /protein_id="CAR30893.1"
FT                   /translation="MDILANCSGGFVPKYACNVLTQVRNATKRAAGSRTSMKDSAGRRL
FT                   GPKKYEGQSVKVGEIIMRQRGTKLYPGENTGIGKDHTIFAKEPGVVRYYVDPFHPKRKF
FT                   VGVSLKRELKLPLPHFAPRVRRFGREILTHPRLKAEEESFLPRKQLEAKDSILKALQER
FT                   ESRRLQLSEDFQVFFEKQLPELQLKDVEMANAYLIRLRSCLKNGYELEDAQYNAQHYLE
FT                   LEYRLQAQRENWNDNLESHLQILQETVGTLNKSVSFDNKLHLMKYIDPQTKESLKSQLV
FT                   KTLHEKAENIETKQQRDEIQSLFQDACQFLTLSEEVHLRRQFLKPVKPETPPTLAPQPT
FT                   KKTVTIKRFNHERNRLETIPRTKSAFLSKL"
FT   gene            complement(<378428..>379360)
FT                   /locus_tag="ZYRO0E04994g"
FT                   /old_locus_tag="ZYRO-ORF3908"
FT   CDS_pept        complement(378428..379360)
FT                   /locus_tag="ZYRO0E04994g"
FT                   /old_locus_tag="ZYRO-ORF3908"
FT                   /product="ZYRO0E04994p"
FT                   /note="highly similar to uniprot|P25605 Saccharomyces
FT                   cerevisiae YCL009C ILV6 Regulatory subunit of acetolactate
FT                   synthase which catalyzes the first step of branched-chain
FT                   amino acid biosynthesis enhances activity of the Ilv2p
FT                   catalytic subunit localizes to mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30894"
FT                   /db_xref="GOA:C5E4D3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4D3"
FT                   /protein_id="CAR30894.1"
FT                   /translation="MNRLVLQGSARRFVSLRYSLNAIRCSSSSTSALAYKQLHRNATRP
FT                   PLPTLETPSWSADSAVSSILYETPTPSAQPCKQHVLNCLVQNEPGVLSRISGTLAARGF
FT                   NIDSLVVCNTEVKDLSRMTIVLQGQDGVIEQARRQIEDLVPVYAVLDYSNASIIKRELV
FT                   LARVSLLGAEYFEDLLVHHHRSTSGIEDTGDLVKEIRNKKYHPSNLPLSEVLRMKHEHL
FT                   GAISNLSNNFGGKVVDISDSSCIIELSAKPSRISAFLKLLEPFGVLECARSGMMALPRI
FT                   PIKNRPDDSDEAVTEKINDMVDISQLPPG"
FT   gene            complement(<379654..>380889)
FT                   /locus_tag="ZYRO0E05016g"
FT                   /old_locus_tag="ZYRO-ORF3906"
FT   CDS_pept        complement(379654..380889)
FT                   /locus_tag="ZYRO0E05016g"
FT                   /old_locus_tag="ZYRO-ORF3906"
FT                   /product="ZYRO0E05016p"
FT                   /note="highly similar to uniprot|P41939 Saccharomyces
FT                   cerevisiae YLR174W IDP2 Cytosolic NADP-specific isocitrate
FT                   dehydrogenase catalyzes oxidation of isocitrate to alpha-
FT                   ketoglutarate levels are elevated during growth on non-
FT                   fermentable carbon sources and reduced during growth on
FT                   glucose"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05016g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30895"
FT                   /db_xref="GOA:C5E4D4"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4D4"
FT                   /protein_id="CAR30895.1"
FT                   /translation="MMPKIQVKNPIVEMDGDEQTRIIWKLIKDLLILPFIDVDLLYYDL
FT                   SITNRDATDDRVTVESAEATLKYGVAVKCATITPDEARVEEFHLKKMWRSPNGTIRNIL
FT                   GGIVFREPIVIPRIPRMVSQWEKPITIGRHAFGDQYKATDTVIPDEGELKLVFKSKDGK
FT                   HDQDLQVFEFPKGGGVAMAMYNTTESIEGFAKASFELALERKQPLYSTTKNTILKKYDG
FT                   KFKDIFEAMYEKEYRSQFEKLGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVQSDI
FT                   VAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRG
FT                   IIQRGKLDNTPEVVKFGQLLEKATVEVVDFENIMTKDLALILGKTDRSAYVTTEEFIHA
FT                   VSKRLKGEVAKF"
FT   gene            <381323..>381395
FT                   /locus_tag="ZYRO0E05038r"
FT                   /old_locus_tag="Zyro0E.tAla_TGC_7"
FT   tRNA            381323..381395
FT                   /locus_tag="ZYRO0E05038r"
FT                   /old_locus_tag="Zyro0E.tAla_TGC_7"
FT                   /note="tRNA-Ala (TGC) cove score=80.16"
FT   gene            complement(<381556..>382278)
FT                   /locus_tag="ZYRO0E05060g"
FT                   /old_locus_tag="ZYRO-ORF3903"
FT   CDS_pept        complement(381556..382278)
FT                   /locus_tag="ZYRO0E05060g"
FT                   /old_locus_tag="ZYRO-ORF3903"
FT                   /product="ZYRO0E05060p"
FT                   /note="highly similar to uniprot|P53981 Saccharomyces
FT                   cerevisiae YNL010W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30896"
FT                   /db_xref="GOA:C5E4D5"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4D5"
FT                   /protein_id="CAR30896.1"
FT                   /translation="MVKAVIFTDFDGTVTLEDSNDYLTDTLGFGKPKRLDAFEGVLAGT
FT                   KSFRDAFWEMLTSIHTPFPECLDILGKKIALDPGFKDTLHWSLENNVPIVVVSSGMKPI
FT                   IKHLLTLLVGEEAVSKVDIVSNAVEVQPDGQWKIVYIDDSPFGHDKSKTIDHYKEKFES
FT                   ESKDSEKPVYFYCGDGVSDLSAAKECDLLFARRGKDLVRYCRRENVPFHEFDSFQDILA
FT                   NMKQVLAGEKTVKELMEN"
FT   gene            <382498..>383838
FT                   /locus_tag="ZYRO0E05082g"
FT                   /old_locus_tag="ZYRO-ORF3902"
FT   CDS_pept        382498..383838
FT                   /locus_tag="ZYRO0E05082g"
FT                   /old_locus_tag="ZYRO-ORF3902"
FT                   /product="ZYRO0E05082p"
FT                   /note="similar to uniprot|P53980 Saccharomyces cerevisiae
FT                   YNL011C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30897"
FT                   /db_xref="GOA:C5E4D6"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4D6"
FT                   /protein_id="CAR30897.1"
FT                   /translation="MNVVVLSGGTATNSLTSCFSQISVSENRELTYILPISDNGGSTSE
FT                   ILRVVGGPAIGDIRARVAQLVGDPQVGQLLSYRLPNDSVRAKEEWNSIVEGQHSVWKDI
FT                   PTPVKEMCRAFIIHMQSELLKKTKSANAFRFEKASVGNFFLTGARLFLGSLDATVELLM
FT                   RIGRCDPHASVIPCISTNHTHHIAALLSNGEVIRGQSQISHPSKPKASQSVLPPSIMGG
FT                   TTSRPTTAAKSDGLDLHSEEEQEEEYANPIYILPELKNSQLHFDKLEKEETFSAPIERL
FT                   LYINPYGEEIKPQGNPRAVSKIKRADMVVYSIGSLVTSLLPIVILGNIADIIAESKSTR
FT                   KVLLINNSYDRESFWLDGVRYVQLVIESMSRAVQTHRQSKGSKDPTPVLLDWTHFVTDV
FT                   VYPIGGEIPIAQEKLESMGIKCHGIDSNKMENESLKQILVQIGSSKP"
FT   gene            complement(<383976..>384680)
FT                   /locus_tag="ZYRO0E05104g"
FT                   /old_locus_tag="ZYRO-ORF3901"
FT   CDS_pept        complement(383976..384680)
FT                   /locus_tag="ZYRO0E05104g"
FT                   /old_locus_tag="ZYRO-ORF3901"
FT                   /product="ZYRO0E05104p"
FT                   /note="similar to uniprot|P39931 Saccharomyces cerevisiae
FT                   YLR250W SSP120 Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cytoplasm in a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30898"
FT                   /db_xref="GOA:C5E4D7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR040250"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4D7"
FT                   /protein_id="CAR30898.1"
FT                   /translation="MKFTPSLVLGLFAGIGIANLNAPIDPKVNVEVEQVPQGLSWEKWH
FT                   MQHEHKLDDYTPEHFFDLHDEGGKGYLNRGDILALYGMNRGEVIGSGDGMGHHDDSEHL
FT                   DQELGDRVAQFIMKLLDVDDDSKITKQEYLNFARKGGVFPDLGVGVGHHADFELEYEIH
FT                   HWNEFHKDKDPDVDVIHKEDIEHELLHHEHEVEHEESVQRGASRSTVITDDELESRINP
FT                   DVIPKKYTNSLF"
FT   gene            complement(<384898..>386550)
FT                   /locus_tag="ZYRO0E05126g"
FT                   /old_locus_tag="ZYRO-ORF3900"
FT   CDS_pept        complement(384898..386550)
FT                   /locus_tag="ZYRO0E05126g"
FT                   /old_locus_tag="ZYRO-ORF3900"
FT                   /product="ZYRO0E05126p"
FT                   /note="similar to uniprot|P53541 Saccharomyces cerevisiae
FT                   YNL012W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30899"
FT                   /db_xref="GOA:C5E4D8"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4D8"
FT                   /protein_id="CAR30899.1"
FT                   /translation="MGLAISGGGYRSMLTASGFIKEMDNYGIFDCLSYISGLSGGSWVL
FT                   MDLLSQNFNVSSLLSNWKLNDGLLKGVPDFDIRHHDIVSGMEEYEDALVKRTVSDEGAL
FT                   RQFFYNFEESLQLAAFLFQEDDEQKRVTKRGVGPLAKIMDFFLQRNDKQEEEDLDDNEN
FT                   SLFGSIQSLHQVIQFYIDLHLGIRPKKMQGFTISFTDYLGKALKKKLSNTKGQSSSFSQ
FT                   LMMNSTKFQDFKAPIPLFIANCRNEHLKNVIFEFNPFEFGSWESNLGLFVKMPYLGSTI
FT                   EAGNPSRCINGFDDIGFITATSSSIFNNVLIYIWQLTAQSSRETMRAVKNIMSIFGLGN
FT                   GKLDEKSFRPTSLNNLDTDYAVYQPNPFYHYPGINNELTQNDYLYLVDGGEDGENIPLR
FT                   PLTIPQRNLDIIFVIDSSSDEFNYPRGKKLKNVLHQLQNEEIDSHSYSIPDFDKVNQYP
FT                   IALGCYQPHLPIILYHPNAPHSYNSNTSTFKITYNESEVNGMLQNGRVIFSLSSNPEHM
FT                   DCIGCLIAKRRIEQVDKSRMPKICRQCFEDYCH"
FT   gene            complement(<387268..>390405)
FT                   /locus_tag="ZYRO0E05148g"
FT                   /old_locus_tag="ZYRO-ORF3898"
FT   CDS_pept        complement(387268..390405)
FT                   /locus_tag="ZYRO0E05148g"
FT                   /old_locus_tag="ZYRO-ORF3898"
FT                   /product="ZYRO0E05148p"
FT                   /note="highly similar to uniprot|P16521 Saccharomyces
FT                   cerevisiae YLR249W YEF3 stimulates the binding of
FT                   aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1
FT                   alpha from the ribosomal complex contains two ABC cassettes
FT                   and binds and hydrolyses ATP EF-3 (translational elongation
FT                   factor 3)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30900"
FT                   /db_xref="GOA:C5E4D9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="InterPro:IPR040533"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4D9"
FT                   /protein_id="CAR30900.1"
FT                   /translation="MSDSQQSVEVLNQLLARLSVATPDNRDEVATEVSSFVNGNIIEHD
FT                   APEHFFNGLAKAIKDKKSAVNALAAVSHVASTSGLAPSVEPYVVALVPAILEQTGSKDK
FT                   DVQSAANAALHAVVTAVNPVAVKAVLPHLTKSLSETNKWQEKVAVLSAISALVDQAKSQ
FT                   ISLRMTELIPVLSEAMWDTKKEVKNAATATMTKATETVENKDIERFIPKLIECIANPSE
FT                   VPETVHLLGATTFVAEVTPATLSIMTPLLSRGLAERETPIKRKSAVIIDNMCKLVEDPQ
FT                   IVAPFLNKLLPGLKNNFSVIADPEAREVTLRGLKTLRRVGAVGEGDVLPEISHAGDPAT
FT                   TLGVLDSLLKTENIAKKFRPAVEYISCIGGDLIDERIIDQQTWFTHVLPYMTIFLHQNQ
FT                   AKEILDEFRKRAVDNIPEPPKFDDEEEEGEDLCNCEFSLAYGAKILLNRTQLRLKRGRR
FT                   YGLCGPNGSGKSTLMRAIANGQVDGFPSQEECRTVYVEHDIDGTHAETSVLDFVFQGDV
FT                   GTKEAISAKLKEFGFDDEMIVMPIAALSGGWKMKLALARAVLKNADILLLDEPTNHLDT
FT                   VNVAWLTNYLITCGITSIVVSHDSGFLDNICQYIIHYEGLKLRKYKGNLSALVERVPSA
FT                   KSYYELGASDLEFRFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTSKPQISDVSFQCSLS
FT                   SRIAVIGPNGAGKSTLINVLTGELLPTTGEVYTHENIRIAYIKQHAFAHIESHLDKTPS
FT                   EYIQWRFQTGEDRETMDRANRQINEDDAQAMNKIFKIDGTPRRIAGIHSRRKFKNSYEY
FT                   ECSFLLGENIGMKSERWVPMMSVDNAWLPRGEVIESHGKMVAEVDMKEALASGQFRPLT
FT                   RKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLDRD
FT                   SLGALSKALKEFEGGVIIITHSAEFTKDLTEEVWAVRDGLMTPSGHNWVSGQGSGPRLE
FT                   KKEDEEDKFDAMGNKISSGTKKTKLSSAELRKKKKERMKKKKELGDAYVSDDDADF"
FT   gene            complement(<390866..>392593)
FT                   /locus_tag="ZYRO0E05170g"
FT                   /old_locus_tag="ZYRO-ORF3894"
FT   CDS_pept        complement(390866..392593)
FT                   /locus_tag="ZYRO0E05170g"
FT                   /old_locus_tag="ZYRO-ORF3894"
FT                   /product="ZYRO0E05170p"
FT                   /note="some similarities with uniprot|P38623 Saccharomyces
FT                   cerevisiae YLR248W RCK2 Protein kinase involved in the
FT                   response to oxidative stress identified as suppressor of S.
FT                   pombe cell cycle checkpoint mutations"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30901"
FT                   /db_xref="GOA:C5E4E0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4E0"
FT                   /protein_id="CAR30901.1"
FT                   /translation="MNKLKNFFKQKKTQEEEEQLDQKQKQQYSLQQGQAQGNSLSTTRP
FT                   YETRVSIEEDTLSSTTKVNSERSTMETQPANIHHNNSTNHQCQSMFVEDVGSSRTSSSD
FT                   ESCGMSDEDEDGDEDDIPEDIFPEQVELDGYTLVNKIGEGAFSTVFRGIICKGSGKEFL
FT                   ANNFKNLAIKVIRKQDIPDSNATKKDAGKTSTRAQVLKEVTIHKLAASGCPEIVQFVDF
FT                   QETDNYYFIIQEFLSGGEIFGEIVKFTYFSEDLSRHIIRQLALAVKHLHNVGVVHRDIK
FT                   PENLLFEPIDFVPSKKIKLRKSDDPSTKKDEGIFRPGFGGGGIGSVKLADFGLSKQIYQ
FT                   AKTKTPCGTVGYTAPEVVKDEKYSTKVDMWGIGCVLYTILCGFPPFYDEKIDTLTEKIS
FT                   RGEYVFLRPWWDEISDGAKTAVKRLLEVDPVKRYDIDEFLNDPWLNTFDCLEEQKEEEE
FT                   RIRSHKRKSKLQFKRKMAIDSTLLYSPAAVAMKDAFDVSNAVQRDEEDKREIMSNSLGA
FT                   LAEDEESDDPSSALASATNANYDNNQDLSQDMFHLSLDSSTIIKRRKNGAVPIAAVVE"
FT   gene            <393899..>398461
FT                   /locus_tag="ZYRO0E05192g"
FT                   /old_locus_tag="ZYRO-ORF3890"
FT   CDS_pept        393899..398461
FT                   /locus_tag="ZYRO0E05192g"
FT                   /old_locus_tag="ZYRO-ORF3890"
FT                   /product="ZYRO0E05192p"
FT                   /note="similar to uniprot|Q06554 Saccharomyces cerevisiae
FT                   YLR247C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30902"
FT                   /db_xref="GOA:C5E4E1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4E1"
FT                   /protein_id="CAR30902.1"
FT                   /translation="MSSVATLDVAADQDFIGDGSKSRDSGTRCFVADGLSDYVCSSQIT
FT                   QPEKEGGIKETIKDGNKKSKLSKCQVEIARLRMYASGEVGGSTDLAAERRVLVQFLEMV
FT                   DQDVLMVSGESGEKLLKVQRGIKDDRWRQILRVAHNKCLEWEVNNSKQNMEAFTTDTSR
FT                   KSRKRGNRSTARNAVVMAKRLVSKMYKDLSCEVTIGLDSANRWILCIRVWLSYLPQSLN
FT                   KFSTETKSFLDTWFSQRAAPSSPSSLDPLPPSPFIQGKFVSQTVAHTRQRLSRWYSDPV
FT                   RDVPGLNLHLLPFQSSTVEWMLSKEVGEFLPRYLGKTKQELLQFLNGCVSYGYESISQD
FT                   LFWNKFTNFVLTGEEVEQIYSGMWAKREEFNQRARGILCEEMGLGKTIEILSLILLNQR
FT                   NLSDIPRTFIAEDGKTILRTSTTLIICPNAILQQWINEVESHTNDMSIFHYKGFLPVKK
FT                   FFKTDNIWEIVDQLSHYDIVITSYNVVSTEVHYAEYNASSRPRRSTCPIKYDYSSPLSL
FT                   MQFFRIILDEVQMLHSDSTKAAKCTSLLHRVHTWGVSGTPIQLVKDFQTVLSYLKISPF
FT                   HELPEIISSVNNNVIQRQKEQLVQGVKFTLSELLNIPIEQDLTVRHSREDVISQIHIPR
FT                   QHNYIVPLEFAPVEWDNYLDVWNSFVTVSGYGPNGTDSPRLNTIQLNQWLTRLRYLCCH
FT                   AVFPDSHTNSKGQSHSSNASLHNIDDILKLMTTDAIEKLDSLYRDNYQLQIRSAQAKSE
FT                   LQNNPDGAIDLLHSVQEKLSEDLKEKCLVDDPFDTDGIPVEERSGTPATKDSPEGVSSI
FT                   RTRAYLDLLHQCFFLMATAYYNKGSSRLEYVDDENEKLALKQSDEKPKTYTDVYNVEEM
FT                   KDIEKNQRLEQEYYGYAERLRKRILFGRVQKVDIFVKETQDYFENDSSSRPQSLQYIEF
FT                   SSSNNFANSMLVSRCFQLLSLLINSLNEQALQFNQLFGELAQLVYEPIIRDYDETNEDE
FT                   KAQEYSNSIENQDKMFAILACMEQLLENRNSILTSDETIKLSKKTFKPQAGQKISDYHS
FT                   ELLSNLKLISGTPFKPIFDDLKNAKVVRNVSTSKSSHKSTSPQEFEDYLLRYEEEIPRM
FT                   VREDKCIRDSLKKLNIVYNAKLEYYSHLQRISDSLVPLLQLENVTRNAIVKSIRDDTQY
FT                   RRNLEKISSAESRVKYLNGLNKLKESIKHNQSFSCAICLGTIHTGSIIKCGHFFCRKCI
FT                   HSWLKNNQSCPLCKTRATLLEVYNFKFKEEPEEESPPSSSSSSEKKNDSQNTNGNDNKQ
FT                   FKREHLDPVLKQKYEFFPQFEEVHKMVIKESFGAKIDFVIKLILFLKLKSESESDQEDP
FT                   PQILMYSQSFEFLKVISKVLNIYEIKHLSCWANVTNVGEAISKFKRNTSITCLLLNVKS
FT                   LGAGLNLLNARHVFLLDPIINRGDELQAMSRNNRIGQTKETYVWNFMIKNSVEENIFKY
FT                   KCVLEGRRRLLGEKLKVKQENLDTMTVEEEEREELEMNESTGEQVCGKHLKNCFFPCTS
FT                   "
FT   gene            <398897..>399247
FT                   /locus_tag="ZYRO0E05214g"
FT                   /old_locus_tag="ZYRO-ORF3889"
FT   CDS_pept        398897..399247
FT                   /locus_tag="ZYRO0E05214g"
FT                   /old_locus_tag="ZYRO-ORF3889"
FT                   /product="ZYRO0E05214p"
FT                   /note="similar to gnl|GLV|KLLA0F22792g Kluyveromyces lactis
FT                   KLLA0F22792g and some similarites with YMR252C
FT                   uniprot|Q04814 Saccharomyces cerevisiae YMR252C
FT                   Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05214g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30903"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4E2"
FT                   /protein_id="CAR30903.1"
FT                   /translation="MLKSLIKPQYFSHLQPRYFSTTVRLGQFKDWKSLSKKDKQEFITN
FT                   YVELFQKKHPCSKGNVMNKNLSEGMHEYDDTPYVFGIIYNEIRSIALGEPNDNEDGEGV
FT                   LSDREFSSLLYK"
FT   gene            complement(<399318..>399788)
FT                   /locus_tag="ZYRO0E05236g"
FT                   /old_locus_tag="ZYRO-ORF3888"
FT   CDS_pept        complement(399318..399788)
FT                   /locus_tag="ZYRO0E05236g"
FT                   /old_locus_tag="ZYRO-ORF3888"
FT                   /product="ZYRO0E05236p"
FT                   /note="highly similar to uniprot|P35181 Saccharomyces
FT                   cerevisiae YLR170C APS1 Small subunit of the clathrin-
FT                   associated adaptor complex AP-1 which is involved in
FT                   protein sorting at the trans-Golgi network homolog of the
FT                   sigma subunit of the mammalian clathrin AP-1 complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30904"
FT                   /db_xref="GOA:C5E4E3"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4E3"
FT                   /protein_id="CAR30904.1"
FT                   /translation="MTQIKYMILASRQGKVRLVKWYTPYTPKEKTKISKELPPLILSRK
FT                   PKMCNIVEYSDHKVVYRRYASLYFICGITPEADNELLTLEIIHRYVETMDTYFGNVCEL
FT                   DIIFNFGKAYAILDEMLMCDGAITESSKRDVLSHIHSMDTMEGSDQLERITS"
FT   gene            complement(<400002..>400904)
FT                   /locus_tag="ZYRO0E05258g"
FT                   /old_locus_tag="ZYRO-ORF3887"
FT   CDS_pept        complement(400002..400904)
FT                   /locus_tag="ZYRO0E05258g"
FT                   /old_locus_tag="ZYRO-ORF3887"
FT                   /product="ZYRO0E05258p"
FT                   /note="highly similar to uniprot|P32469 Saccharomyces
FT                   cerevisiae YLR172C DPH5 Methyltransferase required for
FT                   synthesis of diphthamide which is a modified histidine
FT                   residue of translation elongation factor 2 (Eft1p or Eft2p)
FT                   not essential for viability GFP-Dph5p fusion protein
FT                   localizes to the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30905"
FT                   /db_xref="GOA:C5E4E4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4E4"
FT                   /protein_id="CAR30905.1"
FT                   /translation="MLYLVGLGLSYKSDITLRGLEAVRKCSRVYLEHYTSILMAASQEE
FT                   LESFYGKPIILADRELVESGSDKILANADKEDVAFLVVGDPLGATTHTDLVLRAKRQNI
FT                   AVDIVHNASIMNAVGSCGLQLYQFGQTISMVFFTDNWRPDSWYDKIMENRRIGLHTLVL
FT                   LDIKVKEQSIENMARGRLIFEPPRYMSISQCCEQLLEIEEKRGTKAYTPNTPVVAVSRL
FT                   GSASQQFKAGTIEELSQYDAGEPLHSLVILGRQCHELELEYLLEFADDKEKLRADVLAD
FT                   QEYFKPAPWVPPAEEEDSE"
FT   gene            <401122..>402849
FT                   /locus_tag="ZYRO0E05280g"
FT                   /old_locus_tag="ZYRO-ORF3886"
FT   CDS_pept        401122..402849
FT                   /locus_tag="ZYRO0E05280g"
FT                   /old_locus_tag="ZYRO-ORF3886"
FT                   /product="ZYRO0E05280p"
FT                   /note="similar to gnl|GLV|KLLA0F22858g Kluyveromyces lactis
FT                   KLLA0F22858g and weakly similar to YLR173W uniprot|Q06247
FT                   Saccharomyces cerevisiae YLR173W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30906"
FT                   /db_xref="GOA:C5E4E5"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4E5"
FT                   /protein_id="CAR30906.1"
FT                   /translation="MVDSAGMEADIETQPLLGSSPSRQVLHRGRKSRRRYYTFGITSIL
FT                   VLLTLGAFVWRPILSSQVVVGNAVQVSNVEISKVHLDGWNSEGNQLQLTTNLNFWVDYE
FT                   DWIAGNQSQLSPWQKGLSRFASEKLVRTACFTLNNITNYDQNGTVAYVTVKEPICIDLR
FT                   QGQITPLQLTVLVEPRISNIFKVIKKLVLHQYDDLQISSKVDVTIGKRVAMLHIPLGRL
FT                   KNLNIKWNQMQSYLRGASEVLNRLLSMVNDVSIQDFTMKDSESGFSFDVSADPLSIPTG
FT                   FDWFGWPIDSQIPQINWQVKLPDCADECTIELPSLTCLSDAVKVEDPLKLSAFIDVKGP
FT                   LPESFLTQVCWSDDENAVTPITNFLNRLLNASQMVHIEAQGYPITNSHDNDNNFLIPPE
FT                   TLKILLEEMSFIPLAANMTLDSRDSLRRVTIDGLRIKWTAGGHRLVVAGKMVALVGLPF
FT                   YKTNGQHMAVDHIKGVIKLFHDDIQFLAVPMRVWTPSTSKILHDEKKQTVIELLLDIRD
FT                   DEVQVTNSMELTRVLNEIIVRGHAEVQVSARLDLLVSTPLGELALLGLKEQGNAIVRS"
FT   gene            complement(<404251..>405771)
FT                   /locus_tag="ZYRO0E05302g"
FT                   /old_locus_tag="ZYRO-ORF3884"
FT   CDS_pept        complement(404251..405771)
FT                   /locus_tag="ZYRO0E05302g"
FT                   /old_locus_tag="ZYRO-ORF3884"
FT                   /product="ZYRO0E05302p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30907"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4E6"
FT                   /protein_id="CAR30907.1"
FT                   /translation="MFVDYSGLQRFSSINRCFAHRFIQLLEYEDLDTLEERLKFLKSLE
FT                   KDEVCIQRLEITDFADHSDVMDYLFKLSLSVKQMQEVSEVIRRCPTTYSVEIFNANEIS
FT                   VDIGDVVAWAGMFLRNTYDSIRKALYDDIKQIIVDLKPELNNSSFQDWHLLQRYLFYGW
FT                   CEEVPKFMEPRTNIIIIPMNFPEIFVNNVNKNGFMSATSDITFYTFEVENGDYNSLANF
FT                   NIDSLVRRPIKDKISTIWKDGDEKDYIGTVWEPTKENNIHSNNISENATTQPNFLTLFH
FT                   ECDSGLEPNTIVDGADNSFYMVQHDKERRHHRKYERDSSSPASDGGSAESESNSHSDKD
FT                   GSLYDIFSPLSSNELPTALTPPNNASDSSPVQGKNYNYMANLEREEKSKDYALLPPPPS
FT                   FLPCYSDFENSSLYNQKQGFRYKLRQLFSSSSSSLHSRSKRQSSGDKSLTGFDTIGSWA
FT                   DFQSSNWDDLSTKKFFRYKMRKWKKNYQYYKEVAKQCIEDFHDNTSYN"
FT   gene            <406222..>406712
FT                   /pseudo
FT                   /locus_tag="ZYRO0E05324g"
FT                   /old_locus_tag="pseudo-Zyro0E-406222-406712"
FT   gene            <406954..>408648
FT                   /locus_tag="ZYRO0E05346g"
FT                   /old_locus_tag="ZYRO-ORF3882"
FT   CDS_pept        406954..408648
FT                   /locus_tag="ZYRO0E05346g"
FT                   /old_locus_tag="ZYRO-ORF3882"
FT                   /product="ZYRO0E05346p"
FT                   /note="similar to uniprot|Q06567 Saccharomyces cerevisiae
FT                   YLR253W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05346g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30908"
FT                   /db_xref="GOA:C5E4E7"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4E7"
FT                   /protein_id="CAR30908.1"
FT                   /translation="MMLFKRALKPLPLRRFATNSVQGKPVSKANKFKLTKTRITLGTVL
FT                   LCGTVYYNTSDTGHELLRHVFLTSKRIGIVTVATARCFYNYKKVLRGVYDSEEERNEAL
FT                   SKCHKKCALVTLNALQINGGVFIKLGQHIGAMTYLLPAEWTETMVPLQDQCPESTMEEI
FT                   KELFHQDLKTSIDEKFVEFDPKPIGVASLAQVHIARLRENGQKVAVKCQHPSLKEFVPV
FT                   DVMMTQTVFNLMDIVFPEYPLTWLGDELQSSIFVELDFTKEARNSIDTQTYFSQYRKET
FT                   ALRIPDVVSAKKRILIMEYVAGHRLDDLKYLDDNHISRAEVSACLSHIFNNMIFTPNVG
FT                   LHCDPHGGNLAIRALPSRSYLSANPHNFEIILFDHGLYRFPTTETRRYYAKFWLALLDH
FT                   DQEKVKMYAKRFANITDEQFPLFAAAITGRSIEAALNYDISKPRSNQEIKEMASGMVKG
FT                   TLFSDLMNILSRIPRIVLLILKTNDLTRNLDECLQNPLGPERSFLIMTQYCARTVYNEA
FT                   CEAINNQYKRWSLCWMWQELKAWLEYESRKNQLLLYDIALWWKHKLI"
FT   gene            complement(<408747..>409241)
FT                   /locus_tag="ZYRO0E05368g"
FT                   /old_locus_tag="ZYRO-ORF3881"
FT   CDS_pept        complement(408747..409241)
FT                   /locus_tag="ZYRO0E05368g"
FT                   /old_locus_tag="ZYRO-ORF3881"
FT                   /product="ZYRO0E05368p"
FT                   /note="similar to uniprot|Q06568 Saccharomyces cerevisiae
FT                   YLR254C NDL1 homolog of nuclear distribution factor NudE
FT                   NUDEL"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30909"
FT                   /db_xref="GOA:C5E4E8"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4E8"
FT                   /protein_id="CAR30909.1"
FT                   /translation="MDLSTALNVISTLESQLKELETMSKDYESEMEQVIDKLRRDYVEK
FT                   CDQWESQRTHVTELEIRVDELESENAFLSNKINFLEEENDRHLERNVLLEHELYDAKER
FT                   LENVDHIDRKKKLKRDSESLQVSTSGSSLLVMPRSHSTSNSNAKLNTSQVISTTSQRAK
FT                   P"
FT   gene            complement(<409482..>410519)
FT                   /locus_tag="ZYRO0E05390g"
FT                   /old_locus_tag="ZYRO-ORF3878"
FT   CDS_pept        complement(409482..410519)
FT                   /locus_tag="ZYRO0E05390g"
FT                   /old_locus_tag="ZYRO-ORF3878"
FT                   /product="ZYRO0E05390p"
FT                   /note="similar to uniprot|P53110 Saccharomyces cerevisiae
FT                   YGL159W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30910"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4E9"
FT                   /protein_id="CAR30910.1"
FT                   /translation="MNEVVITDKEVSEFFLAADRGTHLAFLQELEFALQRYSANPSIIP
FT                   PRIKAHTPSGSTVHLYMPVIDDVYSGVKTLGYNVNSNMGFVGSINVTDADSGALFGTLE
FT                   AKQVTGIRTALASCIGLYHQLTKFENTPRINCTVFGAGLQAFWHIFIVIQLFKGHCDAF
FT                   KVNILYRENPMDLEPLLKAVYSQEDAGEVVMEQFPLSDRANVQNCVSNSHVIFGCIPSE
FT                   TPNLLFKDLAVPGTEVEHTYISLIGSYQPYMHECDAETIGRFQGRGTPIIVDSKEHTPL
FT                   ESGELCDSGVYREQLVEIGELAGTTVPTLKCPNSRRSITLCKIVGLAIMDISLSKKLLE
FT                   ISTSL"
FT   gene            <410945..>414679
FT                   /locus_tag="ZYRO0E05412g"
FT                   /old_locus_tag="ZYRO-ORF3877"
FT   CDS_pept        410945..414679
FT                   /locus_tag="ZYRO0E05412g"
FT                   /old_locus_tag="ZYRO-ORF3877"
FT                   /product="ZYRO0E05412p"
FT                   /note="similar to uniprot|P12351 Saccharomyces cerevisiae
FT                   YLR256W HAP1"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05412g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30911"
FT                   /db_xref="GOA:C5E4F0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4F0"
FT                   /protein_id="CAR30911.1"
FT                   /translation="MSADVTVFNNGTSAATDPAAANKMKRKRNRIPLSCTICRKRKVKC
FT                   DKTRPNCEQCSKTGVAHLCHYMEQTWAEEAEKEISKESELKKLKNRVKALEEALVKAQA
FT                   SSYSQTPDSDTPILEDTSPLRGEPTLSGGGKHDNDELDLTRQFDMLHLRNNGIIHLGAT
FT                   HWLAIMKGDPYLKLLWGHIFTMKEKLAEWYGQKKRNPQAQMGKCPVMAPSVRSDCPVDH
FT                   RSLRKSESSVMPGKCPVDLTSLQKCPIDRSTMPRAPTESSSASKCPIDHSASTSRSSVD
FT                   HSSVSKCPVKHEETPLGSPVTKPQTSLPSFQNLTSKCPVIHDALPGIQEAISRNEPAER
FT                   NAPVDQKLDYSQTMARLCELLPPKRIICMFIEKFFKQIYPVIPILDESTFKNHMNYMLS
FT                   LGVNTETDNVKHIRMNKLADFCNLGILVIILRLTWWSLPVNGCKIDLGSHNPSFFMPHA
FT                   TTASVTQAKEEAMLANYATPAEALTLVRENLIKFDQISSVSNSNVNLTTVQFSIFYKLY
FT                   LMCWSNDSGGNGKAANSNNGDNQDNESHQVLFSSIAQMAFSCGLHRDPDNFPQLNSVPY
FT                   AQTDGSNPMSNNNGVNATGSARPHKDAVASTEKFKHTWRKTWYYIVSLDVQQSLSLGTP
FT                   RLLRNLNDFSDTKLPTASKLDYVSDIKELVIVKNTTLFFQIDLCIIAVLNHVLNVSVAR
FT                   NVKKSQLDFLISSLGDLTNNKRNICEVLNGLINNGMLHSSEGTVDNDMENIYGLPSLEE
FT                   LLSQQTAPSSENDVDKRLELAHESTTKALFFSKHLTIRMLLYLLNYVLFTHYEPLGVED
FT                   SDNASIAKSYAQETLNYAMDGYRNCLFFFTNVGHPGSSGSMFNYIEVVLAPQCLDIGHR
FT                   ALQFIVCLILRAKCGPLTGMGESAIIGNNNGSAGNSEEEDDRSNWRKKEGSVDSVDDRD
FT                   DEISLDTGERLADILLSKMILFHKMTKQLCVKYQYAQRTMKSTGFFIALLREPSQKSKR
FT                   GDGQSGDKKHPKLNKMTGLFRNLPSLILCGDGEQLKRCPVYQDAIGFVTPRTDPGINRQ
FT                   GMFGLDSARSGVQLPPLKAYKPITYVSSSVRTERGGEEAKRRRLNGGPPLSSTDIPLGS
FT                   MPAVPPITSPRSVPGAPASLPPIDKIAGDLTPGHQPNAAQFGPMDEIDGRGASTFTTPV
FT                   SEGSLSNFTPTFEDFLMENANFNGIMLNPSSIVEAVGFHNFDGVNMPLGGEPADFLPLD
FT                   SIGIDGLAEPNGVQFPNMG"
FT   gene            <414824..>416638
FT                   /locus_tag="ZYRO0E05434g"
FT                   /old_locus_tag="ZYRO-ORF3876"
FT   CDS_pept        414824..416638
FT                   /locus_tag="ZYRO0E05434g"
FT                   /old_locus_tag="ZYRO-ORF3876"
FT                   /product="ZYRO0E05434p"
FT                   /note="weakly similar to uniprot|Q05902 Saccharomyces
FT                   cerevisiae YLR299W ECM38"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30912"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4F1"
FT                   /protein_id="CAR30912.1"
FT                   /translation="MQLALLTTQNFQLLQRSPMSYNSSRRSTVHSTKGIVASTQPLASA
FT                   AGAKVLELGGNSVDACVAVAACLCVLEPPSTGIGGDCFMLHYDNNSKKVIGLNGTGRSP
FT                   ANLSRTDIIAENESLGRPDAKRMSMGSVHSVTVPGAVAGWVDAVEKCGSGKVTLSQILQ
FT                   PAIDLCEKGHPISKISSILTLNCWKKLNAVNSPELLECFAPVSQPLAPPKDGELVVNKP
FT                   LGRILRSVAENGKDAFYDGDVARGIIGEVQHRGGLLTLDDLKNHASTLVEPIHMDFLGG
FT                   RIWEIPPNSQGLVVLLALGIIKELQKSGTIDLYAMKHNSAEYLHLLIEALKLAFYDVDE
FT                   YVGDPEFGGDGNLISLWLSEYYLKKRAAMFDSHRVIDGSKTTHGVPDPNVNQSDTVYFT
FT                   ASDPEGNATSFINSVYTGFGSAIIPRTLGGFCLHNRGANFNLLEGSRNCLEGSKRPYHT
FT                   IIPALITDPETNELIYTLGNMGGFMQPTGHVQHFLNLMLFKLSPQESLDSPRICLSPHP
FT                   DHTHLDRGRGAGGPVSSPVTLVEVEEDMDPTVVEQLRHLGHAVKVVRAHDRSVFGRGQI
FT                   IKKTSAGDGFIYSAGTDKRGDGIPIPLI"
FT   gene            complement(<416737..>418317)
FT                   /locus_tag="ZYRO0E05456g"
FT                   /old_locus_tag="ZYRO-ORF3875"
FT   CDS_pept        complement(416737..418317)
FT                   /locus_tag="ZYRO0E05456g"
FT                   /old_locus_tag="ZYRO-ORF3875"
FT                   /product="ZYRO0E05456p"
FT                   /note="similar to uniprot|P53109 Saccharomyces cerevisiae
FT                   YGL160W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30913"
FT                   /db_xref="GOA:C5E4F2"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E4F2"
FT                   /protein_id="CAR30913.1"
FT                   /translation="MSSELVKRHGHTHYANIPYGYYVLIVSFFYLVFLGVLRIILKPRA
FT                   AGFNSSKRSRLAQKLYLVNPVVHLPILLVAVLLPFYRHYSISEHATVYIKRLGRLSYAL
FT                   LPLNLLLNLRPNWLLRNNYTYTDLIPLHKWLSRCIIIIAVVHGILFLINWALGESGTLA
FT                   KKIANPYNLAGVLLFAPLISMIFFSIGPMRRFSYNAFYVIHNLTGISFIFVVAFHARPS
FT                   VTIPYLLINIAILLWQGFAKFYYAKRTDILSKNTDYQNTNLVNVQLPRMALPDQFEPAC
FT                   HIRISPYSRLHPLYWLYPSHPFTVASLPSDTVVDLIISESHHPKSFKLELGAPYSVINN
FT                   FDPAVPRSCLEQAKRVAIVCGGSGISFGLPLYRYFKEIHPVEYIQFIWLVKDAYQLKIL
FT                   DKLDTIGLLDGSNDCHAFITRSVDDPNSNQETAPDLEFELESMTQDVVDENGAFVSERD
FT                   GSPTSKFKFASINLGRRIDWATDLSQFVEPALVDNTWLLTCGPSDLIESGRQYAADNSI
FT                   NFASEIYAL"
FT   gene            <418686..>418756
FT                   /locus_tag="ZYRO0E05478r"
FT                   /old_locus_tag="Zyro0E.tGly_GCC_8"
FT   tRNA            418686..418756
FT                   /locus_tag="ZYRO0E05478r"
FT                   /old_locus_tag="Zyro0E.tGly_GCC_8"
FT                   /note="tRNA-Gly (GCC) cove score=66.56"
FT   gene            <419461..>420420
FT                   /locus_tag="ZYRO0E05500g"
FT                   /old_locus_tag="ZYRO-ORF3872"
FT   CDS_pept        419461..420420
FT                   /locus_tag="ZYRO0E05500g"
FT                   /old_locus_tag="ZYRO-ORF3872"
FT                   /product="ZYRO0E05500p"
FT                   /note="weakly similar to uniprot|Q06146 Saccharomyces
FT                   cerevisiae YLR257W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05500g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30914"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4F3"
FT                   /protein_id="CAR30914.1"
FT                   /translation="MRQDNPMVAPSLVGDSVRNVDDAHSSESRDEPIDHATSSSMVLNK
FT                   IQPQSGSVDGSYTTVDELNREGALLTDEMDMDQVVNATDKVHEDPDEHRKWLKSLKKKQ
FT                   LEQSRDHSNNNNNKSNGSLTASPVHSSESKSLLGSVDLGDDQITFSPQSKSRSAIRNSY
FT                   GEFIRDESHRPHLAKGESYQSAGGTGETLPIDEKEERLGRRTARSLDTGSREYLRSLSR
FT                   SLSRDPAAHRRNQQVSTAEAGESLENARLYSTNNYSISQADLEHAPHIIQTLKEEPEES
FT                   EESHNHHKHVQTPKRSNASPSSKDTISEEHATHEARHL"
FT   gene            <420518..>423310
FT                   /locus_tag="ZYRO0E05522g"
FT                   /old_locus_tag="ZYRO-ORF3871"
FT   CDS_pept        420518..423310
FT                   /locus_tag="ZYRO0E05522g"
FT                   /old_locus_tag="ZYRO-ORF3871"
FT                   /product="ZYRO0E05522p"
FT                   /note="weakly similar to uniprot|P43597 Saccharomyces
FT                   cerevisiae YFR016C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30915"
FT                   /db_xref="GOA:C5E4F4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4F4"
FT                   /protein_id="CAR30915.1"
FT                   /translation="MKDQDAVSEAAAKRSSGRRSQVLDLDSIMVGIEEYLNNDDSDHEQ
FT                   KTDKHVDKAATDVPVNIVDGEQNEKGKNVIDLTGKDEDEDEDKGDGENRNDEKSFDDND
FT                   TLPTTQESLTQNKDHLNQFSAPSSNLSGETPISTQDHVHETTKDKDSQIPASIQGIEKG
FT                   SDAPAEKSISGDDFTQKDLHERVASAEKSITNDDNKQKDQPAQAAPAEKSMLNDDHMQK
FT                   DQHEQVASAEKSISSDDRTQKDQPAQAASAEKSIPSDEHIKKDQHAQAAPAEKSIPSDD
FT                   RKQKDQHSQAAPAEKSIPSNDHMQKDLHGKAASVEKSIPSDGSKQNDQPAQAASAEKSI
FT                   PSDDRTQKDQHEQVAPAEKSIPIDDRTQKGQHEHDDRMQNDLHAQAAPAEKSISSDDRM
FT                   QNDQHVQDALTTKVEKPVKEQLASGKTEQTAGSMEEKCARKEVTKDEPIENIDEPTKVV
FT                   EEEIKQHQKVRENSAEDSSYLKSTNNTEERTENREGSAKKNAEGDYMRKPAGSPKDLPE
FT                   THARPFGNSGMSHTKETLEKSAVQYAPQNDIGPAEEKEPAEQSNKSISKRLQGEKDESN
FT                   QSPSGPLDHQGPLTTHTNNSSRSNLTVSVGPKTDGNSDKYNDKSEQDVESDMSGQNNAD
FT                   TRLKTEEQERPEGASIVSNAHASNASNTEGSAECAVVGGDKDSKSASHIEGNEGGTVRP
FT                   HVAREISTNEEDGSDAGNLSAATDANTTDDSDLHSERHSTSLTSGSTENAEKSAGKREA
FT                   EYDNGIKDSNRNKDKLKDCQDNYEETNTIKTTEQKQHQKPPQITPPLQQEEEKQQAVSK
FT                   IDAETEAILKGLDNPQELLKELEAERRKEPVFILTSLAGGGFHIIPRTNRLATILQANR
FT                   IEFSYKDLGTDPQARNLWKAHAQGKQLPGLVRGSDVIGNWQDVEDANEEYRLEEILYSL
FT                   "
FT   gene            <424445..>426691
FT                   /locus_tag="ZYRO0E05544g"
FT                   /old_locus_tag="ZYRO-ORF3865"
FT   CDS_pept        424445..426691
FT                   /locus_tag="ZYRO0E05544g"
FT                   /old_locus_tag="ZYRO-ORF3865"
FT                   /product="ZYRO0E05544p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05544g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30916"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4F5"
FT                   /protein_id="CAR30916.1"
FT                   /translation="MSIKEIALDLTVFTLTSVNDAISFKPQLCFEVPKQDYQQLKEDYI
FT                   NFTGTSIRKNRSKLFFLPTNVSDELQKLNASVPESAKRVPNDGRVYYKNRLITELDYEN
FT                   VKRVETACAFIAYTALNSFVHFETDVKGNASGNGDHESVPMVSTVSAGTNTGSSGSSVD
FT                   IDGTSSNTVGNGGDDDDENEEVSSSESVTRALKKGNILGFRELGHLVGITPWHFHRVFK
FT                   VITGLTIREYGQLCVEFIKKNKELINACRVRVVRFKLTEHYSCLDDTHFLRDGGLQYPA
FT                   TENVVLLPDYFIDPNKSKEFKKRKSSTKPVQEEVNYGVTQRSQIRKRRSSVVYGRIQRA
FT                   SQNTITSNSLNDCLTSPTTTRRSVSFPRSDEENINYNYDYGYNYKNDGNDNVNGNNIID
FT                   SNFGNQIENDTFNNYHYSNTTTNNNFDNDTDESTSASSDWERPIQNVFPPLSMATPRPT
FT                   SPAITSRKNSIISIGSAGAAASASNNKVSKKGGNLMEAHRRNRSDGLGLNLDSLRDGSI
FT                   DHKLSMATTSAGTAVGGDNGNANTSTIEFNNNIFQNDDAEDVDFTNLDYNSSNNIFQKQ
FT                   FKLDPKYPYPSNSSDTNVDSKANSVSRSSGSAAAAAIAAFSGVNGNGNNNDSNGNSGME
FT                   GVPSMTDISLFNNSLLEQTTTPAASLLLDTDPTSASTGIQEELDVDTLLNNSSSLLDEL
FT                   VPFSSHPHHHHNHQPQRKDGIAAGELFSMPEENELFDTLNGDLLAGDALLSFEH"
FT   gene            <427628..>429745
FT                   /locus_tag="ZYRO0E05566g"
FT                   /old_locus_tag="ZYRO-ORF3861"
FT   CDS_pept        427628..429745
FT                   /locus_tag="ZYRO0E05566g"
FT                   /old_locus_tag="ZYRO-ORF3861"
FT                   /product="ZYRO0E05566p"
FT                   /note="highly similar to uniprot|P23337 Saccharomyces
FT                   cerevisiae or YLR258W uniprot|P27472 Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05566g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30917"
FT                   /db_xref="GOA:C5E4F6"
FT                   /db_xref="InterPro:IPR008631"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4F6"
FT                   /protein_id="CAR30917.1"
FT                   /translation="MGRDLQNSLVFEVATEVANRVGGIYSVLKSKAPVTVAQYGDNYTL
FT                   MGPLNNGTWQSEVEELDWTANETFTEELRPLQSVLKSMHSRGVRFVFGRWLIDGSPRVI
FT                   LFKLDSVRGFLNEWKGDLWSLVGIPSPEHDPETDDAIILGYMVAWFLGELAHLDHKHTI
FT                   VTHCHEWLASVALPLCRKRRIDVVTIFTTHATLLGRYLCAAGNIDFYNNLAHFDVDHEA
FT                   GKRGIYHRYCIERAAAHTADVFTTVSQITALEAEYLLKRKPDGILPNGLNVVKFQAVHE
FT                   FQNLHAIQKEKINEFVRGHFHGCFDFDLDNTLYFFTAGRYEYKNKGADMFIEALARLNY
FT                   RLKVSGSKKTVVAFIIMPAKNKSFTVEALKSQAAVKALENSVAEVTRSIGKRMFEYAMR
FT                   YPHMGVHSEIPQDLDELLRPSDKILLKKRVFGLRRAEGELPPVVTHNMVDDANDPILNQ
FT                   IRHVALFNHSSDPVKIIFHPEFLNQNNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAE
FT                   CTVMGVPSITTNLSGFGAYMEDLIEVDQAKDYGIYIVDRRFKAPEESVEQLVDYMEDFC
FT                   KKNRRQRINQRNRTERLSDLLDWRRMGLEYVKAKQLALRRAYPESFRQLVGEELNDLNM
FT                   ETLAGDKKIKIARPLSVPGSPRDRANSVSSAVYMTPGDLGTLQDANNADDYFSLAVDDK
FT                   EDEEDRVYYDE"
FT   gene            <430271..>431686
FT                   /locus_tag="ZYRO0E05588g"
FT                   /old_locus_tag="ZYRO-ORF3859"
FT   CDS_pept        430271..431686
FT                   /locus_tag="ZYRO0E05588g"
FT                   /old_locus_tag="ZYRO-ORF3859"
FT                   /product="ZYRO0E05588p"
FT                   /note="similar to uniprot|P22517 Saccharomyces cerevisiae
FT                   YOL016C CMK2 Calmodulin-dependent protein kinase and to
FT                   YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
FT                   CMK1 Calmodulin-dependent protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30918"
FT                   /db_xref="GOA:C5E4F7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4F7"
FT                   /protein_id="CAR30918.1"
FT                   /translation="MDSSTKDNSHHNSHSEEANHSDTQDGELVAPNHVGGNKVSKLLYK
FT                   LSGQPESYINKRDYVFGRTLGAGTFGIVRQARRYSTKQNVAVKILLKKALKGNDVQLQM
FT                   LYDELSILQKLRHPNIVRFEDWFESKDKFYIVTQLATGGELFDRIIAKGHFTEEDAVKI
FT                   VVQMLNAVEYMHSENIVHRDLKPENILYIDPSDDSPLVIADFGIAKELHNNDELIFKAA
FT                   GSLGYVAPEVLTTNGHGKPCDIWSLGVITYTLLCGYSPFVAESVEGFLEEVAKDRYPVK
FT                   FHEQYWSKISTEARRFILRALEINPQYRPTASELLCDPWITSKSNYTHDLLPHVKKQFD
FT                   ARKKFRDVVEIVKLNNRIDKLRNMYCEGSEEEEDLQGNDLSPHKSLLDSLKDLSLQQPD
FT                   RAASTPGTSSSQSHDELKSSLTQSAFAQLVKAATTNTDKVLNYKDPLAAKSEEAEAEAE
FT                   KREAAKAKSDLKK"
FT   gene            complement(<431805..>434438)
FT                   /locus_tag="ZYRO0E05610g"
FT                   /old_locus_tag="ZYRO-ORF3858"
FT   CDS_pept        complement(431805..434438)
FT                   /locus_tag="ZYRO0E05610g"
FT                   /old_locus_tag="ZYRO-ORF3858"
FT                   /product="ZYRO0E05610p"
FT                   /note="similar to uniprot|P43596 Saccharomyces cerevisiae
FT                   YFR013W IOC3 Member of a complex (Isw1a) with Isw1p that
FT                   has nucleosome-stimulated ATPase activity and represses
FT                   transcription initiation by specific positioning of a
FT                   promoter proximal dinucleosome has homology to Esc8p which
FT                   is involved in silencing"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05610g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30919"
FT                   /db_xref="GOA:C5E4F8"
FT                   /db_xref="InterPro:IPR028942"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4F8"
FT                   /protein_id="CAR30919.1"
FT                   /translation="MSESQDLSVRPEEPLSADTQENGSANVTGNASDDQPPNEKKLGQL
FT                   TFDDFENIKRVENAPNMSSHSMGLRRSKRVPQQKSKQDVADIMEQEAEAEAARKRKAQS
FT                   TAKAKARARERERERYRAKVAAMKKNEASGNTTSKKPANGPTTSSAAPENQEPPLTNDN
FT                   WSPNMPLLSSDFKTHHSVISRLKNPNMKPVLYAGDVMKVMGFVNKFYQFFDTDVLNLSF
FT                   QNFEVGLDLYPGGPVGEVIGIYDETKQRTLLYQDYLPIKDVVSSQDKMNLLFLTLLKLT
FT                   FSQSKAGELQKSHQPLTNLDQMKAQKKPFTMLVRQLRNSARTWGYPKEWRMNDIDKEEF
FT                   FQPKSKLFENDEIEESVDPKMSEILTPNIYQWHHHEPVPLEEDPLQSSELEKDGILALN
FT                   PRDRIILLRAMVDWCGSQSPRIRNEIYHLSHTKRDPAFGVQTQHAPRYLVEGSAVTYAQ
FT                   FRKLCSIVQSRYEIRSKKKHVKKQLSNGKKEDLSIKLKILEEIKQTLKDMPKEEKDQTM
FT                   INLYEKWEKLFEGELPDNPLSNPFEDEVYKLRQQEFFIGRVPHIGDFYLPRLHTYPDEG
FT                   IISTYMNVRNLKSMHDKYANGEIDSLALFEKNGQIMSTQFKVLYHDTISLIRDTAQGQP
FT                   TLGKTYWYEMCHDTKTLKEFLEFLDCKIVVGENQGKDSQPGELSENGLPSEEVKDESKD
FT                   EAKDGSKDEAQDDPKDEAKDESKDEAKDESKDESRDEKGKSGTNSILNKNPLPKESRFN
FT                   PARNKLRFLKDYLSEMYDILKVFEDLREQYGDTKPSQRLLRRSQRRNVSYGFDSDAEEA
FT                   DVDMGEEYVDEEKNVEYDDDDDAALDYEDDYQDADEEESRGTRKRGRPGRPPKQTRSVR
FT                   RNTRRR"
FT   gene            complement(<434758..>437055)
FT                   /locus_tag="ZYRO0E05632g"
FT                   /old_locus_tag="ZYRO-ORF3854"
FT   CDS_pept        complement(434758..437055)
FT                   /locus_tag="ZYRO0E05632g"
FT                   /old_locus_tag="ZYRO-ORF3854"
FT                   /product="ZYRO0E05632p"
FT                   /note="similar to uniprot|P36096 Saccharomyces cerevisiae
FT                   YKL034W TUL1 Transmembrane Ubiquitin Ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30920"
FT                   /db_xref="GOA:C5E4F9"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4F9"
FT                   /protein_id="CAR30920.1"
FT                   /translation="MEIDGNTLLIIIIILFLFFSTPGGDGVSSQYEFNQLQSFKSQLNT
FT                   EYESFEQMSYNSGFRNITGFKLSFNDVKDDPQRNATYPIPSKDYDRWFQNQDYLILPED
FT                   VTTRVKNEVWSPNMNKPEENVFPPNITSSLLGRIQLISNNKHPRIPMPVPRFYESPTEF
FT                   SDVTPPEGETYFKDWPAHSELHNVTFDTGELTIQLTHVDKVPSQLGSQKKKFFNSQTDR
FT                   WKFLNLRISLSDKSEHERHSLYTNAIYDVRRGRILAMTESAKFHSLFAFPHYMNLQNDN
FT                   DNDDEDTFDSLKKAVKEYWDKSNFVKTLTMGDLQSWYDESILKCEYMVFLQLSPWNQYT
FT                   RDQIKMIDDELNWPLGRPANLSHLPPVTVSKGILYSPDCGVELEFHDAKGERYGLKIRS
FT                   IRTHLLFGIGLFIAQIYLLLCQMHHTNTPSSVNKISVYCFSMINLVDGSLATIYFFSAS
FT                   ILPELYLPLVTSAFACFILASVFETRYLISVYASQLNERNVGISTLLRGGHSTNEDTDT
FT                   ATAVVPDESSISGSLYARFFFMLVSFTLLSMSARWWPRKVRMMFEYSAIIVLNSYWLPQ
FT                   IFRNAIKGTLPRRNRLRNQRMNEAMGVRRQNKMPLLWKFVLGTTFIRTLPVVYVFTYSS
FT                   NVFRHHRNVRFVVVLCLWLLFQIAVLYSQDILGSRWFLPKLSIPEGYSYHKAMPAQDLL
FT                   EHGSTAGYTIDCAICMSEVPIRVEEVPETHKVDEQTYMVTPCAHIFHTQCLENWMSYKL
FT                   QCPVCRSPLPPL"
FT   gene            complement(<437437..>438939)
FT                   /locus_tag="ZYRO0E05654g"
FT                   /old_locus_tag="ZYRO-ORF3853"
FT   CDS_pept        complement(437437..438939)
FT                   /locus_tag="ZYRO0E05654g"
FT                   /old_locus_tag="ZYRO-ORF3853"
FT                   /product="ZYRO0E05654p"
FT                   /note="highly similar to uniprot|P32861 Saccharomyces
FT                   cerevisiae YKL035W UGP1 UDP-glucose pyrophosphorylase or
FT                   UTP-glucose-1-phosphate uridylyltransferase EC:2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30921"
FT                   /db_xref="GOA:C5E4G0"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR016267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4G0"
FT                   /protein_id="CAR30921.1"
FT                   /translation="MSYQKKHIKTHSTYAFENNTNAVAASQMRNALNKLADSVRDDENL
FT                   RNRFENELDSFFSVFRRYLVEKSSGNTLLWEKIKSPTQEEVIDYGSLKPTHDDISNLSK
FT                   LAVLKLNGGLGTSMGCVGPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFN
FT                   TDKDTEHLIKKYSANRIRIRPFNQSRFPRVFKDSLLPVPSHYDDELDSWYPPGHGDLFE
FT                   SLHASGELDALLAQGREILFVSNGDNLGATVDFKILNHMIETGAEYIMELTDKTRADVK
FT                   GGTLISYDGQVRLLEVAQVPKEHIDEFKNIRKFKNFNTNNLWINLKAVKRLVESSSLSM
FT                   EIIPNQKTIKRGGQEINVLQLETACGAAIRYFEGAHGVVVPRTRFLPVKTCSDLLLVKS
FT                   DLFFLEHGSLKLDPSRFGPNPLIKLGSHYKKVSDFNGRIPHIPKIVELDHLTITGNVNL
FT                   GKNVTLKGTVIIVCSDGQSIDIPNGSVLENVVITGNLQILEH"
FT   gene            complement(<439616..>442816)
FT                   /locus_tag="ZYRO0E05676g"
FT                   /old_locus_tag="ZYRO-ORF3851"
FT   CDS_pept        complement(439616..442816)
FT                   /locus_tag="ZYRO0E05676g"
FT                   /old_locus_tag="ZYRO-ORF3851"
FT                   /product="ZYRO0E05676p"
FT                   /note="some similarities with uniprot|P32862 Saccharomyces
FT                   cerevisiae YKL038W RGT1 Glucose-responsive transcription
FT                   factor that regulates expression of several glucose
FT                   transporter (HXT) genes in response to glucose binds to
FT                   promoters and acts both as a transcriptional activator and
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30922"
FT                   /db_xref="GOA:C5E4G1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E4G1"
FT                   /protein_id="CAR30922.1"
FT                   /translation="MTPMSENNGSENTRDVSAAMMKSRSNSSEYAGGDGSFHASEVESQ
FT                   SSQGASGGNTSASKRRTKASRACDQCRKRKIRCDYDDDKGVCTSCRKNGESCAFERIQL
FT                   KRGPSKGAVRGHSVSRSISGENNNTAATAVGSGGEFSSPSSRQGSVLLPPLGQYLPQPA
FT                   PVPSNLNATQQQQFWKVPYHDFQGQRRGSIDSLSSDMSAKSVNIPQEHLLYASPSAGHP
FT                   PLHSPVTFGPNNSSTDSGYWPFRNSGGEESDELRRKSGSNPPSLKNVSQPPPPPLQQQQ
FT                   QQQYSYSKFNNSFAQYGANGFPSRHGSIASEGMSPSASVPYQSVPMNQSNSNGLSQQQQ
FT                   QPIQWPKVQPKNLPPPQVQVQAADKEETLGNSFQKTIKKRRTVSASSGENKAEPGEYPL
FT                   ARFSSSGNDSLLGGNLVSPAGFVYGQIPEIQLIDIYYEFIHMVFPIIPLNKETVTNEIL
FT                   LVNTQPISPIHEINNYVILWFRNSLELLIRITLKRRSGHFYDSLTHSKERELSNEIRGN
FT                   SNGGGSNDSKDDNLEMQGVFVTALNECLQKIVDIHPSFRENKDKISPKVKIIYLSTFVL
FT                   LNYILAVVGYDNSFVLGMSTTIFKDFKVYELLLYDDEDDDATKSGSNDNDNTNNDNNSN
FT                   NANNDNNDSRFYDENNAMNWDQAGYSITFKRLYVLLIIFDSLQCCSYGGPKLLNVPIEG
FT                   ASERFFQTKPHSNSKWVVDQSPTRMKFILQSVKFGELLAECSMKRRSICDLSRTQLTWE
FT                   IPPYFLKGVTDEDDELFSLAQLLAAFILIRKEFVDCLLNLQDLETGELPTVDMELCGEL
FT                   IKLLCQLTSIILQALTVMMRTNPKNHIDYNYRPMKPMEHDDSGNSASRKFTTSQAESGK
FT                   NSGNDFYHKLLGLQDNAEACLTNLLRGSISPYCISMLREIRNVMELVKKMPASLIGVVM
FT                   ACAGTHHNTANNNNNDPLAITFQSQELVVKLSNCMNDMMQITSLLNMIKPVNLSDQDSD
FT                   NTSATATITTTETISKSLNRDHSIMRRLYYSKAAKRDKKHIYPSSSSSPQLQETITTLK
FT                   SFVLIGWKLLDDFELGWS"
FT   gene            <444081..>444947
FT                   /locus_tag="ZYRO0E05698g"
FT                   /old_locus_tag="ZYRO-ORF3849"
FT   CDS_pept        444081..444947
FT                   /locus_tag="ZYRO0E05698g"
FT                   /old_locus_tag="ZYRO-ORF3849"
FT                   /product="ZYRO0E05698p"
FT                   /note="similar to uniprot|P38747 Saccharomyces cerevisiae
FT                   YHL013C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30923"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4G2"
FT                   /protein_id="CAR30923.1"
FT                   /translation="MDEILSRHRKESKDLQNRITGMKKQATKSTRKQVMAKCNDLEQEM
FT                   KQRHELEIKEFNGEMKNEDEEVTPEKLLEQLSIDNDTQKTTESTSAPTPAPTSEPKKRR
FT                   NRQKERLAKRDAEIVKMKQEAEEEASKQPDLKKIEQDSLDQLCNLNHLMPHDIKPDGHC
FT                   LFASILDQLTVRHGIKDLDIYKLRQLACNYIRSHSDDFIPYLFDENTMQLQNINEYTDE
FT                   MEKTAKWGGEIEILALSKVFDCPISILMSGRATHIINEAGEKPELKLIYYKHSYALGEH
FT                   YNSLHNA"
FT   gene            <445100..>446314
FT                   /locus_tag="ZYRO0E05720g"
FT                   /old_locus_tag="ZYRO-ORF3846"
FT   CDS_pept        445100..446314
FT                   /locus_tag="ZYRO0E05720g"
FT                   /old_locus_tag="ZYRO-ORF3846"
FT                   /product="ZYRO0E05720p"
FT                   /note="highly similar to uniprot|P38746 Saccharomyces
FT                   cerevisiae YHL014C YLF2 Protein of unknown function, has
FT                   weak similarity to E. coli GTP-binding protein gtp1"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30924"
FT                   /db_xref="GOA:C5E4G3"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4G3"
FT                   /protein_id="CAR30924.1"
FT                   /translation="MSIARKVLLGRPSNNLTTGIVGLANVGKSTFFQAVTDSKLGNPAN
FT                   YPFATIKPEEAKVQIPSNRLSHLAKLYQSAKCVPATLTMYDIAGLIRGASSGEGLGSAF
FT                   LNDIRHVDGIYQVVRGFVKEEITHIEGSVDPVRDLSVVQDELILKDVEFLEGIREKIGR
FT                   KMGRTAKTSMEYRDLSVELELMNSLEEHLYEGRKIIHFKDDWTPQEVSILNRHNFLTAK
FT                   PSLVLLNVSAKDYILGQNQFVKPVKDWLNAYSPGDELVLFSAEFESAYNELGSNAQDLL
FT                   KHAETTWGLSQRQLPNSALPQILLKMRELLHLISFFTCGPAESRQWTIREGTTAPEAAG
FT                   VIHTDLQKTFINASVIKYEDLAQLEPPLQESILKSQAKIKRAGKQYEVEDGDVVLFKAA
FT                   GGKAR"
FT   gene            complement(<446357..>446466)
FT                   /gene="SNR69"
FT                   /locus_tag="ZYRO0E05742r"
FT                   /old_locus_tag="Zyro0E_snoRNA_189"
FT   ncRNA           complement(446357..446466)
FT                   /gene="SNR69"
FT                   /locus_tag="ZYRO0E05742r"
FT                   /old_locus_tag="Zyro0E_snoRNA_189"
FT                   /product="snR69"
FT                   /note="C/D snoRNA monocistronic SNR69"
FT                   /ncRNA_class="snoRNA"
FT   gene            complement(<446910..>447269)
FT                   /locus_tag="ZYRO0E05764g"
FT                   /old_locus_tag="ZYRO-ORF3843"
FT   CDS_pept        complement(446910..447269)
FT                   /locus_tag="ZYRO0E05764g"
FT                   /old_locus_tag="ZYRO-ORF3843"
FT                   /product="ZYRO0E05764p"
FT                   /note="highly similar to uniprot|P38701 Saccharomyces
FT                   cerevisiae YHL015W RPS20"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05764g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30925"
FT                   /db_xref="GOA:C5E4G4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4G4"
FT                   /protein_id="CAR30925.1"
FT                   /translation="MSEFEKGKVQEQEQPQIIKIRITLTSTKVKQLENVSANIVRNAEQ
FT                   YKLTKKGPVRLPTKVLKICTRKAPNGEGSKTWDTYEMRIHKRYIDLEAPISVVKKITQI
FT                   TIEPGVDVEVEVAKN"
FT   gene            <447852..>449156
FT                   /locus_tag="ZYRO0E05786g"
FT                   /old_locus_tag="ZYRO-ORF3841"
FT   CDS_pept        447852..449156
FT                   /locus_tag="ZYRO0E05786g"
FT                   /old_locus_tag="ZYRO-ORF3841"
FT                   /product="ZYRO0E05786p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05786g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30926"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4G5"
FT                   /protein_id="CAR30926.1"
FT                   /translation="MTVPKPAEFFKTIRSVRDTTGPVYQLIKNQGEGNYYKLDESKMDQ
FT                   VTEYLCKIIARDYGDNYNSIPPHGRWQHLNAGGHLRVEQLIDQWRAAKTDEVEISRRLI
FT                   DLLVVSVLVDAGAGNLWKYIVGESESYSRSEGLAVASYYLFVDGEFSSDSNTKFQVNGQ
FT                   KLKDFTMDQFVKGFQVSDANPLNGAEGRLQLIQKLGDSLLTHPEIFGSDARPGGIVDFL
FT                   KKEASTGNCIDLNDIWNALMDGFVTIWPQGRATIQGQPLGDSWSLDTKSKTEKKWDDEF
FT                   LDSLVTFHKLTQWLCYSLLVPLEKFGHKFQVSNKELQTGLPEYRNGGLFYDFGVIALKP
FT                   EHLKRGLALSDKLGVKEPIPTFTAEDGAIVEWRCLTIGLLDELHALVNKRLNTNLALPQ
FT                   VIEAGSWKAGREIAAEKRPLTKGPPIELQSDGTVF"
FT   gene            complement(<449379..>450941)
FT                   /locus_tag="ZYRO0E05808g"
FT                   /old_locus_tag="ZYRO-ORF3840"
FT   CDS_pept        complement(449379..450941)
FT                   /locus_tag="ZYRO0E05808g"
FT                   /old_locus_tag="ZYRO-ORF3840"
FT                   /product="ZYRO0E05808p"
FT                   /note="similar to uniprot|P32857 Saccharomyces cerevisiae
FT                   YKL039W PTM1 Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30927"
FT                   /db_xref="GOA:C5E4G6"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4G6"
FT                   /protein_id="CAR30927.1"
FT                   /translation="MKDFAGFRMSVAKILLTFGFLLNLCVANKMTMDQDDIQVCSGMYS
FT                   KQDHGGKTDPFISFNMKKLTNGDPGVVVAIFDFQDYEHLGVEVSEGVHHYICDDYAISK
FT                   GYCKEDKKDQFIVQDVAYDPYTGANKTLANKVMSFSQNAAGLHDKKYPVTKTGYYCVLG
FT                   FSKSDSTKYQAVVNFRNAYGHLAASEINKLPLYGLLAIGYVVAMALYSFAFWRHKHELL
FT                   PLQKYLLAFFVFLTAEAIFVWAYYNIQNEKGDTAGIKVYMVFLSILTAAKVTFSFFLLL
FT                   LIALGYGIVYPKLNKTLMRRCQLFAVLNFALSVAFLIQSYLEDPESTSLMILITLVPVS
FT                   ITMFAFYFMILKSMTNTVRYLRDQRQVVKLGMYKKLMTIIYASLLIILAGLVISSFVFL
FT                   GMNTIEMIEQHWRTRFFFTDFWPTLVYFGVFVIFAFIWRPTDTSYMLACSQQLPTDPEN
FT                   VADFDLDDLQSMGELDNEFDDTIRDEDINFTDEEEHQPQHEEVHHDDDTHNKDGNINPP
FT                   KSA"
FT   gene            <451608..>452372
FT                   /locus_tag="ZYRO0E05830g"
FT                   /old_locus_tag="ZYRO-ORF3837"
FT   CDS_pept        451608..452372
FT                   /locus_tag="ZYRO0E05830g"
FT                   /old_locus_tag="ZYRO-ORF3837"
FT                   /product="ZYRO0E05830p"
FT                   /note="similar to uniprot|P32860 Saccharomyces cerevisiae
FT                   YKL040C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30928"
FT                   /db_xref="GOA:C5E4G7"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4G7"
FT                   /protein_id="CAR30928.1"
FT                   /translation="MFRFAGFNVSKCLRPNMVSMPRRFIAIKTMTTPNENALKFISTDG
FT                   EMLQDKGSSSLEIKNSDESLIEHSNLAQRIFLQCPGVESLMIGDDFLTVNKDSMVHWNQ
FT                   IKPGVIELLTSQLASGEDVVSDEFHTIRDSDAGYEVTAPKFELSEEDEEVSDMIDELIQ
FT                   TRIRPAIQDDGGDIQYRAYDPKTGTVYLKLQGACKSCSSSEDTLKAGIEGMLKHYVDEV
FT                   TNVVQMLDPEEEIALREFDKMEQRIQQKNAEQ"
FT   gene            complement(<452408..>452737)
FT                   /locus_tag="ZYRO0E05852g"
FT                   /old_locus_tag="ZYRO-ORF3836"
FT   CDS_pept        complement(452408..452737)
FT                   /locus_tag="ZYRO0E05852g"
FT                   /old_locus_tag="ZYRO-ORF3836"
FT                   /product="ZYRO0E05852p"
FT                   /note="similar to uniprot|P38744 Saccharomyces cerevisiae
FT                   YHL018W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30929"
FT                   /db_xref="GOA:C5E4G8"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4G8"
FT                   /protein_id="CAR30929.1"
FT                   /translation="MYNKIVRTAPIVVEGANLVEKLVLLPRWKVLQNQLVREVQFKDYE
FT                   TTWAFLTHVSMRSHLWGHHPTITTNYNYVKLQLCTHELEEKVSDIDLKLAKRFEQYIET
FT                   YKQEE"
FT   gene            <452910..>454559
FT                   /locus_tag="ZYRO0E05874g"
FT                   /old_locus_tag="ZYRO-ORF3835"
FT   CDS_pept        452910..454559
FT                   /locus_tag="ZYRO0E05874g"
FT                   /old_locus_tag="ZYRO-ORF3835"
FT                   /product="ZYRO0E05874p"
FT                   /note="similar to uniprot|P38700 Saccharomyces cerevisiae
FT                   YHL019C APM2 homologous to the medium chain of mammalian
FT                   clathrin-associated protein complex Similar to clathrin
FT                   coat proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30930"
FT                   /db_xref="GOA:C5E4G9"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR027200"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4G9"
FT                   /protein_id="CAR30930.1"
FT                   /translation="MSSCLYILDENLEPLISKNIKSIPNLNTLVEVFQEVYSSNAPPIV
FT                   FNRNWYFIHTKRDSLIFLSAIHGTDDSANAMMITVYMDQFYLLLKKYLGVAQLDRNLVL
FT                   DNVLLVLELLEESSEFGVPQMTEPSVMKDYIRIKVNKSETPIENSDRDDDDKEGDTTDS
FT                   DDDTVQQGLEREAQEKKKPKLPKSKSLYDFFQKTSKTAFSKKDKDGIQEGEDSEEEPDL
FT                   YINSYLVKTTTMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCK
FT                   SYLSGMPKLKIALNKLLQRDAQFMSHSKFHQCVALETLNEKELEFIPPDGEFILCEYEL
FT                   KRHVNDTPILKITSFEIKPQLKKFKLRILLTIETHFKTRNSTSILNVKIPLAKLFADYN
FT                   IDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSLFNKEEFEREQ
FT                   EERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEIPYTTCSGLKV
FT                   EYLKIEEEQLQYQSFPWVRYKTISDEEYAYLT"
FT   gene            complement(<454640..>456052)
FT                   /locus_tag="ZYRO0E05896g"
FT                   /old_locus_tag="ZYRO-ORF3833"
FT   CDS_pept        complement(454640..456052)
FT                   /locus_tag="ZYRO0E05896g"
FT                   /old_locus_tag="ZYRO-ORF3833"
FT                   /product="ZYRO0E05896p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05896g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30931"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4H0"
FT                   /protein_id="CAR30931.1"
FT                   /translation="MWPQLVFRRFGSQWVRLSQCYQKLPPKLSLVLQGYNSKKIRCGLV
FT                   LPSNNGGLQGGSAFLSALLADVYSPDQTWFHVWRQRYLQYNSPSTVLVKYGNVFDKQSG
FT                   KLGGADVTTFSVPSPFLQKHDVEFLEVQSTNLLDDDGCHFYINLQQNVTNTSALYDWPT
FT                   VNLKLNPNIRELPLPIENQLDPQWALGATCNFINDKKTVDGYLDAMQRSNFASVKKQLE
FT                   SKLQDVDGIFRDLQASVLENIARRENLHDQHRKLVNDKREISMKIQRWSESAHAELQSS
FT                   VLPKLQEFVKNQLSIWKVYGYSESKLQLKLINMITGPLHNLQMVNSLNRLKGELQIDDM
FT                   DSKNLVDTGEINHRATSLHKDINKIVYQNFLLLQLPLILVATLGVVSGECSSFSMGALA
FT                   SFGIVLGFSRVLAIWQSLLDSYVKRIRETLSSNIENEKVGLINEYQTSFATKEKDFETK
FT                   YEIFRSLASFTD"
FT   gene            <456481..>457740
FT                   /locus_tag="ZYRO0E05918g"
FT                   /old_locus_tag="ZYRO-ORF3832"
FT   CDS_pept        456481..457740
FT                   /locus_tag="ZYRO0E05918g"
FT                   /old_locus_tag="ZYRO-ORF3832"
FT                   /product="ZYRO0E05918p"
FT                   /note="weakly similar to uniprot|P21957 Saccharomyces
FT                   cerevisiae YHL020C OPI1 Transcriptional regulator of a
FT                   variety of genes phosphorylation by protein kinase A
FT                   stimulates Opi1p function in negative regulation of
FT                   phospholipid biosynthetic genes"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30932"
FT                   /db_xref="GOA:C5E4H1"
FT                   /db_xref="InterPro:IPR013927"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4H1"
FT                   /protein_id="CAR30932.1"
FT                   /translation="MVMSLTEHAGLSEEDVRAAEVLDVLRNSHGSPPSQSFELRDQEIQ
FT                   DHQEHQQVKQDLQVPTLLDRVRRNSIINNVVSLYEMNTRKRSAPPNANVAGGLGSLAPA
FT                   VGSSGNSLEDSNALEDEAENSNDDDDDDYYGYEDDEDIQAVSKRQKISEAIAKSRGNLK
FT                   EYQLNMSIGSKKRLIACLHLLKLANKQLTQKVAYLQEQVESEKSNEVSVDDGLGERAQE
FT                   EEEDDDDDDDDEEYFDASESIDDDKSTVIKMEVVGTVKKVYSLISKFAGNSLPEPARTQ
FT                   VRQTLLNLPTNWSLSANNSSSSSRRAKSQRKPLTTNGKVLILAEESLSVVRNVMNVVDS
FT                   SLGKAEEWVKQKQELKEILKERFIQQQWKKQVRNQLTKEKEEEERSGATNASNAQIEAD
FT                   DENYEQDENKVKDELKVNES"
FT   gene            complement(<457871..>458569)
FT                   /locus_tag="ZYRO0E05940g"
FT                   /old_locus_tag="ZYRO-ORF3831"
FT   CDS_pept        complement(457871..458569)
FT                   /locus_tag="ZYRO0E05940g"
FT                   /old_locus_tag="ZYRO-ORF3831"
FT                   /product="ZYRO0E05940p"
FT                   /note="highly similar to uniprot|P36095 Saccharomyces
FT                   cerevisiae YKL041W VPS24 involved in secretion"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05940g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30933"
FT                   /db_xref="GOA:C5E4H2"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4H2"
FT                   /protein_id="CAR30933.1"
FT                   /translation="MDYVRKAIWGPDPKEQNRKIKMTLRRNGRSIDKSLRDLSILQTKT
FT                   QQLIKKSAKKNDVKTVKLYARELYQINKQYDRMYTSKAQLDSVGMKIEEAFRMRILSNQ
FT                   MADSAGLMREVNSLVKLPQLQSTMVELEKELMKAGIISEMVDDTTEVVQQEGDGEMDEE
FT                   IDEEVNKIVEQYTSNKFDKVDNAPQTELPTTTDSTKQEEQEREIPENQIDEEADNMLND
FT                   MKERLRALQN"
FT   gene            <458785..>458856
FT                   /locus_tag="ZYRO0E05962r"
FT                   /old_locus_tag="Zyro0E.tGlu_TTC_9"
FT   tRNA            458785..458856
FT                   /locus_tag="ZYRO0E05962r"
FT                   /old_locus_tag="Zyro0E.tGlu_TTC_9"
FT                   /note="tRNA-Glu (TTC) cove score=60.23"
FT   gene            <459338..>463159
FT                   /locus_tag="ZYRO0E05984g"
FT                   /old_locus_tag="ZYRO-ORF3829"
FT   CDS_pept        459338..463159
FT                   /locus_tag="ZYRO0E05984g"
FT                   /old_locus_tag="ZYRO-ORF3829"
FT                   /product="ZYRO0E05984p"
FT                   /note="similar to uniprot|Q03690 Saccharomyces cerevisiae
FT                   YMR012W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E05984g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30934"
FT                   /db_xref="GOA:C5E4H3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025697"
FT                   /db_xref="InterPro:IPR028275"
FT                   /db_xref="InterPro:IPR033646"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4H3"
FT                   /protein_id="CAR30934.1"
FT                   /translation="MSADEKGATNATNSEIKLLIKLPFKSGPTAHSKKTQVNQENELQL
FT                   LFTREGKIQNVIDVLGVVYTTKFLTNIDLEANGRVLSPLENLSDVVGNDEAETFKLKLL
FT                   YKPYNAREVLKHLLATREYLGFTPETTDGLSDFAVSVGSKFPEIPFKEIKQRTESEHKD
FT                   EKNEGKKENVEPEISAEEKQEFVKLVHEIFEEFNSEPNKNSYFTGNSIITPCLRSLYLS
FT                   HYNPVPAFYRARGHLMYLKAVTLEGEVFHITAVPSGFYLNKSSETKFDPFPREAENDDH
FT                   YVKPSLHQLIGMHSKKFFSHIENFEKKISKLDSAAYLKPTTTFLHKPWLISSLPVETGD
FT                   YLRLQENSYNFDTERNFNDEFQAVRELASDSLHERVEAERLLIRISHEFSAAASKTAMS
FT                   ILHGDLVAMNPESPLEEQIFLKDNIFYSFVTDVSGNFTGKGGDAAAFAAANQDLRTTNL
FT                   LNRLNLRDVRYLLATIVDFAGKRILAQTPVPGLLNTMGTRIVEDPETGKEVIEDLPNEV
FT                   VVNYGYDEAEGKVVSNEEFDESVRKEFSRTFHLKTHEVDGAQVSFSSQSKGIIGFDKRK
FT                   YILDLANTYPLDINFVRANFDSVEESKRYPHRQTLLRPELIEKWWQEKLTKAGVEYKEA
FT                   YERNMFSYNPDAYQIPGIEDPVIDEISDYLEKTVLQSVVEDYASTNAMAPYDGAHVVDN
FT                   LHINGINVRYLGKLIELAKNTLSQQTADYENNLVKIQEGNKDHQEWEKGYLIKIEKMLK
FT                   ERQEKINKYIEANKEVPKELTGELKLNDEEIRKPTKETPAIIAKDYLLPLISAAESEIV
FT                   ARSLKHVLRSYSKPLPVALLPSFVAYVFNLFFGVEYNDKPVPEEVDEFYPVKNYEFSKL
FT                   TRASLLEAIEEQAYLRFRYELPGNWFEAHTKVPFALIRSVCYGFGIQLINKEYFFNKEQ
FT                   FSAYQNSLDKKMRNKVVAPKYTFSSSDLLVIPRVKTTNYGSSVGDELWAEGAAVLDKDQ
FT                   GLALTFLSQAIAVKEDVSTALDRSVAEKYLALSTIYSSVGLVPEAVAFARKASVIYERV
FT                   TGLDSFELLRSLSNLALMEYSNRSPYNAALVYKRIMEIVKPFDLTSKHHPVIISALNYL
FT                   EEFAVTLKDSRLAIEILNKLCTLVAKLDGENSLASGYLESRIGNLYATLDDMPHALDHI
FT                   ARTNGIFIKELGLNHEVTAQARQWTEGLTNLIKNNQFKQKVLEQKARANNGATPQNRKN
FT                   VDEKQVQPNPGLANKSVDELLNFIEGSEGADTKQSKNKKKSKGKGGKK"
FT   gene            complement(<463341..>464882)
FT                   /locus_tag="ZYRO0E06006g"
FT                   /old_locus_tag="ZYRO-ORF3827"
FT   CDS_pept        complement(463341..464882)
FT                   /locus_tag="ZYRO0E06006g"
FT                   /old_locus_tag="ZYRO-ORF3827"
FT                   /product="ZYRO0E06006p"
FT                   /note="similar to uniprot|P20048 Saccharomyces cerevisiae
FT                   YMR013C SEC59 Membrane protein that catalyzes the CTP-
FT                   mediated phosphorylation of dolichol the terminal step in
FT                   dolichyl monophosphate (Dol-P) biosynthesis required for
FT                   viability normal rates of lipid intermediate synthesis and
FT                   protein N-glycosylation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30935"
FT                   /db_xref="GOA:C5E4H4"
FT                   /db_xref="InterPro:IPR032974"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4H4"
FT                   /protein_id="CAR30935.1"
FT                   /translation="MSRLGASTASSNSAAGEQVTQRQNKDSTITENKKDEGEYSFIDAT
FT                   LKPERILQIGILGLITHLSYDKYYNMDFEHMEIMQMGLIAAAAVFVGIYSSFKSSKGNS
FT                   SVLPEFNTIYLIFIPFMMSLLFDQQNAAANIALVTNCLQMSPFYGIPMQMIFIAFHTVD
FT                   TTIEEKYGYLGAVPINYFIYRTLAKVSCLKSLDKIDCNLFSILLTNVLYLNTSQSLYFL
FT                   VLKKTLTAFVIVVMVNSAISFLTRDMSNGVIRSMILFSVFLVGFPLGVEKLLVIDDNDP
FT                   LGWLINYIAVSKLRQTILFTWLGSLLFLIPNILTFKSSFTLNTSRKVWHFLILVLISHP
FT                   FRLDPEFVKISLSGTIVLFLCVEYLRYLKLEPFGEFLDSRLRSFADFRDDKGPLIISYI
FT                   YLIIGIATPLLISDSPVGLIGLGVGDSLASIVGGKWGKTSWPGTGKTIEGTGAFIAGTS
FT                   FVSLIFKQYLGYFKGISSLNLILICGLSGVLEGNSFLNDNILIPAFMLVAEQVLS"
FT   gene            <465700..>465778
FT                   /gene="SNR78"
FT                   /locus_tag="ZYRO0E06028r"
FT                   /old_locus_tag="Zyro0E_snoRNA_199"
FT   ncRNA           465700..465778
FT                   /gene="SNR78"
FT                   /locus_tag="ZYRO0E06028r"
FT                   /old_locus_tag="Zyro0E_snoRNA_199"
FT                   /product="snR78"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR78"
FT                   /ncRNA_class="snoRNA"
FT   gene            <465866..>465950
FT                   /gene="SNR77"
FT                   /locus_tag="ZYRO0E06050r"
FT                   /old_locus_tag="Zyro0E_snoRNA_198"
FT   ncRNA           465866..465950
FT                   /gene="SNR77"
FT                   /locus_tag="ZYRO0E06050r"
FT                   /old_locus_tag="Zyro0E_snoRNA_198"
FT                   /product="snR77"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR77"
FT                   /ncRNA_class="snoRNA"
FT   gene            <466027..>466126
FT                   /gene="SNR76"
FT                   /locus_tag="ZYRO0E06072r"
FT                   /old_locus_tag="Zyro0E_snoRNA_197"
FT   ncRNA           466027..466126
FT                   /gene="SNR76"
FT                   /locus_tag="ZYRO0E06072r"
FT                   /old_locus_tag="Zyro0E_snoRNA_197"
FT                   /product="snR76"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR76"
FT                   /ncRNA_class="snoRNA"
FT   gene            <466209..>466300
FT                   /gene="SNR75"
FT                   /locus_tag="ZYRO0E06094r"
FT                   /old_locus_tag="Zyro0E_snoRNA_196"
FT   ncRNA           466209..466300
FT                   /gene="SNR75"
FT                   /locus_tag="ZYRO0E06094r"
FT                   /old_locus_tag="Zyro0E_snoRNA_196"
FT                   /product="snR75"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR75"
FT                   /ncRNA_class="snoRNA"
FT   gene            <466361..>466450
FT                   /gene="SNR74"
FT                   /locus_tag="ZYRO0E06116r"
FT                   /old_locus_tag="Zyro0E_snoRNA_195"
FT   ncRNA           466361..466450
FT                   /gene="SNR74"
FT                   /locus_tag="ZYRO0E06116r"
FT                   /old_locus_tag="Zyro0E_snoRNA_195"
FT                   /product="snR74"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR74"
FT                   /ncRNA_class="snoRNA"
FT   gene            <466515..>466615
FT                   /gene="SNR73"
FT                   /locus_tag="ZYRO0E06138r"
FT                   /old_locus_tag="Zyro0E_snoRNA_194"
FT   ncRNA           466515..466615
FT                   /gene="SNR73"
FT                   /locus_tag="ZYRO0E06138r"
FT                   /old_locus_tag="Zyro0E_snoRNA_194"
FT                   /product="snR73"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR73"
FT                   /ncRNA_class="snoRNA"
FT   gene            <466716..>466804
FT                   /gene="SNR72"
FT                   /locus_tag="ZYRO0E06160r"
FT                   /old_locus_tag="Zyro0E_snoRNA_193"
FT   ncRNA           466716..466804
FT                   /gene="SNR72"
FT                   /locus_tag="ZYRO0E06160r"
FT                   /old_locus_tag="Zyro0E_snoRNA_193"
FT                   /product="snR72"
FT                   /note="C/D snoRNA polycistronic Cluster 1 SNR72"
FT                   /ncRNA_class="snoRNA"
FT   gene            <466974..>468458
FT                   /locus_tag="ZYRO0E06182g"
FT                   /old_locus_tag="ZYRO-ORF3824"
FT   CDS_pept        466974..468458
FT                   /locus_tag="ZYRO0E06182g"
FT                   /old_locus_tag="ZYRO-ORF3824"
FT                   /product="ZYRO0E06182p"
FT                   /note="weakly similar to uniprot|Q04347 Saccharomyces
FT                   cerevisiae YMR014W BUD22 Protein involved in bud-site
FT                   selection diploid mutants display a random budding pattern
FT                   instead of the wild-type bipolar pattern"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06182g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30936"
FT                   /db_xref="GOA:C5E4H5"
FT                   /db_xref="InterPro:IPR015158"
FT                   /db_xref="InterPro:IPR037393"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4H5"
FT                   /protein_id="CAR30936.1"
FT                   /translation="MPKDNLIFKLDNLEYQYNYLNGTLENFQPRLNGTSKAYNAKGKKS
FT                   SKRISKLLEEIKIGEVEKQLNELCTDIFQKKTFHLDGKLRQFIEKQLSQYKPSKKSKND
FT                   FTPVIKDIREKYGLEKFSELISKSKVIKLSLSKINPTREPPKWFTEHEFWKIHNDKNNE
FT                   YNPSKIWNEVVMKTEGCNQLLSSLMNNNKCKELIAGFNSGMDVFLNINKGKKDKSKEDK
FT                   VSQSEKETQKTQKEGDNQESPDEKEEQDDDGDESDESSESQLQDEGENGELDEEVLKQY
FT                   DDMLAASDEEDNEGLQLDPNINYNEVTDEEPSDDEKESEDEDEDENEDEDEDDGEPETK
FT                   KPKYQLPELMGGYYSGGDSSDDDLKNDRIAQEQMSNKGQRKNRRGQRARRKIWEQKFGE
FT                   KANHVVKERNVYFEKKRKKQQEFEEREAKRAAKAAKASEFEKKASQEYEKGAARKTESK
FT                   PKNETPAAEHPSWIAKREAEAKLKNAKFEGKKVVFD"
FT   gene            complement(<468599..>470212)
FT                   /locus_tag="ZYRO0E06204g"
FT                   /old_locus_tag="ZYRO-ORF3822"
FT   CDS_pept        complement(468599..470212)
FT                   /locus_tag="ZYRO0E06204g"
FT                   /old_locus_tag="ZYRO-ORF3822"
FT                   /product="ZYRO0E06204p"
FT                   /note="highly similar to uniprot|P54781 Saccharomyces
FT                   cerevisiae YMR015C ERG5 C-22 sterol desaturase a cytochrome
FT                   P450 enzyme that catalyzes the formation of the C-22(23)
FT                   double bond in the sterol side chain in ergosterol
FT                   biosynthesis may be a target of azole antifungal drugs"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06204g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30937"
FT                   /db_xref="GOA:C5E4H6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4H6"
FT                   /protein_id="CAR30937.1"
FT                   /translation="MAEVTVDKAMDTVAGFQNSTVQPLLANNGHTVASILEVVKSLSYW
FT                   KIFVTFLCVLIVWDQISYQTKKGSCAGPKWKWYPIIGPFLESLDPKFEEYKAKWYSGEL
FT                   SCVSIFHKFVVIASTRDLARKIMQSPKYVKPCVVDVAVKILRPNNWVFLDGKAHVDYRK
FT                   SLNGLFTKQALEQYLPGLEVLIDKYIGKFVQLSKDNNNKPQVFFHEMREILCALSLSAF
FT                   CGEYITEDQVRKIADDYYLVTAALELVNFPIILPYTKTWYGKRTADAAMKIFEECAQMA
FT                   KDHIAAGGKPICVMDAWAKLMHDAKNKNDSDSKLYHREFTNKEMSEAVFTFLFASQDAS
FT                   SSLACWLFQIVADRPDVLAKVREEQLAVRNGDVNMKVTLPLIEKMDYTTMVIKETLRYR
FT                   PPVLMVPYVVKQNFQVRENYTAPKGTMLIPTLYPALHDPEVYENPDEFVPERWVEGSKA
FT                   SEAKKNWLVFGCGPHVCLGQTYVMMTFCALLGKFALFTDFEHSVTPLSEKIKVFATIFP
FT                   KDDLLMTFKKRDPLTGKIYE"
FT   gene            complement(<470767..>471888)
FT                   /locus_tag="ZYRO0E06226g"
FT                   /old_locus_tag="ZYRO-ORF3821"
FT   CDS_pept        complement(470767..471888)
FT                   /locus_tag="ZYRO0E06226g"
FT                   /old_locus_tag="ZYRO-ORF3821"
FT                   /product="ZYRO0E06226p"
FT                   /note="similar to uniprot|Q75DH2 Ashbya gossypii ABR054C
FT                   ABR054Cp and weakly similar to YKL042W uniprot|P36094
FT                   Saccharomyces cerevisiae YKL042W SPC42 Central plaque
FT                   component of spindle pole body (SPB) involved in SPB
FT                   duplication may facilitate attachment of the SPB to the
FT                   nuclear membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30938"
FT                   /db_xref="GOA:C5E4H7"
FT                   /db_xref="InterPro:IPR021611"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E4H7"
FT                   /protein_id="CAR30938.1"
FT                   /translation="MNISPTPRRYNSRNGGIDFNDENYLAFSDPVNRDANGNGIGRERI
FT                   VPEEYKLNSRMINRLIRQNKELMNKLDGKQEEIDRLNVLVGSLRGKLIKYTELNKKLED
FT                   RQNVSRSSSGGSNGMETDSNYIQLPKRRNNKDLDKDTDPRLSKDDRISVLSEKLDMLTK
FT                   IMMESRNSSLASPPPQQQQTANIPTPASAPTAATSSTSPLPPNTSTSVWQRPSEEDIMC
FT                   RESMELKQLEDQIESLKRKLLIKRENELRKISLSQELLELMGKLSMEQAQVQQGAAGST
FT                   ATTVPPRTSTAVPSAEQHVSSSSPEFCMECHHTKTHPLHQHHDHNHILRNDLNSRRPTV
FT                   PAINPLETPTPFAKRASLAASTGDLTDTINRVW"
FT   gene            complement(<472430..>474043)
FT                   /locus_tag="ZYRO0E06248g"
FT                   /old_locus_tag="ZYRO-ORF3819"
FT   CDS_pept        complement(472430..474043)
FT                   /locus_tag="ZYRO0E06248g"
FT                   /old_locus_tag="ZYRO-ORF3819"
FT                   /product="ZYRO0E06248p"
FT                   /note="some similarities with uniprot|P53438 Saccharomyces
FT                   cerevisiae YMR016C SOK2 Protein that can when overexpressed
FT                   suppress mutants of cAMP-dependent protein kinase displays
FT                   homologies to several transcription factors"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06248g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30939"
FT                   /db_xref="GOA:C5E4H8"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4H8"
FT                   /protein_id="CAR30939.1"
FT                   /translation="MSMNPPPYPFVVGQQPQYQPQYQQQQEPQEQQPQQPMQQPLSYHQ
FT                   LPQLAIPAPPPGLQFQPYQTFAPQAPMLTSPSSTVHTLPHPYHYPGFQYQQQAQQIPQS
FT                   ISPLPPQSTSPKSLSQLPLRQFTSTPIVPLQQHHDDRSSKTPSTSGSSAILSPYNVSSA
FT                   GSMAQIAKKPIERPIEKPKFSTTTTTTPSAPATTSEPLVHSYDVANIRGGSIISYDSNG
FT                   HVTKPRVTTTMWEDEKTLCYQVEANGVSVVRRADNDMINGTKLLNVAKITRGRRDGILK
FT                   AERIRHVVKIGSMHLKGVWIPFERAQVMAEREKIADYLYPLFVKDIQSVLKETSNHEDE
FT                   RMSRINSPPNDPMSSLNPPSQGPMSLHPPNTYDPWYSTRNIPQPTPTTTTILPQPAQFG
FT                   LPTQSRTTPPFAIQYTPAHTTIRPHPNTPNFDYSTNSSTPNPNSRLIFNQNLAPPLTSV
FT                   TPTPSDTSTTTAPSLTSIRPLSVTPTASDARQQQNVMGFVPAPQPQQLHQSSSQLLRST
FT                   SGKSDTTDRSTSDSDGSKND"
FT   gene            <475960..>478698
FT                   /locus_tag="ZYRO0E06270g"
FT                   /old_locus_tag="ZYRO-ORF3816"
FT   CDS_pept        475960..478698
FT                   /locus_tag="ZYRO0E06270g"
FT                   /old_locus_tag="ZYRO-ORF3816"
FT                   /product="ZYRO0E06270p"
FT                   /note="weakly similar to uniprot|P50104 Saccharomyces
FT                   cerevisiae YMR019W STB4 Protein that binds Sin3p in a two-
FT                   hybrid assay"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30940"
FT                   /db_xref="GOA:C5E4H9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4H9"
FT                   /protein_id="CAR30940.1"
FT                   /translation="MVQEEIRRNRLRVRKACEICKRRKVKCDGSQPCANCVKHGQECKY
FT                   ISGTVRRRYRRDIGNSSGASILIPSRLTPSSSTALNFNGSVNGGGSEILGNNNGVGDSD
FT                   RMASLLLQLGGNGTAGIWPPVSLDSERINANTSAIRHLIKTTNSVGYNNRRSPWQSFSL
FT                   DKYRFHRRYQNLLPFYLGASLMSEIPQHAVESHRLKQPRIQNYGWNMSGGHYLRHDKSS
FT                   KARARARARAEGANLDPEGFFDFENPVHLSVVNKLLKFYFKEINPPMSIVHESMFWQQF
FT                   NNRFLPHTNFKDSSSKLFRSMLYLILAITLRFREGFMENTEGSNEFLFTWEELSFFQRQ
FT                   HREEAMFKYAYSVITQLTFEWESFELIQSWLLITFYFRTCYRQTACWNALGQAINMCNG
FT                   MSLYLNRFPRTHSKYDESRAWHCFWACFIMDKLISFQMGRFYQLSMPVSHMTTPGHWCD
FT                   NKVDVDRNGNSNAEDDDNSIWSDASETTNDESDDSSNVEDVQEVDHNDRQENGEHPQGE
FT                   DVEKSNTPQYEDDGKEDDWFHHETTQLFELAVIVQTCQKRDGEELDLEESIALRRKLDE
FT                   WFEKHIQSTRIDKTWQHLYQIQPLLSYLDVRLTFETRRLFLLINQPLDTGEMIFPIDTL
FT                   GLVKHCQLSVKVLSQINQKQLYFIPWWLNLSQLFTASVISIALIHSGLQTSRSLDILRR
FT                   CMDIWNNLMTSHPKNPPGMLPECLWCIKMLNHMCCLRLLSSATHLENLVGTNPGDSTPN
FT                   DNKFSQFGKVGEMGKAINSDDESGSLSNLPPIQSQIPSASPSIPQSQPIRVKSEPSTHI
FT                   PISTTAVKSLAENQFKITPQSQPHPQPQPQPQPGLSEPILGQGSGTMNTPQASEDFTCP
FT                   RMGNIPSSSITDSSGTGNKENSEAIDEGLFSYLQWFDQNFM"
FT   gene            complement(<478738..>480333)
FT                   /locus_tag="ZYRO0E06292g"
FT                   /old_locus_tag="ZYRO-ORF3814"
FT   CDS_pept        complement(478738..480333)
FT                   /locus_tag="ZYRO0E06292g"
FT                   /old_locus_tag="ZYRO-ORF3814"
FT                   /product="ZYRO0E06292p"
FT                   /note="highly similar to uniprot|P20457 Saccharomyces
FT                   cerevisiae YKL045W PRI2 Subunit of DNA primase which is
FT                   required for DNA synthesis and double-strand break repair"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06292g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30941"
FT                   /db_xref="GOA:C5E4I0"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4I0"
FT                   /protein_id="CAR30941.1"
FT                   /translation="MCRIISTLGELHQSLNLINHSSRQIKMFRQNKKRISSRRHFSDDN
FT                   SGSQFIMGQPGSEAERRLYDKIYESKLSFYELPPQGEITLDQFEIWAIDRLKVLLELES
FT                   CVARNKTAKETETIVKPLLQKLLPFNTDSLEDKKKDYYSHFILRLCFCRTKDLRDKFLR
FT                   AETLLFKLRFNMLTSQYQAKFVQSLDLPMLQFISEDEKMELSQELYQTISPQLQFQLNL
FT                   TDEMQRRQYFQNERFIKLPFESVIDLVGSRQVFLKKGFAYLPQFQQLNLLSREFAQRLE
FT                   EELLRTFQHLPHLNEDDRLIPILTHLSTGYTISDYQQYSHEFGSDAQEGEINSQNVYSK
FT                   EISSNFPLCAKNLFSGLQQHHHLRYNGRQQLSFFLKGIGLNADDALKFWSEAFTARGGN
FT                   MTQDKFNKEYRYNFRHNYGLEGSRISYRVWDCRTILSKPRPARGEFHGCPYRDWNVDKL
FT                   TSELSSMKLTSTQVSSVLESCQKNEFTIACTKVFESTHGQTGMEVDDQTHIAHPNLYFE
FT                   RSRQWQKKHSNETE"
FT   gene            <480856..>482349
FT                   /locus_tag="ZYRO0E06314g"
FT                   /old_locus_tag="ZYRO-ORF3812"
FT   CDS_pept        480856..482349
FT                   /locus_tag="ZYRO0E06314g"
FT                   /old_locus_tag="ZYRO-ORF3812"
FT                   /product="ZYRO0E06314p"
FT                   /note="similar to uniprot|P50264 Saccharomyces cerevisiae
FT                   YMR020W FMS1 Polyamine oxidase converts spermine to
FT                   spermidine which is required for the essential hypusination
FT                   modification of translation factor eIF-5A also involved in
FT                   pantothenic acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06314g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30942"
FT                   /db_xref="GOA:C5E4I1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4I1"
FT                   /protein_id="CAR30942.1"
FT                   /translation="MAIKDKTVVIIGAGISGLKAASKLYEEGVKNCVVLEARDRIGGRL
FT                   HTIQGYQGRKYDLGGSWHHDTLINRLFAEEAKLALQEGKPRFVFDDDSPIYIDGERGHL
FT                   ESDGYLRLEVILDEFIKFVYLIFNQNLGVPDCSYKEMVHRYIYEKREFLTDGQIRYLPQ
FT                   LARFMELWHGVDWEMLSGRDSVYDSQGRNAFVLHYESVINRIAQSFPQDWLQVSTPVKS
FT                   IKRSKGVIVTTDEDEYHCDYTIVTIPQSVLELSLHDEDQPGKISFQPPLNPRIQEGFTK
FT                   SHFGSLGKVVFEFEKCTWSDATTRVVVLSHSSDHIAQQVRSADDWATFWKAADHHEESI
FT                   KPWDHPLFFLNLPRSTGVPSLVVLMQAPLTQYIESLPNKQLVFEFFEPILNKFMAAMGC
FT                   SQPVINAIDKTDVKSPNADSPVLQGIIVTNWSSDPYSRGAYTVCFPGDDAIDMVTAMMG
FT                   GQDSRIRFAGEHTILDGAGCAYGAWESGIREAEYIRERL"
FT   gene            complement(<482415..>483557)
FT                   /locus_tag="ZYRO0E06336g"
FT                   /old_locus_tag="ZYRO-ORF3811"
FT   CDS_pept        complement(482415..483557)
FT                   /locus_tag="ZYRO0E06336g"
FT                   /old_locus_tag="ZYRO-ORF3811"
FT                   /product="ZYRO0E06336p"
FT                   /note="similar to uniprot|P35192 Saccharomyces cerevisiae
FT                   YMR021C MAC1 Copper-sensing transcription factor involved
FT                   in regulation of genes required for high affinity copper
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06336g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30943"
FT                   /db_xref="GOA:C5E4I2"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="InterPro:IPR036395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4I2"
FT                   /protein_id="CAR30943.1"
FT                   /translation="MIIFDSEKYACASCIRGHRSSTCRHTDRMLVKVRSRGRHASMDIR
FT                   KVIIVETDSQVTPDESSPSCDKCYSDSKNECEKMNRQPILFLRTRKTQRAILADGNLQI
FT                   IVENDAKPQDGSDKPHPPFKYISEKDFLRMHLVNEREPSSCGCGKNNKKSKEDITKVEP
FT                   ALETPLPPTAPLVPSADSAFPMENVPQNDFNSKDPFALNADPKQMVELLTHKGLFLSTQ
FT                   CSCEEGHCVCANCLLHRNEEELSSYIQRSGVPLTNMGEAQLSNPMMVGTGSCNCPPEDC
FT                   ECESCPDHPCENMSFNKLLLTGLLNAPLRRKTNIVYKGKLIPSQYWWDFLKLHIPLMGD
FT                   SQLESLDIIGWFERIVSIYEHQLADANANVASVPQSLFAL"
FT   gene            <484003..>484500
FT                   /locus_tag="ZYRO0E06358g"
FT                   /old_locus_tag="ZYRO-ORF3810"
FT   CDS_pept        484003..484500
FT                   /locus_tag="ZYRO0E06358g"
FT                   /old_locus_tag="ZYRO-ORF3810"
FT                   /product="ZYRO0E06358p"
FT                   /note="highly similar to uniprot|Q02159 Saccharomyces
FT                   cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
FT                   involved in the ER-associated protein degradation pathway
FT                   requires Cue1p for recruitment to the ER membrane proposed
FT                   to be involved in chromatin assembly"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06358g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30944"
FT                   /db_xref="GOA:C5E4I3"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4I3"
FT                   /protein_id="CAR30944.1"
FT                   /translation="MSKTAQKRLLKELQQLMKDSSTGIVAGPRSENDLFVWDCLIQGPP
FT                   DTPYEGGIFNAKLEFPKDYPLSPPKLTFTPSILHPNIYHNGEVCISILHSPGDDPNMYE
FT                   LAEERWSPVQSVEKILLSVMSMLSEPNVESGANVDACILWRDNRPEFELQVKRSILQSL
FT                   GF"
FT   gene            <484736..>486097
FT                   /locus_tag="ZYRO0E06380g"
FT                   /old_locus_tag="ZYRO-ORF3809"
FT   CDS_pept        484736..486097
FT                   /locus_tag="ZYRO0E06380g"
FT                   /old_locus_tag="ZYRO-ORF3809"
FT                   /product="ZYRO0E06380p"
FT                   /note="similar to uniprot|P36091 Saccharomyces cerevisiae
FT                   YKL046C DCW1 Mannosidase GPI-anchored membrane protein
FT                   required for cell wall biosynthesis homologous to Dfg5p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06380g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30945"
FT                   /db_xref="GOA:C5E4I4"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4I4"
FT                   /protein_id="CAR30945.1"
FT                   /translation="MLLCKLWVFGFLASWFPSASALDIDLNDFKTLQNASALVAKGLMD
FT                   YYTGDQYGQTIGMFSWPYYWWEAGGAWNTLIDYWFYMKNDTYNDKVTEALLYQSGDNHD
FT                   YVPLNQSTVEGNDDQAFWGIAVLNAAERKFPNPPDDQPQWLYLGQAVFNTMALRWDTAT
FT                   CGGGLRWQIFTWNTGYDYKNTVSNGALFHIAARLAYFTGNSSYVDWAERVYDWMHDVKL
FT                   IEPENDDNKYVYDGVDVSNNCSGPVTRIVWTYNHGLVLSGCAYLYKETGDKIWYNRSKA
FT                   FLETAAKLFYNDSILYEYSCQQSKTCNVDQRSFKSYYSTFLAATAQLIPDFREQIMKVV
FT                   NATAYAAAQACVGGYDGHTCGINWNQKGWDGQYGLGEQMAALEALVVTQAMNKPAPYNS
FT                   TNGGNSTGDGAAGTQTAPTNLKPLHITAGSRAGAGIITCVVGFSIIASFLWLVM"
FT   gene            complement(<486200..>487783)
FT                   /locus_tag="ZYRO0E06402g"
FT                   /old_locus_tag="ZYRO-ORF3807"
FT   CDS_pept        complement(486200..487783)
FT                   /locus_tag="ZYRO0E06402g"
FT                   /old_locus_tag="ZYRO-ORF3807"
FT                   /product="ZYRO0E06402p"
FT                   /note="similar to uniprot|P36090 Saccharomyces cerevisiae
FT                   YKL047W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06402g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30946"
FT                   /db_xref="GOA:C5E4I5"
FT                   /db_xref="InterPro:IPR018626"
FT                   /db_xref="InterPro:IPR028115"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4I5"
FT                   /protein_id="CAR30946.1"
FT                   /translation="MASKSFSSERSNSPLERAQSSLRSAHRVPISCMFLCNFEVKKGNV
FT                   LVWARHSDGFEKKVNLEDIEFKSMPSGVHEVIDDVINFVIPKGEKEGEDGHYNGVAYFK
FT                   QNGQELSKGVGQIDRSRVKMYALGVVVDFDSTQYARNQDWKADEFSSANEYVDDLEQLL
FT                   CQWFNRGTLENFDIFDQFFETYNSGKTVDSLSPVLDRLAAAAYTGQELLSSDAPQAKPH
FT                   MLEYLLYWLRKLGPLIFPLWRSCLLNERILILNPPSGSFEKCNALCYCLSVISLFPQTS
FT                   KFNKSEGHYVTPLYTLGVCDIDRMSKEVSRANSENRKPNGYIACTSDEILLSKPELYDK
FT                   VMKIPGEVEESYFVDIPKLYDNQEQLIRATPHDLHSVQVLYKELFGEELSVTERQNFLK
FT                   MIEPLSWSQYIIDGFYWWVTAGYLKPSYHEETNSIPAGPIGESELALILGALEYFHGRT
FT                   MALFQKLKEIFESKEVCGSDEVVQLPSAELVAMDLDSFSAQDHKFIEEIAHKWFHRTLE
FT                   VTGDLYGAAC"
FT   gene            <487921..>488277
FT                   /locus_tag="ZYRO0E06424g"
FT                   /old_locus_tag="ZYRO-ORF3806"
FT   CDS_pept        487921..488277
FT                   /locus_tag="ZYRO0E06424g"
FT                   /old_locus_tag="ZYRO-ORF3806"
FT                   /product="ZYRO0E06424p"
FT                   /note="similar to uniprot|P35727 Saccharomyces cerevisiae
FT                   YKL061W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06424g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30947"
FT                   /db_xref="GOA:C5E4I6"
FT                   /db_xref="InterPro:IPR020491"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E4I6"
FT                   /protein_id="CAR30947.1"
FT                   /translation="MRDQERTLNQDVERCINVLQDFLDTGSAKAISVFSNKTSENEDWL
FT                   EEIRVKYRIKDNDELQAIKMLKQKRLDQLEALESKVDYYEKLCDELEEFQDEMEVKAKL
FT                   EQNRRSRFDSMTRK"
FT   gene            complement(<488300..>489820)
FT                   /locus_tag="ZYRO0E06446g"
FT                   /old_locus_tag="ZYRO-ORF3805"
FT   CDS_pept        complement(488300..489820)
FT                   /locus_tag="ZYRO0E06446g"
FT                   /old_locus_tag="ZYRO-ORF3805"
FT                   /product="ZYRO0E06446p"
FT                   /note="similar to uniprot|P32559 Saccharomyces cerevisiae
FT                   YMR023C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30948"
FT                   /db_xref="GOA:C5E4I7"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4I7"
FT                   /protein_id="CAR30948.1"
FT                   /translation="MLWKLSPFLAKSQLRYQSQLATAYLPTIYALSTAPGTKSAIAVVR
FT                   ISGTHSKYVYHQLNNSEKKLIHRRTLLRNLYGPGKNLLDKALTLFFDSPKSYTGEDLLE
FT                   LHIHGGKAVTGSVLNAIGSLNDRNSGIEIRYALPGEFTQRAFQNGKIDLIEVEGIRELI
FT                   DAETETQRRCALSSFNGMNKNLFMLWRDKIVNNIAQLTAIIDFGEDTEIEDTNNLLQLV
FT                   KHNMVQLKQEINQFIQKIEKTSILQSGVKVVLLGPPNAGKSSLINSISNDDVSIISHTP
FT                   GTTRDTVEASIDVNGYKVTISDTAGIRSHSSDEIELLGIERAIKKSEQCDLCLLIVDPL
FT                   NKPLINEDLTQMIQSMYKEGKEFVIIVNKQDLLTDENQSKSVMDALREKFGDKFPIITV
FT                   SCKTQEGIEPLVKQLTQIFQRLSETSDESDPIIASRRVKEILHSDVLYGIDSFFVTTDS
FT                   EIGGDSYDVVMASEHLSHAADGIGKITGDAVGIEEVLGVVFANFCVGK"
FT   gene            complement(<489994..>490066)
FT                   /locus_tag="ZYRO0E06468r"
FT                   /old_locus_tag="Zyro0E.tAla_AGC_17"
FT   tRNA            complement(489994..490066)
FT                   /locus_tag="ZYRO0E06468r"
FT                   /old_locus_tag="Zyro0E.tAla_AGC_17"
FT                   /note="tRNA-Ala (AGC) cove score=70.19"
FT   gene            <491055..>492197
FT                   /locus_tag="ZYRO0E06490g"
FT                   /old_locus_tag="ZYRO-ORF3804"
FT   CDS_pept        491055..492197
FT                   /locus_tag="ZYRO0E06490g"
FT                   /old_locus_tag="ZYRO-ORF3804"
FT                   /product="ZYRO0E06490p"
FT                   /note="highly similar to uniprot|P36516 Saccharomyces
FT                   cerevisiae YMR024W MRPL3 Mitochondrial ribosomal protein of
FT                   the large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06490g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30949"
FT                   /db_xref="GOA:C5E4I8"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4I8"
FT                   /protein_id="CAR30949.1"
FT                   /translation="MSQLSSLTRHVAASRCMVTRLAVNGRSRSLPLGRRFNSTVSDRIS
FT                   SSSSSSSLKSNAVELSKYKNYYKELKQIIENVPEDIASKSPELVTLHKRLQLPKEFQLS
FT                   VLSRCLTCRSSHLPNEISNPKLGSAFSSTVPTNNLFDNHGLNIFGKNLLTYHVTRKLMT
FT                   KYPRLPTVILNAAVDAYICEDVLAGVGKSWGVETEKTPVLERYLKEEPIQITLGKLRFY
FT                   NNSLNQEDGIESISSLNFSEKSAYSLAIRSIIGALWACTQETNPQYAFQFIDDHILSRK
FT                   LDISKMFQFEQPTRELAALCRREGLQKPVSRLLAESGRHSKAPVFIVGVFSGDEKLGEG
FT                   FGSSLKEGKARAATDALMKWYCYEPLEDQHPVVDHGAVIV"
FT   gene            <492396..>493178
FT                   /locus_tag="ZYRO0E06512g"
FT                   /old_locus_tag="ZYRO-ORF3803"
FT   CDS_pept        492396..493178
FT                   /locus_tag="ZYRO0E06512g"
FT                   /old_locus_tag="ZYRO-ORF3803"
FT                   /product="ZYRO0E06512p"
FT                   /note="weakly similar to uniprot|Q04368 Saccharomyces
FT                   cerevisiae YMR025W CSI1 Subunit of the Cop9 signalosome
FT                   which is required for deneddylation or removal of the
FT                   ubiquitin-like protein Rub1p from Cdc53p (cullin) involved
FT                   in adaptation to pheromone signaling"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30950"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4I9"
FT                   /protein_id="CAR30950.1"
FT                   /translation="MDSVKLHELLLLEVNYQYESRSVGDTTRPPLCLLLLGLPLDDHEK
FT                   FEIQRSIAIPLRLQVINDQDGQFVYDLDQVTRRIKLARETNPQLQLCGIMVVNDQIYDY
FT                   EKPIESLMQHFEGQIEYLFTYKPDSNAEMGRKLNGFSLLPQRQRIGYRLIHGKVNIETQ
FT                   KIDASINSSLPEISDRQRMDQELSFVQKLTQEIDKMIRYLDLAQPSDAVLRKISMLVSQ
FT                   LKRGPTTDIEEMIMNKEGEINALRTICEQWEMGVELGD"
FT   gene            complement(<493175..>494323)
FT                   /locus_tag="ZYRO0E06534g"
FT                   /old_locus_tag="ZYRO-ORF3802"
FT   CDS_pept        complement(493175..494323)
FT                   /locus_tag="ZYRO0E06534g"
FT                   /old_locus_tag="ZYRO-ORF3802"
FT                   /product="ZYRO0E06534p"
FT                   /note="similar to uniprot|Q04370 Saccharomyces cerevisiae
FT                   YMR026C PEX12 RING-finger peroxisomal membrane peroxin that
FT                   plays an essential role in peroxisome biogenesis and
FT                   peroxisomal matrix protein import forms translocation
FT                   subcomplex with Pex2p and Pex10p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06534g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30951"
FT                   /db_xref="GOA:C5E4J0"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017375"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4J0"
FT                   /protein_id="CAR30951.1"
FT                   /translation="MSFYSNLPTSEVSSSLYPTIFEIVSSQEIDALLPASVRYILTNYW
FT                   IARHPNKITLAINNYFQEWFQVLLKGIVEWHHIKEYNSTFVDRFYGLQRFNCSNEVLVR
FT                   KQAKNNNTKVWPPGLQFTKGQKRVVFIQKVIVPYLKDRLDELESKWVAQSTFQEQRNDK
FT                   RNLIRRFVTHVYPVFKKSWYLLDLFTKLLFLAGRIGSVSFLEYLFKIEYTRAVLPLSGG
FT                   DARPKSVSQANRPQRQNLYALVSRFQRILANVGNTSAYLGSQFFPAFIFMLRVYQWWTT
FT                   QDLGAKLQRKLNDIDKDIPRTNNKTDGKGKSTGTDCPICHQRIQNACVLETGYAACYPC
FT                   ALDHLTNNEGKCPVTGKKLLGCTYDKELQKWKVVTGVRKLLI"
FT   gene            complement(<494514..>495599)
FT                   /locus_tag="ZYRO0E06556g"
FT                   /old_locus_tag="ZYRO-ORF3801"
FT   CDS_pept        complement(494514..495599)
FT                   /locus_tag="ZYRO0E06556g"
FT                   /old_locus_tag="ZYRO-ORF3801"
FT                   /product="ZYRO0E06556p"
FT                   /note="highly similar to uniprot|P14540 Saccharomyces
FT                   cerevisiae YKL060C FBA1 Fructose 1 6-bisphosphate aldolase
FT                   required for glycolysis and gluconeogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30952"
FT                   /db_xref="GOA:C5E4J1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4J1"
FT                   /protein_id="CAR30952.1"
FT                   /translation="MGVESILKRKAGVIVGDDVRHLFDYAKEHKFAIPAINVTSSSTVV
FT                   SSLEAARDNKSPIILQTSNGGAAYFAGKGVSNEGQNASIKGAVAAAQYIRSIAPAYGIP
FT                   VVLHSDHCAKKLLPWFDGMLEADEAYFKEHGEPLFSSHMLDLSEETDNENIETCAKYFK
FT                   RMAAMGQWLEMEIGITGGEEDGVNNEHVDKESLYTQPPTVYAVHEALSKISPNFSIAAA
FT                   FGNVHGVYKPGNVVLSPQILGDHQKYAAEKDGKAAGSKPLYLVFHGGSGSSDKEFQTGI
FT                   DNGVVKVNLDTDCQYAYLTGIRDYVLKNKDYLMSTVGNPEGPDKPNKKFFDPRVWVREG
FT                   EKTMSARITTALKVFRAVNSV"
FT   gene            <496299..>497669
FT                   /locus_tag="ZYRO0E06578g"
FT                   /old_locus_tag="ZYRO-ORF3794"
FT   CDS_pept        496299..497669
FT                   /locus_tag="ZYRO0E06578g"
FT                   /old_locus_tag="ZYRO-ORF3794"
FT                   /product="ZYRO0E06578p"
FT                   /note="similar to uniprot|Q04371 Saccharomyces cerevisiae
FT                   YMR027W High level expression reduced Ty3 Transposition"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30953"
FT                   /db_xref="GOA:C5E4J2"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="InterPro:IPR039763"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4J2"
FT                   /protein_id="CAR30953.1"
FT                   /translation="MIAERFRTSDKNTFGEYTAHSRWPILVQNAVDDIGEELKNHSGES
FT                   KKQGEIIEAQLKELLEEVKNNSKLRPFTQQETAIAGVPASFNEHLTDTRNEGVTWFDAE
FT                   WLFAEIYMYRRINVLFRSQPLWAKFDIFDRVKQATFHSSFHGVVELALRYKTLSAQLRQ
FT                   NGGDSEALQILFKEFIDISLWGNATDLSLLTNATLEDIKSIQGAQARKNAESKIIVDDT
FT                   TKAWQVLQKSGPDARVDFVLDNSGFELYADLVLAAFLINSKLAKQCVFHGKDIPYMVSD
FT                   ALYKDLLALLDNMKDTKFFPAEDSASREALNGFAQDIEKFLANGQLQFRANPFWTTELD
FT                   YWNIDPSETKYGGAEVHKDLSESDLVIFKGDLNYRKLTGDRKWPRTTAWSEAIGPLANN
FT                   GITLLSLRTCKADVQVGLSQGLDEKLSQEWEKDHPGKGSWWTSSGKWAVISFNSSSH"
FT   gene            complement(<497754..>499112)
FT                   /locus_tag="ZYRO0E06600g"
FT                   /old_locus_tag="ZYRO-ORF3791"
FT   CDS_pept        complement(497754..499112)
FT                   /locus_tag="ZYRO0E06600g"
FT                   /old_locus_tag="ZYRO-ORF3791"
FT                   /product="ZYRO0E06600p"
FT                   /note="similar to uniprot|P35728 Saccharomyces cerevisiae
FT                   YKL059C MPE1 Essential conserved subunit of CPF (cleavage
FT                   and polyadenylation factor) plays a role in 3' end
FT                   formation of mRNA via the specific cleavage and
FT                   polyadenylation of pre-mRNA contains a putative RNA-
FT                   binding zinc knuckle motif"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30954"
FT                   /db_xref="GOA:C5E4J3"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014891"
FT                   /db_xref="InterPro:IPR025829"
FT                   /db_xref="InterPro:IPR033489"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4J3"
FT                   /protein_id="CAR30954.1"
FT                   /translation="MSSTIFYKFRSQKDIDRILFDGTGLTVFDLKREIIQENKLGDGTD
FT                   FQLRLYNPDTNEEYEDDSQVIPRSSSVIARRSPAVKAFSVHSMHRGGATAALGNATRYV
FT                   TGRPRVYQKKPVSNGGSSTSAAGAVSGVTEEERIANMFANQENQWEQTQQEMSAATPVF
FT                   YKSHNPNAAENEGPPPPGYMCYRCGARDHWIKNCPTNNDPNFEGKRIRRTTGIPKKFLK
FT                   SVEIDSENMSPEEMAQRKIMVTDDGKFVVQVADQQSWEDYQRKQQNRLINGTDNPWQKG
FT                   HFKDLPADLKCPLTEGLLRGPVRTSKCCNTVFSKTALEDSLLESDFVCPNCHAEGVLLD
FT                   SLVEDEEKAKQVQEFLKERDDGKGGHLGANKRDGEQEDSPNKRLKVDGKSDGEGANGNV
FT                   SGGGNGDSQVKPPAPPLPMPPVPFGMPPFPMFPPPMPFMAPPPPRSTPSPDKK"
FT   gene            <499317..>499685
FT                   /locus_tag="ZYRO0E06622g"
FT                   /old_locus_tag="ZYRO-ORF3789"
FT   CDS_pept        499317..499685
FT                   /locus_tag="ZYRO0E06622g"
FT                   /old_locus_tag="ZYRO-ORF3789"
FT                   /product="ZYRO0E06622p"
FT                   /note="highly similar to uniprot|P32774 Saccharomyces
FT                   cerevisiae YKL058W TOA2 Transcription factor IIA small
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06622g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30955"
FT                   /db_xref="GOA:C5E4J4"
FT                   /db_xref="InterPro:IPR003194"
FT                   /db_xref="InterPro:IPR009083"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR015871"
FT                   /db_xref="InterPro:IPR015872"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4J4"
FT                   /protein_id="CAR30955.1"
FT                   /translation="MAVPGYYELYRRSTVGNSLVDALDTMISDGRIEASLAMRVLETFD
FT                   RVVAETLRDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEGSHEGSGHMGGSDGQS
FT                   TIAVDKLRIVACNSKRSE"
FT   gene            <499973..>501082
FT                   /locus_tag="ZYRO0E06644g"
FT                   /old_locus_tag="ZYRO-ORF3788"
FT   CDS_pept        499973..501082
FT                   /locus_tag="ZYRO0E06644g"
FT                   /old_locus_tag="ZYRO-ORF3788"
FT                   /product="ZYRO0E06644p"
FT                   /note="similar to uniprot|Q04372 Saccharomyces cerevisiae
FT                   YMR028W TAP42 Protein that physically associates with the
FT                   protein phosphatase 2A and the SIT4 protein phosphatase
FT                   catalytic subunits"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06644g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30956"
FT                   /db_xref="GOA:C5E4J5"
FT                   /db_xref="InterPro:IPR007304"
FT                   /db_xref="InterPro:IPR038511"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4J5"
FT                   /protein_id="CAR30956.1"
FT                   /translation="MSLSQEYESLLRTYRDKIEHSSLRQDTTEYQSLVTKTIEKLLSLK
FT                   NSIYGDLALFSSNETVDDISTKSLKLLSIDFYLALLFSRKQMVQLNDPLARQKMKLKFL
FT                   EKTVQLFMQFLTTLQDYEILDPFLSKKIDSLEDTYNPSLQELYQQPAHGEDLSGAQKRR
FT                   QQKIEMFRQSKTINEKLEFIESKYKSNEISSDDDEQMRKLYIKRLQSHSYQAFNEMEQI
FT                   LYELELLRNFTKSGGDPTAQQLEPPSERNSDSGKDSSGYTEKLELLNKPLLSKQGKVLR
FT                   NFTLVDKRTQLQNKVRGYGQYGPTMSVEELLQKEFEENRVLQGGEEATNENVNEDDLNW
FT                   QDQETYKARQWDEFKESVARGSGNTMNRG"
FT   gene            complement(<501139..>504231)
FT                   /locus_tag="ZYRO0E06666g"
FT                   /old_locus_tag="ZYRO-ORF3787"
FT   CDS_pept        complement(501139..504231)
FT                   /locus_tag="ZYRO0E06666g"
FT                   /old_locus_tag="ZYRO-ORF3787"
FT                   /product="ZYRO0E06666p"
FT                   /note="similar to uniprot|P35729 Saccharomyces cerevisiae
FT                   YKL057C NUP120 Subunit of the Nup84p subcomplex of the
FT                   nuclear pore complex (NPC) required for even distribution
FT                   of NPCs around the nuclear envelope involved in
FT                   establishment of a normal nucleocytoplasmic concentration
FT                   gradient of the GTPase Gsp1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06666g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30957"
FT                   /db_xref="GOA:C5E4J6"
FT                   /db_xref="InterPro:IPR021717"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4J6"
FT                   /protein_id="CAR30957.1"
FT                   /translation="MLLLSKVDADLLQLKDSAVDENVINLYLGNSENGISHGVKNSDDD
FT                   IRSSFASTVELSNSNHISYHLSMANTVITLYPVEKNLFNKTINLFLPEPTMNQHHTLTI
FT                   QEFNGCLLINTILQNGIYLLIELPLKYIFSPNERLDHDWFKAFNPYDFTVRVPHLLFSV
FT                   SPQFLVAFLDDGGLLGLKQLNDTDVEPILFNDNSYLQSITSLFSGRNSHRSEKAVSCIL
FT                   YEQRYLVILTQHCHLRIWDITTFSLVQDYDFSKEHHFENVDISSYENPGRFMSLFSNYL
FT                   MVYLPFGNGIFEIGTLTPGGRGRINFTSKGVFAANLSSSSIWSLVDMTLLKPLDLNLTY
FT                   SYANLVVLWKSGTVSKLQILNILDQDLQAHEWIEATNRSLSDIESEQDLNVNSDAEKGL
FT                   FNLKSRYESRLFERAQKILNENNIIMLPGESELMDYLANLETVLKDLKSKSDEVSSLTI
FT                   YRDEIILVNSLQKYNHSVYKTNTPLENIYYNIHSELNDDELTRYLKTLHGFSSTISKDV
FT                   LKDVSERFIGIVSGAVAGNLSPNEKFTDIFKTCLENKFELSNLKLLFNELSSFDIIPTL
FT                   NEFIENNLEPSVVNPSEFVDSITMDSLATVVTLEGLRQQVTIQRHFVLQILLTFAFLDF
FT                   DFTAFEKQITSLLDYHFKQSLFLELFNIDKSLLAKELLTRTTDHGCGINLLSYTELHNY
FT                   LKYALSEFYESPISMSPYFLGFYKSFILESGVSNKQNLLSPKFLLQNVGWPFHVRGNKV
FT                   QEFLIATILFSCEQYGQAFDYFHLHDYPDTIADSLPDCLKELQDNDSSSIWAPLIFSFT
FT                   VPYKHSSFEYELSLLFADIGNYEYALKSIKRSIEYSMKDISIDEPHDFKQAQIVQYLDL
FT                   LFYFDMFAEALDVLRLSPVLSREVKTNYYRSILESTQQSGPFFATLLKLCHSNDKGPLY
FT                   LPPDDYQIIDKIILSHSRENNWTNLKKLYSFRVVNKHERSAVEALYEYVQKAGYDPETK
FT                   RKCFLLIINTLSTFDDEQDQWLLNGCNIVTLGELKAELRRL"
FT   gene            complement(<504600..>506294)
FT                   /locus_tag="ZYRO0E06688g"
FT                   /old_locus_tag="ZYRO-ORF3785"
FT   CDS_pept        complement(504600..506294)
FT                   /locus_tag="ZYRO0E06688g"
FT                   /old_locus_tag="ZYRO-ORF3785"
FT                   /product="ZYRO0E06688p"
FT                   /note="similar to uniprot|Q05040 Saccharomyces cerevisiae
FT                   YMR029C FAR8 Protein involved in G1 cell cycle arrest in
FT                   response to pheromone in a pathway different from the
FT                   Far1p-dependent pathway interacts with Far3p Far7p Far9p
FT                   Far10p and Far11p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30958"
FT                   /db_xref="InterPro:IPR013258"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4J7"
FT                   /protein_id="CAR30958.1"
FT                   /translation="MNSQFPMHPTYTLPGIMHYLQTEFTKNERDRISWELERSEMKARI
FT                   AHLEGENKDLRYRLMKLDPNPEPEILRTLDKSDTSPLIKSKAAVQENVKEIIYLFKSPN
FT                   LGSQMETLNEKKDPVHELEKMGFNQSRDNQSQPLVDNDNAEHQRIDLHQVDSLQEVTQH
FT                   EDLGGAEIDERSDAGTVVVGSENEQQEAEESSDFTKRHRSSSLFTSEKVQPLDAKEEQP
FT                   QEERVSLVQGSTDRSAIVRLKVHGNKVIAYSKSGELSQRFVNKSLDWENDQYHKYEGLS
FT                   SELLDIFWVDNEKFLTLDNEGIKLRKTTVEDHPIAALKLFGENLQFNQVNAWDFKNSWL
FT                   LLALKGRIYLKEISISPDSSKISIGKSYYFNTNKKVWDAKFGMTEKSLIVLNRNPDELV
FT                   IYSFQGKQLQKIDIRKHLSKNIASDSDAMLYLNKKSSKLLILIQELLLIYSFDQKKIIL
FT                   KQSLRSQPTSVIFNSPKDYVALAYDDGYIELRNIKDFNSVIKRYNHVNDEVELDENTQS
FT                   LMDSGLRPMDRNPIVLQDTEIDNHKVIISADNSGRMKLNEIQELGEN"
FT   gene            complement(<506648..>507151)
FT                   /locus_tag="ZYRO0E06710g"
FT                   /old_locus_tag="ZYRO-ORF3783"
FT   CDS_pept        complement(506648..507151)
FT                   /locus_tag="ZYRO0E06710g"
FT                   /old_locus_tag="ZYRO-ORF3783"
FT                   /product="ZYRO0E06710p"
FT                   /note="highly similar to uniprot|P35691 Saccharomyces
FT                   cerevisiae YKL056C RBF18 Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30959"
FT                   /db_xref="GOA:C5E4J8"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR011323"
FT                   /db_xref="InterPro:IPR018103"
FT                   /db_xref="InterPro:IPR018105"
FT                   /db_xref="InterPro:IPR034737"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4J8"
FT                   /protein_id="CAR30959.1"
FT                   /translation="MIIYKDIFSGDELLSDAYDVSEVEGAVYEADCSMVKVGGENIDIG
FT                   ANPSSEGGEEGVEDSAEVVNNVVHSFRLQQTGFDKKSFVSYIKGYMKAVKAKLQETNPD
FT                   AIPVFEKGAQAYVKKILGSFNDWEFFTGESMDPDAMVVMLNYREDGVTPFVAIWKHGVS
FT                   EEKI"
FT   gene            complement(<507383..>508192)
FT                   /locus_tag="ZYRO0E06732g"
FT                   /old_locus_tag="ZYRO-ORF3782"
FT   CDS_pept        complement(507383..508192)
FT                   /locus_tag="ZYRO0E06732g"
FT                   /old_locus_tag="ZYRO-ORF3782"
FT                   /product="ZYRO0E06732p"
FT                   /note="similar to uniprot|P35731 Saccharomyces cerevisiae
FT                   YKL055C OAR1 Mitochondrial 3-oxoacyl-[acyl-carrier-
FT                   protein] reductase may comprise a type II mitochondrial
FT                   fatty acid synthase along with Mct1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30960"
FT                   /db_xref="GOA:C5E4J9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4J9"
FT                   /protein_id="CAR30960.1"
FT                   /translation="MVHLEPVAIVTGATRGIGKAIVQKLSSQGISCICIGSSRESIAGI
FT                   KLGDHLQSVKENQRHRSLAIDLSQWPQWVAQKSHFGIEYYPQRLESMFPLMGFNSWNSP
FT                   HQRYCLSLVVNCAGTTQSSISLRTSTEEMQRIMNINFLSTVSMCDLATRSMIRQRSHSG
FT                   ALPLQIVNISSVLGETELAVKGTSIYSASKAAISHYSKVLSQEVSNWGIRVNTIAPGLV
FT                   NGTDMIKGLDDTAQTALMNLMATSNRRSTPQEIASSVWSIYSDGNYK"
FT   gene            complement(<508456..>510729)
FT                   /locus_tag="ZYRO0E06754g"
FT                   /old_locus_tag="ZYRO-ORF3780"
FT   CDS_pept        complement(508456..510729)
FT                   /locus_tag="ZYRO0E06754g"
FT                   /old_locus_tag="ZYRO-ORF3780"
FT                   /product="ZYRO0E06754p"
FT                   /note="some similarities with uniprot|P35732 Saccharomyces
FT                   cerevisiae YKL054C DEF1 RNAPII degradation factor forms a
FT                   complex with Rad26p in chromatin enables ubiquitination and
FT                   proteolysis of RNAPII"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06754g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30961"
FT                   /db_xref="GOA:C5E4K0"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR041803"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E4K0"
FT                   /protein_id="CAR30961.1"
FT                   /translation="MSAQSRKSNSHNGKNSRVNPEIKFKLETLTELFPDWTNDDLIDLV
FT                   HEYDDLETIIDKITSGAVTRWDEVKKPSKKERLEKRLEQQQQLQKEQQQHQLQQQHYHA
FT                   QDLDGHHGGSSSHHHTKAGQGSGSRYSRDNNGTHSSSGGSNAKSKKQQQQQQQQQNGKP
FT                   SLPSDNARAAISRGKPASGGGSWAAVASSDSKKHQQEEEEEEDQQQQRPESSPEEPSAT
FT                   TVQASETKTDGVEASASATSTAQSSTHATATASTGNAAHNEKPKKMSWAAIAAPKPKVV
FT                   QKKQSSLNNVGGLKKEINEVAKETETPAAGQAQREPVSETNDKATNNQGKKADAQHEDT
FT                   ASKLSEQQQQQQEQLQAQQQEQQQTQQQDQSPIEFQSQGTNQEDTAQHNRPEEQKDTRE
FT                   ITSNQVQIDEQEVAATSEPQEPSQTAQAVATEVNDGSKVKQQQQQPTVGVEAGKPQQQQ
FT                   QQEAYYQQQQQQQQQQQQQYFAQQQQYAQSQTPQHAPQQLSGQQAAVGQPNANANASAN
FT                   ANAAAAATAAQQQYYMYQNQFPGYTYPGMFDSPSYAYGQQQAYQQPSQPSAQAGFGTGT
FT                   ASQYSIPQGYAAAPAADMTTASTATASPVAGHAQPQQQQPYGGSFLPYYAHFYQQSFPY
FT                   AQPQYGMAGQYPYQVPKAGYNYYQPQRQTQGRNVQQGQQSPGHSPSQQGEDVQQQSQPT
FT                   QQNQLQNGQQPLNPQQLQFQQYYQFQQQQQAAAAAAAAAAAQQGLPYGYTGYDYTSQAS
FT                   RGFY"
FT   gene            complement(<511612..>511869)
FT                   /locus_tag="ZYRO0E06776g"
FT                   /old_locus_tag="ZYRO-ORF3772"
FT   CDS_pept        complement(511612..511869)
FT                   /locus_tag="ZYRO0E06776g"
FT                   /old_locus_tag="ZYRO-ORF3772"
FT                   /product="ZYRO0E06776p"
FT                   /note="highly similar to uniprot|O60200 Saccharomyces
FT                   cerevisiae YKL053C-A MDM35 Mitochondrial Distribution and
FT                   Morphology Similar to human sequence predicted by GENSCAN"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06776g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30962"
FT                   /db_xref="GOA:C5E4K1"
FT                   /db_xref="InterPro:IPR007918"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4K1"
FT                   /protein_id="CAR30962.1"
FT                   /translation="MGNVMSASFAPECTELKKKYDDCFNEWYSEKFLKGKSVENECSEQ
FT                   WYSYTACVDAHLIKQGIKPALDEARKEAPFEEGGAIKDED"
FT   gene            <513129..>514325
FT                   /locus_tag="ZYRO0E06798g"
FT                   /old_locus_tag="ZYRO-ORF3769"
FT   CDS_pept        513129..514325
FT                   /locus_tag="ZYRO0E06798g"
FT                   /old_locus_tag="ZYRO-ORF3769"
FT                   /product="ZYRO0E06798p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30963"
FT                   /db_xref="GOA:C5E4K2"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR013866"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4K2"
FT                   /protein_id="CAR30963.1"
FT                   /translation="MTTITHRGLEIRTDEMEVPEATAPLDVLHNYYWVSTKEPHAIRRK
FT                   AILKAHPEVKKLMGHEPLTKYLATIVVLTQLGIAYYLRSGHSWLKTVFLAYVIGATLTN
FT                   NMYLAVHEITHNLAFKKPLYNKMFAIFVNTPVPLPYAADFGPYHQLHHKFLGDELYDTD
FT                   IPTEFEAKFLKGRVGKFFFVLFQALFFALRPMFVVAISLTNFHIANITYQIVVDILWIR
FT                   YFGIQSFLYLGFSSLLAGSFHPLSGHFIAEHFLFDIDEALKGGKETFKYTNGEEQQYSE
FT                   AQKNELESIRPEVEFKREYALETYSYYGILNLFVWNAGLHNEHHDFPFIPWSRLWALHN
FT                   MAPEFYKPLPRHESWCKAIFDFVFRADLNFYSRVKRANPQITKEKELKKQKEMQKSKF"
FT   gene            complement(<514778..>515011)
FT                   /locus_tag="ZYRO0E06820g"
FT                   /old_locus_tag="ZYRO-ORF3768"
FT   CDS_pept        complement(514778..515011)
FT                   /locus_tag="ZYRO0E06820g"
FT                   /old_locus_tag="ZYRO-ORF3768"
FT                   /product="ZYRO0E06820p"
FT                   /note="similar to uniprot|Q3E790 Saccharomyces cerevisiae
FT                   YBR058C-A TSC3 Protein that stimulates the activity of
FT                   serine palmitoyltransferase (Lcb1p Lcb2p) several-fold
FT                   involved in sphingolipid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30964"
FT                   /db_xref="GOA:C5E4K3"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4K3"
FT                   /protein_id="CAR30964.1"
FT                   /translation="MPASHTMEYVETNAQRNKRLNERVNLWSKILHKTFFNYYIHLPFY
FT                   VITQGDAFLLHTFCLTIVSLGLFGIVKYCLLL"
FT   gene            complement(<515664..>515897)
FT                   /locus_tag="ZYRO0E06842g"
FT                   /old_locus_tag="ZYRO-ORF3767"
FT   CDS_pept        complement(515664..515897)
FT                   /locus_tag="ZYRO0E06842g"
FT                   /old_locus_tag="ZYRO-ORF3767"
FT                   /product="ZYRO0E06842p"
FT                   /note="similar to uniprot|Q3E790 Saccharomyces cerevisiae
FT                   YBR058C-A TSC3"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06842g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30965"
FT                   /db_xref="GOA:C5E4K4"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4K4"
FT                   /protein_id="CAR30965.1"
FT                   /translation="MTSRSTMYYVETSAQRSQRLNIYPNPVAQFLRRTYWAYYVHLPFY
FT                   GLTKLDAFWLHTFFLTLMSLGVFGVVKYCILF"
FT   gene            complement(<516731..>520078)
FT                   /locus_tag="ZYRO0E06864g"
FT                   /old_locus_tag="ZYRO-ORF3763"
FT   CDS_pept        complement(516731..520078)
FT                   /locus_tag="ZYRO0E06864g"
FT                   /old_locus_tag="ZYRO-ORF3763"
FT                   /product="ZYRO0E06864p"
FT                   /note="some similarities with uniprot|P38080 Saccharomyces
FT                   cerevisiae YBR059C AKL1 Serine-threonine protein kinase
FT                   member (with Ark1p and Prk1p) of the Ark kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30966"
FT                   /db_xref="GOA:C5E4K5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4K5"
FT                   /protein_id="CAR30966.1"
FT                   /translation="MPATSDAAKTASSVTKPVVDGYAPGTVVAVGNQQVEIISFIAEGG
FT                   FAQIYSVKYIKFLGEFNNGSKAPLQPGDIACLKRVLVPDENGLSEMRNEVEVMKQLRGA
FT                   KAIIQYYDSNASRRTSGQVGYEVLLLMELCPNNSLLDYMNQRLATRLTEKEILKVMYDT
FT                   TLAISQMHYLPIPLIHRDIKIENVLVDAQNNFKLCDFGSTSTCFPLVTTHQDIAILTQN
FT                   IYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFFITPFEMTGQFSILHSKY
FT                   EFPANKYSSKLINLIIIMLAENPYVRPNIYQVMHHICSVIGCEVPIEDKYGLGPYNFEK
FT                   YTEFQTKLQNVQYQMYLLQQKKLENNGRLNAVEEKLLNDLLITSFEVSSKIPAEVGLHQ
FT                   QQLQQQQQQQPMKSKESVSSSDEFSDHRKSVFSSTKPSRNPSSASRKNLPSNEFENESD
FT                   ANLDAEPKQFASVSMTDRDSHFSPPNQRSMSSYSSGKSLSGGPPIQDVKYSDILAVEQT
FT                   ARSEQSPGIIKQHKSNNPFPMMAQGFGQGQPGPLSSSGTPMGAAPVAPAAPVPQAPGPM
FT                   PIPGNAGALPGGAGGVNVAPRGTPISIQPELGSRPEYFVDAHSPADDSQFTISQPQPQL
FT                   PQVGPVPQAQPKMNFNQNMFYQHVDSPVSVQGQAQPIPLKKISDVPQPQSHMRFNYQVP
FT                   PQQPQSGTSPYYPSPSVGPNASLSAQNPMSQIALQQQPQQQVPRPLPSQQQAKQGFVPA
FT                   PQHHHQQQQQQQPPVEQVRQLPQHATTVDSSDLVQPPENPPPKPPHPKTWQDYQSHDGL
FT                   DLKQSLHKRGGSDHRPKTDSPQLERTPSKNLDLSYDEFDLNSNDPPKPISHIKRDTFDS
FT                   ASTVSSTASSESIQIDLDDARRERDRTQQPPASNEKLTQPPEKPIRQTIDSSTGSLRRS
FT                   LDLKYQEVHFSSPETQRPPTKEATRRQDVADPPRRPHGDIRRHSNNNANSNNDNNNNNS
FT                   NNNNSNSNNNNNTTNNGTSAGSGSANAGGTSSNAGTNASSGSPPSLQNNDLDRYKNAHK
FT                   NSSNTSVNASGPASGSGGGEVRRSFAKARQSLDLEKIRKEAVKGEAALSAKRRSIFSVF
FT                   RGPDKKKE"
FT   gene            complement(<520584..>522395)
FT                   /locus_tag="ZYRO0E06886g"
FT                   /old_locus_tag="ZYRO-ORF3760"
FT   CDS_pept        complement(520584..522395)
FT                   /locus_tag="ZYRO0E06886g"
FT                   /old_locus_tag="ZYRO-ORF3760"
FT                   /product="ZYRO0E06886p"
FT                   /note="similar to uniprot|P32833 YBR060C Saccharomyces
FT                   cerevisiae ORC2 Subunit of the origin recognition complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06886g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30967"
FT                   /db_xref="GOA:C5E4K6"
FT                   /db_xref="InterPro:IPR007220"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4K6"
FT                   /protein_id="CAR30967.1"
FT                   /translation="MSDDGIVKHVDILSSPSKARGKVTCRVVSKRRSTPVPDGLDRKRS
FT                   PKKNLLERIERSPTPGGIWQESSDLSSSESPIGKRKRSESRRTKSQNDDKEEEEDNNDD
FT                   GGDAYVSNGDEEDKLDRENKRHRRLPSRSETPIPVLASPVKTTESENEVSITTTPQKKT
FT                   PKKTLSTEHDFTSPLKKVILSNLDEYKNTASSENLKLSRNFVPTPLPTAKEKYVPTTTD
FT                   KSMSSFFDTFEGYFDQRKQLRGSQKSKNTMSMATDVTREEFALISNTFHGKLHRAARDG
FT                   LYEIQTRLFPQYWFELTQGFSLLFYGVGSKREFLERYVFEYLAPNLVSDESSVGVPCVV
FT                   VNGYNPTCNYRDVFKDISRALLPQELSRNETKYWGNHVILQIQKMIELYKNEPPDIKLV
FT                   IVIHNLDGPSLRKDNFQTMLCYLALIRQVALVASTDHIYAPILWDNFKAQNYNFVFHDV
FT                   SNYEPLAVESSFKDVMKMNRNNSASGAEGAKFVLESLTHNTKRMYKVLLETQISNMNSH
FT                   ASNARGQVPPTKRGSPTVGVELKQLLHLCSAEFVASNEISLRSMLTEFVEHKMAAISKN
FT                   PAGTEHVWIPYNYSEINKLLSTVMQSI"
FT   gene            <523402..>525186
FT                   /locus_tag="ZYRO0E06908g"
FT                   /old_locus_tag="ZYRO-ORF3758"
FT   CDS_pept        523402..525186
FT                   /locus_tag="ZYRO0E06908g"
FT                   /old_locus_tag="ZYRO-ORF3758"
FT                   /product="ZYRO0E06908p"
FT                   /note="highly similar to uniprot|P15180 Saccharomyces
FT                   cerevisiae YDR037W KRS1 Lysyl-tRNA synthetase also
FT                   identified as a negative regulator of general control of
FT                   amino acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06908g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30968"
FT                   /db_xref="GOA:C5E4K7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4K7"
FT                   /protein_id="CAR30968.1"
FT                   /translation="MSQEQANAAAEAVANLHLDDATGEMVSKSELKKRQKQRQVEAKRA
FT                   AKKATAQPPAPSKKKKDEALADLSPSQYFEMRSRQILELRKSHQPNPYPHKFFTTTSLA
FT                   DFLSKYAYLQRGETLKEEKVAIAGRIHAKRESGSKLKFYVLHGDGAEVQLMAQLQDYHD
FT                   PEAYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRIQLLTPCLHMLPADHFG
FT                   FKDQETRYRKRYLDLIMNKGSRDRFITRSKIISFIRRFLDSKNFIEVETPMMNVIAGGA
FT                   TAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTT
FT                   CEFYQAFADVYDLMDMTELLFSEMVKEITGSYEIKYHPDPHNPEKEMSLNFARPWKRIH
FT                   MIEALEERFNTKFPAGDQLHTKETGEFLKNLLAANKMDCPPPLTNARMLDKLVGELEDT
FT                   CINPTFIFGHPQMMSPLAKYSRDMPGLCERFEVFVATKEICNAYTELNDPFDQRARFEE
FT                   QARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTL
FT                   KPDVLREEVKKEEVKPSA"
FT   gene            complement(<525320..>528466)
FT                   /locus_tag="ZYRO0E06930g"
FT                   /old_locus_tag="ZYRO-ORF3755"
FT   CDS_pept        complement(525320..528466)
FT                   /locus_tag="ZYRO0E06930g"
FT                   /old_locus_tag="ZYRO-ORF3755"
FT                   /product="ZYRO0E06930p"
FT                   /note="uniprot|P78981 Zygosaccharomyces rouxii Z Na -
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06930g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30969"
FT                   /db_xref="GOA:C5E4K8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006414"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4K8"
FT                   /protein_id="CAR30969.1"
FT                   /translation="MNLNEVKENDLFHTLDIAQTAQVVGTDTEHGLNANEAHARLKHGG
FT                   PNNLGEDTGIDYKSLVIHQVCNAMVMVLFISMVISFAIRDWITGGVIAFVVGVNVSIGV
FT                   FQEFKASKTMNSLKSLTSPTATVIREGKHVSVESATVVVGDICEVRVGDSVPADLRLME
FT                   ASNFETDEALLTGESLPVAKDYQAVYDSDKDTPVGDRLNLAYSSSSVVKGRARGIVIRT
FT                   GLDTEIGKVADSLRSKQTIVSRDPAKSWVVNAYRTVHNTAGVFLGTTIGTPLHRKLSKL
FT                   AILLFFIAVLFAIVVMASQKFNVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMV
FT                   TRNVLVRSLDSLEALGAVTDICSDKTGTLTQGLMVPRQIWVPGFGTVLVESVGKDSCIK
FT                   IIPRLSPHEFAHNNDEDVGILQDFVNLYNDNKLPEDMQRSYFTQWLDTAALANVAKVRW
FT                   DDEKENWVGQGDPTEVAIQTFVAEMGGREERSQEFQNVKEFPFDSTIKRMSAVFESNQD
FT                   KSRCVYTKGAFESVLDCCEYWYGDTSGGMVPLTEKDVEGILNNVDSLSSGGLRVLAFAK
FT                   KVMGKEEPIEKRSKVEAGLCFLGLIGIYDPPRPESLGAVKKFHKAGINVHMLTGDFPGT
FT                   AKAIAQEVGILPTNLYHYPKEVVDVMVMTGSQFDSLDENQVDELPVLPLVISRCSPQTK
FT                   VRMIEALHRRGKFCAMTGDGVNDSPSLKMANVGISMGLNGSDVAKDASDIVLSDDNFSS
FT                   ILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLVVGLAFQDEDGKSVFALSPVEVLWII
FT                   VFTSCFPAMGLGLERAAPDLMERPPNDSSAGIFTWEVIFDMISYGVIIAAVCMGSFTTV
FT                   LYGKDAGNLARNCNKSYTSPCHDVFRARSCAFATMTWCALVLAWEVVDMRRSFFRRQPE
FT                   TDEPCRQFFRDVYENKFLFWSIVVGFAGAFPVVYIPVINTSVFLHKSIGYEWGISIGFT
FT                   FVFWIGAELWKFGKRLYFRGQARAQNPEADLEKNALHDPFEAYSTFTSQSEILSQKVSH
FT                   "
FT   gene            complement(<528766..>529641)
FT                   /locus_tag="ZYRO0E06952g"
FT                   /old_locus_tag="ZYRO-ORF3752"
FT   CDS_pept        complement(528766..529641)
FT                   /locus_tag="ZYRO0E06952g"
FT                   /old_locus_tag="ZYRO-ORF3752"
FT                   /product="ZYRO0E06952p"
FT                   /note="highly similar to uniprot|P38238 Saccharomyces
FT                   cerevisiae YBR061C TRM7 2'-O-ribose methyltransferase
FT                   methylates the 2'-O-ribose of nucleotides at positions 32
FT                   and 34 of the tRNA anticodon loop"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30970"
FT                   /db_xref="GOA:C5E4K9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR028590"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4K9"
FT                   /protein_id="CAR30970.1"
FT                   /translation="MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNEEFHFLDDPNLK
FT                   RVVDLCAAPGSWSQVLSRKLFDKDDYTDRQIVAVDLQAMMPIDHVTTLQADITHPRTLH
FT                   QILELFGNHRADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTVCILKRGGTFVAKIF
FT                   RGRDIDLIYAQLGYLFDQVTCAKPRSSRGSSLEAFVVCQGYNPPEGWQPSLDTNSSVVE
FT                   FFQDCPVGSNENRTIAPFMACGSLESFDSDATYHVEPSATSLDPVQGPTNPPYKRALEL
FT                   KRSGRLTRAV"
FT   gene            <529855..>530502
FT                   /locus_tag="ZYRO0E06974g"
FT                   /old_locus_tag="ZYRO-ORF3751"
FT   CDS_pept        529855..530502
FT                   /locus_tag="ZYRO0E06974g"
FT                   /old_locus_tag="ZYRO-ORF3751"
FT                   /product="ZYRO0E06974p"
FT                   /note="highly similar to uniprot|Q03201 Saccharomyces
FT                   cerevisiae YDR041W RSM10 Mitochondrial ribosomal protein of
FT                   the small subunit, has similarity to E. coli S10 ribosomal
FT                   protein; essential for viability, unlike most other
FT                   mitoribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06974g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30971"
FT                   /db_xref="GOA:C5E4L0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4L0"
FT                   /protein_id="CAR30971.1"
FT                   /translation="MLRRSLYLSRFIRWQSNSAEIPSGVPPFAQRSPLTKENASEKPLP
FT                   INVEAVYHAPLKIPIQYGDLVADLQLRSYDHESLDFFADFIMRTGFYLGMPLTGPKPFP
FT                   TRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMWLSYITKHSVAGVGAK
FT                   CNVYQRAGLSLDMDNAASELQQSPVGESHNMDEAVGEKVLELLNSDEFKKHL"
FT   gene            complement(<530578..>531153)
FT                   /locus_tag="ZYRO0E06996g"
FT                   /old_locus_tag="Zyro0E.mRNA.3864.m"
FT   CDS_pept        complement(join(530578..531080,531138..531153))
FT                   /locus_tag="ZYRO0E06996g"
FT                   /old_locus_tag="Zyro0E.mRNA.3864.m"
FT                   /product="ZYRO0E06996p"
FT                   /note="similar to uniprot|P38239 Saccharomyces cerevisiae
FT                   YBR062C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30972"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4L1"
FT                   /protein_id="CAR30972.1"
FT                   /translation="MSTYEEEHGLSRENSEDARSASVDRRETRSQFQELFQTFGNNNSE
FT                   EDVDNSMLLLLLSQMIPASLQQEWMEQMEQSDKKGCSESFIDSLPRIPASKIKEDDSCP
FT                   ICCCTYKEDDHPLVAELPHCNHKFDLECISVWLSKSTSCPLCRDDVMSHKPGIDTSQVE
FT                   LEEDWGMFG"
FT   gene            <531316..>532419
FT                   /locus_tag="ZYRO0E07018g"
FT                   /old_locus_tag="ZYRO-ORF3748"
FT   CDS_pept        531316..532419
FT                   /locus_tag="ZYRO0E07018g"
FT                   /old_locus_tag="ZYRO-ORF3748"
FT                   /product="ZYRO0E07018p"
FT                   /note="similar to uniprot|P38991 Saccharomyces cerevisiae
FT                   YPL209C IPL1 Aurora kinase involved in regulating
FT                   kinetochore-microtubule attachments associates with Sli5p
FT                   which stimulates Ipl1p kinase activity and promotes its
FT                   association with the mitotic spindle potential Cdc28p
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30973"
FT                   /db_xref="GOA:C5E4L2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR030616"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4L2"
FT                   /protein_id="CAR30973.1"
FT                   /translation="MSNGPKPDAAKVRRDSLLQRNMLLSMRLNNSGNNENQQIGQLTSE
FT                   KNNGNWRKTLGVPRKLSIRSSKVGSPITGKVNNTTHGNPNVNGKRYSPQHSPKLNLKSL
FT                   SLKDFEIGKKLGKGKFGRVYCVRHKVTGFICAMKVMEKQEIMQYNVQKQFRREVEIQSS
FT                   LNHQNLTKLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYVYQMADALDY
FT                   MHQRNIIHRDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYLSPELIASK
FT                   EYDDKVDVWALGVLTFELVVNSPPFEEDSKELTSKRIVRGDLKFPNHISSDAQDLITKL
FT                   LRHNSKDRISLREVKQHPWITKNRPFW"
FT   gene            complement(<532475..>534094)
FT                   /locus_tag="ZYRO0E07040g"
FT                   /old_locus_tag="ZYRO-ORF3747"
FT   CDS_pept        complement(532475..534094)
FT                   /locus_tag="ZYRO0E07040g"
FT                   /old_locus_tag="ZYRO-ORF3747"
FT                   /product="ZYRO0E07040p"
FT                   /note="similar to uniprot|P53166 Saccharomyces cerevisiae
FT                   YGL064C MRH4 Mitochondrial RNA helicase plays an essential
FT                   role in mitochondrial function"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30974"
FT                   /db_xref="GOA:C5E4L3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4L3"
FT                   /protein_id="CAR30974.1"
FT                   /translation="MIRTSTLMRLSSWQQNVLGCFVRYYSKGSKRSSFSKKGLKLASAV
FT                   GSSKKKGSKSTVFNYGNFSGLKENEAANSESAARLISKITEFEHLKLLPQVRQAVKQLI
FT                   FQESLVKGEDLNSIRPSPIQVISVKKLSSSLMDPKLQTHAIAAETGSGKTIAYFAPMLD
FT                   YLKRQEEEDPERWKRFQEKAIIRSVILVPTHELVDQVYNTISKAEESLGMHTFRWRSGM
FT                   PHVEFLEAVKNRIDILVTTPAKLLSLFHINMISRPDRILSQVKFVALDEADTLLDQSWV
FT                   EDTYAAIRKLPNANHVVFCSATIPNEFNKTLQRLFPTVVPITTPRLHKLPNSLDFKVID
FT                   AAVSPYKNSKVRALAQILYAITNDGTEPNLDKRCIVFVNEKRDVPILVEKLTQNYGHTC
FT                   VGLSGDDSVEERSKKIQAFIQPPKPLTAEEPKTDTQESTKSFQIPDSNITIPSRIKSQG
FT                   ALSQKLKVLITTDLMARGLNFQALRNVILFDVPKTSIDLVHRVGRTGRMRQGGRVFMIV
FT                   DKSTKSWAKAVPKVARKNMALV"
FT   gene            <534298..>536202
FT                   /locus_tag="ZYRO0E07062g"
FT                   /old_locus_tag="ZYRO-ORF3746"
FT   CDS_pept        534298..536202
FT                   /locus_tag="ZYRO0E07062g"
FT                   /old_locus_tag="ZYRO-ORF3746"
FT                   /product="ZYRO0E07062p"
FT                   /note="similar to uniprot|P38688 Saccharomyces cerevisiae
FT                   YPL210C SRP72 Component of the signal recognition particle
FT                   (SRP) ribonucleoprotein (RNP) complex that functions in
FT                   protein targeting to the endoplasmic reticulum (ER)
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07062g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30975"
FT                   /db_xref="GOA:C5E4L4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013699"
FT                   /db_xref="InterPro:IPR026270"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4L4"
FT                   /protein_id="CAR30975.1"
FT                   /translation="MAKDNLTRLLSQLNVHSAQGESSKVQETCVELLENGCSEPGSILK
FT                   NLLVSIIQQDAYQLGLDMLKNYKHIDEKFGSEFALEKLYIFYKLNKLKEFQELYSVLNP
FT                   TSIDTVLKQNERQTAPLRGVLHVRAQFCYKNGFYDEAFKIYHYLATHNEKGIDDELELA
FT                   CNVRAPLTVTPELRSNLKLPLAPEDSSSSYDLMFNDSMIQCSLGLYDESLELLTKAHEL
FT                   AKQEGNESDLDAIQLQLAYVYQLKGDKVSCKQNLNDLLNRSDSSSPINLLAKNNLGAFQ
FT                   DFSKYTTNLNLTLRELNVENFTAIDQKHFTKQQWLLLHNNFLFLHLFNNNNIQPKSTIV
FT                   SRTLSNYKSLVEDINLETYSTQAKKAYHHAITMIKSTVEGSTIGFVLLAVQLLVVQKEW
FT                   DNAIRLGEMFLNKCWENSKIIPDGKHHIVCYILFLLYSTTARGHSKTILLQKLANETKV
FT                   LPRDVEFWKHVSFQYLECGDLKNSRKLLKQITGYIPDDEIIRQVLADDDLNVENGYEIT
FT                   SGIDVAALVGAGVTPLESNRIKKDTRSNKIQKKRLDIRKKRRAQKAKKLLATRTVTRSL
FT                   DPERWLPLKDRSTYRPKKKQQGKQTQGGAMNKKAEQSLDISKKSKKSNASKGKKKSRK"
FT   gene            complement(<536289..>536834)
FT                   /locus_tag="ZYRO0E07084g"
FT                   /old_locus_tag="ZYRO-ORF3744"
FT   CDS_pept        complement(536289..536834)
FT                   /locus_tag="ZYRO0E07084g"
FT                   /old_locus_tag="ZYRO-ORF3744"
FT                   /product="ZYRO0E07084p"
FT                   /note="highly similar to uniprot|Q08962 Saccharomyces
FT                   cerevisiae YPL211W NIP7 Nucleolar protein required for 60S
FT                   ribosome subunit biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07084g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30976"
FT                   /db_xref="GOA:C5E4L5"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016686"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR040598"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4L5"
FT                   /protein_id="CAR30976.1"
FT                   /translation="MRQLTEEETRVLFEKLAGYIGRSISNLVDSKDQPHVFRLQKDRVY
FT                   YVPENVSKLATSVARPNLISLGTCLGKFTKTGKFRIHVTALPILAPNAKYKVWIKPNGE
FT                   MPFLYGNHVLKAHIGKMSEDIPEHAGVIVYSMNDIPLGFGVSSKSTNECRDMQPTGIVA
FT                   FRQADIGEYLRDEDTLFT"
FT   gene            <537225..>538909
FT                   /locus_tag="ZYRO0E07106g"
FT                   /old_locus_tag="Zyro0E.mRNA.876.p"
FT   CDS_pept        join(537225..537376,537448..538909)
FT                   /locus_tag="ZYRO0E07106g"
FT                   /old_locus_tag="Zyro0E.mRNA.876.p"
FT                   /product="ZYRO0E07106p"
FT                   /note="similar to uniprot|Q12211 Saccharomyces cerevisiae
FT                   YPL212C PUS1 Involved in tRNA biogenesis; intranuclear
FT                   protein which exhibits a nucleotide-specific intron-
FT                   dependent tRNA pseudouridine synthase activity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30977"
FT                   /db_xref="GOA:C5E4L6"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR041708"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4L6"
FT                   /protein_id="CAR30977.1"
FT                   /translation="MSEDGLKPVYDDQVDEEAYKRGPQYKWTKARKSDYKDGDDSNGEA
FT                   PPEKKVKYEDKPLNDENGKPVEKERRLPKRKVAVMIGYCGTGYHGMQHNPPNLTIESEL
FT                   FTAFVEAGAISKANSTDLKKNGFMRAARTDKGVHAGGNLISLKLIIEDPQIKEKINEKL
FT                   PEGIRVWDIKRVNKAFDCRKMCSSRWYEYLLPTYSLIGPKPGSTLYDTIEQGKQELPGV
FT                   LDEDDESKQFWSEVDKDAREQFSEDELQTIKSYVPPPKDQFDGTDPTYHKVKRYKQMEN
FT                   LHRRQYRISQEKLKKFRSTMEQYLGAHNFHNFTLGKDFKESSAVRYMKEIKVSEPFVIG
FT                   DAKTEWVSIKIHGQSFMLHQIRKMISMATLMTRCGCPTDRISEAYGPQKLNIPKAPALG
FT                   LLLESPVFDGYNTRLEKFGYERIDFANYQNEMDSFKMKNIYDKIYKEEVDENVFNAFFS
FT                   YIDNFDRVTGAKGEETVDKTGTSVQKSIFEFLSAKGIPSSAATNTDTSKKDTSEAPKEI
FT                   PVATTGTEDESQVTPQEAEN"
FT   gene            <539098..>540420
FT                   /locus_tag="ZYRO0E07128g"
FT                   /old_locus_tag="ZYRO-ORF3742"
FT   CDS_pept        539098..540420
FT                   /locus_tag="ZYRO0E07128g"
FT                   /old_locus_tag="ZYRO-ORF3742"
FT                   /product="ZYRO0E07128p"
FT                   /note="similar to uniprot|Q01163 Saccharomyces cerevisiae
FT                   YGL129C RSM23 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30978"
FT                   /db_xref="GOA:C5E4L7"
FT                   /db_xref="InterPro:IPR017082"
FT                   /db_xref="InterPro:IPR019368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4L7"
FT                   /protein_id="CAR30978.1"
FT                   /translation="MFRLQSRQLTTSAIARAAPARGKAQGFAKKTSGNKTTARRITPDT
FT                   LYKNWQDTVHTARLNRYAVPVEIPTFKSSELQSLLNKVTFYSSQQYRSLYHLGAFKKSQ
FT                   FNELFPKPISFVREESTQKLIGLLQNSSNKRFVLTGEPGVGKSVLLSQAQAYAAESGQI
FT                   ILNFSQPYLFLNGRNDFFYDANLKQYVQPMYLKSLLRKILKSNDENLLRSITLKSDYKF
FT                   SNADPKDAAVKKFITFTKDKNNLFDLLTVKTHARNRGTLFQGLLNELVQQSQVPVFFSV
FT                   DNFSRMLTESFSAYKDVHGKNIPLLDLQVGKAIMEVIGGDIKFTNDQSSVVLAISGVDK
FT                   TNRTLPVGLNKLPADPYLKRKHLDPDFAAILQKGKVQEFEVPKLSKEEVKQLVEFYLKS
FT                   ELFLNKDIQSKSVEKLVDEKYFLSGNGNSRELLKSIVLMHL"
FT   gene            complement(<540507..>541856)
FT                   /locus_tag="ZYRO0E07150g"
FT                   /old_locus_tag="ZYRO-ORF3741"
FT   CDS_pept        complement(540507..541856)
FT                   /locus_tag="ZYRO0E07150g"
FT                   /old_locus_tag="ZYRO-ORF3741"
FT                   /product="ZYRO0E07150p"
FT                   /note="highly similar to uniprot|Q01159 Saccharomyces
FT                   cerevisiae YGL130W CEG1 mRNA guanylyltransferase (mRNA
FT                   capping enzyme), alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30979"
FT                   /db_xref="GOA:C5E4L8"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR017075"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4L8"
FT                   /protein_id="CAR30979.1"
FT                   /translation="MDSRNSPEVPGIIQPSNVTQDLRMMMCKLLNSPKPAKTFPGSQPV
FT                   SFQHADIEDKLLEQDYYVCEKTDGLRVLMLILINPVTREQGCFMIDRENNFYLVNGFRF
FT                   PRLPHKDKKELLETLQDGTLLDGELVIQTNPMTKLKELRYLMFDCLAINGRCLTPSPTS
FT                   SRLAHLGKEFFKPYFDLRLVYPDQCVTFPFKISMKHMSFSYDLLKVANSLEKLPHMSDG
FT                   LIFTPVKTPYFVGGKDSLLLKWKPEEENSVDFKLILNIPLVEDETLPKKDPSRWYHNYE
FT                   AKPIFDLYVWQGGADVNSKLQRFDCPFSKKELELLERTYKKFAELTLSDEQWQELKNLE
FT                   QPLNGRIVECTKDQETGAWKLLRFRDDKLNGNHTSVVQRVLESISDSVKLEDLAEVISS
FT                   IKQRWEMRRQNGRPPEGTSGQLPPQNHRPSNDVGSEPQGQPNYVDEEWSE"
FT   gene            <542057..>546487
FT                   /locus_tag="ZYRO0E07172g"
FT                   /old_locus_tag="ZYRO-ORF3740"
FT   CDS_pept        542057..546487
FT                   /locus_tag="ZYRO0E07172g"
FT                   /old_locus_tag="ZYRO-ORF3740"
FT                   /product="ZYRO0E07172p"
FT                   /note="similar to uniprot|P53127 Saccharomyces cerevisiae
FT                   YGL131C SNT2 22% sequence identity with S. pombe Snt2"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07172g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30980"
FT                   /db_xref="GOA:C5E4L9"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR029617"
FT                   /db_xref="InterPro:IPR034732"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4L9"
FT                   /protein_id="CAR30980.1"
FT                   /translation="MTGGEFLSLPRRRTTGKSVNYNEKEADAEMAKRIEQLEEARASNK
FT                   SSKPKKGRGGGIATNCSPNSTDKIKYQKFLNDKSIGWNFIPSVPPFFRKASRFSTILDL
FT                   ENAYVDIEEQSLYNPDSVLIKANDTIYMVSEPPGEPYYIGRVVEFVSKPEFRTIISKAS
FT                   KDVKKFPVKFFQVRMNWFYRSRDIQNRLNNVQPRLIYASLHQDVCPIESYRGKCTVVHQ
FT                   NDINTVAVDKFDFLTRSNNFYFSQLFDRYTRKYYKVITTDDLLKLQSFSPFLVVLNRRF
FT                   RYLFVEENYPLEEIIEKYILKKDEGAKKDDELWSDRCSICREWCSKSMSLKCEECTQAV
FT                   HLYCLDTPLDRKPNKGVVWFCFKCIKKQEGSEEALKELEKDQLEEKEFFDSSRQVLNEV
FT                   AQKELREGNFSSKNCCWFQYAGQTMVNHLKDLMYEHLSLPYPMKFSRVGSRYQWSGCNN
FT                   EEESTSRSYSPDFQQEERGTDTTSQLLWDMKNSKTSPDEVDRYVERCKAEYPPKLNMLP
FT                   ESCNFLDLAVTTLMKNDFDTELAFKKCGELASRESLQEPTFTPEEVKQFEDAIAEFGSE
FT                   LHPVSERVKTQPSSMIVRYYYHWKKTPNGKRIWGNFKGRKKNIGREQLHVENLNSIVQR
FT                   EERKSKRDRKPTKLALESESYKSQEGWKYLDDSSFETENAPSLKPCFQCMFCEIDYSPM
FT                   WYKVTGGSDDDYIKKRMQTGVNEKTETSEKNLPVTKGSKSKDKENKDKKLDALCIRCAR
FT                   IWRRYGVEWQPPLTVLKRLNGPSAASLYATLELVFNETNNNVLKLSSQQAHNKCLEWEL
FT                   VQDSELITRQRGDMISVPERLTKLKKSSMAARMQLYKMVKRPFDKAAWSKDRMLSDLQK
FT                   YLEQQQPKKPKVIPTINNIVNDPNDIAQQDRPRANKTDTTKKNESSNKVEPKKEQVFGI
FT                   SDELKQNLSSNGDLQVHVPLNGGDCGKITLDSEAKYLQLDEKIYGELNSRLDHSRKRFN
FT                   SDDLSQGSHQKKRLKSHDGLHFSKDFKTWNSKNISVITDEKDTARILNMYHQLDPFQSN
FT                   FSHEHQPENGSEDSMPIQKSVSIEGNSFQSDFEKPKDFCNVCGESFDQTLDEEINCYSC
FT                   GLSVHYYCYGVKIPADASRKRKLKFYKWYCDPCSNEIHPIVSTNYKCDLCYVKKFEDSL
FT                   CRGHLDCPDPNALKCTTSGSWCHILCAVFNPDIKFGCATNLQPVINANHVIAKNIGQVC
FT                   SICKLEGGGPIKCSLCSIKFHITCARSTPGFYLKMMMIKSTNIIEDKKIIRGIYDEEYS
FT                   ITPVALCGNHQSELHEIKDFYPLNWKMDENSKTLLQLYCENYKENPRMSTVSTRYLEQQ
FT                   SIWGENLFDHLDGLEQGKMARELAINSEKDKLIKNEVKICSNCGTDRSIFWYDQNICHA
FT                   CHISPKLGKFNANMPTQDQVGPRISKEDAAKVLDVLMPMETVVKNVKEEKKVPKSLTAK
FT                   GSSKKTKWVKETPGP"
FT   gene            complement(<546524..>547228)
FT                   /locus_tag="ZYRO0E07194g"
FT                   /old_locus_tag="ZYRO-ORF3736"
FT   CDS_pept        complement(546524..547228)
FT                   /locus_tag="ZYRO0E07194g"
FT                   /old_locus_tag="ZYRO-ORF3736"
FT                   /product="ZYRO0E07194p"
FT                   /note="similar to uniprot|Q08963 Saccharomyces cerevisiae
FT                   YPL213W LEA1 Component of U2 snRNP disruption causes
FT                   reduced U2 snRNP levels physically interacts with Msl1p
FT                   putative homolog of human U2A' snRNP protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30981"
FT                   /db_xref="GOA:C5E4M0"
FT                   /db_xref="InterPro:IPR003603"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4M0"
FT                   /protein_id="CAR30981.1"
FT                   /translation="MKFTPSVVIDAPTYYVDHFNGRFNTDKCVILRNMQLETDSELMTI
FT                   SLRHLPHPVQILDLTNNELTEFPYLRDNKDIHTLLLSRNQISQLNGDYLPRHLVHLVIC
FT                   NNNIVSFEQLNGLQNCPKSLRSLQLRGNRVIHLEGYREYVLRLIPSLQILDYSRVSDQE
FT                   RKHSKSVELSDRSIDLKKDSDIMPRDKDLEMMHMVIGKMSEERKKELNEQLANATSLDE
FT                   ISRIEKLLSGGV"
FT   gene            <548343..>549971
FT                   /locus_tag="ZYRO0E07216g"
FT                   /old_locus_tag="ZYRO-ORF3734"
FT   CDS_pept        548343..549971
FT                   /locus_tag="ZYRO0E07216g"
FT                   /old_locus_tag="ZYRO-ORF3734"
FT                   /product="ZYRO0E07216p"
FT                   /note="similar to uniprot|P41835 Saccharomyces cerevisiae
FT                   YPL214C THI6 bifunctional enzyme with thiamine-phosphate
FT                   pyrophosphorylase and 4-methyl-5-beta-hydroxyethylthiazole
FT                   kinase activities"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07216g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30982"
FT                   /db_xref="GOA:C5E4M1"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4M1"
FT                   /protein_id="CAR30982.1"
FT                   /translation="MVFAKDEVDYSLYLVTDSTMLPEGTTLYSQVENALENGVSLVQLR
FT                   EKNVDTKKFIEEAIEIQKLCKKFEVPLIINDRIDVALAIDADGVHVGQDDMPIPMVRKL
FT                   VGPDKIIGWSVGYTHEVEQLAQWGPDYVDYIGIGMVFPTNTKKNAKKSPMGPRGVARIL
FT                   DALENNNVDWCRTVAIGGLHPDNISRVLYQCNSLSGQRSIDGISVVSDIMAAKDAGAAT
FT                   KNLRDILDKGYYSFVNLQLSIKTIYDLDFSSHTKRFLEQVAKNRPLVQHITNKVHQNFG
FT                   ANVTLAIGSSPIMSEIKEEANDLAHIPHAALLVNTGSVAPLEVVKTAIQAYNDVKRPIV
FT                   FDPVGYSATTTRIVLNDTLLASGQFTCIKGNTGEILSLAGFSGKMRGVDAHEGDFDKNL
FT                   LAQATREVAFRFRTIAVCTGELDFIADGTLGGTYSLSDGTKDRVLKDLPCVVVSNGPIP
FT                   LMGDITASGCSLGSTIASLLGGANSDENPFELVVAAVELYKEAGRLASLSSEGSGSFHV
FT                   QLIDKLYNCFRSNPRTWAPKVETLN"
FT   gene            complement(<550030..>551040)
FT                   /locus_tag="ZYRO0E07238g"
FT                   /old_locus_tag="ZYRO-ORF3732"
FT   CDS_pept        complement(550030..551040)
FT                   /locus_tag="ZYRO0E07238g"
FT                   /old_locus_tag="ZYRO-ORF3732"
FT                   /product="ZYRO0E07238p"
FT                   /note="similar to uniprot|P21560 Saccharomyces cerevisiae
FT                   YPL215W CBP3 protein required for assembly of ubiquinol
FT                   cytochrome-c reductase complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30983"
FT                   /db_xref="GOA:C5E4M2"
FT                   /db_xref="InterPro:IPR007129"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4M2"
FT                   /protein_id="CAR30983.1"
FT                   /translation="MIQIVLARNGVLNQARSIPLRSRALLHQSSRLLNEKNPKPEELKS
FT                   PEDLARQSHLNSKPIDFTNYAPVRPGKKKTLLSDSKYESKDYQLPKWKEAFGELVIRTL
FT                   NLDMDKVRSGPVAGSYYYALCKNVALQYEGEKLSETAKFFYQDLKLPRTFSQWFQITIL
FT                   HEWLLFVRMRAMPFKYGRNYQQKLVDRTFTDIEARLFDEMNVTTGRIVDQYLKDFNTQL
FT                   RGAVFAYDEGFYTDDATLAAALWRNLFGGRKNIDMVHLEAMVRYVRSQLYVLSRMSDRD
FT                   FAVGSFKFVPPDETVERLTAEQEAQLKQKTIEKYESIDNDPKILPSDRSRLSYKN"
FT   gene            complement(<551290..>554739)
FT                   /locus_tag="ZYRO0E07260g"
FT                   /old_locus_tag="ZYRO-ORF3730"
FT   CDS_pept        complement(551290..554739)
FT                   /locus_tag="ZYRO0E07260g"
FT                   /old_locus_tag="ZYRO-ORF3730"
FT                   /product="ZYRO0E07260p"
FT                   /note="similar to uniprot|P53125 Saccharomyces cerevisiae
FT                   YGL133W ITC1 Component of the ATP-dependent Isw2p-Itc1p
FT                   chromatin remodeling complex required for repression of a-
FT                   specific genes repression of early meiotic genes during
FT                   mitotic growth and repression of INO1"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30984"
FT                   /db_xref="GOA:C5E4M3"
FT                   /db_xref="InterPro:IPR013136"
FT                   /db_xref="InterPro:IPR018501"
FT                   /db_xref="InterPro:IPR028941"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4M3"
FT                   /protein_id="CAR30984.1"
FT                   /translation="MVLYKRKPIMLPDPRPLPTDLNIYVWHIDETGEWFITYEEYLERL
FT                   DFYTRHHFTCEITGTSCLTFFQALDSEETEFRYVEERFPLKLREPVSRFLHFNGIKRLD
FT                   ALVEQVYAKFKNDFFPGEVVYLRKNNKELSATPSQPSPQPDDGANKENGDSTHIQYQRP
FT                   YIIKEKAQFNASKDPNTGEVITPAHSKYMLIEETQGSKSLIADQSQLYRDRTTFTKHLI
FT                   KCFCKITLRRASTKMGAPWAVKEEYLPMYGLTMDWPPEMLKYKDEEPVVKQDASKGKRK
FT                   REDEVEYLQGEEEENKRIEEEQRLKHEEEASSKRKRTAEEEREDSLAQENTAQVNVITS
FT                   IVEDLVLPYQGPPHVFENLYHYNNLLESVPVNRNNSSFKPFRETQKLLQVFQFLSTFAP
FT                   KMCLSYFNLDQLITSLKCTDPSELKGEIVYVELLDQHGESSFAENESDWQRNPKIREFI
FT                   KQRDTERVRHYIAKDDPASDEVIDNVNHNGCGLLIECISALLRLFINEDGDWTSLVMEE
FT                   WLDNNDINGQENSKTDKQGDGSGDGDDAESEFDDINDTLEKCLNYRNVGWAERLSKRQF
FT                   NNHYWTLILLGIFQDCMHIPLYTDVIRVLVEKLVPSDISATQLPKQLWRNFCFQLSLEE
FT                   KLNCIWILVDLLSNFSADIKTAVEESMDLCGQIRSERFRFAKDLKAETSYLNLLNVDLQ
FT                   ALEQAGTGDEPAIESHKARIAVQMEKLERLQKDKNFLDKKLMENDLQRLRTLGLDRYGN
FT                   RYYWMDLCGVPLGNVENTEDLSYHSGRLWIQGPAADAAEFFLQISNDELNQWKKLAEEH
FT                   GKAYATKEVFHVYKTPEGSYRYVEGGNEVEICDCNGIVNSLIELNSIQKKIIDETPDCL
FT                   LLSEDQWYSVDRVEDVRRLIDWFDNWGRREHDLLKQFKTMEDTLDIVYSIRDKVLHLFV
FT                   YDEEEERLFKELQEYEFTEEELNFDAPAKEANNNINGNNDDAENNERNNEEQQEDEEEE
FT                   GEKDEGERDEEELEEIAEKIMKLDDSSKTRKILNSIQELEDRRDELLAKRQAATAADGD
FT                   TTSSGGGKLQARAKKKRLKSIRNDKLNKQAEILTDLLNHRHFVAMEDTISWKNQLSTKI
FT                   LGTALRKNASGKQKIKIVETVDAKLKEIMDQTSRTTAATATN"
FT   gene            <555489..>559088
FT                   /locus_tag="ZYRO0E07282g"
FT                   /old_locus_tag="ZYRO-ORF3727"
FT   CDS_pept        555489..559088
FT                   /locus_tag="ZYRO0E07282g"
FT                   /old_locus_tag="ZYRO-ORF3727"
FT                   /product="ZYRO0E07282p"
FT                   /note="similar to uniprot|Q08965 Saccharomyces cerevisiae
FT                   YPL217C BMS1 Essential conserved nucleolar GTP-binding
FT                   protein required for synthesis of 40S ribosomal subunits
FT                   and for processing of the 35S pre-rRNA at sites A0, A1, and
FT                   A2; interacts with Rcl1p, has similarity to Tsr1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07282g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30985"
FT                   /db_xref="GOA:C5E4M4"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030387"
FT                   /db_xref="InterPro:IPR037875"
FT                   /db_xref="InterPro:IPR039761"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4M4"
FT                   /protein_id="CAR30985.1"
FT                   /translation="MSTMEQSNKEHRQRKEKNTAKKKLHTQGHNAKAFAVAAPGKMART
FT                   MQRSSDVNERKLHVPMVDRTPEDDPPPVIVAVVGPPGTGKTVLIRSLVRRLTKTALSEL
FT                   NGPITVVSGKRRRLTFIECPADDLNAMMDLAKIADLVLMMIDGNFGFEMETMEFLNIAQ
FT                   QHGMPRVLGVVTHLDLFKSQSTMRAAKKRLKHRFWTEVYQGAKLFYLSGVVNGRYPDRE
FT                   ILNLSRFISVMKFRPLKWRNEHPYMLADRITDLTHPEIIHSQGTKVDRKVALYGYLHGT
FT                   ALPADPGTKVHIAGVGDLSIGQVEKLPDPCPTPYYQQKIDEYEREKLKSEGGTTGTTTR
FT                   RRKRLDDKDKLIYAPMSDVGGVLMDKDAVYIDVGKKNEGPSFVPGQEKGEGERLVTSLQ
FT                   SADKNYAERFDGVGLQLFSNGTEYHAPEEGSSDEDADADESDKEVADSGRSSLRHAKTH
FT                   GKSVQDVDREVDELPSDEDEEDMEEGSEDEMPKSRLEEIDFDRDLEGDGHSEKLAMESD
FT                   SEFELSEPEGESWEVSTASKLKGSQNRRRKWDIGKLIYMDNIPPRECLKRWRNEDVGDE
FT                   EEEGSDIEQDEGEGFFKKNDGSFSKAHDYEGDLERFSPYFDKIEKLMEKWSSLDSLKDR
FT                   FIGVPKPEDSKEDGVSDEEGKDEEVYGDFEDLEGQEEQPSESDGDEGEHDSEEDSEDNE
FT                   SQGGDPSENESEDSFADFEKEEQKDNGGQNNNLSVEEERQQNMAKKEKLRFQFEMEEGD
FT                   NFKEDDPENEYDTWYELQKAKIAKQLEINNAELENMPVEQRHRFEGYKAGSYVRIVFEN
FT                   VPMEFIENFDSRVPIIMGGLLPTELKFGIINARIRRHRWHRKILKTNDPLVLSLGWRRF
FT                   QTLPVYTTTDSRTRNRMLKYTPEHTYCFASFYGPLCSPNTPFCGVQVVANSETGGGFRI
FT                   AATGMVEEIDANVEIVKKLKLVGFPSKVFKNTAFIKDMFSSAMEIARFEGAQIKTVSGI
FT                   RGEIKRALSKPEGHFRATFEDKILMSDIVILRSWYPVHVKRFYNPVTSLLLKSKNEWKG
FT                   MRLTGKIRADQGIETPANPDSNYQKVERVERKFNGLKVPKAIQKDLPFKSQVHQMKPQK
FT                   KKTYMAKRAVVLGGEEKKARTLMQQVYTLSRSKDEKKKAKKQDERKERLKRLAKAEEEK
FT                   VQRDKRKKKEYFTTQGKKRSGGETEGGSSKKRK"
FT   gene            complement(<559169..>559815)
FT                   /locus_tag="ZYRO0E07304g"
FT                   /old_locus_tag="Zyro0E.mRNA.3827.m"
FT   CDS_pept        complement(join(559169..559713,559791..559815))
FT                   /locus_tag="ZYRO0E07304g"
FT                   /old_locus_tag="Zyro0E.mRNA.3827.m"
FT                   /product="ZYRO0E07304p"
FT                   /note="highly similar to uniprot|P20606 Saccharomyces
FT                   cerevisiae YPL218W SAR1 GTPase GTP-binding protein of the
FT                   ARF family component of COPII coat of vesicles required for
FT                   transport vesicle formation during ER to Golgi protein
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07304g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30986"
FT                   /db_xref="GOA:C5E4M5"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4M5"
FT                   /protein_id="CAR30986.1"
FT                   /translation="MAWDLLGWFRDVLASLGLWNKHGKLLFLGLDNAGKTTLLHMLKND
FT                   RLATLQPTWHPTSEELAIGNVKFTTFDLGGHVQARRLWKDYFPEVNGIVFLVDAADPER
FT                   FGEARVELDALFNIAELRNVPFVILGNKIDSANAVSEAELRSALGLMSTTGDVRVEGQR
FT                   PVEVFMCSVVMRDGYADAFQWLSQYI"
FT   gene            complement(<560064..>561350)
FT                   /locus_tag="ZYRO0E07326g"
FT                   /old_locus_tag="ZYRO-ORF3721"
FT   CDS_pept        complement(560064..561350)
FT                   /locus_tag="ZYRO0E07326g"
FT                   /old_locus_tag="ZYRO-ORF3721"
FT                   /product="ZYRO0E07326p"
FT                   /note="weakly similar to uniprot|P53124 Saccharomyces
FT                   cerevisiae YGL134W PCL10 Pho85p cyclin recruits activates
FT                   and targets Pho85p cyclin-dependent protein kinase to its
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07326g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30987"
FT                   /db_xref="GOA:C5E4M6"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4M6"
FT                   /protein_id="CAR30987.1"
FT                   /translation="MELNFEKIQRPGFVPDGLSEASDIEEDDEDGFAINDLDDDDVENS
FT                   FELPIRASPYRFNNFSALNDDWRSFRRGNSGINKRVRFDNDRNNNGDEDGRNRSQSDSP
FT                   KGKKNVEELLQYANRVNEYLALNLEKIDMFRSELMDSDGMPYKSIGSETTLATTATTAS
FT                   GSVSNFELSESEMDEDKINLNSSVSGISSDSERAWEKTPLSQDSGRDELRIPSFEQILQ
FT                   HVRRANEREGEKETTENEDNISSITNCETMETSQAIEIFQNTINCILHMSQAQDQQDVP
FT                   NPRDWDFNQFSMKSMPTVTYQEFITRIQTKCTYSPAVFLASAFLLQTLCLMRNDNNGEL
FT                   CLRHRLQDSQIHRLVIACVRIATKIMEDHVHSHQYFSKVCGISKRLLSRLEISLVTCLK
FT                   DEQFMVTRERLAATAKIKDELVACESNQS"
FT   gene            complement(<561794..>562447)
FT                   /locus_tag="ZYRO0E07348g"
FT                   /old_locus_tag="ZYRO-ORF3719"
FT   CDS_pept        complement(561794..562447)
FT                   /locus_tag="ZYRO0E07348g"
FT                   /old_locus_tag="ZYRO-ORF3719"
FT                   /product="ZYRO0E07348p"
FT                   /note="highly similar to uniprot|P53030 Saccharomyces
FT                   cerevisiae YPL220W RPL1A and highly similar to
FT                   uniprot|P53030 Saccharomyces cerevisiae YPL220W RPL1B N-
FT                   terminally acetylated protein component of the large (60S)
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07348g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30988"
FT                   /db_xref="GOA:C5E4M7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4M7"
FT                   /protein_id="CAR30988.1"
FT                   /translation="MSKINSAIIRDNVKELLKYSTETKKRNFLETVELQVGLKNYDPQR
FT                   DKRFSGTLKLPECPRPNLSICIFGDAFDVDRAKSCGVDAMSVEDLKKLNKNKKLIKKLA
FT                   KKYSAFVASEVLIKQVPRLLGPQLSKAGKFPTPVSHTDDLYSKVTDVRSTIKFQLKKVL
FT                   CLAVAVGNVEMNEDSLVNQILMAVNFLVSLLKKHWQNVGSLVIKSTMGPSFRLY"
FT   gene            <563119..>564054
FT                   /locus_tag="ZYRO0E07370g"
FT                   /old_locus_tag="ZYRO-ORF3717"
FT   CDS_pept        563119..564054
FT                   /locus_tag="ZYRO0E07370g"
FT                   /old_locus_tag="ZYRO-ORF3717"
FT                   /product="ZYRO0E07370p"
FT                   /note="similar to uniprot|P53123 Saccharomyces cerevisiae
FT                   YGL136C MRM2 Mitochondrial 21S rRNA methyltransferase,
FT                   required for methylation of U(2791) in 21S rRNA; MRM2
FT                   deletion confers thermosensitive respiration and loss of
FT                   mitochondrial DNA; has similarity to Spb1p and Trm7p, and
FT                   to E. coli FtsJ/RrmJ"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30989"
FT                   /db_xref="GOA:C5E4M8"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4M8"
FT                   /protein_id="CAR30989.1"
FT                   /translation="MLSIHSLRLNLCFRGVSRPLGHFRFNSQGRWLDRQSNDHYTKEAK
FT                   VQGLRSRAAFKLMELDDKFHLFQGDKHKHQRVLDLGFAPGAWSQVAQRRIGPNGMVLGV
FT                   DILPCEPPKGVHSIQANILSRKTHELIRLYFSRHFQLYKSDHLHEHHGYFQHRLEEQLG
FT                   LIKNTDAYDEIFDVGLSSGKVDRFPIDTIISDMYECWPQITGYWNNLTNAAYYRMANTS
FT                   GVAIRDHYQSIDLADAALVTAIDLLRPRGNFVCKLYTGKEDKLFEKRLRKVFQRVNRFK
FT                   PASSRGESKELYFIGLGKKDPIDKLDVFSV"
FT   gene            complement(<564166..>567028)
FT                   /locus_tag="ZYRO0E07392g"
FT                   /old_locus_tag="Zyro0E.mRNA.3702.m"
FT   CDS_pept        complement(join(564166..566841,567011..567028))
FT                   /locus_tag="ZYRO0E07392g"
FT                   /old_locus_tag="Zyro0E.mRNA.3702.m"
FT                   /product="ZYRO0E07392p"
FT                   /note="highly similar to uniprot|P41811 Saccharomyces
FT                   cerevisiae YGL137W SEC27 Involved in beta'-subunit of yeast
FT                   coatomer"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07392g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30990"
FT                   /db_xref="GOA:C5E4M9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016453"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4M9"
FT                   /protein_id="CAR30990.1"
FT                   /translation="MKLDIKKTFSNRSDRVKGIDFHPSEPWVLTTLYSGRVEIWNYETQ
FT                   TEVRSIQATDSPIRSGKFIARKNWIIVGCDDYRIRVFNYNTGEKVVDFEAHPDYIRSIA
FT                   VHPTKPYLLSGSDDLTVKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDS
FT                   TVKVWSLGQPTPNYTLTTGQERGVNFVDYYPLPDKPYMITSSDDLTVKIWDYQTKSCVA
FT                   TLEGHMSNVSFAVFHPTLPVIISGSEDGTLKIWNASTYKLEKTINLGLERSWCLATHPT
FT                   GKKNYIASGFDNGFTVLALGKDVPTLSLDPVGKLVWAGGKNASPSDIFTAVIRGNEEAE
FT                   ESEPLLLQTKELGSVDVFPQSLVHSPNGRFVAVVGDGEYVIYTALAWRNRSFGKCHGFV
FT                   WGPDSNSYAIVDETGQVRYFKNFKEVTSWSIPLQYGVERLFGGGLLGAKSDGFIYFFDW
FT                   ENGNLVRRVDINARDVIWSDNGELVMILNTEEGRGDEASAYSLAFNKDVYEEAVTKGEI
FT                   DEDNGVDDAFDVLHELNESITSGKWVGDVFICTTSTNRLNYFVGGKTYNLAHLTKEMYM
FT                   LGYLVRDNKVYLADREIHTYGYNVSLELLEFQTLTLRGELEEAMNTILPNVESKDTLSK
FT                   IARFLEGQELYEEALKTSPDTDQKFDLALKVGQLTLAYEILGEEESELRWRSLGDASLQ
FT                   KYNFKLASEAYMKAHDLESLFLLHSSFNNTEGLLSVAKDAEALGKYNLSFKAYFIAGDV
FT                   ESAKNLLVKLGKFPEAALLSVTYGIESDGVNSVVTKWKESLKADGKTAIADRICFSEKN
FT                   APNASPLIDIDSAPSGKEETDEQASPAEAAEEVVNEDTQPKESQTTEEPQEPTAAKPEA
FT                   PVEKEESQTEVPTQEASETKEESKKE"
FT   gene            <567345..>568721
FT                   /locus_tag="ZYRO0E07414g"
FT                   /old_locus_tag="ZYRO-ORF3715"
FT   CDS_pept        567345..568721
FT                   /locus_tag="ZYRO0E07414g"
FT                   /old_locus_tag="ZYRO-ORF3715"
FT                   /product="ZYRO0E07414p"
FT                   /note="weakly similar to uniprot|P53122 Saccharomyces
FT                   cerevisiae YGL138C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07414g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30991"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4N0"
FT                   /protein_id="CAR30991.1"
FT                   /translation="MILKIFWYFFTWLSFYQISNAAPVENKIWKALETQDKICSMKYAH
FT                   HEGSYKKMFETLSGLSIPAPLREHDKKPYTGFKLLRSYNIQLLNLGLSSAIHVVFCREG
FT                   KIQWNIKQPLEDDIDWTTPLCVYTPDASVDSTITSNKNNKNNKNNKNNKNNKNNKNNKN
FT                   NNKRTSKEKALEDLNNLHCFKLARRKKYTNRKASLFFPKSWVGGMFYCDLDDDMKRRAL
FT                   DNMEGNLKFKRNKGQDLCNRQNSMPLVPMQSDDYSKYWVEFSSLGASKFSTKVFKPQIT
FT                   KYVPYINTPNDAFSVLNFEHNGNVSVASTAALNWGKPFREQALAVFQKNKMYTSGKDPW
FT                   FSEIEVDEKYQLSSEDLSLWQTWTDHAATKLSSVTNKPSKSFVSLTSIDTKNNATSTSH
FT                   LKGFLSRILKKVESKIWNRLQLRDKIISVLGDDPESLQYLQTEWKNLQMNREMFDYSYQ
FT                   "
FT   gene            complement(<569155..>571524)
FT                   /locus_tag="ZYRO0E07436g"
FT                   /old_locus_tag="ZYRO-ORF3714"
FT   CDS_pept        complement(569155..571524)
FT                   /locus_tag="ZYRO0E07436g"
FT                   /old_locus_tag="ZYRO-ORF3714"
FT                   /product="ZYRO0E07436p"
FT                   /note="similar to uniprot|Q08967 Saccharomyces cerevisiae
FT                   YPL221W BOP1 Protein of unknown function overproduction
FT                   suppresses a pam1 slv3 double null mutation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30992"
FT                   /db_xref="GOA:C5E4N1"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="InterPro:IPR032800"
FT                   /db_xref="InterPro:IPR040241"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4N1"
FT                   /protein_id="CAR30992.1"
FT                   /translation="MRLLMLWWLTTSWLACLATAKRKVFSTSLVTCMENSKLSANTFNV
FT                   TFNPHDRSLRYTFTMVTDIQDYVLAEMEVYAYGFKVVTKSFNPCNMGWKQFCPLSPGDV
FT                   QIDSVEYVAKKYTDDIPGITYHVPDIDAYVIVKVYNYQREYLACVQAFFSNGKTVSQTG
FT                   VKWASAVIAGIGLLLSAVLSTFGNSTAASHISANTMSLFLYFQSVVVVTMEHVHRVPPI
FT                   AEAWAENLAWSMGLIRITFMQRIFRWYVQSTGGKPSLNLTSRKISVLTQRSLDYIKDRQ
FT                   LIKRAKDVLYGNSQVMIFRGIKRLAYDVNIENTAVVCTGFTFFVLCGYVLAGFIIASKN
FT                   ALELSAKCGWIKSTRFVDFRQNWRQVLKGALLRYIYIGFTQLTILSFWEFTQRDSPAVI
FT                   VIACLFIVLAVGLMAWSAFRTTFFAQRSIEVYNNSAALLYGDERVLHKYGFFYTMFNAT
FT                   HYWWNIVILSYMFVKAIVIGFAQSSGQAQSLLIFILDLAYFIAIIYFKPYLDRPTNIMN
FT                   IFISTVTLINSFLFMFFSDLFGQSYAVSAVMGWIFFILNAAFSFILLMMILTFTVMILF
FT                   TKNPDVRFKPAGDDRRSFQRFSLKSTNGMNASVAAELAALGNVAKDHNDNWENQLGDQK
FT                   SQTDDVNVFTLDDEKLDELRAAKQRSNSTSSGINKPTTFKDKVMRKLSLRRSGKGKRNP
FT                   EFAGNDLTSLTPDSESVASAGTPPRNYPGVHQRQPSESRNRLMDSYDDVGEGFNFLPVR
FT                   EGDENLSEDEFEMPRRDASLDTMAQHNGAMRSADIL"
FT   gene            complement(<572497..>575538)
FT                   /locus_tag="ZYRO0E07458g"
FT                   /old_locus_tag="ZYRO-ORF3711"
FT   CDS_pept        complement(572497..575538)
FT                   /locus_tag="ZYRO0E07458g"
FT                   /old_locus_tag="ZYRO-ORF3711"
FT                   /product="ZYRO0E07458p"
FT                   /note="weakly similar to uniprot|P36775 Saccharomyces
FT                   cerevisiae YBL022C PIM1 Mitochondrial ATP-dependent
FT                   protease involved in intramitochondrial proteolysis
FT                   involved in degradation of misfolded proteins in
FT                   mitochondria required for bigenesis and maintenance of
FT                   mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07458g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30993"
FT                   /db_xref="GOA:C5E4N2"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027501"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4N2"
FT                   /protein_id="CAR30993.1"
FT                   /translation="MFFGKNDNVTDIQDFPCLTLNNAPRVVPIPGILYRLTYELEVGQN
FT                   ILGNFKNLKSYENHLLLTGVKGRDKDQPSDSKIANSLTKFRTNHDSPNEEKSLYLTLIP
FT                   SEYGDPCVGCVAKVVGVLTEQKTMTISFKTQKRAIVKAPLVNSGNQVFNSTIKVVDDFP
FT                   GISKLTREQLKRGPQEFKELFNSIDETIRSFKSQYKQPAKNKKSSQHLLFLSPLSNTLF
FT                   FQLNKTGFNKAWSIILGLVVDLENNVKKRSDPEIYLEVLKLVDLITAVLPISVHQKWTI
FT                   LTTTNFTERFQNFGNVLQNFQNVFETLYASTGYVQQYFTQASNLDKSRLIANQLKSLKF
FT                   FIDDVKAQNTFPADVEKRHNKPKTLVPRNFHFDKGSNSKEGKVDEDEEDEEDIDLLKKF
FT                   IDNIRQYEIHPDGIKMLKKDFKRFAKMSPQNTEYQVLKNYFDIITDIPFGRYGEREPID
FT                   VNKSRNTLDKDHYGLQMVKKRLLEYLCILKLQEKLGNIKKRAPILLLVGPPGVGKTSIA
FT                   KSVAQVLNRQFQRVSLGGIHNEADIRGHRRTYVGSMCGLIINALRKSDCMNPLILLDEV
FT                   DKVLSTTGSSAGYSSKINGDPGAALLEVLDPEQNNTFMDHYLGFPVDLSQVLFFCTAND
FT                   LSGISRPLLDRMEVIEIPGYTPEEKIQIGTNFLLPKQISLNGLDSCNCEFQISDKAWKS
FT                   LVLEYTREPGVRSLERQLAAIVRGKVSEVVETGKYEEKNSTSRSENEVLQPKELLKYLG
FT                   FPLHPITRELLQQIKHAEKEGVVNGLSYNSDGTGSVLVFEVIKTGGSDGQDISNTKNGP
FT                   TIISTGNLGNVLQESINIAKSVVKVMLRKKQLVFPPQVVINLQEFLSSEYHLHVPAGAI
FT                   SKDGPSAGAAIALALLSVALKKPVEPTICMTGELTLRGKILPIGGIKEKLLGARIYGMH
FT                   KVLVPLANRSDLVEALTDDVAPFANGQDRSELDLVKQKMHLQVCYVDTIHDVVRHAWPD
FT                   FSDASSPSSNTWTLPDNNSHRAKL"
FT   gene            complement(<575943..>577946)
FT                   /locus_tag="ZYRO0E07480g"
FT                   /old_locus_tag="ZYRO-ORF3710"
FT   CDS_pept        complement(575943..577946)
FT                   /locus_tag="ZYRO0E07480g"
FT                   /old_locus_tag="ZYRO-ORF3710"
FT                   /product="ZYRO0E07480p"
FT                   /note="similar to uniprot|Q08968 Saccharomyces cerevisiae
FT                   YPL222W FMP40 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30994"
FT                   /db_xref="GOA:C5E4N3"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4N3"
FT                   /protein_id="CAR30994.1"
FT                   /translation="MSDGRCVFNVLKESGTSRFVKSLTPDSAVPNVKRAIALAESQDVK
FT                   KRVLPFHQPRNVSRGCHFAYTLPEQRPHYRTLLKSVQTHADMDLKMDEKLEKLLSGEQV
FT                   YYDESQGIFPYSTAYAGFQFGTFAGQLGDGRVVNLFDVQDNKGNWQTLQLKGSGLTPFS
FT                   RFADGKAVLRSSIRELIISEALYHIGVPSSRALQLTLLPETRASRERKSEPCAVLCRVA
FT                   PTWLRIGSFDLFRFRPHLKGLLGLTHFAIDEVFNGGKDFPRKRDLNIFRKDFFPNDGIE
FT                   QGAEARNPVEGSTIYDEFYRHVINLNAKCVASWQTYGFMNGVLNTDNTSIMGLSLDYGP
FT                   FNIMDQLKPDFTPNHDDIAGRYSFENQPSAIWWNLIMLGHDLSVLIGAGPSHIDKILSM
FT                   QELSEELPAEVEKEVVNRANDVIALAGNEYKFTFLSEYANLMGKRIGIDLGLSSDLTNA
FT                   EEIAAQSSQVHDFLSNILEPLLNILETTEVDYNHFFVKLQNYRGPLFDDDGAEGLSRSF
FT                   LSLFLHAPQIEQLQAFKSGEIDINADSGGVRIVMGTVERLSQWAKEYVKFVPDEQKRSE
FT                   IAKEVNPLFTPRAWMFDEVVDDFMDNQRTELNDPESKIDNSLLSKLFLMSSNPYDPSKW
FT                   EESLRPDVQERWMNLEHESIREKYLKQATCSS"
FT   gene            <578645..>580657
FT                   /locus_tag="ZYRO0E07502g"
FT                   /old_locus_tag="ZYRO-ORF3709"
FT   CDS_pept        578645..580657
FT                   /locus_tag="ZYRO0E07502g"
FT                   /old_locus_tag="ZYRO-ORF3709"
FT                   /product="ZYRO0E07502p"
FT                   /note="some similarities with uniprot|Q03213 Saccharomyces
FT                   cerevisiae YMR172W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30995"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4N4"
FT                   /protein_id="CAR30995.1"
FT                   /translation="MSDTTNPLVVGGTTAMTPNGNGLLDTSQPVTNVQVGDGPSPSLNM
FT                   TTAAGGSASGQQPEPLALNLNLALESDPLAANNHTAPNNNNSSRASTAGQTSTNTAAAA
FT                   AAAAVAAANSTGNASTNMNSNSNTTMPTPVMEGSNPGSTNSAGLTGTYPSMNSIPSASP
FT                   SRTIPNDRSTNTVRMFQRMDELSARFIVMEEMFQKLCKTVEQQSLCMADLKLQNSQMCQ
FT                   EVSGKLDEICQQQRHYGEQPNDQDSFVTDLLNSITNVSSSYLRKIRSRSRPGSTKVSPQ
FT                   QQGITPPGGQWTQYDQAATTQNFAQTQSNSVPCDKMFTLNPNGIKRRRHNPPHSNVTSG
FT                   APSYTDLASLNNLGTISLPNLALDHTGITPLIRSGGSGGANGPLGFPTHPTQDQQQQQP
FT                   QQPQQPPQHSSRGRGIHLEIGSELASANEDEDGYQEEDDDDDNSVLAKTHSSSDGGSSS
FT                   SEDASAEEEDEADDEIDNATKESSGNRSNNVNLNARAKRKRPRLADQNMRNLIGNSDDV
FT                   SVRNTPDRNERLVLKNSRSAIGQLVGSSTNSLPDVVGNNVVNTSPNSRDLNYTLLKAPT
FT                   DVRTIWKEYVSGIGGDPPIKKLEEKYGNKWRLNHNRKTFARRKRLYKFIINGMNKGKSA
FT                   DEMIDALERRRLYRDENGEVKRRTIGWLQQSLTGI"
FT   gene            <581568..>583061
FT                   /locus_tag="ZYRO0E07524g"
FT                   /old_locus_tag="ZYRO-ORF3705"
FT   CDS_pept        581568..583061
FT                   /locus_tag="ZYRO0E07524g"
FT                   /old_locus_tag="ZYRO-ORF3705"
FT                   /product="ZYRO0E07524p"
FT                   /note="weakly similar to uniprot|P18899 Saccharomyces
FT                   cerevisiae YMR173W DDR48 DNA damage-responsive protein
FT                   expression is increased in response to heat-shock stress or
FT                   treatments that produce DNA lesions"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07524g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30996"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4N5"
FT                   /protein_id="CAR30996.1"
FT                   /translation="MGLFSKVKEVVSNKSSGGDLVDKAESVAGKDKVEKARKTVGDDKF
FT                   SKGEDFIRNKLNNTHLDDDKKGGKSGKNGDSYGGGDAYGSSGKNKGSSYGDDSYGGSSS
FT                   GKNKSSYGDDSYGGGDTYGGSSSGKGKSSYGDDSYGGGDTYGSSGKGDTYGSSGKGKSS
FT                   YGDDSYGGSSSGKGDTYGSSGKNKSSYGDDSYGGGDTYGSSGKGKSSYGDDSYGGSNAY
FT                   GSSGKGDTYGSSDKGKSSYGDDTYGGSSSGKGKSSYGDDSYGGDTYGSSGKGDTYGSSG
FT                   KNKSSYGDDSYGGGDTYGSSGKGDTYGSSGKGKSSYGDDSYGGSNTYGSSGKGDTYGSS
FT                   GKNKSSYGDDSYGGGDTYGSSGKGDTYGSSGKGKSSYGDDSYGGGDAFGSSGKGKSSYG
FT                   DDSYGGGDAFGSSGKGKSSYGDDSYGGGDTFGSSGKGKSSYGDDSYGGSNTYGSSGKGK
FT                   SSYGDDDNLGSTGGYGGGSDNYGGSGGYGSSGRGGGSNW"
FT   gene            <585395..>589354
FT                   /locus_tag="ZYRO0E07546g"
FT                   /old_locus_tag="ZYRO-ORF3701"
FT   CDS_pept        585395..589354
FT                   /locus_tag="ZYRO0E07546g"
FT                   /old_locus_tag="ZYRO-ORF3701"
FT                   /product="ZYRO0E07546p"
FT                   /note="weakly similar to uniprot|Q03214 Saccharomyces
FT                   cerevisiae YMR176W ECM5 Non-essential protein of unknown
FT                   function contains ATP/GTP-binding site motif A null mutant
FT                   exhibits cellular volume up to four times greater than
FT                   wild-type also large drooping buds with elongated necks"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07546g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30997"
FT                   /db_xref="GOA:C5E4N6"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR036431"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4N6"
FT                   /protein_id="CAR30997.1"
FT                   /translation="MVPLEPNQIKARRVIEDDSNGKFLKETEWGAKVYLGSGSVPILYV
FT                   ARDKLPDPLELYSKILDMGNEYGLVKLVVEGEEGQRERDSLSILSLHADIVWFRSRTQF
FT                   LKSFKTQRRKILRFHRRLYSCHKNLGHVINKVPSIDKRTLDLYRLWRCVQLRGGYKQVC
FT                   QRKLWAQIGRELGYSGRIMSSLSTSLRSAYVKVLLDLELDPRFLQDEEKSDIARDSNGI
FT                   FEVSNSKPDIKLLKGLKKFKGFKSNSHNIYESKKNFNTNYLPGYDLTNWIHSLETYDTA
FT                   QHEKKNLSMYNLRQYYEKSIEYDEKLGQLNQGEISLSHFEKIYWQNLASPITIDVDTSL
FT                   DLPSVKHNFNLLTCLQPSEREKMLKDPWQLNRLPLHRDSLLKFLDLDLGEFTYSHIDVG
FT                   MLFSTKSWSMGPLGMPSLHYNHLGSTKIWYSVPPSQWDKFQNLLKELNHKNSVKENEAE
FT                   EEDDEVNDVNDQTFDATFKFSDIHKSFLETNQLDQDGKINVHNIFDKEPPLNEERLTNE
FT                   LVITPDVLTRNGITLNKITQECGTYIFKFPRTHTFNVDTGFCLSECANFAPFSWLDKHW
FT                   FKTIENDRIISPLPRIDPFQFLMKIFLNSNDSLTIDKCRNLLKDPIEKELRNRVYVQHK
FT                   FISKTQIVENRFDYISDLSLQPTGASKVVLCNDSDCVTLSLREFLDMVVITENGSEEIF
FT                   GLSIDDRTLQVQLHLYYDDSILKRIIDLPYSESKESNIFDNKDLDSLVNVQYANKRIAM
FT                   SCAKEILSTRSGHGVMPLIDALKHAELLKSECGTILERVAAELINPSSIIVKQGEGFNL
FT                   VDLLSQSSGFCDLETLGRIESEIKQCSIEFPEMTQFLQLCEEVNEIQSEAQMAMKNQDL
FT                   EILEKCFALNCSLGIKNDLIAFTIGKLSWLRVYHDVFENPYHARFEENPKDYSLDAMSW
FT                   FLIFGTKYCGPEDLDKLNRVKTTIAKTQALNAKFHELFKGKKPKFKISVQDIASLSAAI
FT                   NQEKLPLNPELVKLLKAIAESVDKVRENMVPIWKMLSVDEQLIEQLKFLIKNESIKSFE
FT                   LFPKFNGGPDDKRIQLKDVSEQKLFIKQRKACKLWLADASRLCSKNGIDKLKHRLENCL
FT                   DLTKDVIRAPGEPTALYCFCREADNGATMVECEICKEWYHTKCIKKGSWKLPDESVFIC
FT                   SLCSPDDTIQDEYANCVDFNDVTNLVLESLDLKLLPDRNMVFDLFTIYGKMMVFKKKME
FT                   RELFQDNGQLNPDIPLHNVKFFLRKAYGAKCNFGNVNKILKDYCKSRDAAPIDQMAKSG
FT                   HIVVTDQPQQLKQEKPSFSSFAENTDNEDEKNKAV"
FT   gene            <589794..>591305
FT                   /locus_tag="ZYRO0E07568g"
FT                   /old_locus_tag="ZYRO-ORF3699"
FT   CDS_pept        589794..591305
FT                   /locus_tag="ZYRO0E07568g"
FT                   /old_locus_tag="ZYRO-ORF3699"
FT                   /product="ZYRO0E07568p"
FT                   /note="similar to uniprot|Q03218 Saccharomyces cerevisiae
FT                   YMR177W MMT1 Putative metal transporter involved in
FT                   mitochondrial iron accumulation closely related to Mmt2p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07568g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30998"
FT                   /db_xref="GOA:C5E4N7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4N7"
FT                   /protein_id="CAR30998.1"
FT                   /translation="MLRISNIRGSVLQFVGSQRPPSSIRIRLHNVAAFHSSAQLKNTAS
FT                   NDKQREELVEKQLEKNPNFHHDLGLDSHGHDHIHLRLSETEENDQMTLGSMPHRRAQKN
FT                   TAHHHGHSHANVSLNPLLVLNKDQMRNNPGVRITWIGLAINVGLALGKFAGGIAFHSQA
FT                   LVADSVHAVSDMVSDLLTLFSVTLADNRSTKDYPFGYGKIETVGSLAVSAILTTAGLSI
FT                   GWSSLCAIVGPIVPQSILETLGHFVGHGHGHSHSVANEVTNVNAAWIAAGSIAVKEWIF
FT                   QATKKIAVQSNSNVLMSNAWHHRVDSLTSLVALVTISGGHFLGLQSLDAVGGLIVSGLV
FT                   IKAGGEGMVGAVKELCDQSLSPEDARYVEVKLALEEALSKLISNNNAGRPYGIKFLTIL
FT                   PSGPNLTAMSTLEVPLQKWGNVLGIREFEVVTDHIRCVLYKNLPRLKYLNIEFVEEEQE
FT                   LTQDELDRMAKPQTELPELEHKSDGSRQGHTHSHFGMGAGHTHNH"
FT   gene            complement(<591361..>591801)
FT                   /locus_tag="ZYRO0E07590g"
FT                   /old_locus_tag="ZYRO-ORF3697"
FT   CDS_pept        complement(591361..591801)
FT                   /locus_tag="ZYRO0E07590g"
FT                   /old_locus_tag="ZYRO-ORF3697"
FT                   /product="ZYRO0E07590p"
FT                   /note="highly similar to uniprot|Q08971 Saccharomyces
FT                   cerevisiae YPL225W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07590g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR30999"
FT                   /db_xref="InterPro:IPR008476"
FT                   /db_xref="InterPro:IPR021148"
FT                   /db_xref="InterPro:IPR023139"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4N8"
FT                   /protein_id="CAR30999.1"
FT                   /translation="MSTFNANEAENLEDIEKQFAVVAVEQAETYWNLLTKVPGSRLRLT
FT                   RYDDEIYNTFMEHFPEFRDVEKLKKFSEQDIKNKTAKDRWRKFCALYEKTIEDYNFGTL
FT                   LRTDSTQEYGQFSTCFVVRIQFYAFEIARNKHGLNDWAAAKK"
FT   gene            <592487..>593359
FT                   /locus_tag="ZYRO0E07612g"
FT                   /old_locus_tag="ZYRO-ORF3696"
FT   CDS_pept        592487..593359
FT                   /locus_tag="ZYRO0E07612g"
FT                   /old_locus_tag="ZYRO-ORF3696"
FT                   /product="ZYRO0E07612p"
FT                   /note="highly similar to uniprot|Q03219 Saccharomyces
FT                   cerevisiae YMR178W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31000"
FT                   /db_xref="GOA:C5E4N9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4N9"
FT                   /protein_id="CAR31000.1"
FT                   /translation="MQRFIRPLSQATKLFDMPKVSAACMIIGDEVLNGKIIDTNSRFFA
FT                   RYCWDNGISLREIVTVGDDESQIVESLQHLTKKYQLVVTSGGIGPTHDDITYESIAKTF
FT                   QLPVKLDPELQRRMQKLSNPESHLSDQALNDFYRMATVPFGPQVKNYYVDDKLWVPICS
FT                   VDHKVYILPGIPQLFKRMIEGFTPQFKEIYGLKEDTREYVRFFVKTPFTESQISYFLRK
FT                   LQEEAAQVSEDIKIGSYPHFGMGFNTISILGTKDNEDYLKNLSDKTIKELKGEPIAAEL
FT                   EEKYSNLQN"
FT   gene            complement(<593495..>597025)
FT                   /locus_tag="ZYRO0E07634g"
FT                   /old_locus_tag="ZYRO-ORF3695"
FT   CDS_pept        complement(593495..597025)
FT                   /locus_tag="ZYRO0E07634g"
FT                   /old_locus_tag="ZYRO-ORF3695"
FT                   /product="ZYRO0E07634p"
FT                   /note="highly similar to uniprot|Q7LHP2 Saccharomyces
FT                   cerevisiae YPL226W NEW1 This gene encodes a protein with an
FT                   Q/N-rich amino terminal domain that acts as a prion termed
FT                   [NU]"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31001"
FT                   /db_xref="GOA:C5E4P0"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4P0"
FT                   /protein_id="CAR31001.1"
FT                   /translation="MPPKKFADLSEFLEDQAPEPGYVPSPYGGYFKNANNYQQQRSYNN
FT                   TNKGPSYNNQNSNNYYNQSYNNSQNYGSQNYRGGYNDYQYQQSAVTPDQSKTPTPSAST
FT                   TSLTSLNDNMANLQVSPVSAALEQIPQCKTIADCKKKLDIVIEEFNKDGASAKDLETWS
FT                   IPDVLTKFAKQKNPALVKESAMLLIGKLAQHFHDKHPQEAYLLPFFDFALDAVADKENT
FT                   VKRAAQQSMDSLVNIFPLEALTSSVLPRILEYLASGAKWQSKLAALGIIDRIREDSPND
FT                   LLELTFKQTVPILTDVATDFKPELAKRGYETLLNYVSILDNLDLAPRYKLIADTLQDPS
FT                   KVPQCVRALSSVTFVAEVTEPALSLLVPILNRSLTLSSSSQEQLRQTVIVVENLTRLVN
FT                   NRIEIESFIPQLLPGVQKVVDTASLPEVRELAGKALQVLKEDEEPNTADYFPGRIATSE
FT                   GKDFLLKRLPKLSINDRLLQIFLQDEKTIQYLAELLTVDANVNDWKRLQEFLISVFGEI
FT                   NEEAIVANFINDLRAIFHQEKTQYDESEGVEIVNTDFSLAYGSRMLLNKTTLRLLKGHR
FT                   YGLCGRNGAGKSTLMRSIANGQLEGFPDKNTLRTCFVEHKLQGEEGDLDLVSFIALDEQ
FT                   LQQTSREEIANALAEVGFDESKRVQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNH
FT                   LDTANVKWLEDYLLDHTEITSLIVSHDSRFLDAVCTDIVHYENKKLAYYKGNLAKFVEQ
FT                   KPEAKAYYTLSDSNSQMRFPPPGILTGVKSNTRAVAKMSHVTFTYPGAPNPSLNDASCA
FT                   LSLSSRVAVLGPNGAGKSTLIKILTGELVPQEGEVQKHPNLRIGYIAQHALQHVNEHKE
FT                   KTANQYLQWRYQFGEDREVLLKESRKVSEEEKEILKKEIDIGDGFSARTIEAIVGRQKL
FT                   KRSFQYEIKWKLWKPKYNSWVSRERLVEEGFGKLVQKFDDFEASREGLGYRELIPSVIT
FT                   KHFEGVGLDSEIANHTPLGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDALGAM
FT                   AVAIRDWKGGVVMISHNSEFVSALCPEQWIVENGKLTQKGVAQVDQTKFEDGGNAEAVG
FT                   LKPVKASPSVTDDDSPANIKVKKKVKRLTRNEKKLQAERRRLRYIEWLSSPKGTPKPKN
FT                   SDDESEGEDE"
FT   gene            <597945..>599936
FT                   /locus_tag="ZYRO0E07656g"
FT                   /old_locus_tag="ZYRO-ORF3691"
FT   CDS_pept        597945..599936
FT                   /locus_tag="ZYRO0E07656g"
FT                   /old_locus_tag="ZYRO-ORF3691"
FT                   /product="ZYRO0E07656p"
FT                   /note="similar to uniprot|P35209 Saccharomyces cerevisiae
FT                   YMR179W SPT21 Protein required for normal transcription at
FT                   several loci including HTA2-HTB2 and HHF2-HHT2 but not
FT                   required at the other histone loci functionally related to
FT                   Spt10p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31002"
FT                   /db_xref="GOA:C5E4P1"
FT                   /db_xref="InterPro:IPR042403"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4P1"
FT                   /protein_id="CAR31002.1"
FT                   /translation="MADISKMTLKILYTLDNGSSGTYLARSKTPQQVRVASIPNLNSPN
FT                   DGEMGMGLRIGAVDLSLVLKEIYLNSPELLNGSMAKMGFDYNLYYKDICEADEPLVSLG
FT                   LLSQIRQKLNNRRQHQIEEEIEEDDATIVIGRVCSNFQALLKKSYSNASKDGSDTDSVI
FT                   PETLELKLSLIKVVHPKNARKNVPSMPNFPSKVIRPAKPTKRPTNPTPAPKAGRTQSLP
FT                   IWNMETKDSNGSVNSIARKIYLADRKTELEQMNEPPHNPLAYQVSALQQDNTVQRTKLD
FT                   TSVSRRFESLANKKKKPQQQQQHQSKKAPNAKKSHAAPKARRCNTMAAIPTPSDESKSL
FT                   AKKHEKLGTDAGSLNDVVQEMLAGPDDTLPVVNDDKENFPPPPPPVENSDEAQGGIDLD
FT                   LLDFSELGEMDWFQNFDPFNSPSLVPAANNGEPVKNTTPRDQNTGNTMTIGDEEVADVE
FT                   EDPCDKIGVTSDIDRTSPIDTLSMPLMELNQQPHAKLITCQEQLKRLPLIGPKHSSSGN
FT                   VTGDSKKDNRAGSDTSKQSKSKDDEIDDDQTSIVGSYSTPVQEDRPKKREKSQLVVENS
FT                   SPIPKRSYADDDDCDEKVPSYKKQRTIPSSPTTMFNYQDEASSQVDDDDENNDLFSSFV
FT                   NGSRPSNQDEMNDTPATQYQNQSSDNIK"
FT   gene            <600213..>601241
FT                   /locus_tag="ZYRO0E07678g"
FT                   /old_locus_tag="ZYRO-ORF3687"
FT   CDS_pept        600213..601241
FT                   /locus_tag="ZYRO0E07678g"
FT                   /old_locus_tag="ZYRO-ORF3687"
FT                   /product="ZYRO0E07678p"
FT                   /note="similar to uniprot|P40350 Saccharomyces cerevisiae
FT                   YPL227C ALG5 UDP-glucose:dolichyl-phosphate
FT                   glucosyltransferase involved in asparagine-linked
FT                   glycosylation in the endoplasmic reticulum"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07678g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31003"
FT                   /db_xref="GOA:C5E4P2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4P2"
FT                   /protein_id="CAR31003.1"
FT                   /translation="MAFNDFKQLQNVDLKGFLTTAAIGLIVSGYLIIYLLSHTPRLPFD
FT                   EELEYQTIDGKGGLVKKRLPNVCRGDSNKNKSNNDNNDEDILLSVVVPSYNETKRISHM
FT                   LADAIAVLQKEMAHRWEIIIVDDGSKDGTSEYCLNLSEKVFQLQEGQLRVVKLSQNRGK
FT                   GGAVRHGLLHIRGKYGLFADADGASQFNDVSKLIESIKQLEGPQGKPAVAIGSRSHMVN
FT                   TDAVVKRSFIRNLLMYGLHTLVFVFGIRSIKDTQCGFKLFNRSAIESIFPYLHTEGWIF
FT                   DVEILMLALRKKIPISEVAISWHEVDGSKMDLARDSINMAKDLVVIRMAYILRIYRDDK
FT                   EC"
FT   gene            complement(<601296..>602576)
FT                   /locus_tag="ZYRO0E07700g"
FT                   /old_locus_tag="ZYRO-ORF3685"
FT   CDS_pept        complement(601296..602576)
FT                   /locus_tag="ZYRO0E07700g"
FT                   /old_locus_tag="ZYRO-ORF3685"
FT                   /product="ZYRO0E07700p"
FT                   /note="highly similar to uniprot|O13297 Saccharomyces
FT                   cerevisiae YPL228W CET1 Interacts with Ceg1p the mRNA
FT                   capping enzyme alpha subunit removes gamma-phosphate from
FT                   triphosphate-terminated RNA mRNA capping enzyme beta
FT                   subunit RNA 5'-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07700g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31004"
FT                   /db_xref="GOA:C5E4P3"
FT                   /db_xref="InterPro:IPR004206"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR037009"
FT                   /db_xref="InterPro:IPR040343"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4P3"
FT                   /protein_id="CAR31004.1"
FT                   /translation="MSQDQKPVPKRALSLDDLVNHDDDAHKVRKTADDSIVENNSDETD
FT                   TDDGEGKGGGVDFNTEMNFDYDKQEQSGRDSNASSSVNTIFDEKASLQSKKNNIKQDLR
FT                   VLNEIAATSKPNKYKNTPIWAQKWKPTVKALQSIDTKDFKIDTSFLSIIPDDDLTKSVQ
FT                   DWVYATIFSIPPDLRPMVEMELKYGVIIDAKSPDRISPPVSTQAIYTDDGRMTPNVDQA
FT                   VFEELKKYIHGVSELNENSGKFSVIESQTTDSLYRVGVATQRPRFLRMSTDLKTGRVAQ
FT                   FIEKRKVSSLLIFSPKDSYDMKLSINLEIPVPENEPPEKYKDQTPMSARTKTRVSYIHN
FT                   DSCTRIDVTDVERLTKGPKGRDTSNNTFEVELEINTAALLNSFDNIATDSNMYASLIRT
FT                   FLNNGTLIRRKMSSISYGIFEGQKKGM"
FT   gene            complement(<602923..>603309)
FT                   /locus_tag="ZYRO0E07722g"
FT                   /old_locus_tag="ZYRO-ORF3683"
FT   CDS_pept        complement(602923..603309)
FT                   /locus_tag="ZYRO0E07722g"
FT                   /old_locus_tag="ZYRO-ORF3683"
FT                   /product="ZYRO0E07722p"
FT                   /note="some similarities with uniprot|Q99395 Saccharomyces
FT                   cerevisiae YPL229W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31005"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4P4"
FT                   /protein_id="CAR31005.1"
FT                   /translation="MQTDYMTMNNFTVGRKMMDGQPQGQAQQQIPVSPPQFNSPLLSGS
FT                   SGSSVESDTLRYKSDMCKSFEDDLFYCPRSLLSAQEQVTCERMDMFLAEQFREYQLQAQ
FT                   ITLSTRPKFNPYTSESFNPGTHGQ"
FT   gene            complement(<603930..>604541)
FT                   /locus_tag="ZYRO0E07744g"
FT                   /old_locus_tag="ZYRO-ORF3681"
FT   CDS_pept        complement(603930..604541)
FT                   /locus_tag="ZYRO0E07744g"
FT                   /old_locus_tag="ZYRO-ORF3681"
FT                   /product="ZYRO0E07744p"
FT                   /note="similar to uniprot|P15992 Saccharomyces cerevisiae
FT                   YBR072W HSP26 Small heat shock protein with chaperone
FT                   activity that is regulated by a heat induced transition
FT                   from an inactive oligomeric (24-mer) complex to an active
FT                   dimer induced by heat upon entry into stationary phase and
FT                   during sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31006"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4P5"
FT                   /protein_id="CAR31006.1"
FT                   /translation="MFSTPFFDFFDNINNEVENVHNILGYSRDRDYPSRRQLTSGREND
FT                   SGKIQKRPHRNNNQRLLSTRLNKWFDDDWSLSDFDLGPTNIVPPVDLFDHEENYEARIT
FT                   IPGVDDSKNINLEYHKDGNEIVVSGEVPSTVTEHNRDNVKVKEVVSGQFKRVITLPENP
FT                   GVNAEEINANYKNGVLSLRIPKLKQSKKDNVRKIEVAGDE"
FT   gene            complement(<604879..>610605)
FT                   /locus_tag="ZYRO0E07766g"
FT                   /old_locus_tag="ZYRO-ORF3679"
FT   CDS_pept        complement(604879..610605)
FT                   /locus_tag="ZYRO0E07766g"
FT                   /old_locus_tag="ZYRO-ORF3679"
FT                   /product="ZYRO0E07766p"
FT                   /note="highly similar to uniprot|P19097 Saccharomyces
FT                   cerevisiae YPL231W FAS2 Alpha subunit of fatty acid
FT                   synthetase which catalyzes the synthesis of long-chain
FT                   saturated fatty acids contains beta-ketoacyl reductase and
FT                   beta-ketoacyl synthase activities"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31007"
FT                   /db_xref="GOA:C5E4P6"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR026025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR040899"
FT                   /db_xref="InterPro:IPR041550"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4P6"
FT                   /protein_id="CAR31007.1"
FT                   /translation="MVMKPETEQELAHILLTELLAYQFASPVRWIETQDVFLKDLNSER
FT                   VVEIGPSPTLSGMAQRTMKNKYESYDAALSLHRQVLCYAKDAREISYTPDPAELEAKER
FT                   AVAEAAGGEAAPAPAATPAPSAAPSAAPAAAPAAAAPAAAPAAPAAGPVAELPDEAVKA
FT                   GLLLRVLVAHKLKKPMDSIPMSKTIKDLVGGKSTVQNEILGDLGKEFSATPEKAEETPL
FT                   EELAETFQETFSGSLGKQSSSLISRLISSKMPGGFTTTVARKYLQTRWGLASGRQDSVL
FT                   LVALTNEPASRLGAEPDAKAFLDSMAQKYASIAGVDLSAASAGGSSGAAGGAAGAGGAT
FT                   IDAAAFEELNKDQRILARQQLQVLARYLKMDLNVGERKFLKEKDTIADLQAQLDFITNE
FT                   LGEYFISGISTSFSRKKARAFDSSWNWAKQSLLSLYFEIVHGVLKNVDREVVSEALNIM
FT                   NRSNETLIKFMEYHVSHTDASRGENYKLVKDLGEQLIQNCKQVIDMDPVYRDISKPTGP
FT                   KTVIDKNGNIRYSEEPKEKVRKFSEYVQEMALGGKLSKQSHSTIEEDLTRVYKAISAQA
FT                   AEHDISGTTAQEFEKVYGDLMQFLQNSKEIDASQTTRLAGVVDDSLDKDSTKEVASLPT
FT                   KSKISKSVSASIPRETIPFLHLRKKGSNGEWQYDRQLSSLFLDGLEKAAINGVTFKDSY
FT                   VLITGAGKGSIGAEVLQGLLQGGAKVIVTTSRFSKPVTDFYQAVYAKYGAKNSTLVVVP
FT                   FNQGSKQDVQQLVEYIYDDEKNGGLGWDLDAIIPFAAIPENGIELENIDSKSEFAHRIM
FT                   MTNLMRIMGQVKIQKSERGVETRPAQVILPMSPNHGTFGGDGLYSESKLSLETLFNRWH
FT                   SESWGNQMTVCGAIIGWTRGTGLMSANNIIAEGIEKAGVRTFSQKEMAFNLLGLLTPEV
FT                   VELCQKSPVMADLNGSLQFLPSLKEFTNKLRSDLIETSEIRKAVSIETALEHKVVNGDN
FT                   ADAAHAKVEVQPKANIQLNFPALKPYEEVKKFSTQELEGLLDLERVIVVTGFSEVSPWG
FT                   SARTRWEMEAYGQFSLEGCVEMAWIMGYIKYHNGNLKGRPYTGWVDAKTNEPVDDKDIK
FT                   SKYESNILEHAGIRLIEPELFRGYNPEKKQMIQEVVVEEDLEPFETSKETAEQFKYEHG
FT                   DKVDIFEIPESGEYTVKILKGATLYIPKALKFDRLVAGQIPTGWDARTYGVPEDIISQV
FT                   DPITLFVLVSTVEAFISSGITDPYEMYKYVHVSEVGNCSGSGMGGVSALRGMFKDRYKD
FT                   QPVQNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATAVESVDIGVETILSGKAKI
FT                   CVVGGYDDFQEEGSYEFGNMKATSDTLDEFEHGRTPSEMSRPTTTTRNGFMEAQGCGLQ
FT                   VIMNADLALKMGVPIYGIVGLTATATDKIGRSVPAPGKGILTTAREHHGELKFPSPLLN
FT                   IKYRKRQLVNRQKQIKEWVENELELLGIESEGVPTELRQVFYAERTEEIKREASKQLKS
FT                   AQAQWGNEFYKSDPRIAPIRGALATYGLTVDDLGVASFHGTSTKANDKNESATINEMMK
FT                   HLGRSEGNPVMGVFQKYLTGHPKGAAGAWMLNGAIQILNSGIVPGNRNADNVDKLLEQY
FT                   EYVLYPSMSLKTNGIKAVSVTSFGFGQKGAQAIVIHPDYLYAAIDQATYEDYKLKVVSR
FT                   EKAAYKFFHNGMIHNKLFVGKDNPPYADELEQSVYLDPLARVSENKQSGSLEYEASALQ
FT                   QKDSYITANNRKTATIVSQLTQQTAAGSKQGSGVGVDVELISSVNADSETFVERNFTES
FT                   EIAYCKAQPSAQSSFAGTWSAKEAVFKSLGVKSQGGGASLRDIEIVRDSTGGPQVTLHG
FT                   EAKKAATQAGVTGVKVSISHDDFQSVAVAISEKN"
FT   gene            complement(<611472..>612434)
FT                   /locus_tag="ZYRO0E07788g"
FT                   /old_locus_tag="ZYRO-ORF3675"
FT   CDS_pept        complement(611472..612434)
FT                   /locus_tag="ZYRO0E07788g"
FT                   /old_locus_tag="ZYRO-ORF3675"
FT                   /product="ZYRO0E07788p"
FT                   /note="similar to uniprot|P32867 Saccharomyces cerevisiae
FT                   YPL232W SSO1 encode syntaxin homolog act in late stages of
FT                   secretion post-Golgi t-SNARE"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31008"
FT                   /db_xref="GOA:C5E4P7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4P7"
FT                   /protein_id="CAR31008.1"
FT                   /translation="MNYNPYESGVDDYEMRNTENVFDDSAAASTPYGPTGGEPNLNSSP
FT                   VDVGGAGAGAGVGENDFVDFMGKINQINSGLDTYEQLINNVDSYHKRLLAEVNEDQEMQ
FT                   LRRMLDDIVAQAGTLQYQLRNEIKDVQREGLRDGSKQAQAENCRQRFLKAIQDYRIIES
FT                   NYKEENKEQAMRQYMVVQPDATPDEVENAVSDVGGQQIFSQALLNANRRGEAKTALAEV
FT                   QARHQELLKLEKTMAELTQLFNDMEEMVVEQQEQVDNIDKNVDDAQEDVEQGVGHTNKA
FT                   VTSARRARRNKLRCWIIVFVIIIIILVASIVPAVVATQT"
FT   gene            complement(<613103..>613687)
FT                   /locus_tag="ZYRO0E07810g"
FT                   /old_locus_tag="ZYRO-ORF3674"
FT   CDS_pept        complement(613103..613687)
FT                   /locus_tag="ZYRO0E07810g"
FT                   /old_locus_tag="ZYRO-ORF3674"
FT                   /product="ZYRO0E07810p"
FT                   /note="similar to uniprot|Q6B152 Saccharomyces cerevisiae
FT                   YPL233W NSL1 Essential component of the MIND kinetochore
FT                   complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
FT                   kinetochore subunits contacting DNA to those contacting
FT                   microtubules required for accurate chromosome segregation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31009"
FT                   /db_xref="GOA:C5E4P8"
FT                   /db_xref="InterPro:IPR013950"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4P8"
FT                   /protein_id="CAR31009.1"
FT                   /translation="MSKIQVSSDQLRSIYGQLYDVLQEKASLHLPELDDPVSREVNLQL
FT                   QLFLTNVMEMAFNSLKIDGPPANDILNSRCEPFDLELNERVRKSYETWEEETVKVANLK
FT                   RAAQETINNVWMENQMDYLRELDSKIDAEPATDTSDNASYALEQYPIDTQLYTDSLESL
FT                   SKTQSKLPHMRNQLQKLQLLLQHLQDEGSVG"
FT   gene            <613837..>614316
FT                   /locus_tag="ZYRO0E07832g"
FT                   /old_locus_tag="ZYRO-ORF3673"
FT   CDS_pept        613837..614316
FT                   /locus_tag="ZYRO0E07832g"
FT                   /old_locus_tag="ZYRO-ORF3673"
FT                   /product="ZYRO0E07832p"
FT                   /note="similar to uniprot|P32842 Saccharomyces cerevisiae
FT                   YPL234C TFP3 vacuolar ATPase V0 domain subunit c'"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07832g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31010"
FT                   /db_xref="GOA:C5E4P9"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4P9"
FT                   /protein_id="CAR31010.1"
FT                   /translation="MSEYAPLYSPFLGFAGCASAMVLSCLGAAIGTSKSGIGISGIGTF
FT                   KPELIMKSLIPVVMSGILAIYGLVVAVLIAGGLSPGEEYSLFNGVLHLSAGLCVGFACL
FT                   SSGYAIGIVGDVGVRKSMHQPRLFVGIILILIFSEVLGLYGMIVALILNTRGSGK"
FT   gene            complement(<614363..>615745)
FT                   /locus_tag="ZYRO0E07854g"
FT                   /old_locus_tag="ZYRO-ORF3672"
FT   CDS_pept        complement(614363..615745)
FT                   /locus_tag="ZYRO0E07854g"
FT                   /old_locus_tag="ZYRO-ORF3672"
FT                   /product="ZYRO0E07854p"
FT                   /note="highly similar to uniprot|Q12464 Saccharomyces
FT                   cerevisiae YPL235W RVB2 RUVB-like protein TIP49b Homologue"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31011"
FT                   /db_xref="GOA:C5E4Q0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037942"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="InterPro:IPR042487"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Q0"
FT                   /protein_id="CAR31011.1"
FT                   /translation="MSIQTSNPDESLKSLSLIAAHSHITGLGLDEHLQPRESSEGMVGQ
FT                   LQARRAAGIILKMVQNGTIAGRAILVAGPPSTGKTAMAMGLSQSLGKDVPFTAIAGSEI
FT                   FSLELSKTEVLTQAFRKCIGVKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKTTDM
FT                   ETIYELGSKMIDGLTKEKVLAGDVISIDKASGKISKLGRSFARSRDYDAMGADTRFVQC
FT                   PEGELQKRKTVVHTVSLHEIDVINSRSQGFLALFTGDTGEIRSEVREQINTKVAEWKEE
FT                   GKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIIMMATNKGISKTRGTNYKSPHG
FT                   LPVDLLDRSIIITTKNYNEQDIKIILSIRAQEEEVELTNEALDLLTKIGGETSLRYSSN
FT                   LISVSQQLSLKRKATQVDVNDVQRSYLLFLDASRSVKYVQENNSQYIDDQGNVGDPMDT
FT                   TE"
FT   gene            <616134..>617243
FT                   /locus_tag="ZYRO0E07876g"
FT                   /old_locus_tag="ZYRO-ORF3670"
FT   CDS_pept        616134..617243
FT                   /locus_tag="ZYRO0E07876g"
FT                   /old_locus_tag="ZYRO-ORF3670"
FT                   /product="ZYRO0E07876p"
FT                   /note="similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
FT                   YPL236C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31012"
FT                   /db_xref="GOA:C5E4Q1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Q1"
FT                   /protein_id="CAR31012.1"
FT                   /translation="MDSFRQLLKFICGTCCCCCDYSESYLSINGRRYSIKKLLGESNFS
FT                   FIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGAMKEVDNYKRFQSPYIIHLV
FT                   DSQVAQQRDGSKTVYILLPYFPLGSLQDSTSRNLLNGTFISEAECIRIVIGIARGLRCL
FT                   HDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLELDILSSANTINSNFYAHRDIKP
FT                   SNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVSDHCTVAYTAPELLHITLNR
FT                   SVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIGTGNFSFPSQDRYSEGLLK
FT                   LITKCLQVNPAARPDINELLTLLQELQES"
FT   gene            <617523..>618068
FT                   /locus_tag="ZYRO0E07898g"
FT                   /old_locus_tag="ZYRO-ORF3669"
FT   CDS_pept        617523..618068
FT                   /locus_tag="ZYRO0E07898g"
FT                   /old_locus_tag="ZYRO-ORF3669"
FT                   /product="ZYRO0E07898p"
FT                   /note="similar to gnl|GLV|KLLA0D08954g Kluyveromyces lactis
FT                   KLLA0D08954g and weakly similar to YMR184W uniprot|Q03233
FT                   Saccharomyces cerevisiae YMR184W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31013"
FT                   /db_xref="GOA:C5E4Q2"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Q2"
FT                   /protein_id="CAR31013.1"
FT                   /translation="MTVAKSYQNCAETEVPGYNDCPSFLFMPQRPSARRKQHRVISDHL
FT                   SANNSPSTHSTSTTDTTTAPPPILHRKPHEIAKNQEKTSNASLNKEEILHRVNELYGLK
FT                   SKLVTNEFEFYRRKVDNNLVSSLENDSTRAVMTRFFLEANTDRTKASNTLRAWMSSDVS
FT                   VLNWCPAFLKIFEHAEHA"
FT   gene            complement(<618222..>619082)
FT                   /locus_tag="ZYRO0E07920g"
FT                   /old_locus_tag="ZYRO-ORF3667"
FT   CDS_pept        complement(618222..619082)
FT                   /locus_tag="ZYRO0E07920g"
FT                   /old_locus_tag="ZYRO-ORF3667"
FT                   /product="ZYRO0E07920p"
FT                   /note="similar to uniprot|P09064 Saccharomyces cerevisiae
FT                   YPL237W SUI3 Beta subunit of the translation initiation
FT                   factor eIF2 involved in the identification of the start
FT                   codon"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31014"
FT                   /db_xref="GOA:C5E4Q3"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Q3"
FT                   /protein_id="CAR31014.1"
FT                   /translation="MSSDLATDLGFDPSLKKKKKSKKVAPENLEVEDKETEKSSSNSTG
FT                   EDDLFSGLKKKKKKSKSPAAEPSESVDEISEALGELKLKKKKKSKEAELDDFEKQLASA
FT                   GVNVDGGNTQESTPVLESSVQQDVGLSYPGLLSRFFDILRTNNPELAGDKSGPKFRIPP
FT                   PVCLRDGKKTIFSNIQDISEKLQRSPEHLIQYLFAELGTSGSVDGQKRLVIKGKFQPKQ
FT                   MENVLRRYILEYVTCKTCKSINTELKKEQSNRLFFLVCKSCGSTRSVSSIKTGFQAHIG
FT                   RRKRM"
FT   gene            complement(<619330..>619959)
FT                   /locus_tag="ZYRO0E07942g"
FT                   /old_locus_tag="ZYRO-ORF3665"
FT   CDS_pept        complement(619330..619959)
FT                   /locus_tag="ZYRO0E07942g"
FT                   /old_locus_tag="ZYRO-ORF3665"
FT                   /product="ZYRO0E07942p"
FT                   /note="similar to uniprot|P46683 Saccharomyces cerevisiae
FT                   YPL239W YAR1"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31015"
FT                   /db_xref="GOA:C5E4Q4"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Q4"
FT                   /protein_id="CAR31015.1"
FT                   /translation="MSLHTDPLEQEDQDAIVLDARSGDLESLKEIFSTLIHPKLITTCQ
FT                   DAETHVTPLHMAAANGHVEVVKYIIQLVKENAPEQLSSFVNRQNDTGNTALHWASLNGN
FT                   LEVVKILCEEFESDPFIKNTFGHDCFFEAENNGREELEDFFLKKYDIAPANKESEDGKV
FT                   GIKEGTEIEQVTREAELAAQQKQQEKDNETETLAQDTKKLDIRDST"
FT   gene            <620287..>622965
FT                   /locus_tag="ZYRO0E07964g"
FT                   /old_locus_tag="ZYRO-ORF3664"
FT   CDS_pept        620287..622965
FT                   /locus_tag="ZYRO0E07964g"
FT                   /old_locus_tag="ZYRO-ORF3664"
FT                   /product="ZYRO0E07964p"
FT                   /note="similar to uniprot|Q12751 Saccharomyces cerevisiae
FT                   YMR185W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31016"
FT                   /db_xref="GOA:C5E4Q5"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019451"
FT                   /db_xref="InterPro:IPR039600"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Q5"
FT                   /protein_id="CAR31016.1"
FT                   /translation="MSTVSDILKKPQFTRSTPLDEFFKKFDSQVLSKKGDLKNDNTNLV
FT                   TLLLNHFQELHDLVIDEQVRLQTENSNMLPISLHDMRYVEELIQLIVAHGIMANIPPSL
FT                   QPASQKSKDIPRSHNLSTLKLVVEKISNILVKEMKPNDYIRSIVLKGPLYTYTYLGILT
FT                   LCTEEPNKAHYEEVLRQMENVQQTYELFAMYNFLVQELGNAVAKAKILSLLSTLAVRRE
FT                   NGVLSLIDFVVGAREDEQLDIEKMNRVTQIIVAKPKTINSVEYFSRLFPQIFDGLSMVN
FT                   RPIVVNCLNSVVTALFFKNSRIINDFLFRRIYQVIFNEPLQEHSAKELNDVVNVIISLT
FT                   KNSSNELISALVQSVDKRQFYLNLWIYVLFLKKYQKINPLGKQHGPYYEVILTILKTFV
FT                   CLFKDSEALIYLSMNLLNYQHEQWGYQIDFETQLAYITLRDNLPDLNLKQEKGDNPLTK
FT                   ANELFAGIDESIDLFIQLLKMVNNENMVKDVFLAVLNRWVKTEQHNDNSLKEVESNALV
FT                   LLDLKALEKLHREFSTDILKKPQDILKLIDELIDFTSSEPLMQQDSDDKDSDDEEEREA
FT                   QQPDSLSLIIQILESVLSMPPKQLADAKPLLQSIDNKLQKRGNSALHKDLLRMLEYKPG
FT                   QTSPDASNDANDYEALEEALNNLNDSLAPMQVLGLTQLNKLVQKHSKVISAARATQLHL
FT                   QYLKNQDPYVYLNAIKGLSSLCQYDKTCIDTLVDCYSSIRKLDDALKIGEVFIQYIQQE
FT                   NQLFQGIQANKIIDACITNVRRRGEIDDRLRMSAMSILGISAQVNARGIQDRIGDMLDC
FT                   SFGVLQMETKTKSGFVVRRAALHLIHDLMYNSDENAGVSLFPPQYDSSRLKTLLDYTRE
FT                   KDDDQLVSEQAAQLLSLLSIS"
FT   gene            <623313..>625451
FT                   /locus_tag="ZYRO0E07986g"
FT                   /old_locus_tag="ZYRO-ORF3661"
FT   CDS_pept        623313..625451
FT                   /locus_tag="ZYRO0E07986g"
FT                   /old_locus_tag="ZYRO-ORF3661"
FT                   /product="ZYRO0E07986p"
FT                   /note="highly similar to uniprot|P15108 Saccharomyces
FT                   cerevisiae YMR186W HSC82 Cytoplasmic chaperone of the Hsp90
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31017"
FT                   /db_xref="GOA:C5E4Q6"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Q6"
FT                   /protein_id="CAR31017.1"
FT                   /translation="MSSETFEFQAEITQLMSLIINTVYSNKEIFLRELISNSSDALDKI
FT                   RYQALSDAKQLETEPELFIRITPRPEEKVLEIRDSGIGMTKAELINNLGTIAKSGTKAF
FT                   MEALSAGADVSMIGQFGVGFYSLFLVADQVQVISKHNDDEQYIWQSNAGGSFTVSLDTD
FT                   NERLGRGTVLRLFLKDDQLEYLEEKRIKEVVKRHSEFVSYPIQLMVTKEVEKDVPLTEE
FT                   EKKEEKKDEEKKEGEDDKKPKLEEVDEEEEKKQEETKKIKEEVKELEELNKTKPLWTRN
FT                   PSEISQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFKAILFIPKRAPFDLFENKKKKH
FT                   NIKLYVRRVFITDEAEDLIPEWMGFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVK
FT                   KLIEAFNEIAEDSEQFDKFYSAFGKNIKLGIHEDTQNRPALAKLLRFNSTKSVDEQTSL
FT                   TDYVTRMPEHQKNVYYITGESMKAVEKSPFLDALKAKNFEVLFLVDPIDEYAFTQMKEF
FT                   EGKTLVDVTKDFELEESEEEKKKREEEMKQYEGLTAALKQILGEQVEKVVVSEKLIDAP
FT                   AAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKIFEISPRSPITKELKKRVEEGGA
FT                   NDRIVKDLTNMLYETALLTSGFSLEDPSSFAKRINRLISLGLNIDEEEQEEEAAPEAAA
FT                   STEAPSEVPADTEMEEVD"
FT   gene            <625615..>626355
FT                   /locus_tag="ZYRO0E08008g"
FT                   /old_locus_tag="ZYRO-ORF3659"
FT   CDS_pept        625615..626355
FT                   /locus_tag="ZYRO0E08008g"
FT                   /old_locus_tag="ZYRO-ORF3659"
FT                   /product="ZYRO0E08008p"
FT                   /note="weakly similar to uniprot|P46670 Saccharomyces
FT                   cerevisiae YPL241C CIN2 Tubulin folding factor C (putative)
FT                   involved in beta-tubulin (Tub2p) folding isolated as mutant
FT                   with increased chromosome loss and sensitivity to benomyl"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08008g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31018"
FT                   /db_xref="GOA:C5E4Q7"
FT                   /db_xref="InterPro:IPR012945"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="InterPro:IPR027684"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Q7"
FT                   /protein_id="CAR31018.1"
FT                   /translation="MSVESFLKSKTGLEERLANHESTETLRGNALELQNQLNQISKELA
FT                   PHDLQKYSKELDELLKNINARVPPQVVKLQFKKKPKPRLFQNRSKKVTSNERITQSQMV
FT                   SNQDFNIVQATATYENLQKCTIIGTHFINDTGSLTFKDLQSCTINLYEATFREGSIIIS
FT                   NCNDCSIYIHTGRETQLRLHDLKGCKLMIRPSQAPQRIVMERCRECVFHEVCEPWITIQ
FT                   EFDNLALTQEEQRNYTFVSLEDWW"
FT   gene            <626606..>631450
FT                   /locus_tag="ZYRO0E08030g"
FT                   /old_locus_tag="ZYRO-ORF3658"
FT   CDS_pept        626606..631450
FT                   /locus_tag="ZYRO0E08030g"
FT                   /old_locus_tag="ZYRO-ORF3658"
FT                   /product="ZYRO0E08030p"
FT                   /note="similar to uniprot|Q12280 Saccharomyces cerevisiae
FT                   YPL242C IQG1 Essential protein required for determination
FT                   of budding pattern promotes localization of axial markers
FT                   Bud4p and Cdc12p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31019"
FT                   /db_xref="GOA:C5E4Q8"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Q8"
FT                   /protein_id="CAR31019.1"
FT                   /translation="MTSSVGSPGKGSVLDRYVKNLANDSSLQPPPQLRTTSQSRLNSFH
FT                   NLKGASRSKPNVDNQDKENVGNAKNGSLNEKNPFMAAAGGLKSSKSPNQLKFGGNKVNQ
FT                   GINGGGGSRSSSNVNTSDLTREEKGYYEFLCRVAEIKQWIERVIGEDLPSEVDLSTGDC
FT                   LRNGVYLATVTQKINPDLAPSVFPAGNRLQFKHTQNINAFFSLVDHVGLPNSFRFELQD
FT                   LYNKQDLPQVFETLYILITMINKKWPTKTPIIENLSGKVNFSKDDIRKCKKTWPRIRDF
FT                   KSLNVNSVKSTVGKKATAPTGGGLIQDFSTVETSEPSSEPETPKPKNRLADAKSQPTLK
FT                   PEPEDEPSFMMKSSTPAKPEEQEELEEPADSESVKITTPEPEPKQLKESDEPLKFEHSV
FT                   STPVRRTRQKLESIKLSPPSSETGSLYFSPTTDRRDYSSTSPIRSQSFRPTESDHLRSP
FT                   YLRPADSDIVSRPPHLEYSPLKSTSFSYYSPTISRYLTYDTDFYVRRSQARERGIDFYQ
FT                   TYKYEPVSYSPQRKKRMTEMEFLDKVIHIQSICRGANARFDMRIQSRLLKLFEKEVLRF
FT                   QSIIRGNKRRVGIPQRFSINLTDDQEVSLTKLQALFRSSRIKSRNDRLKLKIYRKTAQI
FT                   EALQNIFRGSRLRKRVNQELYDRNVSDAPLRKLQSWIQGKRCRNHVKGTSRSLSSKAIA
FT                   FQKFQGSCRGLLYRRHFLFAHHFSDKALSQLKDFQERIRGANVRNSVYDLIYDAEAKNR
FT                   VFKRLSGMLRGRKLRESLLDVLYDDDPDFANVRPLQGIVRGVLVRYTLDLVDDIIEYYH
FT                   LDQFQAHVKGFLLRSKFDEREKYFKRNERSVIIIQSKIRTFIQRESFFDLLHHPNPHIK
FT                   HVKKYAYLLNNTGTIEENQDKLEACQAQLDSENLKKETFEKNIRQQLDTGNVLEKFGLT
FT                   SGLTKELSGMDIPLCRYPTYEKLFFLLQVDPSYWKILYTFEPVFVEKNMYVSFSTVNQR
FT                   MGRREKIYFIRVLADILQQEVIEARSMQQYLTKPDRFWNRMLRTFLRREYPEVFSIFQP
FT                   LLKYINNPRVNFEGDPLVIYKDIHHTEPLSRSEAIEDEKTKIKFIENLRNLWHSVEMTA
FT                   EIFTRKLKEIPLEVRFIASKMFTCAADKNTDEIGTLRSISIVLVNSFIFEYMENRSLYG
FT                   FDADESPNLDRKLHSFMRAIEIVFGLGKFNGYYDPLNQYADEINIQMRELLFNIILDPV
FT                   FEQEADTLVYRDMVTASPQLEILTEKVLVISMKFREYLLEFPDDDVIHEILEKSPTSRD
FT                   FKKSGRIVLDLTASAYRFLVCDDRMRKVYDQVKRSMVYMMQIEDVQTNLSDLVVSTVLP
FT                   QDEPNFIKLMCANPGIKNDPMIKALQSPKYFNMKSSTLKKLKELERSGIIKTNSNQLQN
FT                   FLNDIANTIKNPHYAIDYVTEELHLTQETLKGVAKINKQFEKTLTNLRTCVNQAIRDML
FT                   KSRDFNPGHRSALDNLKGAYKKVQTRKSDKIEGTMKFKWTTRQLYEKGVIKSIESENLA
FT                   EQKVKVFGSSGPKFPDINFKISTSDGAVYGIQLLDRRKGFEKNLEGVDSFSFRDLLGTQ
FT                   VGSKVETWQLLNKKVSINTAQLLKLIIDVFLKKGQ"
FT   gene            complement(<631600..>632907)
FT                   /locus_tag="ZYRO0E08052g"
FT                   /old_locus_tag="ZYRO-ORF3657"
FT   CDS_pept        complement(631600..632907)
FT                   /locus_tag="ZYRO0E08052g"
FT                   /old_locus_tag="ZYRO-ORF3657"
FT                   /product="ZYRO0E08052p"
FT                   /note="similar to uniprot|Q03236 Saccharomyces cerevisiae
FT                   YMR187C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31020"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Q9"
FT                   /protein_id="CAR31020.1"
FT                   /translation="MFKNPFKQDCTCWICLEESNFDSAWIRHECGCNLQVHKLCYLHWL
FT                   YSINRNYISRNLVTKNFNLVTEDDLKRTICYLVDGHRNLHREVSLSEFLNTLPFIRSKS
FT                   NEPMSSSVGIMSLLGINYTISFRIVRSPMALPVEFADCPQCKNHVVNQQITFTSRSFFL
FT                   AIFYWTKSVIRNTTIALTLVLSTLNIGKWWFKIGLWQLRCIFPENVLRVILDISTTRAL
FT                   NVYGETMNGLVSIPQMTRFLIFGFPVCLMGVRSSYPTLNRFRWLYTLVLSVRAGHYDPK
FT                   ATRLLSRTLTTCNICMLLNSAVITPFLSRYYEYLVKAVTPYFCPIDKSLDVFPSQGYGN
FT                   VIIKTSWYDVLFESIVWPAFGSLVGGKLFDAVTWIQREFGLNWTPSCSPNDCRMVFNFV
FT                   GCGLTAVARQLLNMWASHMRAKELKQLQESIEENTQ"
FT   gene            complement(<633136..>634914)
FT                   /locus_tag="ZYRO0E08074g"
FT                   /old_locus_tag="ZYRO-ORF3656"
FT   CDS_pept        complement(633136..634914)
FT                   /locus_tag="ZYRO0E08074g"
FT                   /old_locus_tag="ZYRO-ORF3656"
FT                   /product="ZYRO0E08074p"
FT                   /note="similar to uniprot|P38687 Saccharomyces cerevisiae
FT                   YPL243W SRP68 Component of the signal recognition particle
FT                   (SRP) ribonucleoprotein (RNP) complex that functions in
FT                   protein targeting to the endoplasmic reticulum (ER)
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08074g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31021"
FT                   /db_xref="GOA:C5E4R0"
FT                   /db_xref="InterPro:IPR026258"
FT                   /db_xref="InterPro:IPR034652"
FT                   /db_xref="InterPro:IPR038253"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4R0"
FT                   /protein_id="CAR31021.1"
FT                   /translation="MGVYSPLLATYGVRVDQLLETVQDFVRYHDKLNKKLQKLRHRCQL
FT                   TTRDTKKYRTKEKYSKLSSDDYDENSKLYGVVVLLHAERDLALAEVLKLRARQRGKMKK
FT                   SERKVVSTRLKRAMQTSEKLVALTTNESQWITRVQYLVYEKLARAEYLTHGKQQRHKDS
FT                   KKISKELALSFAALKYLEQASVITDSVVEFLHAKYEYTLKQHADGAFSSTELHNFVVEK
FT                   VEEASQNGDEMVKLLVENGYKPQKQASEAGTSFKEIQWRAFTAKVYDPQVEELIAESKS
FT                   VTVKSAPDYDTKLLKWQQALEIQESRIASQDEDEEDEADNQENDQILLAYIKYNALFTS
FT                   VLRDNYLFGQLWQQWTKLGTAMASRLTKSKEIERIVKNLQKYLQDIMELPGVYRDDELT
FT                   EQLELSKLYFQLTYTSGCLGGLYQLKGRYLESLALHVDAHQKLEERLTEMGNFQDILIP
FT                   LEVLSHKKIESLQQLIKAGWKSVVSLAEYEKHLKVQGQAAHQPTLIEKLDTGRIIPSDV
FT                   KLSNIFPLRPKLRPVPSKPTLFDLAFNYMDYAGEGSESASSWTTQRSEPAPASNNGDDN
FT                   NSNTNKKRGFLGLFGR"
FT   gene            <635266..>636264
FT                   /locus_tag="ZYRO0E08096g"
FT                   /old_locus_tag="ZYRO-ORF3654"
FT   CDS_pept        635266..636264
FT                   /locus_tag="ZYRO0E08096g"
FT                   /old_locus_tag="ZYRO-ORF3654"
FT                   /product="ZYRO0E08096p"
FT                   /note="similar to uniprot|Q12520 Saccharomyces cerevisiae
FT                   YPL244C HUT1 Protein with a role in UDP-galactose transport
FT                   to the Golgi lumen"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08096g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31022"
FT                   /db_xref="GOA:C5E4R1"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4R1"
FT                   /protein_id="CAR31022.1"
FT                   /translation="MSGGVLALFICAAGIYSSFLTWALVQEPLTTKFWPNSQHQFQAPS
FT                   VVAAVQAAVAMIVGLGYLKWKKCGYGPVNFVKDHGKSLAMISLSQSCSGPLATYSLQYV
FT                   DFLTYMLAKSCKMLPVLLIHLLLYRTSISKEKRLVAVLVSLGVAVFSFGGSGGKQKTNG
FT                   DDAFSLHGYALLVVSLFLDGVTNASQDKMLKANSRKDASKPITGAHMMFALNMFIVVWN
FT                   LGYLFTFDRLQVDMAKFMLSLDGEIWKYLLTYAICGAVGQCFIFFTLEHYGSLALITIT
FT                   VTRKMISMVLSIFVFRKKVMPLQWIGIGIVFGGITWEAISKRRQAARIKKD"
FT   gene            complement(<636314..>637603)
FT                   /locus_tag="ZYRO0E08118g"
FT                   /old_locus_tag="ZYRO-ORF3653"
FT   CDS_pept        complement(636314..637603)
FT                   /locus_tag="ZYRO0E08118g"
FT                   /old_locus_tag="ZYRO-ORF3653"
FT                   /product="ZYRO0E08118p"
FT                   /note="similar to uniprot|Q12179 Saccharomyces cerevisiae
FT                   YPL245W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31023"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4R2"
FT                   /protein_id="CAR31023.1"
FT                   /translation="MTQGFQTVKRARKAGTAVAKSAAADRLSNVKLSTEQANLKLKIME
FT                   FTRDHLKSYKKGDKPAMFVIQGDAGTGKSVILNSLFNEIQKASTTSGDALLGTSNYLIV
FT                   NHPEMLKLYLNICKKFPYISRSCLERPTSLINKLQKDHSLADVVIVDEAHLLATSKDAF
FT                   KRFYGQNHLQELMELAKVLIIVYDEKQALRMGCFWDEGSGNGANLQTFYDQVPDERRDW
FT                   YRLKQQFRVAAPPDVLQWIEDISVKGIIPKYPQKSEQFDFKIWDDCGAMFEALKEHDTN
FT                   LGQCRMLATYDFPYRLDGKDYYVTCGDNFKVRWDRYTPKSVLPWSERPDTIDEVGSVYT
FT                   IQGFDLKYAGVILGRSIGYDAENDCIKLKPEMYDDHAGFTKKKNIKDAAMVEKKIIMNS
FT                   LNVLLTRGVNGLYVYAWDPELRQRLAESRK"
FT   gene            <637763..>638572
FT                   /locus_tag="ZYRO0E08140g"
FT                   /old_locus_tag="ZYRO-ORF3652"
FT   CDS_pept        637763..638572
FT                   /locus_tag="ZYRO0E08140g"
FT                   /old_locus_tag="ZYRO-ORF3652"
FT                   /product="ZYRO0E08140p"
FT                   /note="similar to uniprot|Q12270 Saccharomyces cerevisiae
FT                   YPL246C RBD2 Possible rhomboid protease, has similarity to
FT                   eukaryotic rhomboid proteases including Pcp1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31024"
FT                   /db_xref="GOA:C5E4R3"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4R3"
FT                   /protein_id="CAR31024.1"
FT                   /translation="MFDWKSIVKPNGKPFCALTAGLAVFLTFVFLLEQVISLEDRMVLS
FT                   PKNIFNLGRLSNYPLIHLSWLHLFFNLFSLMGPLNLFESQHGTVYTGVALNLTAIFAGL
FT                   LYCVVGKLLYPEESVAGASGWFFTLIGYFSWKASLANPRTQVLQTPYHFPTALSPLILL
FT                   LLITLIIPNASFWGHLSGLTIGYLIGANEKAFSKLSPPGWLIKKIETKLDAYIEKIPHF
FT                   VKYYREVEVEDTDRTDYSWLFEPNVSLPLHNDPPQQTRGNGRVLGTA"
FT   gene            complement(<638625..>639317)
FT                   /locus_tag="ZYRO0E08162g"
FT                   /old_locus_tag="ZYRO-ORF3651"
FT   CDS_pept        complement(638625..639317)
FT                   /locus_tag="ZYRO0E08162g"
FT                   /old_locus_tag="ZYRO-ORF3651"
FT                   /product="ZYRO0E08162p"
FT                   /note="highly similar to uniprot|Q03246 Saccharomyces
FT                   cerevisiae YMR188C MRPS17 Mitochondrial ribosomal protein
FT                   of the small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31025"
FT                   /db_xref="GOA:C5E4R4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4R4"
FT                   /protein_id="CAR31025.1"
FT                   /translation="MARQNFLGLVVSQGRMQKTVKVRVETKVFNRRINKELFRRKDYLV
FT                   HDEGQISREGDLVRIEATRPLSKRKFFSVAEIIKNKGQQFALYESQAKTQVAQEETQKT
FT                   QDFLQRRSERKDSGGSVLLRDIRVIQDALSKGESPQELEEIKARYGVQNFTPETVRQLL
FT                   QLDVTKFEDQLKAQTSRIDSVQLRVQQLLDDEASANQFLKSHGVEDPVALKKNIKKNIL
FT                   RKHVLQEL"
FT   gene            <639823..>641343
FT                   /locus_tag="ZYRO0E08184g"
FT                   /old_locus_tag="ZYRO-ORF3650"
FT   CDS_pept        639823..641343
FT                   /locus_tag="ZYRO0E08184g"
FT                   /old_locus_tag="ZYRO-ORF3650"
FT                   /product="ZYRO0E08184p"
FT                   /note="similar to uniprot|Q12523 Saccharomyces cerevisiae
FT                   YPL247C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08184g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31026"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4R5"
FT                   /protein_id="CAR31026.1"
FT                   /translation="MDPFRGSKRSSISFGNFQRQPNSYATGAYDGGVGLMQNPNLGSST
FT                   SNSGGTGINTGNNGASANMTSRSPMYSPLQYSQFDYNQPAYSPGYSPFHPLRSPGPPVL
FT                   TKPVCEYEAKYPLFGLDWSNEDFVCLGSYRDGSTNSLHILHSGDLLSWDRVAECNVTFP
FT                   VSTIQWQPSMTHPRRFATCSDSLRIWSFCEEERNLQEQINLSLCKYDKQQQGASRVNAA
FT                   AGGSGSIRTNPQQQQGLIGELPPITSFHWNPVDPNLLISSSIDTTCIVWDLQSSNYVRT
FT                   QLIAHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTT
FT                   AAGSSSAADSDTGVPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGSPVLVLEGHSA
FT                   AVNQMRWHPSKRNVLLSCADDCQVLYWDLNNYIMGHPTDQDPDHAVDSQQQNNPVAKWN
FT                   SKNVLRTLDTPSMFYSNGGQEVNNIVWRPQGDDWFGSVAGNVFQNVRL"
FT   gene            <641673..>644723
FT                   /locus_tag="ZYRO0E08206g"
FT                   /old_locus_tag="ZYRO-ORF3648"
FT   CDS_pept        641673..644723
FT                   /locus_tag="ZYRO0E08206g"
FT                   /old_locus_tag="ZYRO-ORF3648"
FT                   /product="ZYRO0E08206p"
FT                   /note="highly similar to uniprot|P49095 Saccharomyces
FT                   cerevisiae YMR189W GCV2 P subunit of the mitochondrial
FT                   glycine decarboxylase complex required for the catabolism
FT                   of glycine to 5 10-methylene-THF expression is regulated by
FT                   levels of levels of 5 10-methylene-THF in the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08206g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31027"
FT                   /db_xref="GOA:C5E4R6"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4R6"
FT                   /protein_id="CAR31027.1"
FT                   /translation="MLKNQVTILGSTARSLGRSYRSSLAVKRWLQTNVTSSNYAKVYEA
FT                   KPSDLERPLDEFPRRHLGPSPKDLEKMLKTVGFEDLNSFVESVVPQNVLKKRALELEAP
FT                   ERGYSEMEMIEHLKELANKNRYEVKNFIGKGYYGTILPPVIMRNVLESPEWYTSYTPYQ
FT                   PEISQGRLESLLNFQTVISDLTGLPVSNASLLDEGTAAAEAMLLSYNFHRAKRPKFVID
FT                   SKSHPQTKSVVYTRALPLGIEVSEIDTRNVENSLKVLDDKAVCGCLLQYPATDGSIVAP
FT                   ETLTQFAEVLHQHKSLLSVASDPLALTLLKAPGHLGADIVLGSSQRFGVPLGYGGPHAA
FT                   FFAVQEHLNRRIPGRIVGVSKDRLGNVALRLALQTREQHIKRDKATSNICTAQALLANV
FT                   AANYCVYHGPEGLKNIAKRIYGMTSILANQINTSSPHDVVNDTWFDTLTIEINESTTAS
FT                   AVLEKALNEYNINLFAPNEKTVSLSLDETTTLKDLQNLIQLFTCSADLPSEVPQFPATL
FT                   ARTDDILTHEVFHLYHSETAMLRYLHRLQSRDLSLANSMIPLGSCTMKLNSTVEMLPIT
FT                   WPEFANIHPFQPTDQVQGYAQLMSSLENALCSITGFDAVSLQPNSGASGEYCGLRIIRA
FT                   FLEDTGELHRRVCLIPTSAHGTNPASAAMCGLKVVSFNCLPDGSLDLEDLKKKIDKHAH
FT                   ELAAIMITYPSTYGLYEEGLTRAIEMVHEAGGQVYMDGANMNAQVGLTSPGDLGADVCH
FT                   LNLHKTFAIPHGGGGPAGAPICLKSHLAPYLPRHPVVDMITYGKDDIKSSKAIDSVSSG
FT                   PYGNALVLPISYAYIKMMGQQGLPYASAIAMLNANYMRARLQNHYEILFAKNHCAHEFI
FT                   IDLREFKAQGVEAIDIAKRLQDYGFHAPTLAFPVPHTLMIEPTESENLEELDRFVDAMI
FT                   SIRSEIDSYLQGKPEGQMLKYAPHSLEDLILANDWDTRGYTRQQAAYPLPQLKGSKFWP
FT                   VVARLDDTYGDMHLMCTCPSVEEIAEN"
FT   gene            <645342..>647204
FT                   /locus_tag="ZYRO0E08228g"
FT                   /old_locus_tag="ZYRO-ORF3645"
FT   CDS_pept        645342..647204
FT                   /locus_tag="ZYRO0E08228g"
FT                   /old_locus_tag="ZYRO-ORF3645"
FT                   /product="ZYRO0E08228p"
FT                   /note="similar to uniprot|P39709 Saccharomyces cerevisiae
FT                   YAL067C SEO1 Putative permease member of the allantoate
FT                   transporter subfamily of the major facilitator superfamily
FT                   mutation confers resistance to ethionine sulfoxide"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31028"
FT                   /db_xref="GOA:C5E4R7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4R7"
FT                   /protein_id="CAR31028.1"
FT                   /translation="MNTPTTSLMKEIFVDPWRRLKFGIIPVKRVLEEDNLVKTGSTEPE
FT                   SLSDEWDDKKRSLREVLEETPDSEVDEEEELNEYEYRDQANRPWWKFFDEQEYRITKKK
FT                   GKSNHWYSWFNGSPSTQEKKLILKLDILLALYACMSYWVKYLDSVNLNNAYVSGMKESL
FT                   GMHGNDLVHVQNMFSIGNIVSQVPFLFVLNKVPLNYLLPTLDLCWSLMTLGQGFAHTTD
FT                   SIKALRFFVGFFEGPSYLAFQYLFGCFYKHDEVVRRSAFFYFGQYIGILSSGGIQSAVY
FT                   KSLNGRNGLAGWRWNFIFDFIISIIVALIGFYSLPGDPQNCYSIFLTDDEIRLARTRLK
FT                   ENKTEGNDFHKKVFDIGVWKKIIFDWKIWIVSIWAIFCWDNSNVGSGCYILWLKSLTNS
FT                   NGEQRYSIPKVNTLSMITPALGLVYLTVTALIADKLHSRWSAILFTQIFNIIGNVILAV
FT                   WNVQEGAKWFAFMLQCMGWAMAPVLYGWVNDICRRDSESRGIIMTAMNIAASVFSVWTS
FT                   VVFFPTTEAPRYLKGYSFAAANALALILWTFLVLWFYKNEERKYAKENGIILYNSNVGV
FT                   PPKEERQQLGNIYHDDQERSSSPAEAEGEHVHIVGDKGDKIINI"
FT   gene            complement(<647243..>651127)
FT                   /locus_tag="ZYRO0E08250g"
FT                   /old_locus_tag="ZYRO-ORF3644"
FT   CDS_pept        complement(647243..651127)
FT                   /locus_tag="ZYRO0E08250g"
FT                   /old_locus_tag="ZYRO-ORF3644"
FT                   /product="ZYRO0E08250p"
FT                   /note="similar to uniprot|P35187 Saccharomyces cerevisiae
FT                   YMR190C SGS1 Nucleolar DNA helicase of the RecQ family,
FT                   involved in maintenance of genome integrity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31029"
FT                   /db_xref="GOA:C5E4R8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR022758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4R8"
FT                   /protein_id="CAR31029.1"
FT                   /translation="MSMVSKPSNNLRSECKWLKETNSLQEEKELALKVINSNTLNKRPR
FT                   VDKVSQETSVSSITPLSSFNNDTQLPQRESQSQSKQKQPPLPTAPRQVPNYSTQRRDRS
FT                   ELQRLLIGCLKSQNKLLLRRCRISESTSLSEDAKRTQIVDGIKPELSKLMSQMTTLEEE
FT                   LDILSQSNDTNLSTDRTHSTVIPSPEEMNPGDEISAAPEPAATEALLFSSKPVQNELVQ
FT                   VLEEDDDDMEPMIVSQKDQQRASTMTPLSQQESESEQARRSIAARNLRNRENNVNYRIP
FT                   DHDDPFDYVMGVAENHGEASDVTMDAEDDIDSNYLKSDDGTENKVDQSDLDFVVMDEEA
FT                   RDSIDRSYQDSQWPGLSESQKQDIENDSIEMILSSPQPKMTQTSPADENVERIDLIEDD
FT                   FEKDQIVEDTMMNDYGVAPFVRNMNANLSNSDLELIVSEGNEEEEAEAISDSDLEKFDE
FT                   ERENRAQVPDIKELDDDLKIINERKLEEEDFLPTPIMVKQENPPELITKIHKSQDILDD
FT                   DDDDLLRDIAKGDQDKAVVHQPQPRYAWSDEVDYRLHQSFGLRSFRPNQLQAVNSTLAG
FT                   KDVFVLMPTGGGKSLCYQLPAIVKSGKTRGTTIVISPLISLMQDQVEHLLNNNIKASMF
FT                   SSRGTADQRRQTFNLFIHGLLDLIYISPEMISASEQCKRGIKKLHNDGKLARIVVDEAH
FT                   CVSNWGHDFRPDYKELKYFKREYPHVPMMALTATASEQVRLDVIHNLELKDPVFLKQSF
FT                   NRKNLFYGVVRKTKNTIAEICESINTRFANQTGIIYCHSKNSCEQTAAQIQRNGIRCAF
FT                   YHAGMEPDERSDVQRAWQNDDLQVICATVAFGMGIDKADVRFVYHYTVPRTLEGYYQET
FT                   GRAGRDGKPSFCITYYTFRDVRSIQTMIQKDKNLDKDNKEKHLNKLQNVMMYCENGLDC
FT                   RRKLVLSYFNEEFDAKDCHKNCDNCCNSFKVATEQRDVTEDAKKIVKLVDELQDSRVTL
FT                   IYCQDIFKGSRSSKIVQAGHTELEFHGAGKSMPKSDVERIFFQLINLGILAEYPIVNNS
FT                   GFASNYVKLGKRARELLRGALPVQMQFNMSSSRPNSGLDSNALPPSSSTSRISSRTVNL
FT                   GGNKRDNHTVEPISLNNENEWKSTQELSELTHAYETLKEASMNAGYRMNPPVTNFIPDA
FT                   ALRKLAKKLPISESEFSSMPEIGPRHAKKFKVFRKTIMELRRRRSNLGGGNDINASNSI
FT                   VLSEGSLPDNSVVASRFIAMDSAESQQNEEIIRQIRMSQQRSTQPSQPSQRTGRASKSS
FT                   YSKKRFKRRG"
FT   gene            <651705..>654089
FT                   /locus_tag="ZYRO0E08272g"
FT                   /old_locus_tag="ZYRO-ORF3642"
FT   CDS_pept        651705..654089
FT                   /locus_tag="ZYRO0E08272g"
FT                   /old_locus_tag="ZYRO-ORF3642"
FT                   /product="ZYRO0E08272p"
FT                   /note="similar to uniprot|P04386 Saccharomyces cerevisiae
FT                   YPL248C GAL4 DNA-binding transcription factor required for
FT                   the activation of the GAL genes in response to galactose
FT                   repressed by Gal80p and activated by Gal3p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08272g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31030"
FT                   /db_xref="GOA:C5E4R9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR005600"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4R9"
FT                   /protein_id="CAR31030.1"
FT                   /translation="MKRLNTIDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKAN
FT                   RTPLTRAHMTKVETKLDRLEQLFRELFPEEDLDKVLNDRNTGQLKERLKRFLVRRAKGV
FT                   GNDRMDDHESVGIGLGTHSDSNQEHITEGEVPKDPLRGFDWVEGQDMPIGSDRVGFIVT
FT                   DISNSGYYGQECPRLIFKKLGIDSVPLLTTKASSINAVTDPHALCSRNVTSKYVKAYFD
FT                   NFHIYYPLIDTHIFLKLYDNQAGLRYVDQWQILFNTVLAIGAWSSEGESTDADLFYYSN
FT                   VKSHLKPKVFEAGSVTLVIAFHLLSRYAEWRQNPNTGYLYHGHALRMAISLGLHRDLPP
FT                   EGIPDVIKERRRRIWTCLYSHEVHSALLDGRPLQYMFFDDQVTISLPNSVEDENTWTKG
FT                   PSIYMGAIETAKLLKEFGYVWFVDSKITTSRCLQLCQRLDACQKAMPKYLQADEHLTGL
FT                   TYYLKKYPWISFIRFYLRWERQWLQIYVLRRLLQSEGALKVEPNSELDKCATMLSDIAQ
FT                   KTIWGVANYLNNHHLTSFFAWYCTFYLFNASLVPLAQIYTGTGDRQESLNQLSTCIRLF
FT                   KQLKDYNLSTCEKYIHILDHLCDGGMNTTDSATRGTNVEVKKQQTTHSPPLPTMSNALS
FT                   PSVKSAASLSDLEKLFSSRTPVLNLRVPSQPAQYPTQPVQLPQVSPIIPSTTAASNASN
FT                   MPQPPSQLIRQTTPAASLPGNECSPSGSTTTTTAPNSAIKTGHPLDNEGPFWTDQAAYN
FT                   AFGLTSSLFNTTTMDDVYNFLFDEEDHTPPKSKSWQDSDRH"
FT   gene            <654410..>655456
FT                   /locus_tag="ZYRO0E08294g"
FT                   /old_locus_tag="ZYRO-ORF3639"
FT   CDS_pept        654410..655456
FT                   /locus_tag="ZYRO0E08294g"
FT                   /old_locus_tag="ZYRO-ORF3639"
FT                   /product="ZYRO0E08294p"
FT                   /note="weakly similar to uniprot|P42933 Saccharomyces
FT                   cerevisiae YMR191W SPG5 Protein required for survival at
FT                   high temperature during stationary phase not required for
FT                   growth on nonfermentable carbon sources"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08294g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31031"
FT                   /db_xref="GOA:C5E4S0"
FT                   /db_xref="InterPro:IPR038816"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4S0"
FT                   /protein_id="CAR31031.1"
FT                   /translation="MALNSWRQWAKLTKKQLRQLGRVIDEELGGVIERNLPRPNGRLVK
FT                   VPVPVPVRQAPPKFRASATTVSTRGYHQSAHQFVRSRLVRTDIRLVKSVPRVTMFSSAP
FT                   RVPNGVPRGLFTNWNIIGRNAGQRMYSTASIKFTHEAVNNMAVSLRCFFNSLDGLIPPN
FT                   NGSQLSGRFPGPVHGQAKLSSRDVSLIRDMELFEMIKYHKNEALLAEGEETVGAYVEFK
FT                   APQLDMNKAIPQKTFANSLALDVWRDEIWNYTNELKILERNVRRIYENYGSLPITTTKD
FT                   SIRIHFPTLTMLETDKLITELEITMGNVYPDPQGPPSDILSNLDVSSDSDFSSVLSPSI
FT                   SNEAFSLV"
FT   gene            <655793..>658909
FT                   /locus_tag="ZYRO0E08316g"
FT                   /old_locus_tag="ZYRO-ORF3638"
FT   CDS_pept        655793..658909
FT                   /locus_tag="ZYRO0E08316g"
FT                   /old_locus_tag="ZYRO-ORF3638"
FT                   /product="ZYRO0E08316p"
FT                   /note="similar to uniprot|Q12344 Saccharomyces cerevisiae
FT                   YPL249C GYP5 GTPase-activating protein (GAP)"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31032"
FT                   /db_xref="GOA:C5E4S1"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4S1"
FT                   /protein_id="CAR31032.1"
FT                   /translation="MGKKKGKKSSAAANKAPKNSKDTVTETPVIERPVEETANDKIELK
FT                   DESGENLDSLDDLNETTENFQNEEITSENPSSEFIPVKPEAPFDQASAQSSAEVKPLFA
FT                   DESGQDEKTESKREKLVKPEEPSTQPLHIQKPATPVTQSPVQDFGTFKPNSPPPVPSRR
FT                   PASSTHGQHKHEEEKSTDEASSPCPNPLPIDTNAGVSRSGSYSSKPTSPRPKPPSVEGS
FT                   PVSEAAFKGASSGFSSARPVPPTPTVDSPSAPGINAHKEEHSRKPISPALPPRNSLHST
FT                   TTVKEYSRHDSEEVPGLRSFHKVPTKEKDNQKPEQRVHNNGFGGLNLVSPTPITLSEET
FT                   QMQESEEPKTAGMMNMDLNDATEAATPERLATPAKLDRSKEFEKSVGEGDAKGSLTSHV
FT                   SPSKRPETQSPISPPLPARGTSIKRRSIPPPLEQEMQSDEFRKSLAFAHARDTKGTPPP
FT                   INRSKRLESAAEINLIANRFKETRQSYQTEDEASRENIEKGQSALKSSFSTFLESLPAT
FT                   PVTPSGKFEDPQTPELGVTPSAQTELGEDELHLLKTDWSFWTQVVNDFGSVAANPEKLE
FT                   QKITDGIPQQIRGIIWQLIANSKSVEFEVIYNTLRDTESPHESSIRRDMKRTKFIPENK
FT                   FENLFNVIKVYSVFDPDVGYTQGMAFIVTPLLLNTDTEAEAFGLLVRLMKGYGLRRMYL
FT                   PEMPGLMLMLYQFDRLLEENSPQLYNHLTRQGVRSSMYATQWFLTFFAYKFPLEFVLRI
FT                   YDIVFVEGMESFLKFAVNLMLKNIDSLLDLQFDKLLDFLKDELFFYYLKANVEQRKMET
FT                   DDDGSVFKKEISSIESPQKRIRTEDEEYDVDQFVHDAMNHVHITPISLRRYASEYDEIH
FT                   EIEQQKEAQYESMRIKNQQLHKEVRKLESSYTLLNREHVDIANELIKNRLKIETLSDEN
FT                   NDMKITILELRKQLEEIGRKQTSPSPDNELPSDIRHDLNRTIKRNAEVMNENLRLQDRV
FT                   TELERSLATLKTKQVVSATSNTAGNTPKLTNGWSGFKKVFKKEEANHPK"
FT   gene            complement(<659035..>661290)
FT                   /locus_tag="ZYRO0E08338g"
FT                   /old_locus_tag="ZYRO-ORF3635"
FT   CDS_pept        complement(659035..661290)
FT                   /locus_tag="ZYRO0E08338g"
FT                   /old_locus_tag="ZYRO-ORF3635"
FT                   /product="ZYRO0E08338p"
FT                   /note="highly similar to uniprot|P13711 Saccharomyces
FT                   cerevisiae YGL205W POX1 Fatty-acyl coenzyme A oxidase
FT                   involved in the fatty acid beta-oxidation pathway localized
FT                   to the peroxisomal matrix"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31033"
FT                   /db_xref="GOA:C5E4S2"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR029320"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4S2"
FT                   /protein_id="CAR31033.1"
FT                   /translation="MTKSSTVNQECAAFKPQKLIQSERSNSRVDVDQINAFLESSPERR
FT                   DQAQALIQEIVKDPILKTDSSMYDRSKREERAVTARKIARLALYMEHDIKTARKHFKGN
FT                   DLIEDLQRDTESKLPALSNKDLSIFDRRLSLLHNIDPQLGTRVGVHLGLFGNCIKGNGT
FT                   NEQIHYWLQERGSSFMKGIYGCFGMTELGHGSNVARLQTKATYNPDSDTFTLLTPNLPA
FT                   TKFWIGGAANSATHCSVYARLIVEGKDYGVKTFVVPLRNPETFQLLPGIAIGDIGHKMG
FT                   RNGIDNGWIQFHNVVIPREYMLSRFTQVIPSKAPNGKATVKTQPQLDQISGYSALLSGR
FT                   VNMVMDSFRFGSKFAIIGARYAVGRQQFAKPKQPETQLIDYPLHQYRVLPQIAVPYLVS
FT                   PVAFKLMDQYYSILDELYKVSSPATFDKTGLAIVSKKLKNLFIDSASLKATNTWLVAEL
FT                   IDQLRQSCGGQGYSSYNAFGKGYDDWVVQCTWEGDNNILSLSSAKSILKKFAASRRGVF
FT                   DRSLDSGSFDYLEPSFVRAVLTGQETASLRQLQDYTKVWAIALVKFLDHIARLIDVTKD
FT                   LDSVAKLLVLVSKFHSLHSMLQAYYEKLKNPQDSHVTDAASEAALWDIYKLFSLYFIDK
FT                   HSGEFQQFKVFTPDQISQTVQPKLLELLQKVRKSIIPLTDAFKLPDDMINAPIGYFDGD
FT                   IYHNYFSEIIKQNPAEADGAGVPPNADLFTRLLARGSEFDHALGGSPRSEIIERLGK"
FT   gene            <662545..>667491
FT                   /locus_tag="ZYRO0E08360g"
FT                   /old_locus_tag="ZYRO-ORF3631"
FT   CDS_pept        662545..667491
FT                   /locus_tag="ZYRO0E08360g"
FT                   /old_locus_tag="ZYRO-ORF3631"
FT                   /product="ZYRO0E08360p"
FT                   /note="highly similar to uniprot|P22137 Saccharomyces
FT                   cerevisiae YGL206C CHC1 vesicle coat protein presumed
FT                   vesicle coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08360g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31034"
FT                   /db_xref="GOA:C5E4S3"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015348"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="InterPro:IPR022365"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4S3"
FT                   /protein_id="CAR31034.1"
FT                   /translation="MSDLPIEFTELADLTSLGISPQFLDFRSTTFESDHYVTIRETNDG
FT                   VNSVAIVDLANNNNVIRKNMGGDSAIMHPSQMVISVRANGTIVQIFNLETKSKLKSFTL
FT                   DEPVLFWKWLNEKTLGLVTARSILISHVFDGNVGAKPQLLTIRHASLNNTQIINFVTNK
FT                   NEDWFAVVGILQENGRIAGKIQLYSKQRNISQAIDGHVAIFANILLDGNVNPVQVFVTG
FT                   NRNVQTGAGELRIIEIEHDNSLPVSYQKKTVDIFFPPDAVNDFPIAVKVSEKYGVVYLL
FT                   TKYGFIHLYELETGTNLFVNRITAESVFTAASYDNQNGICCINKKGQVLAVEISTSQIV
FT                   SYILNKLSNVSLALTVASRGGLPGADGLFQKQFESLLSQGDYQGAAKVAASSNQLRNQN
FT                   TINRLKNVQAAPGAISPILLYFSTLLDKGKLNRDETIELAKPVLQQDRKQLFEKWLKED
FT                   KLECSEPLGDIVKPFDTTLALACYLRAGSHAKVVSCLAELQQFDKITAYCQKTGFQPNF
FT                   LVLISSLIRFSPDRAAEFAISLLQNPETASQLEIEKIADLFFSQQHVQQGTSLLLDALK
FT                   GDTPNQGHLQTRVLEVNLTHAPQVADAILGNNIFSHYDKPTIASLSEKAGLYQRALENY
FT                   TDIKDIKRCIVHTNALPVDWLVAYFGKLNVEQSLACLRTLMENNLQSNIQIVIQVATKF
FT                   SDLIGSSVLIKLFEEYRATEGLYYYLASLVNLTEDKDVVYKYIECAAKLNQYKEIERIV
FT                   KDNNVYDAEKVKNFLKNAELEDQIPLIIVCDRFDFVHELVLYLYKTRNMKFIEAFVQQV
FT                   NPSKTPQVVGALLDVDCDEDFIKGLLQSVFGQVSIKELTEEVEKRNRLKLLLPFLEQTL
FT                   AQGAQDQGVYNALAKIYIDSNNAPEKFLKENDQYNTLDVGHYCERRDPYLAYIAYEKGT
FT                   NDEDLIRITNENSMYKYQARYLLKRSDSELWNTVLNSDNVHRQQLIEAVISVGIPELTD
FT                   PEPVSLTVQAFMSNGLKIELIELLEKIILEPSTFSDNVALQGLLLLSAIKYEPSKVASY
FT                   IEKLEKYDANEIAPLCISHGLTEEAFEIYEKHEMPEKALKVLIEDVMNLDRAQTYVEKV
FT                   NTPGLWSQLGTAQLDGLRIPSAIESYIKAEDPSNYENVIEVAEKEGDYEELLPYLTMAR
FT                   KSLKEPKIDGSLILAYASLGKVHEIENLLSGPNVADLEDVGDRLMDIKNYKAAKLCYAS
FT                   VSNYSKLASTLVYLDDYQAAVDTARKASNIRVWKLVNDACIDRKEFRLAQICGLNLIIH
FT                   AEELGELVEKYESNGYFDQVISLFEAGLGLERAHMGMFTELAILYSKYEPSKTYEHLKL
FT                   FWSRINIPKVIRAVEEAHLWNELVFLYAHYDEWDNAALTMIDKSAKNLDHSYFKEVIVK
FT                   VSNLEIYYKAINFYVTEHPSLLVDLLAVLTPRLDIPRTVKLFAKSDNLPLIKPFLVNVL
FT                   PKNNSVVNQACHDLMIEEEDYKALQDAVDSYDKFDQLALAARLESHELIFFKKIAALLY
FT                   RRNKKWAKSLSILKEEKLWRDAIETAAISGDSKVVEDLLTDFVETENKESFVALLYTAY
FT                   HLVRYDFVLEISWLHNLGDLSKPYEISVQKEHTDAIKKLSDELVQKGSVSEGPADGQPL
FT                   MLTNGAPGLF"
FT   gene            complement(<667983..>671075)
FT                   /locus_tag="ZYRO0E08382g"
FT                   /old_locus_tag="ZYRO-ORF3629"
FT   CDS_pept        complement(667983..671075)
FT                   /locus_tag="ZYRO0E08382g"
FT                   /old_locus_tag="ZYRO-ORF3629"
FT                   /product="ZYRO0E08382p"
FT                   /note="similar to uniprot|P32558 Saccharomyces cerevisiae
FT                   YGL207W SPT16 Subunit of the heterodimeric FACT complex
FT                   (Spt16p-Pob3p) facilitates RNA Polymerase II transcription
FT                   elongation through nucleosomes by destabilizing and then
FT                   reassembling nucleosome structure"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31035"
FT                   /db_xref="GOA:C5E4S4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013719"
FT                   /db_xref="InterPro:IPR013953"
FT                   /db_xref="InterPro:IPR029148"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR040258"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4S4"
FT                   /protein_id="CAR31035.1"
FT                   /translation="MVELNIDFDVFKKRLLTLHSQYKTYENSPNSLLFVLGSSNTENPY
FT                   QKTSILHNWLLSYEFPSTIIAVLPDKVVIITSAAKAKHLEKAVELFSNEPVKLELWQRN
FT                   SKDPEHNKKLFEDVIDVIQKAGKSVGAPEKNVYQGKFMLEWSPLWDEAVKKYELNVVDI
FT                   SAGLSQTWEVKDDNEKALLSVASKSSDKFMDYLADEMVRAVDEELRITNVKLSDKIENK
FT                   IDDDSFLKKIAPELSKLCPKGYPFNLDLLDWTYSPIIQSGEKFDLRVSARSTNDQLDGN
FT                   GSILASCGIRYNNYCSNVTRTFLIDPSDEMVRNYEFVLELQKEIVNNKLKVGSTPKEVY
FT                   DSVVEFVQKVRPDLVGNLTKNLGSVIGLEFRDSSFVLNAKNETRKVQAGDCFNISFGFN
FT                   NLKDSKTDKSYALQLSDTVLLASEENSEPQYLTNCARSPSQVSFYFNNEEDENESKKAK
FT                   KPAKPEPNSKILKTKLRGEARGDSQENQKEQIRKENQKKLHEKLQKNGLLRFSAADANG
FT                   TGNEQRQYFKKYESYVRDSQIPSNVRDLRVHVDWRSQTVILPIYGRPVPFHINSYKNGS
FT                   KNEEGEYTYLRLNFHSPGAGGISKKTEELPYEESPDNQFVRSITLRSKDGERMSDVFKQ
FT                   ITDLKKESTKREQERKVLADVVRQDKLIENKFGRTKRLDQIFVRPSPDPKRVPSTVFIH
FT                   ENGIRYQSPLRSDSRIDILFSNIKNIIFQSCKGELIVIIHIHLKNPILMGKKKIQDVQF
FT                   YREASDMSVDETGTGRRGQSKFRRYGDEDELEQEQEERRKRAALDKEFKYFADAIAEAS
FT                   NGMLTVESAFRDLGFQGVPNRSAVFCMPTTDCLVQLVEPPFLVINLEEIEICILERVQF
FT                   GLKNFDMVFVYKDFSKPVTHINTVPIESLDFLKQWLTDMDIPYTVSSINLNWSTIMKSL
FT                   TEDPHQFFLDGGWSFLAMGSDDEGSGESDEEISEYEASEEEPSDESAFSDDEDAYSEGE
FT                   AEFSDDGSEEVSADEESEAGEDWDELEKKAAKLDRVSNYRE"
FT   gene            complement(<672301..>673347)
FT                   /locus_tag="ZYRO0E08404g"
FT                   /old_locus_tag="ZYRO-ORF3625"
FT   CDS_pept        complement(672301..673347)
FT                   /locus_tag="ZYRO0E08404g"
FT                   /old_locus_tag="ZYRO-ORF3625"
FT                   /product="ZYRO0E08404p"
FT                   /note="some similarities with uniprot|Q04739 Saccharomyces
FT                   cerevisiae YER027C GAL83 One of three possible beta-
FT                   subunits of the Snf1 kinase complex allows nuclear
FT                   localization of the Snf1 kinase complex in the presence of
FT                   a nonfermentable carbon source contains glycogen-binding
FT                   domain and some similarities with YGL208W uniprot|P34164
FT                   Saccharomyces cerevisiae YGL208W SIP2 Member of a family of
FT                   proteins including Sip1p and Gal83p that interact with
FT                   Snf1p and Snf4p and are involved in the response to glucose
FT                   starvation component of Snf1 protein complex involved in
FT                   response to glucose starvation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08404g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31036"
FT                   /db_xref="GOA:C5E4S5"
FT                   /db_xref="InterPro:IPR006828"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR030077"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="InterPro:IPR037256"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4S5"
FT                   /protein_id="CAR31036.1"
FT                   /translation="MNPSIIQLLLQHDEIVVKHGHSEYSPVVLITTNKKQGKERIRDKE
FT                   SKTNGRMDNNVTYSLSQMNLDPPTLGRRKSTLIFDDEEEMGYTNHQEHSKSMDSDSSSS
FT                   TESLRTGMCPVEITWQQGGNKVYVTGSFTGWRKMIGLVPVPDQPGLLHAKLQLPIGTHR
FT                   FRFIVDNELRFSDYLPTATDQMGNFVNYLEIGRGQKDTLSARSRIAMEIENEPDDIGNG
FT                   FTRFKEEIPLKPQVEYTQDIPAVFTDPSVMEQYYLTLDQQQHNHQNMAWLTPPTLPPHL
FT                   EDVPLNSYNGIQGDSNNENNSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVT
FT                   QILYAPLQ"
FT   gene            complement(<673465..>673980)
FT                   /locus_tag="ZYRO0E08426g"
FT                   /old_locus_tag="ZYRO-ORF3623"
FT   CDS_pept        complement(673465..673980)
FT                   /locus_tag="ZYRO0E08426g"
FT                   /old_locus_tag="ZYRO-ORF3623"
FT                   /product="ZYRO0E08426p"
FT                   /note="some similarities with uniprot|P53035 Saccharomyces
FT                   cerevisiae YGL209W MIG2 Protein containing zinc fingers
FT                   involved in repression along with Mig1p of SUC2 (invertase)
FT                   expression by high levels of glucose binds to Mig1p-binding
FT                   sites in SUC2 promoter"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31037"
FT                   /db_xref="GOA:C5E4S6"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4S6"
FT                   /protein_id="CAR31037.1"
FT                   /translation="MKASLPQDNDDRPFRCEICNRGFHRLEHKKRHIRTHTGEKPHKCS
FT                   FPGCGKSFSRSDELKRHLRTHTGTSQRKTKKTPSKRVEKDRIPTPAPSTAKNIVSSTSP
FT                   VKLPPVPLALPVTMPLTPVSSRPVSAQSSAISLPTLATLEQPEEKVVLPPVSKMLKQID
FT                   VFNTGKSI"
FT   gene            complement(<674946..>675395)
FT                   /locus_tag="ZYRO0E08448g"
FT                   /old_locus_tag="ZYRO-ORF3620"
FT   CDS_pept        complement(674946..675395)
FT                   /locus_tag="ZYRO0E08448g"
FT                   /old_locus_tag="ZYRO-ORF3620"
FT                   /product="ZYRO0E08448p"
FT                   /note="similar to gnl|GLV|CAGL0C02497g Candida glabrata
FT                   CAGL0C02497g and some similarites with YER029C
FT                   uniprot|P40018 Saccharomyces cerevisiae YER029C SMB1
FT                   associated with U1 U2 U4 and U5 snRNPs as part of the Sm-
FT                   core that is common to all spliceosomal snRNPs U1 snRNP
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31038"
FT                   /db_xref="GOA:C5E4S7"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4S7"
FT                   /protein_id="CAR31038.1"
FT                   /translation="MSKVQVKQDARLPDLIGFRLRVLTQDGRVYVGELLAFDKFMNLVL
FT                   KNCIEERIPKTQLDKLQNETSDKNDIKVEKRTLGLAILRGEQVLSSVVQDKPQLSKRER
FT                   LDGIKNQEKKISKERRSRNKQTKEKKNGKVEKKKFQPPPGLRKRV"
FT   gene            <675512..>675997
FT                   /locus_tag="ZYRO0E08470g"
FT                   /old_locus_tag="ZYRO-ORF3619"
FT   CDS_pept        675512..675997
FT                   /locus_tag="ZYRO0E08470g"
FT                   /old_locus_tag="ZYRO-ORF3619"
FT                   /product="ZYRO0E08470p"
FT                   /note="similar to gnl|GLV|KLLA0B00649g Kluyveromyces lactis
FT                   KLLA0B00649g and weakly similar to YER030W uniprot|P40019
FT                   Saccharomyces cerevisiae YER030W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31039"
FT                   /db_xref="GOA:C5E4S8"
FT                   /db_xref="InterPro:IPR019098"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4S8"
FT                   /protein_id="CAR31039.1"
FT                   /translation="MAEEDKKREEITTKEEPAKQEPSKEEPAKQEPSKEEPAKQEPSKE
FT                   EPAKEDPSKEEIGAKRKSTGSSRRVKRRRNYEENDAKVENEKPDQDEESEVDDAKLDSL
FT                   VAQDEEDDDLAEIDTSNIVTTGRRTRGKVIDYKKTAEELPQRQEEEDSDDDEEFKET"
FT   gene            complement(<676074..>676811)
FT                   /locus_tag="ZYRO0E08492g"
FT                   /old_locus_tag="Zyro0E.mRNA.3478.m"
FT   CDS_pept        complement(join(676074..676684,676766..676811))
FT                   /locus_tag="ZYRO0E08492g"
FT                   /old_locus_tag="Zyro0E.mRNA.3478.m"
FT                   /product="ZYRO0E08492p"
FT                   /note="highly similar to uniprot|P51996 Saccharomyces
FT                   cerevisiae YGL210W YPT32 probably involved in intra-Golgi
FT                   transport or in the formation of transport vesicles at the
FT                   most distal Golgi compartment; ras-like GTPase, highly
FT                   homologous to YPT31"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08492g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31040"
FT                   /db_xref="GOA:C5E4S9"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4S9"
FT                   /protein_id="CAR31040.1"
FT                   /translation="MNNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTNDFNMESKST
FT                   IGVEFATRTIEVEGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKPSSYENC
FT                   NHWLTELRENADDNVAVGLIGNKSDLDHLRAVPTDEAKNFAQENQLLFTETSALKSENV
FT                   DLAFRELITAIYQMVSKHQVDLGDANTQGNAPKGPTISLTPAPNENKKKSANNCC"
FT   gene            <678434..>682189
FT                   /locus_tag="ZYRO0E08514g"
FT                   /old_locus_tag="ZYRO-ORF3615"
FT   CDS_pept        678434..682189
FT                   /locus_tag="ZYRO0E08514g"
FT                   /old_locus_tag="ZYRO-ORF3615"
FT                   /product="ZYRO0E08514p"
FT                   /note="some similarities with uniprot|P40020 Saccharomyces
FT                   cerevisiae YER032W FIR1 Protein involved in 3' mRNA
FT                   processing interacts with Ref2p potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08514g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31041"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4T0"
FT                   /protein_id="CAR31041.1"
FT                   /translation="MVDGQDTLQGVHPILRNPDLPNPTASPTLMSPRSQVRFSVPDTSF
FT                   MNEAQVSVSESPSKIVFPKGSEEDSVYETANEEIGDEFRNLGKEGHFMDMHSRVMIDVP
FT                   EEIWDFHTRRLIKHRRSRSTGDQSIYNGNANGNLEMSRSLQSIIVDTLDSMGKFKEKYR
FT                   AENSNSEDSSGISQVSPLNLRRETNYDLYLTPYSPLNNYDVPIPLEISLPPYLSPKNKE
FT                   RKRSSLIFDGKHYSPFNMDSFESSAEEDVEDRDRLNESSHMSADAEEEGSISADSIPSA
FT                   VHDISFDVSSLHDVDEELGIDQDANVNLKVQRKNLKRQSPSKSSPLTRKSHTKSASRNL
FT                   NDQQVPDLPPTQEPEVADEPPLDQEGIEEEEKNEQEALAPVLSKKSLDILETPSKQIYI
FT                   PDFDSDPTPATSTAGSLKFFDTLDDREEGHEEAFTTNPNREVDILDMTFKFPPLPPKED
FT                   ESHEEKDTSNPNREAHNLDMAFKFPPSPPKEDADFLRVDNSPVDPQFESRRSKLMQQKV
FT                   LTPGGRRHMHSRSRSMHNVQDMFAATSTPPTAAPAAITTTTNNNNNTETPSGSPLRQNY
FT                   AVQEGAALFEMDKQKEQIPPRESPRGFAEDEYGLPTTPTPFARFNGDLPVTPSSTGRNR
FT                   SELAMTPTPFSRRRRGKPVTPTSFEEQVHEVDMTPESEPYVEHEEESDPSSVYEEVHAL
FT                   KEQPSHEQPEPTRNQEDFVSQDQSSYNKTDESLKIISEKNLNYDHFDFSDEVEREVALS
FT                   TPVKQKELSPPPVSPVNPMTSFQSFTRPVIPPENEYENIVSMPPEHNKINYNLLSPGRS
FT                   LSNNGSESSKNSQFSKNTNQSSRTSYPAEREMINPLVENLKKSDVPYSFPYPFDPVLNN
FT                   AMKLQRHSMPAFDIYNGSAPSFRQLNEEISFQDNDRYKQGLHQQQPDIPADKSAQRVYS
FT                   RPKSVIGPGAYVEDQVSSNVGPRSEVPSCNQRKGQMHHRSRSLEQSTYPRALNDYHGES
FT                   YHEPKDHLLSQNTMRPRSFHAPRRSIQSFMADDLYGPDDYRMFEDYQNVNQHAQEDDSE
FT                   RPADVVSYPHRLAPSADFRDVLETLDNMSPSTQRSKEFSSREPDHYTLPETPVRSKRNA
FT                   ATDEGYRTEYEVRDGKLVEVLVLDDDSDESIHNQSEKDSPLSPSKVSQYSSPNRNHEEL
FT                   LKMCEDTATHAKKVILQLVDDKKTKKAGGKKKKLSRPPPPVTTKEVEQVARLTPRQNNH
FT                   RRSSSIGQERYLRNLHRAMKSKPYPQ"
FT   gene            complement(<682374..>685205)
FT                   /locus_tag="ZYRO0E08536g"
FT                   /old_locus_tag="ZYRO-ORF3613"
FT   CDS_pept        complement(682374..685205)
FT                   /locus_tag="ZYRO0E08536g"
FT                   /old_locus_tag="ZYRO-ORF3613"
FT                   /product="ZYRO0E08536p"
FT                   /note="weakly similar to uniprot|P40021 Saccharomyces
FT                   cerevisiae YER033C ZRG8 Cytoplasmic protein of unknown
FT                   function transcription is induced under conditions of zinc
FT                   deficiency"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08536g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31042"
FT                   /db_xref="GOA:C5E4T1"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4T1"
FT                   /protein_id="CAR31042.1"
FT                   /translation="MRSFIRSHKKANSLDENPTGFAPPHSNNEGLTAPDMPKNDTVSFI
FT                   QSTPPQSGSNFQGFKHSPGFESFHKLNKKMFPGKLFKKNSSSNSPLLQPGPFGPKEYSS
FT                   APGTPQANKYEMPGDVGMGRNSHDDNRFLAVKGTVTHSWGDNGDKEQQVIVLNNNNNNN
FT                   NDNDSNDNNNNNGSNHSGKFQSSTQPSTPVLSSDLGPAVRIASERKAQEAPPRSFQLPG
FT                   YAPRSSTEDGSLRQGEQQQPQVYSKLSSVKNKNRQARIHSHDDILHLGQDSSVTMDFLK
FT                   STFSPDTLDEDSPDMRTLNDDNGDEATAKVNNTSKLSNFKGPDNVTKRSPAVKFQEDHG
FT                   ASQDVEVGDTEHLPPEEEDYEEDEEYEEDDEEDATSRFSFEISGINGRTSSVKYYSKPE
FT                   PSEAMYIDDLYEDENFDDDLNCFEDEDGEMEFPSNLLGISDNSDNESVVKKDLTPDDAH
FT                   LSEPKPVKKYQDLFALSDEEEEDGADHSGLAGLGLDTKTINVSAQSFASNEKRPLSSVP
FT                   SSARHSKHMESTEKDQKSSPTNLNDSRTSDSFNHDTTMRSPSASQSTTTVCSQAPLQTS
FT                   PHIQSSPTMSMPSIRLQSPSTIKPPATNKPPRYHASPGAQSPLDVQPSIPALSGKQPSL
FT                   PKSKAVKSFSDIFDLEDGLSDEDEDQDDLIGEVNAAEDGSFSIPDRESPNASDDSQQRK
FT                   YLQMHTSPLGRPKTPVQIYLTPPGNSASTSVTPFDSQPHLSNTTPSLPPPARSQSLKYH
FT                   DLSSNLDSEIPGLMSNLYFIDEKEEDKYMEEHKLADDDYLDEINTVPEDFTFSDSEHDD
FT                   PAKPSLRRSLRGSFRGTHSYSSQPTGTAKENAPARNKLEIKNKTVTFFNHGWDRSPIDK
FT                   YQRSPRTSEQYLDSIDDYITSPSKADYENFAPLTPNNSVNKPSPGFINDKSLSPIQEGS
FT                   SSVDNSPKIPSLR"
FT   gene            complement(<685474..>686586)
FT                   /locus_tag="ZYRO0E08558g"
FT   CDS_pept        complement(685474..686586)
FT                   /locus_tag="ZYRO0E08558g"
FT                   /product="ZYRO0E08558p"
FT                   /note="highly similar to uniprot|P53088 Saccharomyces
FT                   cerevisiae YGL211W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08558g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31043"
FT                   /db_xref="GOA:C5E4T2"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020554"
FT                   /db_xref="InterPro:IPR032442"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4T2"
FT                   /protein_id="CAR31043.1"
FT                   /translation="MSFVPPSDPVNKKQVKVSQLCELCRCRKAIIRRPKNLQKICKSCF
FT                   FHVFETEIHNTIVNNNLFYRGEKVAIGASGGKDSTVLAYVLKLLNDRYDYGIELVLLSI
FT                   DEGIVGYRDDSLATVKRNQVQYGLPLEIISYRELYDWTMDEIVACAGVRSSCTYCGVFR
FT                   RQALDRGSSKLGISHVVTGHNADDMAETVLMNILRGDVARLEKSTAIITQSSGSPIKRS
FT                   KPFKYSYQKEIVLYAHYKKLDYFSTECSYAPEAFRGTARELMKNLEMVRPSCIIDIIHS
FT                   GENLVLKPKKPKRTGTPKQMEVRTDGSVSLGFVDGNKCEKCGYLSSNRICKACMLLEGL
FT                   ENNRAKVTLDNDTSTQGTARLTRTLESLKF"
FT   gene            complement(<686734..>687798)
FT                   /locus_tag="ZYRO0E08580g"
FT                   /old_locus_tag="ZYRO-ORF3610"
FT   CDS_pept        complement(686734..687798)
FT                   /locus_tag="ZYRO0E08580g"
FT                   /old_locus_tag="ZYRO-ORF3610"
FT                   /product="ZYRO0E08580p"
FT                   /note="similar to uniprot|P32912 Saccharomyces cerevisiae
FT                   YGL212W VAM7 Regulator of vacuolar morphogenesis
FT                   hydrophilic protein heptad repeat motif"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08580g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31044"
FT                   /db_xref="GOA:C5E4T3"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4T3"
FT                   /protein_id="CAR31044.1"
FT                   /translation="MRPQRIEVAVVIDDIRIVKESYALYGVLVKVIRSNDESANEQSYE
FT                   HRVYRRFSEFWDLKMKLEKEFGTELPYELPQRQFGLWKQSSLDPDVIEERKITLANFLQ
FT                   DLLNDSFDTKWKNSPQVCKFLKLSSNWNSYEPKNSDLPSSQGNINDPTQWLTTFRDSKH
FT                   LLESCKRGMASSVTRDLMQLRLVLHDLENALKRGSEKLGQAEFARRQNLLQTLKKDMNE
FT                   FALESSSRPHDSSNSNNNNEHNDLKVALFEGPTEPRTPKKPAIGRRRFGETEETAPLNN
FT                   QQLLQLHKDSMSKQDLEMKEMHKIVQRQKDLSLAMNQELLQDNELLDSLNDGVDNTASK
FT                   LRTANRRAKQFNNE"
FT   gene            <687971..>689242
FT                   /locus_tag="ZYRO0E08602g"
FT                   /old_locus_tag="ZYRO-ORF3609"
FT   CDS_pept        687971..689242
FT                   /locus_tag="ZYRO0E08602g"
FT                   /old_locus_tag="ZYRO-ORF3609"
FT                   /product="ZYRO0E08602p"
FT                   /note="similar to uniprot|Q02793 Saccharomyces cerevisiae
FT                   YGL213C SKI8 essential for protection against viral
FT                   cytopathology dispensable for mitotic but required for
FT                   meiotic recombination and spore viability antiviral protein
FT                   mRNA is induced early in meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08602g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31045"
FT                   /db_xref="GOA:C5E4T4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4T4"
FT                   /protein_id="CAR31045.1"
FT                   /translation="MSNVFISTANCGKAHNADIYGTSVCLPYTVTCSGDGTIKLWKNKL
FT                   LDNELPKENVITQFVHRTGVHHVDTFYSVEKGGHELCIVSCVSFAGTIHFYQVDVKSGK
FT                   VEAVDLLPSQDKKKSYWSLKWFKSDDQMVCHRLAATDVKGNTLVWRFHPFAQEFDEELA
FT                   KKEEEKRAKRLARGQSVEDPSTNSENDEELKLQPHLKLHGEIPSVEPVFATCVGISHNG
FT                   LVATGFANGSVVVSELSTLRRIHNFEGFGIQGIEQNSNTVRAVEFSPLGTLLAVASDSG
FT                   SYGCVSLYETEYGERVGSLTVPTHSAQTSIGTFAHDGWVFGLSFNPTGEFLATCGYDSK
FT                   VRIWDVKLRERVSTLNISAGDIEVEEDIMLQDENGESVKNPPVMDVKFINKGVRGGMGS
FT                   ETNEGLCCVCLDRSVRWFRAAGGS"
FT   gene            complement(<689547..>691463)
FT                   /locus_tag="ZYRO0E08624g"
FT                   /old_locus_tag="ZYRO-ORF3607"
FT   CDS_pept        complement(689547..691463)
FT                   /locus_tag="ZYRO0E08624g"
FT                   /old_locus_tag="ZYRO-ORF3607"
FT                   /product="ZYRO0E08624p"
FT                   /note="similar to uniprot|Q2U0T7 Aspergillus oryzae
FT                   AO090011000310 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08624g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31046"
FT                   /db_xref="GOA:C5E4T5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4T5"
FT                   /protein_id="CAR31046.1"
FT                   /translation="MKVFFWSLCLSFFIGSLEALAVSKQVKLGDISYYVPGVPELTVDV
FT                   GMMSSLFGTLESSFLFPLTVFGYSGNLDYSTIESVSKNFSCSDDVYSDYFLETIMVQSP
FT                   NVGVVSYSNCSLSTLNVSTIISLGGSALPNGPYFASYLDGQLSVYKAYRLYADAYGAFQ
FT                   AGIVPSDENAESFMALPAGVEVAHAQTIAVPSKLYYTVTEEQPLAGYRVGVKDLYDIAG
FT                   TKTGGASRKYYELYDEAALTCPSVQRLIDMGAVIVGKLKLTQFANGGNPTANYVDYHAP
FT                   FNPRGDGYQSPSSSSCGSGAAEAAYDWLDFTVGSDTGCSVRCPAGSQGLYGLRPSFDAI
FT                   SLDGVIPMNDLMDTAGYFSRDPSLFKVFGETWYGENKNISTSYTSFPKTVYTFAFEEGD
FT                   SDFIESGASSEALALFNTFVSNVVSFVNGSNAKLDIYSKYEQDTGSSLANVFNNTWYGL
FT                   AGFYQYVNIWERFSKDYQEASNGDIPFMDPIPKFRWEWAYNNLTQDGYDRCVEQKWQFD
FT                   DWWNANVTSTNPQTCSSSLYIFLSNDGSTAYRNVYNSAPNADGFSAFSEMYISSFARTP
FT                   EAIVPLGEVAYNSTITLTEKYLPVTAAIGAAPGCDFMVLDLIEQMGRANLIGGVATGQK
FT                   LFP"
FT   gene            complement(<692604..>694010)
FT                   /locus_tag="ZYRO0E08646g"
FT                   /old_locus_tag="ZYRO-ORF3606"
FT   CDS_pept        complement(692604..694010)
FT                   /locus_tag="ZYRO0E08646g"
FT                   /old_locus_tag="ZYRO-ORF3606"
FT                   /product="ZYRO0E08646p"
FT                   /note="weakly similar to uniprot|P35190 Saccharomyces
FT                   cerevisiae YGL215W CLG1 cyclin-like protein that interacts
FT                   with Pho85p in affinity chromatography cyclin-like protein
FT                   that interacts with Pho85"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08646g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31047"
FT                   /db_xref="GOA:C5E4T6"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4T6"
FT                   /protein_id="CAR31047.1"
FT                   /translation="MASTFMYYPGHAPGGPVVDTCAAANAAALQHHQQQHQQSHLRQME
FT                   AHQQQQQQQQHSQQQQQYAASAAAAAAAPYGYYQNGLAAAQGMAAVQQQQQHQQQQAAA
FT                   FYNQQQHQHQQQAVAHHRRTSSFRQQPTLPPLGMFYPGAPPATILPLPLQQEAPAPREE
FT                   YVNGGVNQFLDYDLDLMSEFVIKKSYNAFGTDAGAVIRETGSNQTVDLFTKGVFSVLSA
FT                   TRLPAVTIFMALDLLSKYVTKTHAASGSIRSGCVNVVYQNTMVAFVLANKFNDDKTFTN
FT                   KSWSQATGMDVLCINNFEREWLDVLEWRLFDDKFVHYDEYAHAFEIFCQEKRCPSPPNM
FT                   LPAPHSTDNYLSPPSDCQTPVHLNANVYSSPGFLEKDTNDFYYGQPGVLSSPVSQFTPN
FT                   SAAAYSTTSGGPMNYNFYNFGPPQPAAAVQPMMGLPPAHMWNMDERFGNFASSNFPGFD
FT                   NNYYCYSAVY"
FT   gene            complement(<694586..>696922)
FT                   /locus_tag="ZYRO0E08668g"
FT                   /old_locus_tag="ZYRO-ORF3604"
FT   CDS_pept        complement(694586..696922)
FT                   /locus_tag="ZYRO0E08668g"
FT                   /old_locus_tag="ZYRO-ORF3604"
FT                   /product="ZYRO0E08668p"
FT                   /note="similar to uniprot|P53086 Saccharomyces cerevisiae
FT                   YGL216W KIP3 Kinesin-related motor protein involved in
FT                   mitotic spindle positioning"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08668g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31048"
FT                   /db_xref="GOA:C5E4T7"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4T7"
FT                   /protein_id="CAR31048.1"
FT                   /translation="MDSKERQSSIVVAVRVRPFTDYESSHLMPEGRDEFYVNMGDSNLV
FT                   LPNGNSVGDSDEKYQKSNTRLPAMLRPQGIRRIVECVDDKMLIFDPADTNPLNKVGETV
FT                   LNSMYSRKNRSRRRLRRNGGEVRFVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTV
FT                   FAYGATGCGKTYTISGSPENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIR
FT                   DLLCPETSSKKLVILEDSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEA
FT                   SSRSHAVLQIHIMQHNRTADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINR
FT                   SLLALGNCINALCLNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYD
FT                   ETLNTLKYANRAKEIKTKVSRNNQTLDRHVSSYLKMISEQKQEIDELRRREQVVIDMRL
FT                   KKYQLTQEKVQLAIEDCLQNVQTAFAKAGNFHNSKNIKSLMLCKRRFLQLVQLELINVI
FT                   SLVQEWTDPQIYQSSTLLHDQLTNKIRELEDAFDQPGELDLVLERCRTVDLPKLKEMEG
FT                   WNDARDLPYFEAQLDHLAEFIRNEILINASAMVERVLQDEILSQRFKFLSLCLAHDTNI
FT                   AAAVQDLVKIDEEFETFGRNFVISSGSSRSSSPPTVSSTQSILKPATRRSGPRRVTKAT
FT                   DSPTGSSSPNGNNGSNRKNLQTPVVTKTVRWLNLESPSTTPEPTDMDVSMQDAEPVGTA
FT                   VGAGRPTMLPRQAPRNSLLDRRLGE"
FT   gene            <697343..>699097
FT                   /locus_tag="ZYRO0E08690g"
FT                   /old_locus_tag="ZYRO-ORF3603"
FT   CDS_pept        697343..699097
FT                   /locus_tag="ZYRO0E08690g"
FT                   /old_locus_tag="ZYRO-ORF3603"
FT                   /product="ZYRO0E08690p"
FT                   /note="similar to uniprot|P53083 Saccharomyces cerevisiae
FT                   YGL219C MDM34 Mitochondrial outer membrane protein
FT                   colocalizes with mtDNA nucleids required for mitochondria
FT                   shape"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31049"
FT                   /db_xref="GOA:C5E4T8"
FT                   /db_xref="InterPro:IPR027536"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E4T8"
FT                   /protein_id="CAR31049.1"
FT                   /translation="MSFRFNSQAFEDNSFNEKIREKLTQALNSSSSDSRSPKVTKTTMG
FT                   EGSTSKKDSGSGGKSRKFDILKSGITVSKVNFPTTPQLEILDLDISAQPRSLVKGICKI
FT                   SCKDAMLQIQTEVEANLLLVYSECSPSFATPNMICNDSFTIPITMVFSEIRLEAITNIF
FT                   VKHSGIGISFNDVNLDFKFDCSMKILQSTIERRLKNSMHHLFKEVLPSVIFSMSQSLFL
FT                   SEAARNQEMHNESRGDSRPSPRVVLEESDLQELSPANMLRLSTLISSRQTLSLHGTVLN
FT                   VPSTIPGCLERQNLHRFNSRIPSLSNYYASYKEEEKSRQVEVKKSVGSSVPLPHTSFAA
FT                   NPNLLPVRTLQEGAYDLPTITGIQNRIFERSTDENERPRRRKLKIKMSGRKQQPQAPKE
FT                   EEPKQAEQQPETEPQQQRLLPTPEIPSREQASTPVDIDPTVSTPDSPDTEITSPKPLSI
FT                   RNPILSDVEKMDSEDASAKSFVAPLKLPVSITSKYFNYPADHISAQTPRRYSPQRINWE
FT                   DALFNTSELSNLRTSLYSPIARGSLLNPTKERPDRGRILDNRRLSFVGLNFKGGKWGDD
FT                   DDPPPYSG"
FT   gene            complement(<699208..>699525)
FT                   /locus_tag="ZYRO0E08712g"
FT                   /old_locus_tag="ZYRO-ORF3599"
FT   CDS_pept        complement(699208..699525)
FT                   /locus_tag="ZYRO0E08712g"
FT                   /old_locus_tag="ZYRO-ORF3599"
FT                   /product="ZYRO0E08712p"
FT                   /note="highly similar to gnl|GLV|CAGL0I06985g Candida
FT                   glabrata CAGL0I06985g and similar to YGL220W uniprot|P53082
FT                   Saccharomyces cerevisiae YGL220W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31050"
FT                   /db_xref="GOA:C5E4T9"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4T9"
FT                   /protein_id="CAR31050.1"
FT                   /translation="MKFHLSDPYMVNQHQETRRSRMVSKDQIEIRIKENVSELYQTIVT
FT                   DISGGCGQSFDIVVVSNSFQGKNKLQRSRWMNTVLKEEIAQIHAFSCKCYTEAEWSKIV
FT                   T"
FT   gene            <699587..>700456
FT                   /locus_tag="ZYRO0E08734g"
FT                   /old_locus_tag="ZYRO-ORF3598"
FT   CDS_pept        699587..700456
FT                   /locus_tag="ZYRO0E08734g"
FT                   /old_locus_tag="ZYRO-ORF3598"
FT                   /product="ZYRO0E08734p"
FT                   /note="similar to uniprot|P53081 Saccharomyces cerevisiae
FT                   YGL221C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08734g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31051"
FT                   /db_xref="GOA:C5E4U0"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4U0"
FT                   /protein_id="CAR31051.1"
FT                   /translation="MSRALARSQLQRFINAVTKYYPSGYADSSWDNTGLLIDCSVEKAS
FT                   SEEPRVLLTVDLTASVVQEAIEKGCNAILAYHPFIFPSWKSLSPHSNPQHRSALRLIQE
FT                   GISVYSPHTAVDAAKGGVNDWLAFGLAGNDRYRVVSNVVLEPIKGQCINGEEPSEVGYG
FT                   RLVTLSAPLSLAQIVENVKKSLGIPHVQVASLAKDHQQHNIRKIALCAGSGSGVFKSLR
FT                   EDVDLYYSGELGHHEVLRYKESGKAVIVCNHSNTERGFLRDEFSKQLQDEGIENIVSET
FT                   DVDPLQVV"
FT   gene            <700580..>701137
FT                   /locus_tag="ZYRO0E08756g"
FT                   /old_locus_tag="ZYRO-ORF3597"
FT   CDS_pept        700580..701137
FT                   /locus_tag="ZYRO0E08756g"
FT                   /old_locus_tag="ZYRO-ORF3597"
FT                   /product="ZYRO0E08756p"
FT                   /note="similar to uniprot|P40022 Saccharomyces cerevisiae
FT                   YER034W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31052"
FT                   /db_xref="InterPro:IPR035303"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4U1"
FT                   /protein_id="CAR31052.1"
FT                   /translation="MDPYALKQDNRKRFKDKQHAKQRHATPSDRKYRALKRQEQAHEDE
FT                   QEAPPPPPSNEYRYHEDVTMAYGEQQDEERNTHANKRVRELLMNKDEGSGLNLDQGGLS
FT                   KESQAAVTRKELEKMDVAGLNRVLGRSHTPDLVKHTNDPLAPPRQATKSQEKARKEPSP
FT                   NKNVSTVPQDLKDDEDFLDGLI"
FT   gene            <701308..>702291
FT                   /locus_tag="ZYRO0E08778g"
FT                   /old_locus_tag="ZYRO-ORF3595"
FT   CDS_pept        701308..702291
FT                   /locus_tag="ZYRO0E08778g"
FT                   /old_locus_tag="ZYRO-ORF3595"
FT                   /product="ZYRO0E08778p"
FT                   /note="weakly similar to uniprot|P53080 Saccharomyces
FT                   cerevisiae YGL222C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08778g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31053"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4U2"
FT                   /protein_id="CAR31053.1"
FT                   /translation="MSTDAMYMNSPHVLRASGKHTNRTSHVTKLDKQRIQQNDKGSNKS
FT                   KNGQVAISVPKTQVLPNGEKPDFGNSNSTRKSKNGTQKKGGAKEQKDVTKGLRSLRLPD
FT                   EKTKSSRQQQQKEKETQSTKSQSSRPRSNSNASAGLNSSSTPISSTPPTVPTSPLEKPA
FT                   AAIPNVTPLMAPGAIPVPPPLTGLPNLMPNSIPHPLPPPPTGVQPLPMQPPLFGGPGYP
FT                   YGNYAVRPMPYMNPQTPSPVVSQMYPQIPLPMMQMQMQMPQVNSDTEAQTTMMQTTMMT
FT                   AKPSATSTSSCSNSRRPTTTKSTSFAGASFASKDPVINKLPKPSFA"
FT   gene            complement(<702554..>704386)
FT                   /locus_tag="ZYRO0E08800g"
FT                   /old_locus_tag="ZYRO-ORF3594"
FT   CDS_pept        complement(702554..704386)
FT                   /locus_tag="ZYRO0E08800g"
FT                   /old_locus_tag="ZYRO-ORF3594"
FT                   /product="ZYRO0E08800p"
FT                   /note="highly similar to uniprot|P40024 Saccharomyces
FT                   cerevisiae YER036C"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31054"
FT                   /db_xref="GOA:C5E4U3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4U3"
FT                   /protein_id="CAR31054.1"
FT                   /translation="MPPVSSSKAKRDAKRVERENKKLEAGKTVRKFGKTKDNSEQKDEA
FT                   DVAAENVAAMKLQQDEEGISDRVVTGVLDSLKTSRDIKLSSVSLLFHGKVLIQDSILEL
FT                   NYGRRYGLLGENGCGKSTFLKALAAKEFPIPEAIDVYLLDEPAEPSEYSALEYVVREAE
FT                   NELKRLEELVEKIIIDEGPESDYLESLYERMDSLDPDTFETRAAIILVGLGFNKDTIQK
FT                   KTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTLVLNSH
FT                   SQDFLNGVCTNMIDMRLQKLTSFGGNYDSYAKTRSELETNQMKQYNKQQEEIAHIKKFI
FT                   ASAGTYANLVRQAKSRQKILDKMEADGLVQPVVPDKVFSFRFQEVERLPPPVLAFDEIS
FT                   FAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRVSRHTHV
FT                   KLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLGRYGLTGDGQKAQMGTLS
FT                   EGQRSRVVFALLALQAPNILLLDEPTNGLDIPTIDSLAEAINTFNGGVVVVSHDFRLLD
FT                   KIAQDIFVVENKTAYRWDGSILEYKNKLAKNVVL"
FT   gene            <704618..>705790
FT                   /locus_tag="ZYRO0E08822g"
FT                   /old_locus_tag="ZYRO-ORF3592"
FT   CDS_pept        704618..705790
FT                   /locus_tag="ZYRO0E08822g"
FT                   /old_locus_tag="ZYRO-ORF3592"
FT                   /product="ZYRO0E08822p"
FT                   /note="weakly similar to uniprot|P53079 Saccharomyces
FT                   cerevisiae YGL223C COG1 Essential component of the
FT                   conserved oligomeric Golgi complex (Cog1p through Cog8p) a
FT                   cytosolic tethering complex that functions in protein
FT                   trafficking to mediate fusion of transport vesicles to
FT                   Golgi compartments"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31055"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4U4"
FT                   /protein_id="CAR31055.1"
FT                   /translation="MDVDAVGFLRTHSVVEVRDLDLEISGDAAKLYDKFAQELREQYGE
FT                   ILEVTKSVGELFGCLKRGDFELRDLCFRDDLYKLKKLEPLEGTIERENVKESAADDNGA
FT                   ANKVLLISNWSLAISDFVSRFAVSLSSAKLFDQVITQFQNLQEYGQWQEYETVIRDKCE
FT                   QFVQYLLDSSSNNITFTVGQWARIWSLVFKGTNFPWNGEQVLKLDEILFQSLFQESLDV
FT                   LMNDTDEEVSKFVHSSEFEQKLNAKILQDIERQFQLLEDLVSQQEEDTTPTFEYPRAVQ
FT                   ELDVAQVVENCRLHSIGLTTRSRVQMYNLVDPLIQMINDLQVHGGQSDQVTQLRRKLAT
FT                   VLKNKIPVTDEHKEPNESLTMDQVLEHLMTNQNDSSASRLIRKQINALGA"
FT   gene            <705988..>706827
FT                   /locus_tag="ZYRO0E08844g"
FT                   /old_locus_tag="ZYRO-ORF3590"
FT   CDS_pept        705988..706827
FT                   /locus_tag="ZYRO0E08844g"
FT                   /old_locus_tag="ZYRO-ORF3590"
FT                   /product="ZYRO0E08844p"
FT                   /note="similar to uniprot|P53078 Saccharomyces cerevisiae
FT                   YGL224C SDT1 Pyrimidine nucleotidase overexpression
FT                   suppresses the 6-AU sensitivity of transcription elongation
FT                   factor S-II as well as resistance to other pyrimidine
FT                   derivatives or to YER037W uniprot|P40025 Saccharomyces
FT                   cerevisiae YER037W PHM8"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31056"
FT                   /db_xref="GOA:C5E4U5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4U5"
FT                   /protein_id="CAR31056.1"
FT                   /translation="MTIAKDSQREYRLHILKQLEENARHLETLDYSGSKVTFPLDQGIP
FT                   EPDPHAKVFFFDIDNCLYHRSTNIHEIMQQSIRSYLINELSIDEDEAETLNQGYYKEYG
FT                   LAIRGLMMFHGIDAMEYNRTVDDSLPLQHILKPDLQLRKVLYELRQRGHIDKMWLFTNA
FT                   YKHHALRVVRILGIADLFDGITYTDYNVGPNSLICKPDPRAFEKAKLESGLGDYSNAYF
FT                   IDDSGNNVEQGLLLGMSKCIQVVEDNHVDEILGNIPMGALLVNSVSDLPRAVPELFK"
FT   gene            complement(<706896..>708026)
FT                   /locus_tag="ZYRO0E08866g"
FT                   /old_locus_tag="ZYRO-ORF3589"
FT   CDS_pept        complement(706896..708026)
FT                   /locus_tag="ZYRO0E08866g"
FT                   /old_locus_tag="ZYRO-ORF3589"
FT                   /product="ZYRO0E08866p"
FT                   /note="weakly similar to uniprot|P40026 Saccharomyces
FT                   cerevisiae YER038C KRE29 Essential protein of unknown
FT                   function heterozygous mutant shows haploinsufficiency in K1
FT                   killer toxin resistance"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08866g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31057"
FT                   /db_xref="GOA:C5E4U6"
FT                   /db_xref="InterPro:IPR014803"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4U6"
FT                   /protein_id="CAR31057.1"
FT                   /translation="MSSDSDEDAIIFRQNVNDNELDSSSSSSSSTDEDDRLLQTLKRTS
FT                   YSSRRVTRSSPIKKSKSVQIQKFDLGRNFDPQLASSLDRIQNVKDEVDNPSTVTTVKEQ
FT                   KSNTVRSRIKPRDASSQYIDLIVRETISGRYIDWHFISNDTRFEDVDIDDELIEDSDNH
FT                   AVRDAIRRKYPTLLELIESLGADLSLLQEDKPLTRKRDYDSLSEMTPVDSMMRAIGCYQ
FT                   DDKQFIKYLLCFILDRKIWESQDCDDDWCSQMLESVGDEQIIDFYLSLVDPKDYFMHYR
FT                   LSRCISRLQSPLIHRIIRPITIEEEFTQLIEDKNYESLLYFTLFVYGSHEMPFGPSSRT
FT                   QYFKDCVEDMCNEGTNAVELSLLRGLLSLFLKIRIS"
FT   gene            complement(<708203..>709297)
FT                   /locus_tag="ZYRO0E08888g"
FT                   /old_locus_tag="ZYRO-ORF3588"
FT   CDS_pept        complement(708203..709297)
FT                   /locus_tag="ZYRO0E08888g"
FT                   /old_locus_tag="ZYRO-ORF3588"
FT                   /product="ZYRO0E08888p"
FT                   /note="similar to uniprot|P40107 Saccharomyces cerevisiae
FT                   YGL225W VRG4 May regulate Golgi function and glycosylation
FT                   in Golgi Golgi GDP-mannose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08888g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31058"
FT                   /db_xref="GOA:C5E4U7"
FT                   /db_xref="InterPro:IPR038736"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4U7"
FT                   /protein_id="CAR31058.1"
FT                   /translation="MSELKVGNEHALARITNNGPISILAYCCSSILMTVTNKFVVNKDD
FT                   FNMFFVMLVVQCLVCTLVLVVLKGLGYAKFRPLNKTDIKNWMPISFLLVLMIYTSSKAL
FT                   NLLPVPIYTIFKNLTIILIAYGEVLFFGGSVTSMELSSFLLMVFSSVVATLGDRQDVAA
FT                   KAQAEALALAQKNAGGVNGAGSGGSLGTAGLANAAANALPGAASSLNVGYVWMLFNCVS
FT                   SALFVLIMRKRIKLTNFKDFDTMFYNNALAMPILLIASFLFEDWSSANLRVNFSNESMT
FT                   ALVISGAASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLLFFDAPKNFLSILSI
FT                   FIGFLSGIVYVAAKQKKMKQQPPK"
FT   gene            <711088..>713649
FT                   /locus_tag="ZYRO0E08910g"
FT                   /old_locus_tag="ZYRO-ORF3584"
FT   CDS_pept        711088..713649
FT                   /locus_tag="ZYRO0E08910g"
FT                   /old_locus_tag="ZYRO-ORF3584"
FT                   /product="ZYRO0E08910p"
FT                   /note="some similarities with uniprot|P18494 Saccharomyces
FT                   cerevisiae YER040W GLN3 Transcriptional activator of genes
FT                   regulated by nitrogen catabolite repression (NCR)
FT                   localization and activity regulated by quality of nitrogen
FT                   source"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08910g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31059"
FT                   /db_xref="GOA:C5E4U8"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4U8"
FT                   /protein_id="CAR31059.1"
FT                   /translation="MPEGANTFNLYDIIDQTPPTGLTDDIDKESNGENDQHTAPSTFAF
FT                   NASTFDTMLEVLPDDVGLNIPAFSGAESVPDSDGKRQTSKDINDDDIQGITNSNLGMEG
FT                   LDDTNLQSHMDLMPPTRPIDIASNQLSGEIAPLWDFKMEDFMMTPAPGDFNSSAPNSFN
FT                   SNRHFLQSESAPTGQHGSFNGFGSTGFNLTQTLGMGMPQHHFNYNQSTSSSPKTGTNHF
FT                   NNSNTNGNNNYNHNTDDNVTFNTPQRENSFSQRHSIGSRKPSNQFSKTVHTEDGGIALS
FT                   SSTTTNSVKKNSLVRQVSSTSLSNYKRGSSSGIPDLPKKPPIQCYNCKTNKTPLWRRDA
FT                   QGNTMCNACGLFQKLHGTMRPLSLKSDVIKKRNTKKRTEKEKQSQEHGNQSNNTNTNNN
FT                   NNNTNNNNTKNSRQSTRKNARGSIHGNNDSGGVGGFPVLTQSITVPVTSFETGVAGSPI
FT                   VSSLENRSQQLQASSQASSQAQSQSQYERQQNVTTESLNPYNLMDHNKKMASSNTQCSR
FT                   KSRRSSTSSNNSSSSKSFSRSVVPILPKPSPGAPQFNVNYNGSSSAGNSAASSPRVFAA
FT                   GCNPESPMNSCQQTASSNSASKTGISIPRPKSSRNYSSSSSFMAASLHQLQQQHQKQEQ
FT                   PQQHQQSPNVQMGSGGFSMPNSWNSGSQTSIGYSPNSTRSPKGGFDFVGSPVDSSGPGT
FT                   RTGSRKSHTSLLSQQLQNSALYNEEMAHQQGQSEAHTPNVPQSNGSSNVGTPQPVPLGR
FT                   NSVTASPRNSYADSLLQQRGMKDELGSSFRRQNSVWARKNVSLKEHVISSNAEATVCSN
FT                   PNILAATPTVSTTASPAASGETSTEAHKNITDELDWLKFKM"
FT   gene            <713990..>715735
FT                   /locus_tag="ZYRO0E08932g"
FT                   /old_locus_tag="ZYRO-ORF3581"
FT   CDS_pept        713990..715735
FT                   /locus_tag="ZYRO0E08932g"
FT                   /old_locus_tag="ZYRO-ORF3581"
FT                   /product="ZYRO0E08932p"
FT                   /note="weakly similar to uniprot|P40028 Saccharomyces
FT                   cerevisiae YER041W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08932g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31060"
FT                   /db_xref="GOA:C5E4U9"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4U9"
FT                   /protein_id="CAR31060.1"
FT                   /translation="MGVPQIWELLRPYLQDKRVPLKKFVSDFKFSHGRSPRIAIDGYSW
FT                   LFECGFILNQETPGKYASHGTIGKAVLNFVYRLKELLALNITFILVFDGSMKPSFKKNF
FT                   GSPLSCAEDDYWSTWNSHMEIHERNGHCLKIMLDSEGLHFMQVVKGVLGSMRISYVEAC
FT                   GEGEAQCAWLQRNGHVDYVLTNDSDALVFGATRLLRNYSKFTNDLGATGNSPLGKQRSS
FT                   SKDLFVTVVDLDQLNSATNDRYNWWSLLFFSVLLGADYNQGVKGMGKVKAAKLAQLQDP
FT                   DFAQRFRDMFADLRRRPQLSEYQNFQQELTEFCKDHSVELFDRNYRAMLGELSLEGWPS
FT                   LNAIMYYFHPILIPQMDFQVFDKSNVNISGSNGYKEINFLQLQAYLGDFRLPAVTNFEK
FT                   WFTETILDSFLLRRLLSQDRNLTDYVQIVDQRTFEISGKWPLSCWKIKYKPYILFFQVG
FT                   ESGRNSFPYTMWIPQGLIPQDHILITKWKRTPKSKTPSPSKSKISPQKNTLDSFLKKHA
FT                   SPVKDFSPAKKIDDQVTLEPVKKRLFVDSNDSSNDSEDDSLVILDEITLKDNSSLSTWK
FT                   KRRQK"
FT   gene            <715937..>716491
FT                   /locus_tag="ZYRO0E08954g"
FT                   /old_locus_tag="ZYRO-ORF3580"
FT   CDS_pept        715937..716491
FT                   /locus_tag="ZYRO0E08954g"
FT                   /old_locus_tag="ZYRO-ORF3580"
FT                   /product="ZYRO0E08954p"
FT                   /note="highly similar to uniprot|P40029 Saccharomyces
FT                   cerevisiae YER042W MXR1 Peptide methionine sulfoxide
FT                   reductase reverses the oxidation of methionine residues
FT                   involved in oxidative damage repair providing resistance to
FT                   oxidative stress and regulation of lifespan"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31061"
FT                   /db_xref="GOA:C5E4V0"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4V0"
FT                   /protein_id="CAR31061.1"
FT                   /translation="MVPTLSKGIKFNSQTDKILTVGAGCFWGTEHIYRKYLGERIDDCK
FT                   VGYANGSEMKKDQTNSVTYKRLCIGDTGFCEVLQIAYNPQKLSLKELVDLFFRCHDPTT
FT                   ANQQGPDAGTQYRSALFAHSEGDLKELKELKDQWQPKWGNKITTEVELIKNFYDAEDYH
FT                   QLYLDKNPEGYACPTHYVRNL"
FT   gene            complement(<716557..>716946)
FT                   /locus_tag="ZYRO0E08976g"
FT                   /old_locus_tag="ZYRO-ORF3579"
FT   CDS_pept        complement(716557..716946)
FT                   /locus_tag="ZYRO0E08976g"
FT                   /old_locus_tag="ZYRO-ORF3579"
FT                   /product="ZYRO0E08976p"
FT                   /note="similar to uniprot|P53077 Saccharomyces cerevisiae
FT                   YGL226W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31062"
FT                   /db_xref="GOA:C5E4V1"
FT                   /db_xref="InterPro:IPR004203"
FT                   /db_xref="InterPro:IPR036639"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4V1"
FT                   /protein_id="CAR31062.1"
FT                   /translation="MWARVTLKPLARRSASSLSYTPPSMVDLPSRWSTMNPQLQEEITE
FT                   YLTWKMEDSWKLMTVDELKASYYISYGQWGPRGKTDIQLTPTMLIWKGLFSTLLFTALG
FT                   VSLINLKRDKHMDKALNGLQRNSSE"
FT   gene            <717090..>717428
FT                   /locus_tag="ZYRO0E08998g"
FT                   /old_locus_tag="Zyro0E.mRNA.1107.p"
FT   CDS_pept        join(717090..717110,717189..717428)
FT                   /locus_tag="ZYRO0E08998g"
FT                   /old_locus_tag="Zyro0E.mRNA.1107.p"
FT                   /product="ZYRO0E08998p"
FT                   /note="similar to uniprot|Q92316 Saccharomyces cerevisiae
FT                   YGL226C-A OST5 Zeta subunit of the
FT                   oligosaccharyltransferase complex of the ER lumen, which
FT                   catalyzes asparagine-linked glycosylation of newly
FT                   synthesized proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E08998g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31063"
FT                   /db_xref="GOA:C5E4V2"
FT                   /db_xref="InterPro:IPR007915"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4V2"
FT                   /protein_id="CAR31063.1"
FT                   /translation="MSYADLQKEFKVAETFEPVFQLSSQSRYALFSLVIAVLLISMALV
FT                   SAYSKKGFLIRLAIFAALSAAGSMFSGIGVVFLANSLGVYV"
FT   gene            complement(<717476..>720061)
FT                   /locus_tag="ZYRO0E09020g"
FT                   /old_locus_tag="ZYRO-ORF3578"
FT   CDS_pept        complement(717476..720061)
FT                   /locus_tag="ZYRO0E09020g"
FT                   /old_locus_tag="ZYRO-ORF3578"
FT                   /product="ZYRO0E09020p"
FT                   /note="similar to uniprot|Q753T4 Ashbya gossypii AFR242C
FT                   AFR242Cp and weakly similar to YGL227W uniprot|P53076
FT                   Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09020g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31064"
FT                   /db_xref="GOA:C5E4V3"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4V3"
FT                   /protein_id="CAR31064.1"
FT                   /translation="MSAYMDNVDREFIKGLFPEYLLQQPVAYSLWMSYYRHKKVFHKMK
FT                   HNGISDIGKQQLLSRESGYYRLSNKLSYSARKEIWQKLMSLGVLGTLSFDSANDEYLVQ
FT                   VYKYFHPGPNNNLSGNASSGALPNGSIGMQYASGSGDEMEDLTKPAIAEEEILAELAMQ
FT                   DADDMEEDDDRDTAEAMDDDEDDDDEDDDDEDNDESNEGVRLGRRDGSNVTDDANQDSS
FT                   SGSRSSHGSHHETMNFYPALATHAHPTKSKNNNMTSDVYQMLGYSLPSQWVTQPNNCVL
FT                   LSADGISRLSPNPNWQAYNAYERSTASTRNRLRNSFSGNQKNDFAVTWANNFLHLNKLG
FT                   IFYYEIRILGVTSSQGAQNSNIIVGYKCWPDSDVSGTVSKSENERAGLSGSGVPGLGGG
FT                   LRSSVRSGGGSTGSAAGDDSSSGAKSGIEEGFFGYRGSDGSITVGSQYKSYAKPFGRDD
FT                   VIGCGVNYVDGTIFFTKNGVFLGTAFTDFHEVNLIPYIALRQGNSVRTNFGLYEEFVFD
FT                   ILGYQNRWKAKAYKHIFKSSDHSDLLDEFDLSDEEDNDQEVKGEKAMEIDNDGLQDTDS
FT                   DIACIKDSLLLKDTRFEDDQLRKPDVEKINNLNTGDDSIPSTLHTMINDYLIHEGLIDV
FT                   SKGFLKDLQRENVSNSSDDRGAAVIRHNERQIIKEEKNLKIRQDLRRFITEGNISQCLS
FT                   YIESQLPGLLQENIELLFEIRVAQYLLTILHYKKYSIESIVSKGQELSKDFVYNESVPE
FT                   DLRERFRAQLSNVSALLAYDDPVNESPEELARYLSNEYLQDRLFQVINTNILKFLKKNS
FT                   DSKLETVIRYTRSMLATLMTCNVEGSSVYNGTELRYFKILNIDEDLLNL"
FT   gene            complement(<720719..>722068)
FT                   /locus_tag="ZYRO0E09042g"
FT                   /old_locus_tag="ZYRO-ORF3575"
FT   CDS_pept        complement(720719..722068)
FT                   /locus_tag="ZYRO0E09042g"
FT                   /old_locus_tag="ZYRO-ORF3575"
FT                   /product="ZYRO0E09042p"
FT                   /note="highly similar to uniprot|P39954 Saccharomyces
FT                   cerevisiae YER043C SAH1 S-adenosyl-L-homocysteine hydrolase
FT                   catabolizes S-adenosyl-L-homocysteine which is formed after
FT                   donation of the activated methyl group of S-
FT                   adenosyl-L-methionine (AdoMet) to an acceptor"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09042g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31065"
FT                   /db_xref="GOA:C5E4V4"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4V4"
FT                   /protein_id="CAR31065.1"
FT                   /translation="MSAPAQNYKVADISLAAFGRKEIELSEHEMPGLMAIRKAYAAEQP
FT                   LKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWK
FT                   GETEEEYMWCIKQQLFAFKDNKKLNLILDDGGDLTSYVHESHPEMLEGCFGLSEETTTG
FT                   VHHLYRMVKENKLKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVA
FT                   GYGDVGKGCSAALRNMGARVIVTEVDPINALQAAMEGYQVLTMDEAASQGQVFVTTTGC
FT                   RDIIRGDHFLKMPQDAIVCNIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSTGKHVI
FT                   LLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKANDKAFREKYVEFQKTGPFSLD
FT                   VHVLPKILDEAVAKFHLGKLGVQLTQLTDVQSEYLGIPQEGPYKADHYRY"
FT   gene            complement(<722374..>724443)
FT                   /locus_tag="ZYRO0E09064g"
FT                   /old_locus_tag="ZYRO-ORF3574"
FT   CDS_pept        complement(722374..724443)
FT                   /locus_tag="ZYRO0E09064g"
FT                   /old_locus_tag="ZYRO-ORF3574"
FT                   /product="ZYRO0E09064p"
FT                   /note="some similarities with uniprot|P53075 Saccharomyces
FT                   cerevisiae YGL228W SHE10 Putative
FT                   glycosylphosphatidylinositol (GPI)-anchored protein of
FT                   unknown function overexpression causes growth arrest"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09064g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31066"
FT                   /db_xref="GOA:C5E4V5"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E4V5"
FT                   /protein_id="CAR31066.1"
FT                   /translation="MKILTKFFLLLVVTTCSLHYYCQIGQCSTQLQRVCHYTTPSVWDE
FT                   LLVEKNEFYREQLNPKVKVLKSHISQINSHYQDKVLPKLVDLGNRFYFDIVSPRIDNVC
FT                   EFWEEFELKPYRERSLNQIRKVRQRIWFYYSVYLKPNLTKLDNQYALSDKYGKVHNKIA
FT                   PFVAEIAQNFQNVYHQAAAKVHPHWENLRRTVNAKWEPISSSLWQRCRTNEICFKTNAQ
FT                   LKNIWKNLKLGCDYLSIYVHDALSPYSDGLESNVRATKAKSKSKPRVNASASARGNARA
FT                   GAKAGAKAGTSEISASATADPTTSASATVTAGFEDDYDDEEPLYTSTSTIMLTVTMSTD
FT                   QNELSPSQNTANAELGISEQDAIKDEFEAWFKVVDQKSSGVVKTFNKEVNKYLHHRVQQ
FT                   LDSIFQNKTKTVSEVLQNRYKNLNRAIQDINCTCETDTGAGNQTCFDSTGTTQLSEYIT
FT                   RSKMRELFAEAHSTLDQSMLQLKQDLEPIAQEVESRVSLIREEMVEVYEEWGDAMVSEW
FT                   SKRLAYIDVVAGHLDDNGASTDEESSENWRKFLNLKKQVIKARDELAEHPADLHEIKQF
FT                   VKKVHYLIEVLAKEAGEYLYILRARANLAFQAREQESKQREDSPRMDRDSTQNVENSNT
FT                   TTASAEKSGKKAKKVKRVAQNGTNSTEKFSAGPDSSSKEPSMETTVQNNVTLQI"
FT   gene            <725543..>728698
FT                   /locus_tag="ZYRO0E09086g"
FT                   /old_locus_tag="ZYRO-ORF3572"
FT   CDS_pept        725543..728698
FT                   /locus_tag="ZYRO0E09086g"
FT                   /old_locus_tag="ZYRO-ORF3572"
FT                   /product="ZYRO0E09086p"
FT                   /note="weakly similar to uniprot|P43612 Saccharomyces
FT                   cerevisiae YFR040W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09086g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31067"
FT                   /db_xref="GOA:C5E4V6"
FT                   /db_xref="InterPro:IPR007587"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4V6"
FT                   /protein_id="CAR31067.1"
FT                   /translation="MSFWPFGQSISSSNINKILDEYFSVLHSLEKSNPNVAKSVRQSLH
FT                   GAQETIQRSGGEFVDSLDYVPEDELLESTGSIQQRDRSNSSSGSSSSSSSSSLSSSKSG
FT                   SSGTDLDDDEIQNSTAPLVTATSIASLNSSYINRLLNESELLNELTRQNSNLLDFICFG
FT                   FFYDEKTKNKIPFLEYLIDQLMDCIDKISPSTTSLADVLEVESTPPQPPPPPETERTTG
FT                   SMDDENNDNNDDDDEDDETNDKEPNYLSRATIISEIFSLDIWLITESLVNNQSYLSKIW
FT                   SMLNHPNLKTERSPLVPIFLKINQNFLITKQDQYLNFVRLRTNLVDDMLQHISISMLMD
FT                   FFLKCIATDKFESPTGLIELVNDQRLIPKCLNFLNNDVYSSDVQACAGDFLKALIAISA
FT                   NAPLDDMSIGPNALTRQLASQESIDQLVDIIINKRGPALNTTVSIVIELIRKNNSDYDQ
FT                   VNLLTTTIRSHPPSNHDPIYLGYLLKTFSRHLPTLFKIIIDAENDNNKPMLENQLHQKF
FT                   RPLGFERFKIVELVAELLHCSNMGLMNSKRAERIVKERDHFRKHMVNQLQDAIQDLTIA
FT                   SKDSPNATITSSSSKRRSSKSRRDSKSDRRYSADDSDISSKDKRQKRRQKENQKHQQLK
FT                   YTHDNNDDDDDNGCQVYDNDEGNDNEAAKSVSPMTTTTTTTTDYDSITTNGHDAGVTQD
FT                   NDNDDNNTNNINNNTNTNASASTTTTNNNNNNNNNNNNNNNNNNNNNDNNDNDDNININ
FT                   DNGINNEFDDEEDEVDESFEIPYVNVNQSNKLRKKPTVGDFFKIQLYDVQFLPKIIELF
FT                   LTHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYSLFNLRGSLQFMPTELQKQNSRDF
FT                   TLTKDFILQGYQDSYHFYEKYHTNLGYMGHLVLIAEEVVKFSKLYKVELISPDIHQALQ
FT                   DEEWRFYAEDVLNDTRMMYSKILGGGNYVDDGNGNIIPQLPDPSLPPSENENSTVGGGL
FT                   INVESLEEQLGLSTESDLHDKLRELLISSSQKEIDSRNERNGVIVLGPPSQDFDDDTID
FT                   DDE"
FT   gene            complement(<728771..>729667)
FT                   /locus_tag="ZYRO0E09108g"
FT                   /old_locus_tag="ZYRO-ORF3570"
FT   CDS_pept        complement(728771..729667)
FT                   /locus_tag="ZYRO0E09108g"
FT                   /old_locus_tag="ZYRO-ORF3570"
FT                   /product="ZYRO0E09108p"
FT                   /note="similar to uniprot|P43613 Saccharomyces cerevisiae
FT                   YFR041C ERJ5 Endoplasmic reticulum protein that may
FT                   function as a cochaperone as suggested by the presence of a
FT                   DnaJ-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31068"
FT                   /db_xref="GOA:C5E4V7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4V7"
FT                   /protein_id="CAR31068.1"
FT                   /translation="MPSIGIGIWLLLICAVGYCFTNAEVEIFQLQQELVKKYGSDIDFY
FT                   HFLKLPNLQGSTAKEITKNFRKLSKKYHPDKNKKFKKLYGRLNIATQVLTNENTRKTYD
FT                   YYLKHGFPDYDFSKGGFFFRRVQPKTWFIILFVYTSASLIHYILLKTQAQSQRKRIQFF
FT                   IDQVKSQDDTRGLGEKKLAFQQHAEDEPREITIRYGDVFITEEDGAETAISPDTVPEPG
FT                   VLDTLFFRLPWIIIRPFVKPLLKPFVSDKKQERSKKSEKVNLEVDVQDSKPKKNATTKS
FT                   NQKVLANGKVLTARKRK"
FT   gene            <729760..>730431
FT                   /locus_tag="ZYRO0E09130g"
FT                   /old_locus_tag="ZYRO-ORF3569"
FT   CDS_pept        729760..730431
FT                   /locus_tag="ZYRO0E09130g"
FT                   /old_locus_tag="ZYRO-ORF3569"
FT                   /product="ZYRO0E09130p"
FT                   /note="similar to uniprot|P43614 Saccharomyces cerevisiae
FT                   YFR042W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31069"
FT                   /db_xref="GOA:C5E4V8"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4V8"
FT                   /protein_id="CAR31069.1"
FT                   /translation="MLRIQENYLVLLKTKVSVQIQSSMALFSHSTISKLYQWYQICTTF
FT                   LYLALLARWIILLPLVGSKFLPGGIHEFLCHLMVWSSLAELVWLFKFHGFKNGLQSRTL
FT                   VKCLNFFYFVTVLHFHDDYEHALVLKNTSYSSFIIGLSLTQSHSHWCKLFKRGFVSKKS
FT                   WFYKLETWIWMPVLYISEFYLLLLNVQNPNFHSTPVLDRINRVVLVLFFPIALTLYKRQ
FT                   L"
FT   gene            complement(<730474..>731187)
FT                   /locus_tag="ZYRO0E09152g"
FT                   /old_locus_tag="ZYRO-ORF3568"
FT   CDS_pept        complement(730474..731187)
FT                   /locus_tag="ZYRO0E09152g"
FT                   /old_locus_tag="ZYRO-ORF3568"
FT                   /product="ZYRO0E09152p"
FT                   /note="similar to uniprot|P43615 Saccharomyces cerevisiae
FT                   YFR043C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09152g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31070"
FT                   /db_xref="GOA:C5E4V9"
FT                   /db_xref="InterPro:IPR034627"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5E4V9"
FT                   /protein_id="CAR31070.1"
FT                   /translation="MIMDSVSSPEQPKNKILVTFGDGDSIHQRELISQLFGIDIGIGDR
FT                   IVKGLVWKTKYYRVEFDLYIDDYNDFSSWFQEFASEEFAALREAMAGLVVVDQYEPTKP
FT                   LNPLGLQDTFVVWVNTDSKVGQDQVDEINDKLFQTEESTVELVNLHSNEDTNEYGEKIG
FT                   IPRFKEIVDTCSWKNCDMDYLTSTSSTTNPEVSLELIVQRMQHARLKHANSEMDNDEAL
FT                   QIAQEIAEELTGKED"
FT   gene            <731394..>731816
FT                   /locus_tag="ZYRO0E09174g"
FT                   /old_locus_tag="ZYRO-ORF3566"
FT   CDS_pept        731394..731816
FT                   /locus_tag="ZYRO0E09174g"
FT                   /old_locus_tag="ZYRO-ORF3566"
FT                   /product="ZYRO0E09174p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09174g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31071"
FT                   /db_xref="GOA:C5E4W0"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4W0"
FT                   /protein_id="CAR31071.1"
FT                   /translation="MLVNLFKSHKERPVDPVTECSFNDGTPSPDKSSIPECPVKNHNSS
FT                   QLRRPQSHDEERKTKFYSRICNKVINSINSRTFKVLMILAAVLNVLQLIAFFLIGVLYL
FT                   PKRTKKNLKNDDIYFMMDHVADNYIDYDFFLNESVL"
FT   gene            <731918..>732499
FT                   /locus_tag="ZYRO0E09196g"
FT                   /old_locus_tag="ZYRO-ORF3564"
FT   CDS_pept        731918..732499
FT                   /locus_tag="ZYRO0E09196g"
FT                   /old_locus_tag="ZYRO-ORF3564"
FT                   /product="ZYRO0E09196p"
FT                   /note="similar to uniprot|P53073 Saccharomyces cerevisiae
FT                   YGL231C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09196g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31072"
FT                   /db_xref="GOA:C5E4W1"
FT                   /db_xref="InterPro:IPR009445"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4W1"
FT                   /protein_id="CAR31072.1"
FT                   /translation="MSKVDAAAVEPHQWATNLTDSKYAKNLTIVTSNSMPSPSGFSSIE
FT                   STGRDSLEGRKNKFNSHVKSEDVVTLQMQKAWQIALAPAKSIPMNFFMSYMSGTSLQII
FT                   PIMTALMLLSGPIKSIFQVRANFRPVLGTSVTESQILVPMLVFIACQFALMYIGFQKLN
FT                   SMGLIPNTTSDWLSWEKRIDYNNGIRSFSF"
FT   gene            complement(<732536..>733473)
FT                   /locus_tag="ZYRO0E09218g"
FT                   /old_locus_tag="Zyro0E.mRNA.3320.m"
FT   CDS_pept        complement(join(732536..733342,733420..733473))
FT                   /locus_tag="ZYRO0E09218g"
FT                   /old_locus_tag="Zyro0E.mRNA.3320.m"
FT                   /product="ZYRO0E09218p"
FT                   /note="similar to uniprot|P53072 Saccharomyces cerevisiae
FT                   YGL232W TAN1 Putative tRNA acetyltransferase RNA-binding
FT                   protein required for the formation of the modified
FT                   nucleoside N(4)-acetylcytidine in serine and leucine tRNAs
FT                   but not required for the same modification in 18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09218g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31073"
FT                   /db_xref="GOA:C5E4W2"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR040183"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4W2"
FT                   /protein_id="CAR31073.1"
FT                   /translation="MSKRSFGGVSRDSGKRKKFKLSTGFLDPGTSGIYATCARKHEKQA
FT                   AQELSIVFEEKLEEMYGDELKKINEEKNDGEDDDKEVEALSIEDEVKRELSQLNGSKDS
FT                   SNQGQDRQKEILKFIDLSCECVIFCKTRRPVVPEQFVKSIMEDLADPSDMAKRTRYIQK
FT                   LTPITYSCSSSMEQLGKLAAKVLQPHFHDPSVTQDYKFAVEVTRRNFNTLERDDIIKKV
FT                   VSEVLNGSEHNHQIDLKNYNKLILVECFKNNIGMSVVDKDYITKFRKYNVQQIYEKKLK
FT                   EQNEK"
FT   gene            complement(<733659..>736304)
FT                   /locus_tag="ZYRO0E09240g"
FT                   /old_locus_tag="ZYRO-ORF3561"
FT   CDS_pept        complement(733659..736304)
FT                   /locus_tag="ZYRO0E09240g"
FT                   /old_locus_tag="ZYRO-ORF3561"
FT                   /product="ZYRO0E09240p"
FT                   /note="similar to uniprot|P22224 Saccharomyces cerevisiae
FT                   YGL233W SEC15 Essential 113kDa subunit of the exocyst
FT                   complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
FT                   Exo84p) which mediates polarized targeting of vesicles to
FT                   active sites of exocytosis Sec15p associates with Sec4p and
FT                   vesicles"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31074"
FT                   /db_xref="GOA:C5E4W3"
FT                   /db_xref="InterPro:IPR007225"
FT                   /db_xref="InterPro:IPR042044"
FT                   /db_xref="InterPro:IPR042045"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4W3"
FT                   /protein_id="CAR31074.1"
FT                   /translation="MDQEAQTQVSQEFQKVLLSSVSASLPSIVDDDTKNLSGQDDVLEL
FT                   DPSAFDKWVPYLRRSVERDQLGLATEELYNSVDDHFEGLEVELLQDSQVNDKLRNSIGQ
FT                   ISRVHNLIENSLVRDISNIQDQLNYSTNEVIMKKEVYVNDKKTSLKILEANILITKVLQ
FT                   ILELSNKCQELIIERDFFKALQNLDSLEKIYLQEFKNYNFQFLKEIYNSIPYLKSSIKN
FT                   ECINSIRNHFNSNIGKNIADVGEGYFNVYDEKLFPTWLEKKDHMKLANFKFNSPVEVSL
FT                   RDEDLVEELNLEKFFHLDEFHDSILIFRSLNELDYLISEFRREYEFRKAKLIDPLTWRK
FT                   SQKGNGSAFGDFTNDLFAQSLTMDFLKQYFLKILGFLLYDINLNRSTDFILVDNDYNAT
FT                   NEFWDALMLRLEPYLKHFVRKLQTEEELGEFKNFMCMYVCILENHNLNIEPLYRLLIVV
FT                   FEKVCNVNTTAFSAEFDILLHDDDFMPLAISDRGLYEKMLKICWMKDDELAKARAEAAE
FT                   QNGQFTITLPFSPLYPMTCTLLKKTYNKLIHFIGTYYRHELHTLNNILVKTMESIFSKI
FT                   INEKIRAKLDSTSREEIAQILINLDYFVIAAKEFSNMMTRDNILQNPSIEIKLASINNY
FT                   VESRKYAEDQLIELIDSKVTDILETVDLDWRAMEVRQEPDISIVDVAQFLEMMFSSTLV
FT                   NLPYSVQTLLIFREFDSLTRQFLDILLHETPPKITQESILNFEVDMKYLEGIISRIFPQ
FT                   RESESNGNNELQSPLMITSPTINGFTRSSNTIGNNVKSLEATFTELKQCIELMKLENMG
FT                   EYNDSEIRLRKYPRIKPEDASLLISKVEIPMNDVQSSFDDIDLNNSSQESNFRELSTNG
FT                   KKIAKFFNRG"
FT   gene            complement(<736735..>738267)
FT                   /locus_tag="ZYRO0E09262g"
FT                   /old_locus_tag="ZYRO-ORF3560"
FT   CDS_pept        complement(736735..738267)
FT                   /locus_tag="ZYRO0E09262g"
FT                   /old_locus_tag="ZYRO-ORF3560"
FT                   /product="ZYRO0E09262p"
FT                   /note="highly similar to uniprot|P43616 Saccharomyces
FT                   cerevisiae YFR044C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09262g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31075"
FT                   /db_xref="GOA:C5E4W4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017153"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4W4"
FT                   /protein_id="CAR31075.1"
FT                   /translation="MLTRALGVSSCLRRIATPNIVKRTVMTTNLQPKFEKLFDRIDALK
FT                   PAFIERLGQAVEIPAVSGDETLRPQVVKKAHFLVDQLSKLGFTDIQLKHLGKQPPPTSI
FT                   PDLQLPPVVLSRFGNDPSKKTVLVYGHYDVQPASLEDGWDTEPFKMYVDEKLQLMRGRG
FT                   TTDDTGPLTGWLNVVQAHKEAGVELPVNLVTCFEGMEESGSLGLDDLIAREAQGYFKGV
FT                   DAVCISDNYWLGTKKPVLTYGLRGVNYYQTTVEGPAADLHSGIFGGVVAEPLVDLTQVL
FT                   SSLVDSKGKILIDGIDEMVAPLTEKEKKLYENIDFSLDDLNAATGSQTALYNKKEDILM
FT                   HRWRYPSLSLHGVEGAFSSAGAKTVIPAKVHGKFSIRTVPDIDSDKLTKLVQDHCNKVF
FT                   AKLGSPNKCSTELVHDGNYWVSDPHNASFTAAAKATKDVYGVEPDLTREGGSIPITLTF
FT                   QDQLKCNVLLLPMGRGDDGAHSINEKLDISNFVGGMKMMGAYLHYYAESKEN"
FT   gene            <738556..>739658
FT                   /locus_tag="ZYRO0E09284g"
FT                   /old_locus_tag="Zyro0E.mRNA.1172.p"
FT   CDS_pept        join(738556..738567,738660..739658)
FT                   /locus_tag="ZYRO0E09284g"
FT                   /old_locus_tag="Zyro0E.mRNA.1172.p"
FT                   /product="ZYRO0E09284p"
FT                   /note="weakly similar to uniprot|P43617 Saccharomyces
FT                   cerevisiae YFR045W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09284g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31076"
FT                   /db_xref="GOA:C5E4W5"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4W5"
FT                   /protein_id="CAR31076.1"
FT                   /translation="MVESKELTTELIAGSAAAVFQTTISYPFEFLKTGLQLQRSLPGTA
FT                   PFNMLHSVKTYFTGSSALNIAAIIKTTTRFTTFEKACQMLRDPSLPAGTPLSGPRLLMA
FT                   GTITGFMESLWIIPFENIKVTMIENGIKDSEKSQKKPEVTDKTTKKPLQENRPTFHAST
FT                   SNGKPQLTPQEAAFLKYEKAPPLHFFPTIKEIYLTRGIQGFFKGSFPTIFRQMGNTAVR
FT                   FTVYTSLKQTISPNKPLKEHYAFAIGFVSSCAVVGITQPIDVVKTRMQSKYAWMTYKNS
FT                   LNCAYRIFVEEGVGKFWKGWIPRLFKVGLSGGMSFGVYQYVENLVTLMRSEGYLE"
FT   gene            complement(<739724..>742108)
FT                   /locus_tag="ZYRO0E09306g"
FT                   /old_locus_tag="ZYRO-ORF3558"
FT   CDS_pept        complement(739724..742108)
FT                   /locus_tag="ZYRO0E09306g"
FT                   /old_locus_tag="ZYRO-ORF3558"
FT                   /product="ZYRO0E09306p"
FT                   /note="similar to uniprot|P07244 Saccharomyces cerevisiae
FT                   YGL234W ADE5 7 Bifunctional enzyme of the 'de novo' purine
FT                   nucleotide biosynthetic pathway contains aminoimidazole
FT                   ribotide synthetase and glycinamide ribotide synthetase
FT                   activities"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09306g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31077"
FT                   /db_xref="GOA:C5E4W6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4W6"
FT                   /protein_id="CAR31077.1"
FT                   /translation="MSLNILILGSGGREHALVWKLAESPSVKKIYLAPGNGGTAVGAHG
FT                   KTVNVPDMSISPSNFENLAKFAVEHDIGLVVPGPEQPLIDGVAEFFKKVGIPVFGPGKA
FT                   TAAFEGSKTFSKDFMHKHNIPTARYGNFSAYEDAKKFLDSVDFQVVLKADGVAGGKGVL
FT                   IPNSMQEAQESLKAIMVEKQFGSAGDSIVIEEYLEGDEISILTISDGYSYVNLPAAQDH
FT                   KRIGENDTGLNTGGMGAYAPAPVATPQLLQQIDSEIVKPSIDGMRKERRPLVGVLFTGI
FT                   ILTKNGPKVLEYNVRFGDPETQTVLPLLSDDTDLAEVMLAAAEHRLDSVEIKLKENTYA
FT                   TTVVLAAGGYPDKYDKGEEITVDEELLPKGSYVFHAGTTLKDGKIVTAGGRVIAASAVG
FT                   STLREAVDTAYQAIKCIHFKNSYYRKDIAHRAFRDADVAASTGITYADSGVSVDNGNLL
FT                   VQRIKEKVKSTSRPGADSDIGGFGGLFDLKQAGYNTDDTLLVGATDGVGTKLMIAQENN
FT                   IHNTVGIDLVAMNVNDLVVQGAEPLIFLDYFATGKLDLKVASDFVSGVADGCIESGCAL
FT                   VGGETSEMPGMYPEGHYDTNGTAVGAVRKTDILPKISAMQEGDVLLGLASDGIHSNGFS
FT                   LVRKIIEHTGLPWDAKSPWDSTKTLGEAVLVPTKIYVKQVLPSIKENLLLGLAHITGGG
FT                   LIENIPRALPSHLQAKLDINTWEIPEVFKWLGKAGNVPVDDILRTFNMGIGMVLIVKKE
FT                   NVSRVKQHLKTANQKTFEIGTLVHKNENQPGCVIDNAVNLY"
FT   gene            <742766..>744850
FT                   /locus_tag="ZYRO0E09328g"
FT                   /old_locus_tag="ZYRO-ORF3556"
FT   CDS_pept        742766..744850
FT                   /locus_tag="ZYRO0E09328g"
FT                   /old_locus_tag="ZYRO-ORF3556"
FT                   /product="ZYRO0E09328p"
FT                   /note="highly similar to gnl|GLV|KLLA0A00935g Kluyveromyces
FT                   lactis KLLA0A00935g and similar to YGL236C uniprot|P53070
FT                   Saccharomyces cerevisiae YGL236C MTO1 Mitochondrial protein
FT                   required for respiration in paromomycin-resistant 15S rRNA
FT                   mutants forms a heterodimer complex with Mss1p that plays a
FT                   role in optimizing mitochondrial protein synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31078"
FT                   /db_xref="GOA:C5E4W7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4W7"
FT                   /protein_id="CAR31078.1"
FT                   /translation="MSKSNARDMLTRRVFQLRNFPTLRNSLVSKRSLVLTADLERTLSK
FT                   LPDEGVVVVGAGHAGCEAATGSARTGAPTVLITPFLNKIGTCSCNPSMGGVGKGTLLRE
FT                   VDALDGVAAKVTDLAGIQFKMLNRSRGAAVWGPRAQIDREIYLREMQNKLNNYPNLRLW
FT                   EGKVKDLIVDIRKNQNSNYTYGAVKGVILEDGSLLKSSKVVITTGTFLSAEIHIGLETF
FT                   PAGRMGEGATYGISETLEDAGFQLGRLKTGTPARLDGRTIDYTHLEKQYGDDPPHPMSL
FT                   INEDVSIKDQVLCYGTYTNLGLHDYIRSNLHRAMHIRETIKGPRYCPSIEAKILRFSDK
FT                   DSHRIWLEPEGLNTDVIYPNGISNSMPEDVQIQMMRMIPGLENVEILQPAYGVEYDYVD
FT                   PRQLRQTLETKLISGLYLAGQINGTTGYEEACAQGVVAGINAGLLHMNREPLKLSRSDA
FT                   YIGVLIDDLITKGVEEPYRMFTSRSEFRVSVRADNADFRLTELGRKLGVVGDDRWSIFQ
FT                   SYKNQYLNIESKLKDFNLSARKWTNLLNIQVADSAKNRSAWELFRFNGVTLEKMMEAVP
FT                   ELGIDINELPRHVLVKVNVQGKYSPYISRQNQYVKAFQADENMVLPQNFDYSQLPSLSF
FT                   ECKTLLNTIQPETIGQARRIQGITAASLFELYRLVKSKQRVLQSTPNSVNIPNTAEQKL
FT                   "
FT   gene            complement(<744883..>745848)
FT                   /locus_tag="ZYRO0E09350g"
FT                   /old_locus_tag="ZYRO-ORF3553"
FT   CDS_pept        complement(744883..745848)
FT                   /locus_tag="ZYRO0E09350g"
FT                   /old_locus_tag="ZYRO-ORF3553"
FT                   /product="ZYRO0E09350p"
FT                   /note="weakly similar to uniprot|P43618 Saccharomyces
FT                   cerevisiae YFR046C CNN1 Kinetochore protein that co-
FT                   purifies with Nnf1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31079"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4W8"
FT                   /protein_id="CAR31079.1"
FT                   /translation="MDTPKRFNDPGSDFLATTPFRERALQEQRLKEELLSSATPGWRRK
FT                   SPERHVDAISKDPSEVKEYLRDLSSVLVSQGRNLTSFLAEQVSTQDDQADTEIKSSPKE
FT                   PTPQKPHYSIAESVLSQLESGIRKPKIRKIDGLVIKDKARTPFQEDHLPERQMSLQESV
FT                   RSPSVVEESIPIPEDDYEDEPLVENGLDPSPLASAPIESPQGFESDQSSVDSEPETVDP
FT                   LNITRLKHSLGQFMNENDIKLGQGSWRSLQDASVTLVERLAKHFTEEDRKIVLDRQSIL
FT                   KMLEQFEIVPLRATNDDIFEMCCKYLPLEDLNELEMGLFL"
FT   gene            <746695..>747645
FT                   /locus_tag="ZYRO0E09372g"
FT                   /old_locus_tag="ZYRO-ORF3550"
FT   CDS_pept        746695..747645
FT                   /locus_tag="ZYRO0E09372g"
FT                   /old_locus_tag="ZYRO-ORF3550"
FT                   /product="ZYRO0E09372p"
FT                   /note="some similarities with uniprot|P06774 Saccharomyces
FT                   cerevisiae YGL237C HAP2 Subunit of the heme-activated
FT                   glucose-repressed Hap2p/3p/4p/5p CCAAT-binding complex a
FT                   transcriptional activator and global regulator of
FT                   respiratory gene expression contains sequences sufficient
FT                   for both complex assembly and DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31080"
FT                   /db_xref="GOA:C5E4W9"
FT                   /db_xref="InterPro:IPR001289"
FT                   /db_xref="InterPro:IPR018362"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4W9"
FT                   /protein_id="CAR31080.1"
FT                   /translation="MNDQGEEHQPLDIGLLRYSTDEIGMRSAPNTMSDKITKVAKDVLV
FT                   EQSNPADIYLYDQPQEALRQNAHKRSLETQQSLTSTTSNYGNDKNTTDYTNDTNNRINS
FT                   NNDSNNDSPHDINYNNSSNNNMDVQSMLTPLKQRDRHDYREDHHKQQNLGPDKGPPITA
FT                   SHESSIPASQEMQSADTLLTRTTFDTRGSNEGNDPTEQPFYVNAKQYYRILKRRYTRAK
FT                   LEENLRISRERRPYLHESRHKHAMRRPRGQGGRFLTLAEIEAMKLKEGSASSGSSVSSP
FT                   PSIKSESEHMGPGPRLIEKQGPKPKKLKPADGSHR"
FT   gene            complement(<747966..>750848)
FT                   /locus_tag="ZYRO0E09394g"
FT                   /old_locus_tag="ZYRO-ORF3547"
FT   CDS_pept        complement(747966..750848)
FT                   /locus_tag="ZYRO0E09394g"
FT                   /old_locus_tag="ZYRO-ORF3547"
FT                   /product="ZYRO0E09394p"
FT                   /note="highly similar to uniprot|P33307 Saccharomyces
FT                   cerevisiae YGL238W CSE1 Nuclear envelope protein that
FT                   mediates the nuclear export of importin alpha (Srp1p)
FT                   homolog of metazoan CAS protein required for accurate
FT                   chromosome segregation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09394g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31081"
FT                   /db_xref="GOA:C5E4X0"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR005043"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4X0"
FT                   /protein_id="CAR31081.1"
FT                   /translation="MGDLGTIAKFLEESVVASTAKSAERNLGSLETQPEFGLSLLHIVA
FT                   STNLPLATRLAGALFFKNYVKRRWIDEDGNHLLPASDTELIKKEIVPLMISLPNNLQIQ
FT                   IGEAISAIADSDFPGNWPTLLNDLASRLTADDMVTNRGVLIVSHSIFKRWRPLFRSDEL
FT                   FLEIKMVLEVFTEPFLSLLKTVDEQIQQNGNNQQQLQVLFEVFLLLVKLYYDFNCQDIP
FT                   EFFEDNIQTGMGILHKYLAYSNPLLDDPDDSETASVLIKVKSSIQELVQLYTTRYEDVF
FT                   GDMINDFIQITWSLLTAMSSEPKYDILVSKSLAFLTAVSRIPKYFEIFNNEFAMNNIAE
FT                   QIILPNVTLRESDIELFEDDPIEYVRRDLEGSDTDTRRRACTDFLKELKEKNEQLITNI
FT                   FATHVQKFFEQYQLNPTENWRYKDLSIYLFTALAINGNVTSSGVSSTNILLDVVDFFTK
FT                   QIAPDLTNSVPHVILRVDAIKYIYIFRNQLNKPQLIEILPILANFLERDEYVVYTYAAI
FT                   TIERILTIRESITSPNFVFNKMDLTNSAEPLLTNLIKLILKQGSSPEKLAENEFLMRAV
FT                   FRVLQTAEDTIQGLASHLLQELLGIVTIISKNPSNPRFTHYTFESIGAIESHSPLELLP
FT                   QIVQSIVPVFLEILSEDIQEFVPYVFQLFAFCVEKGKSVPDSIKQLAQPILSPPLWEMK
FT                   GNVPAVTRILKSFIKADQSLFPNLIPVLGVFQRLIASKAYDIYGFEILEVIILHIDMER
FT                   LKPYLKQIAVLLLQRLQTSKTERYVKQLVVFLATISIKLGPDFVVEFIDGVQDGVFSQI
FT                   WGNFILTTLPGIGHLLSRKIALVGTLNVMISGNIFVNKYQPLLVPTLEAIVETASSQSI
FT                   ANLTNDHIDFDNMEEISTFGSSFSRLVSVTERPVDPLADIDLTNGLRSYVATSLSKYNE
FT                   SSGMALVSNLAPQLPQDAQIKLKDLMSVAV"
FT   gene            complement(<751079..>751864)
FT                   /locus_tag="ZYRO0E09416g"
FT                   /old_locus_tag="ZYRO-ORF3544"
FT   CDS_pept        complement(751079..751864)
FT                   /locus_tag="ZYRO0E09416g"
FT                   /old_locus_tag="ZYRO-ORF3544"
FT                   /product="ZYRO0E09416p"
FT                   /note="similar to uniprot|P53068 Saccharomyces cerevisiae
FT                   YGL240W DOC1 Processivity factor required for the
FT                   ubiquitination activity of the anaphase promoting complex
FT                   (APC) mediates the activity of the APC by contributing to
FT                   substrate recognition involved in cyclin proteolysis"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09416g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31082"
FT                   /db_xref="GOA:C5E4X1"
FT                   /db_xref="InterPro:IPR004939"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR016901"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4X1"
FT                   /protein_id="CAR31082.1"
FT                   /translation="MIVVTTREVTKSSMDPQQVENLLDKLAPTSALGPVINQKEPKTVL
FT                   DDTVIDEGTKNMFVNGFQDESKYAHMTAEKLSTRFLQGLQLFDTDSTCNVNHLAHWKPS
FT                   SFKMGNSIDNALDDNPDTYWQSDGVQPHQLDITFSKRIDVILIAFYFSLIADESYTPRL
FT                   IKIYVGHSPSDALFYKTLEVRNVNGWVALTFEDNRSSDNLLKCQFIRIVFPVNHENGKD
FT                   THLRGIRIFAPSKKTSVENSEWMQSLASSNQLVTQCSLR"
FT   gene            complement(<751942..>752829)
FT                   /locus_tag="ZYRO0E09438g"
FT                   /old_locus_tag="ZYRO-ORF3542"
FT   CDS_pept        complement(751942..752829)
FT                   /locus_tag="ZYRO0E09438g"
FT                   /old_locus_tag="ZYRO-ORF3542"
FT                   /product="ZYRO0E09438p"
FT                   /note="highly similar to uniprot|P43619 Saccharomyces
FT                   cerevisiae YFR047C BNA6 Quinolinate phosphoribosyl
FT                   transferase required for biosynthesis of nicotinic acid
FT                   from tryptophan via kynurenine pathway"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09438g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31083"
FT                   /db_xref="GOA:C5E4X2"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4X2"
FT                   /protein_id="CAR31083.1"
FT                   /translation="MAHYENLLPSNGQWKQDITNWLQEDVPSFDYGGFVVGSDQKAATL
FT                   FCKQDGYLSGVPFANEVFKQCELQVEWYFQEGDQLLISKAPQGKLPVAKVTGKAKDVLL
FT                   AERTALNILSRSSGIATSSRRLMEAAKSVGYRGTIAGTRKTTPGLRRLEKYSMLVGGCD
FT                   PHRYDLSSMVMLKDNHIWSTGSITNAVYAARRVCGFAVKIEVECQSEQEADEAIEAGAD
FT                   VIMLDNFEPEGLKICASSLKTKWKGQREFLLECSGGLKLDNLQGYLCPEIDIYSTSSIH
FT                   QGTGVVDFSLKIDH"
FT   gene            complement(<753030..>756059)
FT                   /locus_tag="ZYRO0E09460g"
FT                   /old_locus_tag="ZYRO-ORF3541"
FT   CDS_pept        complement(753030..756059)
FT                   /locus_tag="ZYRO0E09460g"
FT                   /old_locus_tag="ZYRO-ORF3541"
FT                   /product="ZYRO0E09460p"
FT                   /note="similar to uniprot|P53067 Saccharomyces cerevisiae
FT                   YGL241W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09460g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31084"
FT                   /db_xref="GOA:C5E4X3"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4X3"
FT                   /protein_id="CAR31084.1"
FT                   /translation="MFDAPSLILEAQSPLDNVRKSSEERLLQMCDEDSSQVFVQFVQVA
FT                   ADTQQELPSRQFALLTLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQ
FT                   PSKIRNGASYAVVQISAVDFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISEEM
FT                   FFEEGIGFETLKIVFHVMNSYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVE
FT                   ACKEILQMWVNFLTTQNKTISETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTI
FT                   VMRDLENASQIYMQMVENSSQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLS
FT                   RLCCLNQDTVDSWQTDFNSFVSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHE
FT                   ISQISDFSDGWIFNESLLYLLQSLLLNEANSLEFMDAVTRIFTKLQSILEKSLSCVFVN
FT                   CRIILLIPKLLEKIMDSFPNVRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFA
FT                   ELPSVLGPDNCIQVQQKTLKLIAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSII
FT                   QTEFHLVFTISSKDPSNIQTTIELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSA
FT                   HSSFEYSPLLSLTLQVLGVLMKRKPLDPTLSITICNDVFEPLQNILNQSKDEEILQYAT
FT                   EALGYLIYNTEAEVILPHLKSIVNILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQN
FT                   LIPMILQAAAARLGQATNITTTQNLLSVFCFVTSADAQQTVDFLFNTTISNQNGLNLVM
FT                   SKWLESFDVVRGEKRTKENIITLSKLFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKE
FT                   MPDRYTQVSVYHKIIKLFTSELEFQGKHQDPQLLMAGTYGIETNTEENQDDDDNDDWED
FT                   VEGPLEYERLQHYVEEDETDDRGEELDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGF
FT                   QSIYEQLSDNEKQILSENLL"
FT   gene            <756328..>756855
FT                   /locus_tag="ZYRO0E09482g"
FT                   /old_locus_tag="ZYRO-ORF3539"
FT   CDS_pept        756328..756855
FT                   /locus_tag="ZYRO0E09482g"
FT                   /old_locus_tag="ZYRO-ORF3539"
FT                   /product="ZYRO0E09482p"
FT                   /note="highly similar to uniprot|P53066 Saccharomyces
FT                   cerevisiae YGL242C Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31085"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4X4"
FT                   /protein_id="CAR31085.1"
FT                   /translation="MDKEGASFGEQLLDASRRNNIDLLKMVFEGLGGDPERISELINES
FT                   RDPLGDTALHLCCRYGSWEVLDEILDQDGIEIDPQNTKELDTPLHVTVRYAHDEPEHGT
FT                   FIARNLVEVGADPRIKNMNGDKPVDLIHGDDLDELIDLLQGAELAADNDRVDDGEEGEI
FT                   IEDDGEDVDDED"
FT   gene            complement(<756951..>758084)
FT                   /locus_tag="ZYRO0E09504g"
FT                   /old_locus_tag="ZYRO-ORF3538"
FT   CDS_pept        complement(756951..758084)
FT                   /locus_tag="ZYRO0E09504g"
FT                   /old_locus_tag="ZYRO-ORF3538"
FT                   /product="ZYRO0E09504p"
FT                   /note="similar to uniprot|P53065 Saccharomyces cerevisiae
FT                   YGL243W TAD1 tRNA-specific adenosine deaminase deaminates
FT                   adenosine-37 to inosine in tRNA-Ala"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31086"
FT                   /db_xref="GOA:C5E4X5"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4X5"
FT                   /protein_id="CAR31086.1"
FT                   /translation="MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVA
FT                   IDKKNSDLRLISIATGVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNS
FT                   NSDNQIDLVERASEDQLFHFKDNWELAIYISTLPCGDASMDLLCQDESIIEMQDDDPIQ
FT                   FVDPAVTSIVRGRFNYSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKL
FT                   LNKPVYLKYLVTPNTTDLLHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMS
FT                   SIKLYSTPESTVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNA
FT                   TYLQFKATIQDRNALIQDCRKLLSPKGWISTSRDDCE"
FT   gene            complement(<758296..>759978)
FT                   /locus_tag="ZYRO0E09526g"
FT                   /old_locus_tag="ZYRO-ORF3537"
FT   CDS_pept        complement(758296..759978)
FT                   /locus_tag="ZYRO0E09526g"
FT                   /old_locus_tag="ZYRO-ORF3537"
FT                   /product="ZYRO0E09526p"
FT                   /note="similar to uniprot|P53064 Saccharomyces cerevisiae
FT                   YGL244W RTF1 Subunit of the RNA polymerase II-associated
FT                   Paf1 complex directly or indirectly regulates DNA-binding
FT                   properties of Spt15p (TATA box-binding protein) and
FT                   relative activities of different TATA elements"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09526g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31087"
FT                   /db_xref="GOA:C5E4X6"
FT                   /db_xref="InterPro:IPR004343"
FT                   /db_xref="InterPro:IPR036128"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4X6"
FT                   /protein_id="CAR31087.1"
FT                   /translation="MSDIEEDLLALAGADEEEDDDEVLASSAKRSGKSDRASSKKRRIE
FT                   VEGGEDDEDEDEDDYNPAASGAGTGDYDDEEEEEENPFPLEGKYKDEADRDYLGGLPEM
FT                   ERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQRSKQQEEGKKTRSSTRSTVATGHSD
FT                   IKASKLSQLRKQREKKSQNRPYSDEEEEGEDEGDDYGYEDKKYSDEEDEEEYDPYSRRS
FT                   RFEEDEDEVQWAEEALDREANVADFNKAKIGRSFVANFCFYPGFNDIVRGNYGRVNVGT
FT                   DKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGKDRKVFQMRYFSDGAITQQE
FT                   FERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLTNDIVRNRMVFNKKLSGVN
FT                   AVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYEKQHENDKVGINKLNALT
FT                   TKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFYYQEIQKEENEKAKNDAEQ
FT                   KQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSIDI"
FT   gene            <760326..>762104
FT                   /locus_tag="ZYRO0E09548g"
FT                   /old_locus_tag="ZYRO-ORF3533"
FT   CDS_pept        760326..762104
FT                   /locus_tag="ZYRO0E09548g"
FT                   /old_locus_tag="ZYRO-ORF3533"
FT                   /product="ZYRO0E09548p"
FT                   /note="similar to uniprot|P43620 Saccharomyces cerevisiae
FT                   YFR048W RMD8 Cytosolic protein required for sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31088"
FT                   /db_xref="GOA:C5E4X7"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4X7"
FT                   /protein_id="CAR31088.1"
FT                   /translation="MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAG
FT                   HAAGVKSREDHVADRNRLAPYPSNGSKSSSVRRRPSGRFSDISIDNILSDASDVPSGRR
FT                   EERQSSSSLDRFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYG
FT                   PKRAAASLNATGKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECL
FT                   YVAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVD
FT                   NNFELDSNGNYDADITPDHLPNAMGNQDTFNPSEPQFFAEETPVEQERRERRENFNFDS
FT                   SSKNDDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHD
FT                   IEREQFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILT
FT                   SATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPL
FT                   YIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSV
FT                   AEILVRYVMIRNRLSG"
FT   gene            complement(<762205..>764325)
FT                   /locus_tag="ZYRO0E09570g"
FT                   /old_locus_tag="ZYRO-ORF3530"
FT   CDS_pept        complement(762205..764325)
FT                   /locus_tag="ZYRO0E09570g"
FT                   /old_locus_tag="ZYRO-ORF3530"
FT                   /product="ZYRO0E09570p"
FT                   /note="highly similar to uniprot|P46655 Saccharomyces
FT                   cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
FT                   forms a complex with methionyl-tRNA synthetase (Mes1p) and
FT                   Arc1p complex formation increases the catalytic efficiency
FT                   of both tRNA synthetases and ensures their correct
FT                   localization to the cytoplasm"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31089"
FT                   /db_xref="GOA:C5E4X8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR041103"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4X8"
FT                   /protein_id="CAR31089.1"
FT                   /translation="MVNLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPV
FT                   VFNGSSDDTFAKIISTYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVL
FT                   NLRTFILGGLKISAADIVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHE
FT                   YLTKSMQGIKKAVTAGKKKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAI
FT                   LNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYD
FT                   LCVQLIKEGKAYCDDTDVEKMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKN
FT                   CVRAKIDYKAANKTLRDPVIYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALR
FT                   TIEYRDRNAQYDWMLKALRLRKVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPR
FT                   FPTVRGVRRRGMTVEGLRNFVISQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDP
FT                   VEITLEGEGAPETPKVELKPKHKKNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMD
FT                   WGNIIITSKNADGSLVAKTNLGGDFKKTKHKVTWLANTDYVPVEMVDFDHLITKDKLEE
FT                   DENFTDFITPQTEFHTKAVGDVNVKDMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIP
FT                   DGKSVNRYGAKK"
FT   gene            <764748..>765890
FT                   /locus_tag="ZYRO0E09592g"
FT                   /old_locus_tag="ZYRO-ORF3529"
FT   CDS_pept        764748..765890
FT                   /locus_tag="ZYRO0E09592g"
FT                   /old_locus_tag="ZYRO-ORF3529"
FT                   /product="ZYRO0E09592p"
FT                   /note="similar to uniprot|P53063 Saccharomyces cerevisiae
FT                   YGL246C RAI1 Nuclear protein that binds to and stabilizes
FT                   the exoribonuclease Rat1p required for pre-rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31090"
FT                   /db_xref="GOA:C5E4X9"
FT                   /db_xref="InterPro:IPR013961"
FT                   /db_xref="InterPro:IPR039039"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4X9"
FT                   /protein_id="CAR31090.1"
FT                   /translation="MVVTSNLFVKQKGTTTALKQPKELTFYSRTDDDNFLVEDDVHLQY
FT                   YYLPDADLEKRLDLSSGIKKLKDTASNFKDQGTLFGLLQSIQNYEQRKNKKIKADIVTF
FT                   RGIMRKLISAAFDTSNFNPIDLRIVSFDGQLFIKEVPKQEAKPAPGSPAQLAWYSGYKF
FT                   ETLATLPQPLPLVSRTTLDKRPKKLVNTGEEYITVVKTGVGNVKVILGAEVDCIFDFKE
FT                   EGKDNLKHYAELKCSADVSTPADARKFERKVFRTWLQCFLVGIPRIIYGFRDNNNVLKT
FT                   VEEYTTTEVPVLLKSNNPAMNSSCLDAIKWYGTLTEWLLKMIPRDGDTIRAYRLVYENN
FT                   HLRLTEIEDTESEYQGLVEGEEILSDEFKKWRKSMNERNL"
FT   gene            complement(<765913..>766839)
FT                   /locus_tag="ZYRO0E09614g"
FT                   /old_locus_tag="ZYRO-ORF3528"
FT   CDS_pept        complement(765913..766839)
FT                   /locus_tag="ZYRO0E09614g"
FT                   /old_locus_tag="ZYRO-ORF3528"
FT                   /product="ZYRO0E09614p"
FT                   /note="similar to uniprot|Q07551 Saccharomyces cerevisiae
FT                   YDL124W NADPH-dependent alpha-keto amide reductase reduces
FT                   aromatic alpha-keto amides aliphatic alpha-keto esters and
FT                   aromatic alpha-keto esters"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31091"
FT                   /db_xref="GOA:C5E4Y0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Y0"
FT                   /protein_id="CAR31091.1"
FT                   /translation="MTRPIIPTIEIKETHTHIPVLGFGTGTQWRIAKREGETKGQFIDK
FT                   LVDQLVTAVDLGFNHIDTAEFYLTHEEVGEALRRSQLPRDKLFITDKYNQGAWTGLDCS
FT                   GPIQAAKKGLEALGIKYFDLYMLHRPDITKENAGIDLQEAWRQVEELYEAGIAKAIGVS
FT                   NFPLETLKQMESYCRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPLAPLFRA
FT                   RPGPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKS
FT                   DVELINEVGSKKHFQWCLPHFFDVYRS"
FT   gene            complement(<766929..>767438)
FT                   /locus_tag="ZYRO0E09636g"
FT                   /old_locus_tag="ZYRO-ORF3527"
FT   CDS_pept        complement(766929..767438)
FT                   /locus_tag="ZYRO0E09636g"
FT                   /old_locus_tag="ZYRO-ORF3527"
FT                   /product="ZYRO0E09636p"
FT                   /note="some similarities with uniprot|P53062 Saccharomyces
FT                   cerevisiae YGL247W BRR6 Essential nuclear envelope integral
FT                   membrane protein required for nuclear transport depletion
FT                   alters nucleoporin distribution and nuclear envelope
FT                   morphology suggesting a role in the spatial organization of
FT                   nuclear pores"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09636g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31092"
FT                   /db_xref="GOA:C5E4Y1"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="InterPro:IPR040202"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Y1"
FT                   /protein_id="CAR31092.1"
FT                   /translation="MTQLLTQSSTSNNASHIGEFVRLAFNSSILVIILSVVIKFILLIK
FT                   QDVDQKVQLKIAEQVIRVKRCQKHYEDNGCVSHVPALETLCDGWHHCMHSTGQVQSASL
FT                   WTQTLAETLNAFVEAISFRSLVFVLLAVCALVLVTNVVIASYRVQYYIRGDRMSTYQPS
FT                   NNARIE"
FT   gene            complement(<767795..>767865)
FT                   /locus_tag="ZYRO0E09658r"
FT                   /old_locus_tag="Zyro0E.tGly_GCC_16"
FT   tRNA            complement(767795..767865)
FT                   /locus_tag="ZYRO0E09658r"
FT                   /old_locus_tag="Zyro0E.tGly_GCC_16"
FT                   /note="tRNA-Gly (GCC) cove score=66.56"
FT   gene            <769341..>769706
FT                   /locus_tag="ZYRO0E09680g"
FT                   /old_locus_tag="ZYRO-ORF3526"
FT   CDS_pept        769341..769706
FT                   /locus_tag="ZYRO0E09680g"
FT                   /old_locus_tag="ZYRO-ORF3526"
FT                   /product="ZYRO0E09680p"
FT                   /note="similar to uniprot|P19955 Saccharomyces cerevisiae
FT                   YFR049W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31093"
FT                   /db_xref="GOA:C5E4Y2"
FT                   /db_xref="InterPro:IPR020373"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Y2"
FT                   /protein_id="CAR31093.1"
FT                   /translation="MRSTCVRLAHHYTPMIRFVGGRHHHTPHSSEILPHPCAENGLLPN
FT                   SKDTVPAGEFLKNLRPFKVIPYKSKAETVQPDSRYQYQQRPLQEGEKTHAYELSPRFQF
FT                   KGFSESEIESINGGGAL"
FT   gene            complement(<769778..>770845)
FT                   /locus_tag="ZYRO0E09702g"
FT                   /old_locus_tag="ZYRO-ORF3525"
FT   CDS_pept        complement(769778..770845)
FT                   /locus_tag="ZYRO0E09702g"
FT                   /old_locus_tag="ZYRO-ORF3525"
FT                   /product="ZYRO0E09702p"
FT                   /note="similar to uniprot|P22434 Saccharomyces cerevisiae
FT                   YGL248W PDE1 Low-affinity cyclic AMP phosphodiesterase
FT                   controls glucose and intracellular acidification-induced
FT                   cAMP signaling target of the cAMP-protein kinase A (PKA)
FT                   pathway glucose induces transcription and inhibits
FT                   translation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09702g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31094"
FT                   /db_xref="GOA:C5E4Y3"
FT                   /db_xref="InterPro:IPR000396"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Y3"
FT                   /protein_id="CAR31094.1"
FT                   /translation="MSKFEVTVLGASGGPDVGETQCFLIRPFGWHGLESVCVDGGAGTT
FT                   QISRMLAGELRVGLIESFYERDYEPVNQFFDSDVQVRPGLSDSTLHALDSSPRITSYRS
FT                   AKVYESIKGYYVTHPHLDHIAAMVVDSPLIFNSPKPMAKTIWGLPFTTSAIERFIFNDS
FT                   IWPNLIHGGGQRLKTESLTDQIATTNPTFTHIEITPFRVSHGKGAYSPREKIFSTVYLF
FT                   RDITTDHCIIICGDMEPDSDEPLLSNLCSYLAARVPLHKIKAIIVECSSPIDTKELYGH
FT                   MSPTRLVEELSHLQNVYGCEQRPDMDVIITHVKGHCSFKDPRLVILNEVRQEAQRFGLE
FT                   GIRFSVAVKGYTFYL"
FT   gene            complement(<771237..>772022)
FT                   /locus_tag="ZYRO0E09724g"
FT                   /old_locus_tag="ZYRO-ORF3524"
FT   CDS_pept        complement(771237..772022)
FT                   /locus_tag="ZYRO0E09724g"
FT                   /old_locus_tag="ZYRO-ORF3524"
FT                   /product="ZYRO0E09724p"
FT                   /note="highly similar to uniprot|P30657 Saccharomyces
FT                   cerevisiae YFR050C PRE4 20S proteasome beta-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31095"
FT                   /db_xref="GOA:C5E4Y4"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR016295"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Y4"
FT                   /protein_id="CAR31095.1"
FT                   /translation="MNHDPFSWGRPSDATYGAYDQQLAHPKMNTQQPIVTGTSVLSVKY
FT                   NNGVVIAADNLGSYGSLLRFNNVERLIPVGDNTVVGISGDISDMQHIETLIEELVTENN
FT                   YDNSFADSVEGLKPSYVFEYLAAVMYHRRSKFNPLWNAIIVAGVEDGKPFSRYVNLLGV
FT                   TYSSPSLATGFGSYMAVPLLRKLVDRDSDVAKLDLQTAENAIVECLKVLFYRDARSSKQ
FT                   YSLAIIDNDLGLQFKTNQRIENLSWSFAKDIKGYGTQKV"
FT   gene            complement(<772264..>773880)
FT                   /locus_tag="ZYRO0E09746g"
FT                   /old_locus_tag="ZYRO-ORF3523"
FT   CDS_pept        complement(772264..773880)
FT                   /locus_tag="ZYRO0E09746g"
FT                   /old_locus_tag="ZYRO-ORF3523"
FT                   /product="ZYRO0E09746p"
FT                   /note="similar to uniprot|P43621 Saccharomyces cerevisiae
FT                   YFR051C RET2 Delta subunit of the coatomer complex (COPI)
FT                   which coats Golgi-derived transport vesicles involved in
FT                   retrograde transport between Golgi and ER"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09746g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31096"
FT                   /db_xref="GOA:C5E4Y5"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR027059"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Y5"
FT                   /protein_id="CAR31096.1"
FT                   /translation="MVVLAASITTRSGKPLLSRQFRELTKDRVLELLSNFQSLVTNLSS
FT                   EHTFVEGNHVRYVYRPFDDYYIILITNRQSNIIEDLSTLNLLSQTVNNCLSSYDENEIY
FT                   DSAFEILTAFDEVVIMGYKENLSSTQVTTYLTMESHEERIQEIIERNKEFEATEERKRR
FT                   AKEIAKREQERRMGIPSMDFSMPSNKFIGSNDPNVTNAYNSYYSHASPAAQQSYLKSQK
FT                   LGDQPVEDLSSQDSLPRRSDGSAGMKLGGARSKKAVTPVRHSSSSRPSIKPENEEDSFT
FT                   NNGILILIKEIVNAQISRDGAVSSSELKGVLELRINEKSLGHAKLVLGNDVNVKDRNMQ
FT                   FRTHPNIDKNAFLSNKSIGLRSNDKAFPANDQTLGVLRWRKVGANDDKTLIPLECSTWV
FT                   SPSEEGEGMFEVTVEFEVNPDYNKDLKDLVFTVPVLTENVFISPDNNDCNASLAGVDEE
FT                   MGIAIKVDHVEPGQPAVFSFVIEAGYEDALFPLNVNFAHVEQGSSSLTGVSVANITDSQ
FT                   TEEQLPYDLITSLRAEEYAVV"
FT   gene            complement(<774077..>776068)
FT                   /locus_tag="ZYRO0E09768g"
FT                   /old_locus_tag="ZYRO-ORF3522"
FT   CDS_pept        complement(774077..776068)
FT                   /locus_tag="ZYRO0E09768g"
FT                   /old_locus_tag="ZYRO-ORF3522"
FT                   /product="ZYRO0E09768p"
FT                   /note="weakly similar to uniprot|P53061 Saccharomyces
FT                   cerevisiae YGL249W ZIP2 Required for 'ZIPpering' up meiotic
FT                   chromosomes during chromosome synapsis involved in meiotic
FT                   recombination and disjunction"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31097"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Y6"
FT                   /protein_id="CAR31097.1"
FT                   /translation="MELEYWILDSSAVNSSDGGYENTFTNTKETVRLEKKSQKLLQKLS
FT                   HSSGPKVQLQKVKTDSLEHFQLEAMPLKFTPKQYNIRCLPWPKIEISDNLQNFHSPKEK
FT                   LKLEDESKRLFVWLTDLSKSQIQHDPIARRKNRLQGRESFKIKFEFLTSCIKQCSKINR
FT                   CEFMPSVLGTRFKETLRENIPKTVSFAFGEKLKLEHHFCKTASLEDYILEATEVPLLPR
FT                   ISAELLRWPVPSANPNELVFEMLRSQLFDLEFNKLEFFKMDITCTQSNKRAKIKLPKNW
FT                   KMCKSELKQWDWNPFKQIEKTAIAESTTRETIATYAFNPPIFVLEFHKFPYNSFDFINL
FT                   EEDTFGSLKFASASRLAPTMTKKPSATSEREKTMDSTINSEHDNTSMIPHKRSFIDDDL
FT                   LTILHSRKRSRKHDDHYTSTPSHGATMFRIMNQEMNRYQAVGSSPVSAALEPPKTPAIP
FT                   FEPANDPRRILVNATKIRENHKIIQYLSNETQLQLVEQELPLQCDFIIDATSCIVIVQL
FT                   DLFFQLQADKTMFYENTLKSLLNEFKTVVVLIKYPVIIDIADRDVFWKIRLYLQPPDFQ
FT                   LFLTEETPQEIGKWINMLSNEPLNDQPLGSHPLLLLHFNKFLVQELLSKYTLKKILLMA
FT                   IKNQNKELSCLLTDAQLKRIQKLMALGW"
FT   gene            complement(<776416..>777264)
FT                   /locus_tag="ZYRO0E09790g"
FT                   /old_locus_tag="ZYRO-ORF3520"
FT   CDS_pept        complement(776416..777264)
FT                   /locus_tag="ZYRO0E09790g"
FT                   /old_locus_tag="ZYRO-ORF3520"
FT                   /product="ZYRO0E09790p"
FT                   /note="similar to uniprot|P53060 Saccharomyces cerevisiae
FT                   YGL250W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31098"
FT                   /db_xref="GOA:C5E4Y7"
FT                   /db_xref="InterPro:IPR018822"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Y7"
FT                   /protein_id="CAR31098.1"
FT                   /translation="MDNSDDVGVALVDEEEDLLEYDNSMSSSGEQEGSDREEAGNGNAN
FT                   GSEDKVHVVSDNEIRQAAEQLLQHKLPQVFIEYNGHGFLLFDCEEKDQLQFNLPVICED
FT                   TKGFVHGCNELFNLIRRFLEDYHGKLSFVSKELILELPCLDLTLCEDNVYNSQITFSDI
FT                   TTIFDILRQRSLENLETDVPECIRGTVSTRPRFVSRYNTLVELTQSSATLKNIKPFQND
FT                   ETHPLVLDDNGLPSTHGQTKEVVVMNLEEDEDNADREMDDKQDRSDSEELLEIVDNEEE
FT                   G"
FT   gene            <777831..>781106
FT                   /locus_tag="ZYRO0E09812g"
FT                   /old_locus_tag="ZYRO-ORF3519"
FT   CDS_pept        777831..781106
FT                   /locus_tag="ZYRO0E09812g"
FT                   /old_locus_tag="ZYRO-ORF3519"
FT                   /product="ZYRO0E09812p"
FT                   /note="similar to uniprot|P51979 Saccharomyces cerevisiae
FT                   YGL251C HFM1 Meiosis specific DNA helicase involved in the
FT                   conversion of double-stranded breaks to later recombination
FT                   intermediates and in crossover control catalyzes the
FT                   unwinding of Holliday junctions has ssDNA and dsDNA
FT                   stimulated ATPase activity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09812g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31099"
FT                   /db_xref="GOA:C5E4Y8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Y8"
FT                   /protein_id="CAR31099.1"
FT                   /translation="MFNASSFKITQDDTSLTTSFHEDIPAVQPPQPKRRRVLKKSENKE
FT                   LIKNGLSTSALPDSFQSFFRFREFNKMQSEAFPDLYETDMNCVISSPTGSGKTVLFELA
FT                   IMRLIKETGDAIDNIKILYVAPTKSLCCERLKSWGPNFLNLTVGMLTSDTSYLETEKVR
FT                   KCNIIITTPEKWDLLTRKWKAYNRLFELVKLILVDEIHTLRERRGATLEVVLTRMNIMC
FT                   QSIRIIAISATIPNVEDISSWLRSKDTQERAKILKFDDSYRQVPLQKIVYGYSFYNKND
FT                   FFYDSMYNSKLDEILRMHSKNRPVLIFCPTRASTVSTAKYVVQNCFHLAPGSDRNADEQ
FT                   FHDQGLLECYHQNVAFHHAGLSIEDRTKVEQGFLEGKIKILCSTSTLAIGVNLPAYLVI
FT                   IKGTRIWNTSAAQEYPQLDVLQMIGRAGRPDFENEGCAIIMTDSKMKQTYEKMLHGTDN
FT                   LESSLHLELTEHLSAEISLGTISSTETAVNWLRNTFFYVRFSRNPDVYGKITKFMDHIN
FT                   VQDSQLVQFCEGILQNLLLNQIIEKQDDRLICTPYGYAMVRHYVLFDSTKIFINAPKSQ
FT                   SVQNILRLLSGSKEFTDIRIRHNEKRLYKEINSSPLTKFPFLTEKKQSQIIDTTFQKVS
FT                   LLIQYELGGLEFPSYQGASKLHQTLVQDKALVFRNCFRILKCMVDAFIERKDGISLKNT
FT                   LFLLRSVNGNCWEDSTMVLRQLKSIGLVSVRKLVHHDVNNLEQMRQISDQQIEYYLGQK
FT                   RGSGSKIKRDLTLLPQLQVRCKLEYCSHKGHQLEVTLKIELSAQFETSIWHGQGLSLDI
FT                   QTLKSTGELLDFRRLKLAHLKTPRSFRILTMMQLQSDSIEISINCLEVAGIGKSIQFST
FT                   KDLPQKFHETPPVKSYATVLDKCLIHSDSESDLEDSSLSSDDCLFQYLDKNPINRQINK
FT                   EDVPDNRRVRSNGNFECNHACKDKSHCRHLCCKEGIPKELLRSKRAASTNHPAPDSFRA
FT                   PQQSVDVIPTSDIKEALESDSSLEEIIPFQPETKRFNSTFEYGLQSVHNSTKPTTCADP
FT                   NVTNAGAMMPQSLNSIALPSGSSDSNETDHTRLAFLGSDVDLN"
FT   gene            <781375..>783141
FT                   /locus_tag="ZYRO0E09834g"
FT                   /old_locus_tag="ZYRO-ORF3518"
FT   CDS_pept        781375..783141
FT                   /locus_tag="ZYRO0E09834g"
FT                   /old_locus_tag="ZYRO-ORF3518"
FT                   /product="ZYRO0E09834p"
FT                   /note="highly similar to uniprot|P32608 Saccharomyces
FT                   cerevisiae YGL252C RTG2 Sensor of mitochondrial dysfunction
FT                   regulates the subcellular location of Rtg1p and Rtg3p
FT                   transcriptional activators of the retrograde (RTG) and TOR
FT                   pathways Rtg2p is inhibited by the phosphorylated form of
FT                   Mks1p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09834g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31100"
FT                   /db_xref="GOA:C5E4Y9"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Y9"
FT                   /protein_id="CAR31100.1"
FT                   /translation="MSAISDSDTETEVISRNLCGVVDIGSNGIRFSISSKAAHHARIMP
FT                   CVFKDRVGISLFEVQYAANSLEKEPIPEDIINDIRAAMKRFKLICEDFGVPQSSVRVVA
FT                   TEATREALNSVVFTEAIHDSTGWEVELLTREDEGRIGAYGVVSSFNIVNGLYMDLGGGS
FT                   TQLSWIKCINGEVEQSSTPVSLPYGAGALARRLHSEDKRALFLEIKKAYSGAIERIGIP
FT                   EEMLLDAKEKGGFDLYTCGGGLRGMGHLLLSQSKDYPIQTIINGFSCSYEEFSSMSDYL
FT                   FLKNKVPGSKDTKIFKVSERRASQLPAVGLLMSAAFESLPQIKTVHFSEGGVREGTLYS
FT                   ILPREIRAQDPLIVATRPYAPLLASKYLELLMTAIPVKDVPPIVYKRVAPALCNLAFVH
FT                   ASYPKELQPTASLHVATAGIIAGCHGLSHRARALIGIALCSRWGGDIPEGEEKYMDLLK
FT                   NVVLRDGDKSERKRVIFWTKYIGTIMYVICGVHPGGNIRDGAFNFSILEKEEGENEVRE
FT                   LTNDEAMTPTPGDANNRKKREFEVVVKISKDDLKTSASVRSRIITLQKKIRKLSRGSSV
FT                   KVKISVQYAEIH"
FT   gene            <783344..>784144
FT                   /locus_tag="ZYRO0E09856g"
FT                   /old_locus_tag="ZYRO-ORF3516"
FT   CDS_pept        783344..784144
FT                   /locus_tag="ZYRO0E09856g"
FT                   /old_locus_tag="ZYRO-ORF3516"
FT                   /product="ZYRO0E09856p"
FT                   /note="highly similar to gnl|GLV|CAGL0A04807g Candida
FT                   glabrata CAGL0A04807g and similar to YFR052W uniprot|P32496
FT                   Saccharomyces cerevisiae YFR052W RPN12 Subunit of the 19S
FT                   regulatory particle of the 26S proteasome lid synthetically
FT                   lethal with RPT1 which is an ATPase component of the 19S
FT                   regulatory particle physically interacts with Nob1p and
FT                   Rpn3p"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31101"
FT                   /db_xref="GOA:C5E4Z0"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR006746"
FT                   /db_xref="InterPro:IPR033464"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Z0"
FT                   /protein_id="CAR31101.1"
FT                   /translation="MSTSLPELVKSLSVAFDLKKYDSCQKLLPAIKVELIKNNLVIPDL
FT                   SSQNKAYLNDLNVAKSFFEIGALVSIYCSDLESFQNYFAQLRVFYFSPNQQLAESENKS
FT                   KILSLYMLILLSQGEITKFHSELEFLDKHIRNLEEDELLSYPIRVERWLMEGSYQKAWD
FT                   LLKSGLKQQEFDVFTGTLMNAIREEIARNTEMAYEKLPLSNIKVLLFFNSEKEAEHFAV
FT                   QRGWKVANGSVEFEEDEESNETPLEKTHLIEKTLNYAINLESIV"
FT   gene            complement(<784297..>785757)
FT                   /locus_tag="ZYRO0E09878g"
FT                   /old_locus_tag="ZYRO-ORF3515"
FT   CDS_pept        complement(784297..785757)
FT                   /locus_tag="ZYRO0E09878g"
FT                   /old_locus_tag="ZYRO-ORF3515"
FT                   /product="ZYRO0E09878p"
FT                   /note="highly similar to uniprot|P04807 Saccharomyces
FT                   cerevisiae YGL253W HXK2 Hexokinase isoenzyme 2 catalyzes
FT                   phosphorylation of glucose in the cytosol predominate
FT                   hexokinase during growth on glucose functions in the
FT                   nucleus to repress expression of HXK1 and GLK1 and to
FT                   induce expression of its own gene"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09878g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31102"
FT                   /db_xref="GOA:C5E4Z1"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Z1"
FT                   /protein_id="CAR31102.1"
FT                   /translation="MVHLGPKKPPARKGSMADMPQDLLDQVRGLEVIFSVSTEKLRAVT
FT                   KHFIDELQKGLSKKGGNIPMIPGWVLEYPTGKETGNYLAIDLGGTNLRVVLVKLNGDRT
FT                   FDSSQSKYKLPHHMRTTRNPKDLFDFIASSLKNFIEEEFPNGCEDTLPLGFTFSYPASQ
FT                   GKINEGVLQRWTKGFDIPGVEGHDVVPMLQESLSEKGVPINVVALINDTTGTLVASHYT
FT                   DPETQMGVIFGTGVNGAYYDVCKDIEKLQGQLPEDITPDTLMGINCEYGSFDNEHVVLP
FT                   RTKYDVIVDEESPRPGQQSFEKMSSGYYLGEIIRLVLIDLHEQGFIFKDQDVSKLREPY
FT                   VMDTSYPSMIEEDPFENLEDTFDLFQKDLGITTTTPERKLIRRLCELIGTRAARLSVCG
FT                   IAAICQKRGYKTAHIAADGSVFNKYPGFKERAAAALNDIYGWGIEDRHKQPIQIVAAED
FT                   GSGAGAAIIAALTQQRLAANKSVGVIGK"
FT   gene            <786545..>788164
FT                   /locus_tag="ZYRO0E09900g"
FT                   /old_locus_tag="ZYRO-ORF3513"
FT   CDS_pept        786545..788164
FT                   /locus_tag="ZYRO0E09900g"
FT                   /old_locus_tag="ZYRO-ORF3513"
FT                   /product="ZYRO0E09900p"
FT                   /note="similar to uniprot|P38124 Saccharomyces cerevisiae
FT                   YBR008C FLR1 Plasma membrane multidrug transporter member
FT                   of the major facilitator superfamily involved in efflux of
FT                   fluconazole diazaborine benomyl methotrexate and other
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31103"
FT                   /db_xref="GOA:C5E4Z2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Z2"
FT                   /protein_id="CAR31103.1"
FT                   /translation="MGYINGFRNTFFVDLLERANLVQVEPYPNQLQVSNTAKPSQPSVD
FT                   LEKGDSNDSHNKGTEKESSDTTKDVDPFLVEFTGSDDPEHPLNWPNSKTTLVITEIMVL
FT                   TCVTYMGSSIYTPGQEEIQHDFHVGHVVGTLNLSLYVLGYGLGPLIFSPLSEFAKIGRQ
FT                   RLYIITLFLFCMLQIGCALVQNIAGLVILRFITGFLCSPSLATGGASIGDIVRPEIVPI
FT                   FIGLWGVGAVAAPVTGPLLGASMVVANGWRWIFWLMVWMSGGILIILVFFFPETSVENI
FT                   LYRRCQRIRKLKNDDRYYTLKERQESKLTRKDIAITALYRPFQMIFEDPIVMALDGYLA
FT                   LCYGTFYLFFEAFPIVFIGVYDFTLIEVGLAYMGFTVGCAIAYVVCLTFMVFVVAKKFK
FT                   NNTMTPEVFLILGMMTSWCLPLSLFLFGWAASVHWTLPMLAEIFFVLCVFNLFQSTFAY
FT                   LAFSYPKYLASVYAGNGVCRAGFACAFPLFGKAMYDNLAIKGYPVAWGSSILGFFSMAL
FT                   ATIPFFLYKYGPYLRSKSKFSG"
FT   gene            <788952..>790643
FT                   /locus_tag="ZYRO0E09922g"
FT                   /old_locus_tag="ZYRO-ORF3510"
FT   CDS_pept        788952..790643
FT                   /locus_tag="ZYRO0E09922g"
FT                   /old_locus_tag="ZYRO-ORF3510"
FT                   /product="ZYRO0E09922p"
FT                   /note="similar to uniprot|P38124 Saccharomyces cerevisiae
FT                   YBR008C FLR1 Plasma membrane multidrug transporter member
FT                   of the major facilitator superfamily involved in efflux of
FT                   fluconazole diazaborine benomyl methotrexate and other
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09922g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31104"
FT                   /db_xref="GOA:C5E4Z3"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Z3"
FT                   /protein_id="CAR31104.1"
FT                   /translation="MRSLISAYVNTYRNTFAVDILERFNLVQVDEHFALKDESDDSLCK
FT                   EDISKDVPNADLEALEKQPSGNVTLASAGGIISAGDDNSGELKDAKDATDPYLVQFRGT
FT                   KDPDHPHNWLGFKKFVVILEIMLLTCVTYMGSAIYTPGQEEIQKEFGVGHVVGTLNLSM
FT                   YVLGYGLGPMVFSPLSEFAMYGRQQLYIITLFLFSMLQIGCALVHNIAGLVILRFITGI
FT                   LCSPSLATGAASIGDIVTPQWVPVFIGMWSIGAVAAPVTGPLLGASMVVAKNWRWIFWL
FT                   LMWMSAALLIVLIFFFPETGEDNILYRRCVRIRKITGDDRYYTFKAREEAKLTFKDIAV
FT                   VALYRPFEIIVKEPIVLALDIYIALCYGTFYLFFEAFPIVFAGVYHFTLIELGLAYMGF
FT                   CVGCVFAYAISLIFLSQYGARQAKKNRFTPETFLVLAMGVCWCLPLALFLFGWAASVHW
FT                   TLPMLAEIFFVICVFNLFQATFSYLAMSYPKYMASVFAGNGVMRAGFACAFPLFGKAMY
FT                   DNLAIKGYPVAWGSSLLGFFSIGLAVLPFLLYKYGPYLRSKSKFSG"
FT   gene            <792326..>792705
FT                   /pseudo
FT                   /locus_tag="ZYRO0E09944g"
FT                   /old_locus_tag="pseudo-Zyro0E-792326-792705"
FT   gene            <793128..>794813
FT                   /locus_tag="ZYRO0E09966g"
FT                   /old_locus_tag="ZYRO-ORF3504"
FT   CDS_pept        793128..794813
FT                   /locus_tag="ZYRO0E09966g"
FT                   /old_locus_tag="ZYRO-ORF3504"
FT                   /product="ZYRO0E09966p"
FT                   /note="similar to uniprot|P38124 Saccharomyces cerevisiae
FT                   YBR008C FLR1 Plasma membrane multidrug transporter member
FT                   of the major facilitator superfamily involved in efflux of
FT                   fluconazole diazaborine benomyl methotrexate and other
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31105"
FT                   /db_xref="GOA:C5E4Z4"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Z4"
FT                   /protein_id="CAR31105.1"
FT                   /translation="MQALIAAYVNTYRNTFAVDVLERLNLVQVDEEYALKDESDSSLSK
FT                   DSTSKDESNVDLEALEKQPSAVLANTGGSVSGGDGNSGELKDGKDATDPYLVQFRGTKD
FT                   PDHPHNWLGFKKFVVILEIMLLTCVTYMGSAIYTPGQEEIQKEFGVGHVVGTLNLSMYV
FT                   LGYGLGPMVFSPLSEFAMYGRQQLYIITLFLFSMLQIGCALVHNIAGLVILRFITGILC
FT                   SPSLATGAASIGDIVKPELVPVFIGMWSIGAVAAPVTGPLLGASMVVAKNWRWIFWLLM
FT                   WMSAALLILLVFFFPETGEDNILYRRCMRIRKITGDDRYYTFKAREEAKLTFKDIAVVA
FT                   LYRPFEIIVKEPIVLALDIYIALCYGTFYLFFEAFPIVFAGVYHFTLIELGLAYMGFCV
FT                   GCVFAYAISLIFLTQYAARQAKKNKFTPETFLVLAMGVCWCLPLALFLFGWAASVHWTL
FT                   PMLAEIFFVICVFNLFQATFAYLAMSYPKYMASVFAGNGVMRAGFACAFPLFGKAMYDN
FT                   LAIKGYPVAWGSSLLGFFSIGLAAIPFLLYKYGPYLRSKSRFTG"
FT   gene            <796142..>797788
FT                   /locus_tag="ZYRO0E09988g"
FT                   /old_locus_tag="ZYRO-ORF3501"
FT   CDS_pept        796142..797788
FT                   /locus_tag="ZYRO0E09988g"
FT                   /old_locus_tag="ZYRO-ORF3501"
FT                   /product="ZYRO0E09988p"
FT                   /note="similar to uniprot|P38124 Saccharomyces cerevisiae
FT                   YBR008C FLR1 Plasma membrane multidrug transporter member
FT                   of the major facilitator superfamily involved in efflux of
FT                   fluconazole diazaborine benomyl methotrexate and other
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E09988g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31106"
FT                   /db_xref="GOA:C5E4Z5"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Z5"
FT                   /protein_id="CAR31106.1"
FT                   /translation="MYIDTYRNSFAVDVLEYFKLVKLNQEIPKRRISSEESSLQPEHVN
FT                   IDVDALEKQSFEGPNEAGDIDGAVEQMHDFKDTRDPFLIDFTGPEDPEHPHNWSTLKKT
FT                   IVITEVSLLTFITYMGSSIYTPGQEQIQQEFGVGHVVATLNLSVYVIGYGIGPIIFSPL
FT                   SEFAIFGRQQLYIVTLFLFTMLQAGCALVHNIAGLVILRFLTGVLCSPSLATGAASIGD
FT                   VVRPKYVPILLGLWSGAAYAAPCVGPLIGAAMVIAKNWRWIFWLLMWMSALLLVTLIFF
FT                   FPETSEDNILHRRCERIKKITGDDRYYTFKAREESKLNAKDIAIIALYRPFEIMVKEPI
FT                   VQALDIYIALTYGIFYLFFESFPIVFSGIYHFTLIELGLSYLGFLVGSFVAYAASIIFL
FT                   HYYADRKMANGTFTPETFLVLAMCVSWCLPCGLFIFGWAASVHWMVPIAAELLFVMCDF
FT                   NLWESIFSYLAVSYPKYVASVFAGNGVLRAGFACAFPLFGKAMYDNLAIDGYPVGWGSS
FT                   LLGFITIGLALLPFLFYKYGPYLRSKSKFTG"
FT   gene            <797935..>799866
FT                   /pseudo
FT                   /locus_tag="ZYRO0E10010g"
FT                   /old_locus_tag="pseudo-Zyro0E-797935-799866"
FT   gene            <801410..>802273
FT                   /locus_tag="ZYRO0E10032g"
FT                   /old_locus_tag="ZYRO-ORF3495"
FT   CDS_pept        801410..802273
FT                   /locus_tag="ZYRO0E10032g"
FT                   /old_locus_tag="ZYRO-ORF3495"
FT                   /product="ZYRO0E10032p"
FT                   /note="similar to uniprot|P32643 Saccharomyces cerevisiae
FT                   YER175C TMT1 Trans-aconitate methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10032g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31107"
FT                   /db_xref="GOA:C5E4Z6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Z6"
FT                   /protein_id="CAR31107.1"
FT                   /translation="MSAFSEKDFDAKSYSSSRPSYPDEFYRVIDEYHVGARNRLIDVGC
FT                   GPGVATFQLADKLKPFNQIFGTDISNTMVERARGRKGENFEKYEGVNFEVSPGDDFSFL
FT                   KGPDNKCDMVTAVQCVHWLDFDSFQKSVAAVLREGGTFVIWGYADPIFPEYPKLDALLD
FT                   DFSYGPDHLGPYWESGRQILRNLLRDLHLNTELFTDFQEACFNIDYIRSNQTDPLLIKR
FT                   TITLAQFQDYLKTWSAFHSWKKSHSQERDITEGFVDRVQQLYPHLTKRSKFQVVWKSFY
FT                   KLCRKL"
FT   gene            complement(<804765..>806651)
FT                   /locus_tag="ZYRO0E10054g"
FT                   /old_locus_tag="ZYRO-ORF3493"
FT   CDS_pept        complement(804765..806651)
FT                   /locus_tag="ZYRO0E10054g"
FT                   /old_locus_tag="ZYRO-ORF3493"
FT                   /product="ZYRO0E10054p"
FT                   /note="similar to uniprot|Q07824 Saccharomyces cerevisiae
FT                   YLL028W TPO1 Proton-motive-force- dependent multidrug
FT                   transporter of the major facilitator superfamily able to
FT                   transport eight different compounds including polyamines
FT                   quinidine cycloheximide and nystatin involved in excess
FT                   spermidine detoxification"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10054g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31108"
FT                   /db_xref="GOA:C5E4Z7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Z7"
FT                   /protein_id="CAR31108.1"
FT                   /translation="MVKIDASADLDWNNLPPQQRLGRIVGGKYIETVHMDESSPEAMER
FT                   PMTKVECDIPLTYTESVEKDGKEWVMLTFAPGDPENPFNWSLRLKWFLTTLLCLMTLFI
FT                   GLATTAYSSGIDRMAKHFNSSSEVGQLGLFTFNETCSIAPLFLAPFCELVGRKVIYTGG
FT                   YLCFCLCFIGLALGKNMATIICLRACLGLFGCIGTILVGGTFDDMFVADERAIPMALFA
FT                   YVAILGTVGAPIYAGFIDQAIGWRWIEGIQGLSNVPLLIIIFLFFKETRGGVTLQKRAK
FT                   SLRKDTGDERWVSKEELEAPGLKDALYNSSVKAIKMLISEPVVFFFGLWISFAWFLTFL
FT                   FLSVIGITFSHFKHWSEGVAGLPYISLVIGVTIGFLTNFLQIRKYENMRKKSKYPLPPE
FT                   NRLYGAMTGAVFLPIGLMIYSFTQYHWLHWIGPNIGLACISLGIFFIFESCYSYTSDCY
FT                   GPDASSAIAGQGFMRNTLGAVSPLFGKYMFLNMHSQWAGLLCSLVAFGLTLLPFVLYKF
FT                   GPAIRARSKRAIVYHGEEDDEDDEIAEQQSSSSTGGGRSLQDDAHVENANNNQLFEKNE
FT                   GSRESDSPETARETDSLSPSEKVDNHAGVSRSVEEHSDTVSESELHGHTGRA"
FT   gene            <810559..>810858
FT                   /pseudo
FT                   /locus_tag="ZYRO0E10076g"
FT                   /old_locus_tag="pseudo-Zyro0E-810559-810858"
FT   mobile_element  812956..815114
FT                   /mobile_element_type="retrotransposon"
FT                   /locus_tag="ZYRO0E10098t"
FT                   /old_locus_tag="Zyro0E.retrotransposon.1"
FT   gap             818075..818709
FT                   /estimated_length=635
FT                   /note="gap of 635 nt"
FT   gene            complement(<818710..>822132)
FT                   /locus_tag="ZYRO0E10100r"
FT   rRNA            complement(818710..822132)
FT                   /locus_tag="ZYRO0E10100r"
FT                   /note="RDN25-1 25S rRNA"
FT   gene            complement(<822770..>824572)
FT                   /locus_tag="ZYRO0E10104r"
FT   rRNA            complement(822770..824572)
FT                   /locus_tag="ZYRO0E10104r"
FT                   /note="RDN18-1 18S rRNA"
FT   gene            <827379..>827499
FT                   /locus_tag="ZYRO0E10106r"
FT   rRNA            827379..827499
FT                   /locus_tag="ZYRO0E10106r"
FT                   /note="RDN5-1 5S rRNA"
FT   gene            complement(<828578..>832000)
FT                   /locus_tag="ZYRO0E10108r"
FT   rRNA            complement(828578..832000)
FT                   /locus_tag="ZYRO0E10108r"
FT                   /note="RDN25-1 25S rRNA"
FT   gene            complement(<832253..>832411)
FT                   /locus_tag="ZYRO0E10112r"
FT   rRNA            complement(832253..832411)
FT                   /locus_tag="ZYRO0E10112r"
FT                   /note="RDN58-1 5.8S rRNA"
FT   gene            complement(<832638..>834440)
FT                   /locus_tag="ZYRO0E10114r"
FT   rRNA            complement(832638..834440)
FT                   /locus_tag="ZYRO0E10114r"
FT                   /note="RDN18-1 18S rRNA"
FT   gap             834441..835074
FT                   /estimated_length=634
FT                   /note="gap of 634 nt"
FT   gene            complement(<835288..>838709)
FT                   /locus_tag="ZYRO0E10118r"
FT   rRNA            complement(835288..838709)
FT                   /locus_tag="ZYRO0E10118r"
FT                   /note="RDN25-1 25S rRNA"
FT   gene            complement(<838962..>839119)
FT                   /locus_tag="ZYRO0E10127r"
FT   rRNA            complement(838962..839119)
FT                   /locus_tag="ZYRO0E10127r"
FT                   /note="RDN58-1 5.8S rRNA"
FT   gene            complement(<839345..>841147)
FT                   /locus_tag="ZYRO0E10134r"
FT   rRNA            complement(839345..841147)
FT                   /locus_tag="ZYRO0E10134r"
FT                   /note="RDN18-1 18S rRNA"
FT   gene            complement(<843747..>845354)
FT                   /locus_tag="ZYRO0E10142g"
FT                   /old_locus_tag="ZYRO-ORF3463"
FT   CDS_pept        complement(843747..845354)
FT                   /locus_tag="ZYRO0E10142g"
FT                   /old_locus_tag="ZYRO-ORF3463"
FT                   /product="ZYRO0E10142p"
FT                   /note="similar to uniprot|Q12235 Saccharomyces cerevisiae
FT                   YLL055W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10142g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31109"
FT                   /db_xref="GOA:C5E4Z8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Z8"
FT                   /protein_id="CAR31109.1"
FT                   /translation="MESQSSSEEHVVVDIIDKDKSVEENAVKDSTEINDQEKKYAVVKS
FT                   KDTDVVLKFMEEHDSEVPEITPDQERTLRRKVALIIVGFTFLIDLTLYSDKAVLSYDSI
FT                   LGLFQDTGLTQNTYNDANTLFYVGYLIGQFNLIFVQKFSIGRVVAIMTGVWTIVIFLHC
FT                   TAYNYQGIIALRFFLGFVESIAVPTLNITMNQFLTPSEKNSYGPIWYISSMGVTIPVGF
FT                   IAYGILYAKSNVPTWKLFTIIIGGCTFLITILVFLWYPNNPADAKFLSTNEKVWVIRRV
FT                   QKSSRASIEQKVIKKYQIVEAVKDPITWLFFLFFLTQQLANNLAYQQNLLFEGLGHITN
FT                   LDSTLVSVASGGFASVCSIVATVFLLYTKDYTAFSVVFWSIPSFASSIALTTIPWDKRI
FT                   ALLAMLCVASPLFGIPWILMFSWNTTSCSGYTKRITRNAIVMIGYSISNIISPQIWRAK
FT                   DAPRYIPAWIVQIVLSFFFAPMLALVVRYILKKRNVRRLTDLKSNNGLVEIDGEAVKVD
FT                   VAMLDLTDLENKSFIYPL"
FT   gene            complement(<846673..>846746)
FT                   /locus_tag="ZYRO0E10164r"
FT                   /old_locus_tag="Zyro0E.tIle_AAT_15"
FT   tRNA            complement(846673..846746)
FT                   /locus_tag="ZYRO0E10164r"
FT                   /old_locus_tag="Zyro0E.tIle_AAT_15"
FT                   /note="tRNA-Ile (AAT) cove score=71.64"
FT   gene            complement(<847046..>847127)
FT                   /locus_tag="ZYRO0E10186r"
FT                   /old_locus_tag="Zyro0E.tSer_AGA_14"
FT   tRNA            complement(847046..847127)
FT                   /locus_tag="ZYRO0E10186r"
FT                   /old_locus_tag="Zyro0E.tSer_AGA_14"
FT                   /note="tRNA-Ser (AGA) cove score=83.48"
FT   gene            <850696..>850768
FT                   /locus_tag="ZYRO0E10208r"
FT                   /old_locus_tag="Zyro0E.tThr_AGT_10"
FT   tRNA            850696..850768
FT                   /locus_tag="ZYRO0E10208r"
FT                   /old_locus_tag="Zyro0E.tThr_AGT_10"
FT                   /note="tRNA-Thr (AGT) cove score=74.49"
FT   gene            complement(<850980..>852656)
FT                   /locus_tag="ZYRO0E10230g"
FT                   /old_locus_tag="ZYRO-ORF3458"
FT   CDS_pept        complement(850980..852656)
FT                   /locus_tag="ZYRO0E10230g"
FT                   /old_locus_tag="ZYRO-ORF3458"
FT                   /product="ZYRO0E10230p"
FT                   /note="weakly similar to uniprot|Q07824 Saccharomyces
FT                   cerevisiae YLL028W TPO1 Proton- motive-force-dependent
FT                   multidrug transporter of the major facilitator superfamily
FT                   able to transport eight different compounds including
FT                   polyamines quinidine cycloheximide and nystatin involved in
FT                   excess spermidine detoxification"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31110"
FT                   /db_xref="GOA:C5E4Z9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5E4Z9"
FT                   /protein_id="CAR31110.1"
FT                   /translation="MPRIIDDLEPEPKKCEQEFVEDVNSPVEDNSSGTSPTGISPAEKF
FT                   RQESSSIHTVNGKRVLQEYEVYDKLGYEFPQWKKWSIVTVIFVCQLSMNFNGSVYPHAL
FT                   SLISKEFHVSSQAANTSQMIFKVAYGFGCELWAPWSEEYGRRNIMQLSLFFTNIWQILG
FT                   GKAPNFGTIIVARFLGGISQAGGSVTLGVVADMWQPQDHGYAVAYVVLASVLGAVIGPV
FT                   FGGLMEEHLSWHWNFWIQLIFGGVTQLLHFFLVPETRASVLTDREAKRRRKSGEDPEIY
FT                   GPHEVKSLDFKEIMRTWLRPFYMFLCEPIVLFCSLLSGFADHLIFICNQSFTPIFKQWH
FT                   FSTTACGLIFITLVVSYAIAYPLHLIDIYYMRKKMDELMHSPRGPERRLLLLLYLAPLL
FT                   SIGLFGFAWTSMGPSYTPWIAPAIFSTVIGIANYSIYMATIDYMVAAYGPYASSATGGN
FT                   GLARDLLGGIAAMYAGPLYNNIGGKFHYQWASTLLGCLSIICSIPIYIFYWKGPLIRKK
FT                   SKFAQEIARSLEDEMEHVQPGHTDKTINVQSNPSKEVSDKV"
FT   gene            complement(<855171..>855635)
FT                   /locus_tag="ZYRO0E10252g"
FT                   /old_locus_tag="ZYRO-ORF3453"
FT   CDS_pept        complement(855171..855635)
FT                   /locus_tag="ZYRO0E10252g"
FT                   /old_locus_tag="ZYRO-ORF3453"
FT                   /product="ZYRO0E10252p"
FT                   /note="some similarities with uniprot|P28319 Saccharomyces
FT                   cerevisiae YKL096W CWP1 Cell wall mannoprotein linked to a
FT                   beta-1 3- and beta-1 6-glucan heteropolymer through a
FT                   phosphodiester bond involved in cell wall organization"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31111"
FT                   /db_xref="UniProtKB/TrEMBL:C5E500"
FT                   /protein_id="CAR31111.1"
FT                   /translation="MQLVVLILVLTSAFNVLVVSDMFRLRTLRSGDIITMEDGPLDDAN
FT                   VTNENNRLRINKDKTDLYAAVDDDHHLLFANNSYASEKTEGYFQQTSKHVASSPFSIKD
FT                   GYLNYKNSKKFYAVAEDNGYTLYTRAAGGDAVEIVLMVESIDGKEIPDFP"
FT   gene            <856908..>856981
FT                   /locus_tag="ZYRO0E10274r"
FT                   /old_locus_tag="Zyro0E.tIle_AAT_11"
FT   tRNA            856908..856981
FT                   /locus_tag="ZYRO0E10274r"
FT                   /old_locus_tag="Zyro0E.tIle_AAT_11"
FT                   /note="tRNA-Ile (AAT) cove score=71.64"
FT   gene            complement(<857927..>858262)
FT                   /locus_tag="ZYRO0E10296g"
FT                   /old_locus_tag="ZYRO-ORF3450"
FT   CDS_pept        complement(857927..858262)
FT                   /locus_tag="ZYRO0E10296g"
FT                   /old_locus_tag="ZYRO-ORF3450"
FT                   /product="ZYRO0E10296p"
FT                   /note="no similarity"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31112"
FT                   /db_xref="UniProtKB/TrEMBL:C5E501"
FT                   /protein_id="CAR31112.1"
FT                   /translation="MRQIFLRLLFPTKITHGIIQNRLNRSQTYTNLYGAILFSFVVYLQ
FT                   TSRNFTSMVFIHHAVIHELGSSFKAHELLVMFFGRIYLSFPSIQLSTKLTNSRCGKKNR
FT                   GGSHYST"
FT   gene            complement(<859580..>861139)
FT                   /locus_tag="ZYRO0E10318g"
FT                   /old_locus_tag="ZYRO-ORF3448"
FT   CDS_pept        complement(859580..861139)
FT                   /locus_tag="ZYRO0E10318g"
FT                   /old_locus_tag="ZYRO-ORF3448"
FT                   /product="ZYRO0E10318p"
FT                   /note="highly similar to uniprot|P15202 Saccharomyces
FT                   cerevisiae YDR256C CTA1 Catalase A breaks down hydrogen
FT                   peroxide in the peroxisomal matrix formed by acyl-CoA
FT                   oxidase (Pox1p) during fatty acid beta-oxidation"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10318g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31113"
FT                   /db_xref="GOA:C5E502"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:C5E502"
FT                   /protein_id="CAR31113.1"
FT                   /translation="MRSRTSYITDCLGIAPSSSSFSIRKSITTMSPANYSVPLYTTSNG
FT                   CPVRDPNAMLKMGKFGPTLLQDHHLIDLIAHFDRERIPERVAHAKGSGAHGYLEVTDDV
FT                   SDIVSADFLNGIGKKTPLFLRFSTVGGEKGTADSARDPRGFAIKFYTQEGVIDWVNINS
FT                   PIFFIRNGVQFPYLVHTQKARDPKTNLKDPNMFWDFLLNNPESVHNTMFVFSDRGTPFS
FT                   YRHMHGYSAHTYKWVNKEGKFHYVQVHLLTDQGIKNLNNEEAHALEADDPDHAGRDLYE
FT                   SIEGGEYPSWTIYIQTMTAEQAEQADFSVFDLTKTWPQKEYPLRRVAKLVLDRNPENYF
FT                   AEVEQSAFSPANTVPGIEPSADPVLQARLFSYADTQRYRLGPNFNQLPVNRPLQAYCPF
FT                   QRDGPGRTDGNYGAVPNYPSSFEPLNYRADASNNEAHEKWVGEATSFHWGATEKDYEQP
FT                   RIFWELFKNTGQQDAFIHNVTENVKATRPDVQKRVLELFSKINPEISELMSHSLETKAK
FT                   RT"
FT   gene            <861907..>863475
FT                   /locus_tag="ZYRO0E10340g"
FT                   /old_locus_tag="ZYRO-ORF3447"
FT   CDS_pept        861907..863475
FT                   /locus_tag="ZYRO0E10340g"
FT                   /old_locus_tag="ZYRO-ORF3447"
FT                   /product="ZYRO0E10340p"
FT                   /note="highly similar to uniprot|Q2UD26 Aspergillus oryzae
FT                   AO090012000349 Choline dehydrogenase and related
FT                   flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31114"
FT                   /db_xref="GOA:C5E503"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5E503"
FT                   /protein_id="CAR31114.1"
FT                   /translation="MELRGSKYDWAYKTTMVKRDDYERIEKPNTRGKALGGSSSLNYFS
FT                   WIPGCKPTFDRWEEFGGEEWTWDPLVPYLRKSATYHDDLKLYPEELKKIGGGGPLPISH
FT                   AELVDELAPFREKIIEAWKSRDLPMSENIYDGEMIGLTHCVDSIYHGVRSSSVYFLKEK
FT                   PNITILSQVHSKKVIIDAADKVAKGVTIIKPSGEEHSYYAKREVIVAQGVFESPKLLML
FT                   SGVGPKKELETHGIDVIVENPHVGQHLLDHPGVPFVLHVKDGFGMDDHLLREGPAHTAA
FT                   VEQYKKKSTGPVGSGLLELVGFPRIDEYLEKDPHYLQAKKANGGKDPFCPEGQPHFELD
FT                   FVSMFGSAFQWHYPTPKEGCYTSVVVDLVRPISEPGEVKLNSADPLVQPNINLNFFADE
FT                   LDIIAMREGIRFSYDVLTKGKGFKDIVVGEYPWEMPLDDDKEMRKQILDRVQTAFHPCG
FT                   TARLSKSSEQGVVDSSLKVHGVKGLRVIDASVIPVIPDCRIQNSVYAIGEKGADAIKEA
FT                   HKDLY"
FT   gene            <867393..>868394
FT                   /locus_tag="ZYRO0E10362g"
FT                   /old_locus_tag="ZYRO-ORF3443"
FT   CDS_pept        867393..868394
FT                   /locus_tag="ZYRO0E10362g"
FT                   /old_locus_tag="ZYRO-ORF3443"
FT                   /product="ZYRO0E10362p"
FT                   /note="similar to uniprot|P53183 Saccharomyces cerevisiae
FT                   YGL039W and similar to uniprot|P53111 Saccharomyces
FT                   cerevisiae YGL157W"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10362g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31115"
FT                   /db_xref="GOA:C5E504"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5E504"
FT                   /protein_id="CAR31115.1"
FT                   /translation="MAVLVTGATGFIAQWVLDCLLKENYQVIGTVRSQEKGDKLHKQFG
FT                   SPSKLSFEIVKDISDTEAFEPLFKKRGKEIDIVLHMASPCHFNTSDYEKDLLIPALNGT
FT                   KGVLNAIKKYGDVKKVVVTSSYAAITDMVNSADGSLVFTEKDWNPATWERCQTDAVNAY
FT                   CASKKFAEQAAWEFSKETGVSLTTINPVFVFGPQKFDEDVTSQLNTSNEIINGLIHSKP
FT                   GDKLEPDYHSAYVDVRDVARAHLVAFQKDTTGERLGLSNGAFNCQSILDILNEKFPQLD
FT                   NTKGPEPGMGDTKPGAVFDNRHSKEVLAFPFISLEQCVYDTVAQVLKKEGRL"
FT   gene            <870306..>870377
FT                   /locus_tag="ZYRO0E10384r"
FT                   /old_locus_tag="Zyro0E.tGly_TCC_12"
FT   tRNA            870306..870377
FT                   /locus_tag="ZYRO0E10384r"
FT                   /old_locus_tag="Zyro0E.tGly_TCC_12"
FT                   /note="tRNA-Gly (TCC) cove score=71.59"
FT   gene            complement(<871237..>871980)
FT                   /locus_tag="ZYRO0E10406g"
FT                   /old_locus_tag="ZYRO-ORF3439"
FT   CDS_pept        complement(871237..871980)
FT                   /locus_tag="ZYRO0E10406g"
FT                   /old_locus_tag="ZYRO-ORF3439"
FT                   /product="ZYRO0E10406p"
FT                   /note="similar to uniprot|P33751 Saccharomyces cerevisiae
FT                   YDR538W PAD1 Phenylacrylic acid decarboxylase confers
FT                   resistance to cinnamic acid decarboxylates aromatic
FT                   carboxylic acids to the corresponding vinyl derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10406g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31116"
FT                   /db_xref="GOA:C5E505"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C5E505"
FT                   /protein_id="CAR31116.1"
FT                   /translation="MLGMQFFSRALCVGGHVRSFCFSQVRGPVKLRSFGTNLAKRNSSS
FT                   SSLTEKQVCNGTVAPKPKRIVVSITGATGIALGVRILQILKELNVETHLIISKWGMATM
FT                   KYETDFTLEDLRSIATHTYPAKNVAAAVSSGSFLHDGMIVVPCSMKTLAAIRCGYTEDL
FT                   IVRAADVTLKEKRKLLVVPRETPLSEIHLENMLSLARMGVIIFPPVPAFYTKPTSLDDI
FT                   IEQSCGRILDCFGIHTNNFSRWDGF"
FT   gene            <872520..>874055
FT                   /locus_tag="ZYRO0E10428g"
FT                   /old_locus_tag="ZYRO-ORF3437"
FT   CDS_pept        872520..874055
FT                   /locus_tag="ZYRO0E10428g"
FT                   /old_locus_tag="ZYRO-ORF3437"
FT                   /product="ZYRO0E10428p"
FT                   /note="similar to uniprot|Q03034 Saccharomyces cerevisiae
FT                   YDR539W Hypothetical ORF"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31117"
FT                   /db_xref="GOA:C5E506"
FT                   /db_xref="InterPro:IPR001158"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032903"
FT                   /db_xref="UniProtKB/TrEMBL:C5E506"
FT                   /protein_id="CAR31117.1"
FT                   /translation="MAPKLTPVLKFRDFLEALRREGDLVEIFQEVDPHLEVGAIMRKVY
FT                   ENKLPVPLFKNLKQPKGNVDPDNLFDIAGCIGGLRAFGNDHARIAHHLGLSSDTGMKEI
FT                   IDHLLEAKKRKPIPPVKVNRDSAPCKENILKGDQINLEQLPAPYLHDEDGGKYLQTYGM
FT                   FVLQTPDKSWTNWSIARAMIHDEKHLTGLVMNPQHIRRVADQWKTVGKENAVPFALCFG
FT                   VPPASILVSSMPIPEGVSEADYIGSVVGEPIQVVQAETNQLEVPAESEIVLEGTLNLDH
FT                   MVPEGPFGEMHGYVFPGTGHPCPTYTVETISYRNNAILPVSNPGLCTDETHTLIGSLVA
FT                   AEAKQICLNHPVLSKIVMDAFMPYESQVLWLAFKINVKELVKLNTDSKSLADLFAKEIY
FT                   GNKVGMTTQEIILVGDDIDIFNFKKLMWAYVTRHTPGDDQYFYDEFVAFPLAPFISQGP
FT                   RIKTKRGGNCVTDCLFPIQYRDPNFRFVTCDFDSYDSAIRDKINQNWSNYGYQ"
FT   gene            <874684..>876855
FT                   /locus_tag="ZYRO0E10450g"
FT                   /old_locus_tag="ZYRO-ORF3436"
FT   CDS_pept        874684..876855
FT                   /locus_tag="ZYRO0E10450g"
FT                   /old_locus_tag="ZYRO-ORF3436"
FT                   /product="ZYRO0E10450p"
FT                   /note="some similarities with uniprot|P32319 Saccharomyces
FT                   cerevisiae YBL017C PEP1 Type I transmembrane sorting
FT                   receptor for multiple vacuolar hydrolases cycles between
FT                   the late-Golgi and prevacuolar endosome-like compartments"
FT                   /db_xref="EnsemblGenomes-Gn:ZYRO0E10450g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR31118"
FT                   /db_xref="GOA:C5E507"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR031777"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="UniProtKB/TrEMBL:C5E507"
FT                   /protein_id="CAR31118.1"
FT                   /translation="MRCNQWKPEIRMHFVQVLWALWALVTAQESVPCVSRSHIERPHKP
FT                   NAFNRGNVYTFSDSHTLMFYFERSLQITFDSGRNWQTVDVFGEDISWVDIDEFYKERAF
FT                   VTTTSGEIHMTEDQGRSWKQLSLPQEIEDEKDCVLDTHPFNTNLLLLHCIIIPGNFELE
FT                   HSPETIPDSSSFMEDIAYASADAGKSFRRISAPFEEYEATQDLEYRGTTCQFATLSKES
FT                   IFDKDGIYCMHQLESRTEIQKQSSHPYGMNIGKKSFRETQPSVPKTYTMGTLFYTTDLG
FT                   QSTKLFDELEGFSVKDVSILPFHVLVTTSEANEVDGAANRLWVSTGGPFKPACLPKRVA
FT                   YLPQRVRKPLELDPESILLRAILEEDEGHGKFEHLLLSDSSGLNFSLIDSIAQEHAQHV
FT                   MIKKLDNLEGAVWGEFIFREVHNRITELDMDETKLDKKVNWFQRIIEFIKKHILHRVPY
FT                   MFFRTKGSFDNGNMYDMFSKTKGSFDNGKTWTNLKVVDPSGTHKHIFQCDIDDVENCSF
FT                   QEVFSPYFDAPINEPTAGILMETGVVGKHALRLGEEDNMTFISRDGGSSWEVVFEFPVS
FT                   AAFLDFGNIIVAVPESSCLKDSSVEKFFYSLDQGNNWREYYLDELTHASNIVLDGWGLN
FT                   VVIGLGNGKKQPTEYTFYTVDFSEVLGGSACTDNDWEKWYLSDGKCFNGVKYSFNRRKA
FT                   DAQCLMRKTFEELTLNEESCEPRDIKSSI"
FT   gene            <877559..>878646
FT                   /pseudo
FT                   /locus_tag="ZYRO0E10472g"
FT                   /old_locus_tag="pseudo-Zyro0E-860659-861746"
FT   gene            <879386..>879458
FT                   /locus_tag="ZYRO0E10494r"
FT                   /old_locus_tag="Zyro0E.tLys_CTT_13"
FT   tRNA            879386..879458
FT                   /locus_tag="ZYRO0E10494r"
FT                   /old_locus_tag="Zyro0E.tLys_CTT_13"
FT                   /note="tRNA-Lys (CTT) cove score=75.47"
XX
SQ   Sequence 881646 BP; 266803 A; 173785 C; 172698 G; 267091 T; 1269 other;
     gtaatcgaca gaataaaatt tttgtctatt ataatagcta ccgttccagg tgtgaacttg        60
     ggacaatggg atcggatagc tatgaaaatg aatcagcatc tgcaaaatag aaacgccagc       120
     gacgggggca aacgtgatga ttttttcgat ggaaaccaat gctttcactt tttcgaaaaa       180
     gaatttgaac ctcttgtttc cgataaaggt gtgtttgatt ttttcaaaaa gttactcgag       240
     ccgcttttcc ctagccaatg gttactatac cgtgacctgg actgtattgc tgcggatgcg       300
     ctcagagcgt gcgaaactcc ttctgattag atcaatgtgg ccttgtaacg ttaagaattt       360
     accagctaac gactacctct cgattccaaa tcaatatact ttgctttggt catgggtttt       420
     caaaaacatt ggttttgaga agtttcaaat gaataataga gtcattgttc aaaactaggt       480
     tttttgactg ccacaccaca gaagcccaga agagattagc tcttaacgtg ctttttatct       540
     cttatgtcaa acagattaac aaggggcagc gaataaaata agaatggcat gccaaatcaa       600
     taagaaaaaa tagaccaggg tcatagttac agagagcgct aattctattg cccccaagta       660
     aagcattgag gtgctgagaa tattgcgaaa cttctcgaaa ataccgtctc tacattcatc       720
     ttcctctgcc gtatgtgata atttaccaaa attctcaacg ctcttgtcat aatttgcaac       780
     tgctctctcg attagaacct tatttgatgg atttttccaa aaattcctgt acctttctcc       840
     ttcgtaataa caccttatgt cgtaggtctg gcactctatt ggttttacga tttctctcac       900
     aaaaaagtgc atacaatgct ctccactgta aaaaagggaa taccgatatc ctgtctcttt       960
     agaaaagaga ttaactctag atgtaattct ccgccaagct attggatccc cgatcaagtc      1020
     catttcagcc acttccttca ataacgtttg gagcactttt gtgtcaatat caacgttttt      1080
     cttatggtag atgaagttca caaaaaacac agtaaagaat aggaagtaat gaacgatcat      1140
     ccatacggga gaaaatactt ctaaaaattt tgtttcaagt tcagtatcaa aatagtcgcg      1200
     cagactaaac taaggcaacc gtacaaatgg tgatgacaca aatgtaccta aaagagagag      1260
     gctaatatcg gatatccatg ttttctcgaa aaaatatggg gcaaggaagt acatcaactt      1320
     tccaccagta ctgtcctctg gtaattctat tttttcctct tcaaacgtct gcacacactt      1380
     ctctaaatcc atttcactct cgtcacttat cacactcata ttgtcttgtt ggttaaatac      1440
     accattgctg ccgcgagtgt cagtttgtat ctgaattgcc gccttttatg tcttttcact      1500
     ccggattgct tcccccttga ttgttccctc cccgcgggac agtttcatgc aggagaaact      1560
     cgaagtgtca aaatgataac gtatatatac gaaagtggta gacgggtagt tcaaagatca      1620
     gtttggaaac tctaatcaga gcactgaaag attgccttat gtctggtgtg tcggcacctt      1680
     atttcacttt gttgaccttt tctgttgaca gtatatagag ctgccggttt atcatatgtc      1740
     gattatgttc gagtgtaaac gatggttagt tgtctatata ttatatataa ccatcgagtt      1800
     gaataaatcc acgaggtacc gaaagaagta cgcgggaagt cagttcagca acagacacaa      1860
     attgcaagaa gcaatgtcgt atcgccatca acttaacgct tgtgctaata aggcagactt      1920
     gcttcacgga cacaagggca agaaactgtc ggagctacct caagttttta atcagcggtt      1980
     cagttgccat ggaggttgta gagagccctt aacgtggtac aaacagtaga atacgtatct      2040
     atttctgatt aagctagcgt cctgggtagg aattgaggaa ttgcctaaaa gccttttgat      2100
     ctcagaagga tatatctgct cttgatgcgc atcacctttt tgtcaagaat atctctcata      2160
     tgtttctatt ttcaagcgag acaggacatt acagaaaata tatacgtata ggcaacataa      2220
     actttgtttg aacttgttac ccattgttac ccattgttat ccattgttat ccattgttat      2280
     ccattgttat cacgaattcc tttttctgca atcttcgtca tgtcgctccg atgacgataa      2340
     aaatctgatc tcgtttctca tagcaactca ggaaactact cactacatac aagaaaggag      2400
     tttaaacaag aacaaacatg gaatccgata aagaatctca aagcccgtat tacccaaaca      2460
     actcttcaag agtgacttta catggtcgtt ttatgaaata tccaagcatc gctcccccca      2520
     gttgatctca tgtttatgcc ttgttgggtg ggtatcacta tatgggagta atttaataaa      2580
     taaaaaggag tctacgggtg tcatgtttgc cactttatac ctagaatttt caattctact      2640
     tccccttgca cggttacaat attcgaaaat gtatcccaat acaacagtgt tggttcgaca      2700
     agtgctagaa ttgaatcctc aacgtgattt caagaaatgg gacgacattg caagtaaatt      2760
     gaacctttta ttttaccaag agcatatctg gaatacacca tacttttttt atgatggtca      2820
     acagactcaa cttgcattca aggataatgt tttaaggcca tatcaccaag gaaaatttaa      2880
     cggtattact gatgcggaca agattcaatc agcaaggagt tatatgcaat caataaaaaa      2940
     ggattttgga ttatcattga gagacagttt gtcaaaaccc gttttaaatt ccaaattacc      3000
     cagagacacc tacagaggca agttctcctt ttactcaaga tatttgctcg tgggattgac      3060
     ttatttgttt caaattgact ctctgttaaa aattgtaaca acatttggcc aaaaaccatt      3120
     cgaggctttg atttcgctca tatattggca gtttctgttc ttgatattct accgctatcg      3180
     ctatcgcctt ctgtatcaag agatgggtac aatgcaagca atcaaatttt tgtcgataat      3240
     aacaaaagtc aatcctgaaa aggaactgaa taaatgggat caagtagcca gacatatgaa      3300
     tgaatatcta gctagtgagg aaaatagcag tcattctaag cgtagatttc tggacggtaa      3360
     acgttgttta aactgttaca agacctactt tgagcctcta tccgttggta atggtccttc      3420
     ggaatactgc gagctgaaag aaattgttga aattataaaa ccagatgcat agggcgatac      3480
     caattagtaa aactttgtat ttctcaagca caatctgaaa gtagcagtct ataatgattt      3540
     aaaatatgat agtatcacaa gtgctgtgct gatggtccct caaagtacta aacttctccg      3600
     ggtggtactt tcagctcaga ttgcaccctt tttcttggct aaagataatc tctaaagcca      3660
     acgattggga aaatagaatt aacatttaga attgagaatt gagaattcca tgttcactta      3720
     agaaattctt gtgtgtgcag aagtgcctcg ttaaccacct gaagatagtt tatttgataa      3780
     gccagcccca gattgacgtc catttaccct cagtaacgaa cgaccaaaca acacattaag      3840
     aatcgaaaaa ctggcgacaa aaacttctca gaaacaacta aatactactt tggacgtctt      3900
     taggctcaca actctcctca tttagtgtaa gctcttcaaa tgtttccctc atcaaacatt      3960
     gggcatccgc ttttcttctg ttaaagctgt acttgatacc atcaatgcac ttgccattag      4020
     acaaatacca tttttcccaa tctccatcag tgcaagcacc ttccccgaac acttccgaaa      4080
     aatctattgt gtaaacggta tattcagcgg gttgcttgtc tttttttttg ccgaggccta      4140
     tcacagcgtt taaaccccag ccatcaagta cgacatcgaa cgcatgtgta ggttcatcga      4200
     ggtaatattc cctccaatta tttccctgat ccacagaata aaagaactgc ttcactggtg      4260
     agttctttga aaaggaaggc ttgcgtatag cgacgattat gttaccgaaa tccaaaaatg      4320
     ctgcgtagac gggaaattca aaagctagct cccaagaagc accaccatct cgtgaaataa      4380
     atgtcatttc atcgtaatca cgtaacacct cggtatttct tctgacgaca ccggttttca      4440
     taagtatacc agctgttggt tcatttctag caggttgaaa gtaaggagaa aaaagttcct      4500
     ggaaaaaaca atgttctact tcattgatat aacattggag cgagcaatgc tctacttcat      4560
     tgatatcaca ctggaaaagg tgcttatttt ttctagaagg atctacaact ttcagattag      4620
     tccatgtttt cccattatca aagcttattt tattcttgga aaattcttta tactcaatga      4680
     aagggaaagt ttttatatga gggtaggatt ccctgcggaa tataaaatca ttaataaatt      4740
     taatagtttt ttgaaaccga ttgatcttct catcatggtt tgcttcgtac atttccaatt      4800
     tcttgctttg attaagacct atttcaaacc tgaatttacc ccacattgtt cccttgaggt      4860
     tgcctaactt ttttaggtta atattttgaa caggttcctg agtcatggag tcagtgaaag      4920
     aaaagttgag accagaagaa tcggacagta gcaaatgctc ggattttccg tgtccttcac      4980
     cttctgccag aacagcacat aataatattc gctctcgatc aagctccagt ggatttttga      5040
     tcctatttgg caaaaaggcc accggctcag gtaggtacgc atgttcaaaa ggctgttttt      5100
     attatgctta gcttcagggc cccctgatat ggctaccaaa atataggagg gcagaatcca      5160
     taagtccttt atcgagaagt cctttaattc atcaacgagt cttgtacttt gaccaaaatc      5220
     atttgtgtaa aacagggtac ccacagtgtt taatactgga tcgaggaact tttttttcgt      5280
     aaaagttttc ttttcactgt caatcctaca tgtatatgaa gaccaatttc gaacgttggt      5340
     cactctttcc accttgtgga tacaataaat agcgtcccta tcgaaggtag attctttcga      5400
     tgaagtggcg aatttgcagg tagtgccatg gtactggaga tcaggggtag cttcatattc      5460
     gtaaactggt tctccaatac gtctaaagct tttcccagaa tcatcagaag cgtaagctat      5520
     acgttccata aaggaaagtg agtccggatt attcgttgaa ttatgtccca gctgaaactt      5580
     atcgtgcata ataatgcagt gtagcaatag aaaattctta ttgaacggat gtttctgcaa      5640
     cttgcaacct ttcttgtctt tgatttcctg tggtaaagat agttgcttcc aacttcttcc      5700
     ttgatcttcc gtcacatgga tccttccaaa accgctagtt acaaaggctc tatttttgtg      5760
     aaactcatca atatcgaccg cttctacatt tctcccgacc tcatcgatag ttcgccaatt      5820
     cctcccatga tcaaatgtta tctgcaaact atagtgcaaa taaaacatag aaacatggga      5880
     gtcgctgaag gtatagaaat ctccgtgatt gaaagcaagg ggtttataag gtatctctat      5940
     atgagatctc gatacaccag gaacaaactc ttgagcagtc actagagccc acagagccca      6000
     aaatactgga ataaaatgca tccttatcct tggtttccac tggttacacc gcatgccaag      6060
     aagtttcaag atccatgaat gcccctcgcc ttttatcaat tttttatctc gattacccga      6120
     aaataccaag agataaagaa aggtagatac tgatcaccga gaaaatgtct ggggctgaca      6180
     acagaacttg tattagtaca caatcaaatg caccgatgcc atctactaac taccagcgct      6240
     agtaagtata ctcttagata taggcaaata tacgcccagc ctagtatgga taacagctca      6300
     acaaccccct cggcacggac acttgccttt cacaaaacca cttcaatcgt cgattacatg      6360
     tccaattgat gcatctatga actgtagttc ctaataaaat cttcaagtaa tcagagccta      6420
     cgcagtttgc atctcggctg tttacgagta atctcactta atattcgatt atctaagcca      6480
     aaaaagctcg taagcagcca aagtcttccg ggacatccat agcggcagta gatacaatag      6540
     acgtttgaag gatcacacca aaggtttttg aaattttctt ggattttata actggttcag      6600
     ttccttttta ttggaaacta cgtgatgtaa ttagacgaat attcattggc tctatcacga      6660
     atagcactat cgtaggaatc aaagccacag gttccaaatc ggaaattagg atccttgtac      6720
     taaagacagt ccgtaacaca ataccctccc cttttagttt taatccctga atgatgaaag      6780
     gtgctagagc gaaagcaacg aattcgtcat agaaatattg atcatttcca ggagtatgcc      6840
     tggtcatata tgcccacatt aatatttcaa aattaaaatg tcaatatcgt caccgattaa      6900
     aattatctct cgagtagtca ttccgacttt gttaccatag attttttttt gcgaataaca      6960
     gctaagaact tgctgtcaat attcaattta acaagctctt tgactttgat ttaaatgcta      7020
     accaaagcac ttgggactca taaggaataa atgcatccat gactatttgt gaaaggactg      7080
     gatggttcgg acaaatttgc ttagtttctg ctgcaactaa agatccaatt agtgtatgaa      7140
     ttcttaaaca atattttgtc ttactttcac ttgaatatat tttccaatac attattttat      7200
     tttcttattt cattatttcc aactattctt attctttatc tcaatacatg ccctttagga      7260
     ctatatacct aatctcaagt atcttcaatt gaaacgctaa ataacatctg acttttagtt      7320
     tctctttcca tttttcgcat agaataccat tgataaagcc atccatcaga tattttcatc      7380
     ttattttctc ataccagtcg caattctcta ctcacctctt tctatccaac cccttgggta      7440
     tttatcgtac tcatttacaa agatcaaata tatctagatc tatctcatct caacatatgt      7500
     ccttttgtaa acgcctaatc aagaacttcc ttcccaactt gggtgctata caccattaaa      7560
     aacaactttt ctttaatttc tgacagccga atgttcttcg ccgagaccta aacaataaaa      7620
     aattgaagtt gcaagagtta gtgcattcca aaatacattt cgcatattat atagacattc      7680
     agattgatac atatctaaac caagtatatt ctaacatttt attttatata acaacaccac      7740
     ttcaaagata gcaatacatg aagataacaa tttatatatt atcacatgtt tgaacatgac      7800
     agtaaagtca gtacatataa aaaagaagtt gtttgaacaa gtgcctacca aacaacagat      7860
     cgagagacaa aatacagtcc attaaaccag tggaggatct tgaaactagt ttcactcagc      7920
     tccaagaacc gtaagccttt tccacatttg ctgaggctac aaatgttaaa cgtgcggctg      7980
     gtacacgcta gaaggctgtc ggtgtaaatg ttaactgttc tgatgcatac agatagatta      8040
     gtaagaagtg ctagaagtga taaataaaaa ggggatctgc atggaggtgg tgacctgcta      8100
     cattaaccta ttgcataact tcatgataat atgcacctac acacaaacac aaggattatg      8160
     ctcgctgcct aaaatcttcc ataacaaggt catgtaaatt agtgatctaa accgtcgaat      8220
     tggctcttac actatgccat tccctcaagg cagaaactaa gcctgtggtc aatttcctca      8280
     actgctcctt ggaaataatg tatggcggca tgatgtaaca gaggttccta aagggtctga      8340
     tatacacccc tttggagata aacgcttcct ggaaccactc ctgatctatc gatactttta      8400
     gctcaattac acctactgct ccgacgatcc tcacatcttc gactaaccat aactcctttg      8460
     ctgcagctcc ttccattagc ggcacgaaca actcctcgaa taactgttcc tctattctat      8520
     gtacttgctg cttccaataa ccgcacatca gaatatccaa gcttttgttt gcaacagcgc      8580
     aagctagtgg gttccccata aacgtggggc catgcatcat acatccgcct gtgggactac      8640
     tgggtgacga gataccaagt gctattttgg gtgtagtgac aacggcactc aatgtcaagt      8700
     acccgcctgt tagtgctttt cctacgcata ttatatctgg ataaacatct atctgcattt      8760
     cgcgcggaat gtgattctgt tcctgataaa tctggcaatg atggaaagca aatgtcgtac      8820
     ccgttcttcc aaaccctgtg gcaatctcat ctagtataag tgggatatgg taccggttgc      8880
     acagtcttct tacctcgatg agaaactgcg ggtggtacaa tctcattccg ccagctcctt      8940
     gcaaaattgg ttccagaaaa actgcacaca actcatcatg atgattttct atcttatcgc      9000
     gcacgtcatt gatatcatcc tctttccagc ttgttctgtc gccgaatgac ttgccatact      9060
     ttcggaatac gccagaggtg ggaagcaccg gaatcatgga tggccctctg gcaaaaatgt      9120
     tctcggctag ataccctcta taaatcgagt gcattgaccc taccggatcg catacgctca      9180
     tagctcctgt ggtatcgccg tgataaccgc tacttatggt caagaacttg ctctttttcg      9240
     gcttccctaa agtaaaatgg tattgcaaag ccatcttcat tgccacctcc actgctacag      9300
     aaccactatc agcgagaaaa cagtgctgca gctctttgtg gttcatcatc tttagcaatt      9360
     tttggaccaa atttattgca ggcctgtggg ccagcccacc aaacattaca tgagacattt      9420
     gactggcctg tgatatcagt gcatcgttca attccttgtg gttatagcca tggattgcac      9480
     accaccagga tgacattcca tcgattactc tattctcgct tccatcctgc gtttctagaa      9540
     taagctcaca gtcatacgcc gccttcacta gatgcactgg tagtggattc accatagatg      9600
     tataaggatg ccatatgtgc tccctgtcaa accttaacaa agccttcgtt tcctcaggta      9660
     atttcataat atctgtcacc gcttcactta gttggacctc gtttcatcga gaggtaaagt      9720
     cctaaacagc actaaactca acgatgcatg tacgttaaat acaaagtgtg tgggaatgga      9780
     gaagggccag ccttttcata taacagtcct ccaacagttt tgcgtggtgg ttggtggata      9840
     attaagcccg tggaagtggg ctggaatacc aacaaaccgc atgagtcatg aatcatcgtg      9900
     tatagtcata ctggaatggc tatcaataca gcacacaaaa acctgttgac tcgcgtgcgg      9960
     ataaaccctg caacgaaaca ttgcataaat tatggaacca tataaaagag gccagcacaa     10020
     atgagaaaac cgcaaaacaa ttcgttccgt ctattcgaaa ggtaagtggg caaatatcca     10080
     tacccttcta ccttaatgaa accgcctgtt tttttcgtca caggcacaga cactgatgtt     10140
     ggcaaaacct tcatttcatc gctactagta tacaaatgga gagctaacta ctggaaacca     10200
     gtccaaacag gaattgaatc tgatattggt gacactgcta cggtctctaa cgtattggta     10260
     gacgattctt ggaagcctca tttattcccc ccacggcatc agctgctaaa accattgtca     10320
     ccatatgaag caatggacta cgaaccaggg gttaatgttc agattacgga ttttgaaatt     10380
     cctgaaggca ccgacgagca ccctcttgtt gtagaagggg cgggtggagt cgccgttcta     10440
     gttacgaaaa aaatggagac cattgtggat ctcatcaaag aattgagttt caaatgcgat     10500
     cggcctttct atatcatact cgtggcaaga agtacacttg gcacgataaa tcatacgttt     10560
     ttgacgttga attaccttcg tagtaagggg ctaggtgaca agatccttgg ggttgttgta     10620
     aacggtgaac aaaatgaggg aaacctgaaa gtaatgagag aatttggagt gaacatttta     10680
     gctaccgtcg actatcatac ttctatgtca gaggcgctgt ccgatattcc atctttttgc     10740
     tcacttgatc ttgctcacaa cgatcctgcc tcgattcaaa agaattagag atgtatcttt     10800
     tccaggccag atatcattcc gatctaatta gagagtcgtt tatcatcctt tctgctatga     10860
     gagtaagcca tggtgttaat caaaatgaac atgagcagac cgcaccgaca tgtaaaatag     10920
     tgggaagtag tgacacaagc ccgagcatac ttgtataaat gcatgtaaga aacatttcac     10980
     tttttccaat tgtgacgcta aagcacaaag cccactggag aaccgccaaa ggaaaacaaa     11040
     agatgtatgg aaactattca aatcgctcat ctggcggtta ttgatgggta catcgtcttc     11100
     tttaactaat tcgtgcttgg ggtgtcttct tctttggtga tggggcttac aatgggtgtc     11160
     catattgatt atatacggcc cattgttgta attttatttc gctttgatgt gttctatttc     11220
     atatctgatt tcactgtaat gcggcccaat gcaagcggtt cttacttctg gactttaaag     11280
     ttactctggg agccgataca aaagaacagt gttaaaattg atgaaccaag atttctctga     11340
     aaccgaggta aaacagtaag aaaggtactg caatgctaga aacaaagtgc agcagcctag     11400
     gtcgaaaaaa aaattggata ctggcctgag taattatgtt ggcgttgtct ttaccacctc     11460
     tggtgtattt aattccctct tgttaagcat tcctgggata aactcgttga tatacctacg     11520
     ataccagctt caccgctggc atgtcttcct cgcttatcaa atactgaata tttctaccgc     11580
     gctcgcagga tgccatggta aatagcttcc agtcacctct aaatttggtc ttgttgcttc     11640
     cgttttttcc tgctgtataa aattacttga ttctatgacc agccacagct tcaaccatga     11700
     cattctgtgg ccagcggcaa aaacaatttt cgataataga acccactggt catcagcagt     11760
     caaatttact cgaggctgct taataggcgc tggaaagttg ctgggatcga tccggcaaac     11820
     acgtagtcga cagatacggg gtataatctg tcccgtaaat ctgtcccaag ggtattgaca     11880
     tgcaatgttc ttcttggatt cttgaacagt tttatctatt ccattgttat cgattgttat     11940
     caggaatctt tttttctgca attttcgtca tgttgctccg atgacgataa aaatctgatc     12000
     tcatctctca tagcaactca ggaacgtact cacaacatgg aacaacagag gtataaaatg     12060
     aacaaacatg gaatccaata agaaatctca aaagcctgtc ttacccaagg atctctttag     12120
     aatggcttga aatgaatgtt ttatgaaatg tcgaagcatt gtttccccag tgtggtctca     12180
     tgtacattct gcgtcatcgc ctgggtagca ttttcaatgg atgcttctta tcaaaatgtc     12240
     cctggattct acacgaatgg ccgtgtggtt ttcgaatttg tattttgctc tcccttaggt     12300
     ggttctatta ttcgaaatcg catcccatac aacattgttg gttcagtaag tactggaatt     12360
     gaatcccaga gtggatatag aaaaccggga tggaactacc aatagattga atcagtgcct     12420
     ttatcaagaa catatctgga acacacctta ctttttctat gatggtcaac gggttcaact     12480
     taattttaga gataacgttt taagaccata tctcaaaggg aaatttgaag gtgttgccga     12540
     cgtggacaag atccaatcag caaggcttta cctaaaatca gtaaatgaaa attttaaact     12600
     atcattaaag gacaatttgc cagaatcctt tctaaattct gaacaaccca gggacaccta     12660
     cagaaacaaa tctatgcttc actcgcgata tttgttcatg ggaatcatat ttttgcagcg     12720
     tcaataccaa attttgttgg gtatcgtaat gggatttttt cagaagttat tttttacttt     12780
     gttttgttgc atattttggg atcagatttt ctcagaagat aactggagct tctattggtt     12840
     ggtatatcca gagatggata taatgaaagc aatggaattt ttggcgataa taacaaaagt     12900
     tagttctgga aaagaactag atcaatggga tcagataacc aaatatacga atcaatattt     12960
     gaagggggaa atagcggcca ttctaggaag gtatttttcg acggtaagca ctatttagac     13020
     tgttaccagg attgctttgg gccactttcc gttgaaaaca gcttggttta tggagagttg     13080
     aaggaaattg tggagtttac aaaacggagt aaagaaacaa ataaatccga ttttttactc     13140
     tcaacctgag agtggcagtg tatagtatct caaaatacgt tggcatcaca ggtactgcta     13200
     ccgatggtcc ctgtgtgtac ttatttcctg tggagtagtt gtcctaacta aaaatactgc     13260
     ctcttggtca aagataatcc atagggacag taagcaggaa agaaggataa aaaataaaaa     13320
     ataaaaaaaa aaaaaaaaaa aagattcaga attgacggtc ctaggtttaa ttaaaaatcc     13380
     gtatttgtat gaactcaccc ttgtaattac ctgtggagat tttctccgat agctatctcc     13440
     agattaacga ccattgcatt tagtggtaat tttatgttcc tccaaagatt atatcattcc     13500
     aatgaagctt caaaacgtag gcgacgtaat tgacagaatg aatttctgtc tatcataata     13560
     actaccgcac caggtgtgaa cttggggcaa tgggaccaaa cagttatgaa aatgaatcag     13620
     catttacaaa atagaaatgc caacgacgga ggtagacgtg atagtttttt cgatggcaac     13680
     caatgctttc acttttttga gagagttaga agcttttgtt tccaataagg atgtggttgg     13740
     accaagaagt tactcgagcc tcttttctct agccagtggt tactttacca tgacctagac     13800
     tgtattgctg cggatgcgct cagagcgtgc gaaactcctt cttattagat cgatgtggcc     13860
     ttgtaacgtt aagaatttac cggctaacga ctacctctcg attctaaatc aataaactct     13920
     gctttggtcg tgggtattca aaaacattga tttcgagaag ttctaagtga aaaatagaat     13980
     cattgttcag aaggaggatt ttcgactgtc acaccacaga agcccagaag agattagctc     14040
     ttaatgtgct ttttatctct tatgaccaac atactaatgg ggggtagcga atgaattaaa     14100
     aatggcgcaa gaaatcaccg atataatgaa ggtcagcatc ataatcataa aggaccctag     14160
     ctctgtcatc accaagtaaa acaatgaggt gtcgaaaata ctatgaaact tctcgaaaat     14220
     accatctcta aattcatctt tttctgccgt atgtgataat tcaccaaagt tctcaacgct     14280
     cttgttataa ttcgcaagtg ctctctcagt tagcgccttg tttgatggat ttttccaaaa     14340
     attgctgcat atttctcctt cgtaataaca tcggatgtcg taggtctgac gctctattgg     14400
     ttttacgatt tctcgcacga aaaaacgcat acaatgctcc ccactgtaaa acacggaata     14460
     atgatatcct ccctcttcag aaaagtgatt aactctagat gcaattctct gccaagctaa     14520
     tggatccccc atcaggtctg tttcagccac ttccttcaat aacttttgga gcactttttt     14580
     ctcaatatca acgtttttcc tattgtcgat gaagttccaa aaagaaaacg taaagcatag     14640
     gaaataatga atgatcatcc ataagggaga aaatacgtct aaaagtttcg gttcgtatgg     14700
     atcatgataa aagtctcgca gaataaagta aggcaaccgt acaagcgatg gtgacaaaaa     14760
     tgcacctaca agagaagcga taatgtcata aaaccatgtt ttctcgaaaa agtatggggc     14820
     aaggaagtat gtcaactttc cgccagaact gtcctctggt aattctattt cctcctcttc     14880
     atacatctgt acacacttct ctaaatcctt ttcactgtcg tcacttatca tactcatatt     14940
     gtcttgctgg ttaaatacac cattgctgtt acgagtgtca gtttgtgtct gaattgccgc     15000
     cttttatata tttttcaccc cagactgttc ccgcccttga ttgtttcctc cccgcgggac     15060
     aattccatgc aggagaaact cgaaagcgtc aaaatgataa aattgacaca aagaggtgga     15120
     caggtagttt aaaggtcaat ttggaaactc tttaattaaa gctctggaaa cttactttgt     15180
     ggcataaatg tttcaactgt tataaattgt cagaagaaat caaaacatga tattaaccga     15240
     atgaagtagg acggccccag aaaattggca tgtccaacaa aaagcagagt aagagtaagg     15300
     ccagcgagag ccacaagcgt ggtggaagag agaacagtcc tcgtggacaa cacaactctc     15360
     cctcaccaca aagaaacaac agtatcactg atcagcaagg aagcgagaac ggcggtactg     15420
     gctctagaac atacgggatc aaattagccg ctcgcttgtt ccgcaatcca ttgttatcca     15480
     aaagaggggt taaacatgcg aaagagggac taaaaattag gagttcagat aaatcaataa     15540
     gcggagtaag atgtggaggc agcttctgtc tctttgttta cccgattttt ttgataggat     15600
     acagtatctt cggtttttta tacggggaca aaaataatag tatacatgtt ttcttgtatg     15660
     gcagtccact attcactgct gttccttata tcatacaata cctgaatgat gtcgatacat     15720
     tgcttttaag catatttgag attggggaga agaatttgct cgaatatttc gcagacccgg     15780
     gaatcagaga gctcctcttg attgtttttg agattgtggg attcatttat caattagtga     15840
     agggtagaca aaattttggg atatttatat gcgggattgt cggttttgtt tcttatctcc     15900
     tgggacatac tttgctaatc ttggaaagaa agaaaaggcc aggatcggta gcgggtgact     15960
     cggcgtgagt ttcaaatttg caccttgcca tagaatcttg cttttagaat aatgcaactg     16020
     gatgaaggaa ctgagcttac agtatcgccg gtttatcaac tgtgggtcat gttctggtgt     16080
     aaacgctagt cagttgtcga taaatagatt atatgtataa ccatagagtt gaataaatct     16140
     atgagtcacc aagttcagca acaaacacaa tcttcaagaa gcaatgtcgt ctccttataa     16200
     acataacgtt tgtgtaaaga ggcagaattg cttcacaaat acaggggcaa gaaactgttg     16260
     gagtttccca tgtcaggtgc gaacgacatt atgtgttcag tagcggttca attagcaatc     16320
     gaggttgtat agggccctta acgtggtgca aatagtagaa tatgatctgt ttctgattaa     16380
     gctaatggcc tgaggaggaa ttgcagaagt gcctaagagc atcttgatct tacggaatat     16440
     ttcacttttg catcaccttt ttgccaggaa tatctctttc ttatatattt ccactttcaa     16500
     gcgagaaggg cattagaaag gtgtatatgt ataggtaaca tgaacatcgt tcggcatact     16560
     atccattgtt gtcaggaatc tctttttctg catgcctcgc cttgtcgctc tgatgacgat     16620
     aaaaatccga tctcgtctct catagcaact caggaacgta ctcacaacat ggaacgacag     16680
     gggtatagaa aagaacaaac atggaatccg ataacgaatc tcaaaagcct gtcttaccca     16740
     aggacctctt caaaaatgca ttcacatgga tgttttatga aatctccaaa catcgcttcc     16800
     cgagcgtggt ttcatgtgta tacttggtaa ttgtattggt aggattttgg tggaattttg     16860
     ctgataaaaa tctgcctttg agtatcgtac ttgctgctgt tggcctcttt ggaattttat     16920
     ttggacttat ccctgcatgg ttccagaacg tgaaagagca tcccaataca aaaaagttag     16980
     ttcagcaagt gttggaatca aatcccggcg ttgataccag gaaatgggac gaaattgcga     17040
     atatactgaa ccttttcttt taccgagaaa acatctggag aacaccatac ttttttttta     17100
     atggtcaaca tgttcaacgt gtgttcaagt ataatgtttt aaagccatat ctcggagggc     17160
     aatttgaagg tgttgctgac gcggacaaaa tccaatcagc aaagtgttat atgcaatcaa     17220
     tcaaagtgta ttttgaactg tcattgaaag acagtatatc agaatttttt ttaaattccg     17280
     aactacccag agacacccac agaaataaat ttttctttca cccacgatat tttttcatgg     17340
     gattcatgat ttgtttcttt caaggtcaaa ttttgttact ggttgtacaa ctatttgtac     17400
     agagatcgtt ttggatcctg cctacaatca taaattacca gtattgctta ttgaaatgtt     17460
     accaatatgg ctatcgtttc tggtatccag aaatggatgt aatgcaagca atcaaattct     17520
     tggcgataat aacaaaattt agtcctagaa aagaactgga taaatgggac caaatagcca     17580
     ggtatatgaa tcaatatttg atggagggaa atagcagtca ttctaggaat atatttttcg     17640
     acggtaagca ttgtttagac tgttacaagg cttgctttga gtcgctttcc ttaggaaata     17700
     attctttatc ctatgacgag ctgaaagaaa ttgttgagat tacgcaacca agcttaaacg     17760
     aagagaccga ttaatgaagc agtgtattcc ttcttcgcaa actgaacgta gcagtatata     17820
     atgatttaaa atatgatagt atcacaagtg ctgtgctgat ggtccctcaa agtactaaac     17880
     ttctccgggt ggtattttca actcagattg cacccttttt cttggctaaa gataatctct     17940
     aaagccaaca gttgggaata tagaattaac atttagaatt gagaattgag aattccatgt     18000
     ttacttaaga aattcttgtg tgtgcagaag tgtctcgtta actacctgaa gagagcttac     18060
     ttgatagcca gccccagttt gatgtccatt taccctcatt aacgaccaaa caacacatta     18120
     agaatcgaaa agctgacgat aaaaacttct tagaagcact aaatactact ttggatgtct     18180
     ttaggctaaa atgaacatct taaaatgtat gcaatcttga aataccctgg aaagatgttg     18240
     tatctttctg tattatcgag ataattgtta ttcttgtaat ttgtatgtta ctcattctcc     18300
     ttcgctatta gttttgtatc agaaaggatg ctgtacattc cgatacaaaa gaaacgctta     18360
     ctcaaaattg ttcagtagtg gatcactgac ttgatacaac aatggcgtga agttgcattc     18420
     aaacttaata ataaatttca tgatcacatt ggtgatattc agataagata agataagata     18480
     agataagata agataagata agatgagatg ggatgagaag taaatcttcg tcggtaatga     18540
     gtttaacttc aaggttcgag gttgaaaatc accatggcaa cccggttgtc gatgtgtact     18600
     tcattgtact aaagccacgc ccaaaattga gaaagatagt ctggaagatc cctgttctcc     18660
     tttttctgcc agcagatgtt ttcagatccc ggttcatatg gaagatctat gaaaccatca     18720
     agatttatcc ctgggtggca tcgcaatttg tcctttaatg tcgtttttat atctgatgaa     18780
     agaaaatgta aaaatctccg aatcattcat cagtgtattt cttatttgcc agttcataag     18840
     catggtttat actctactcc ttctttggta cacacatata aattattcca tacctttccc     18900
     aaataccgaa cttcttggtg acgttgttct agcagtcaat caaggcgccg atgctaggaa     18960
     atgggatatt gtgacgtcca aagtgaataa ttctctttat gatcatggtt atcaagggac     19020
     atcgtattac tttctcaata ggtcacattg ttggtctgtt tctcatcatt atattttaag     19080
     attcgattct gaggctgctg aacggtacag acaggcccgt gaacaagctt ttcaacgacc     19140
     ttttaggaga taactcttct gattaaggtt ctcaatttgg aagagagctt aatgttaagc     19200
     ttgtttccga taggggcctc gctattccga catttggtat gaccatttat tatgctgttc     19260
     ttgcctgtat tcatttatga cgatcaaata aacccaaata tcttgagaat atttacagcg     19320
     taattatttt tgttctaatt tttcattcct ttgtttccgt atacaaagaa cgtggtatgg     19380
     ttaagtctaa taccctagga gttttgggta gaataaagtt tctagcaact ataatgcagc     19440
     tggttccggg aaatgatttg ggaaaatggg ataacatcgc taggcacatg aattatcatt     19500
     cacatgtaaa aggagtttga cggggaccag atgaaaactt tctcgacggg aaggaatgtt     19560
     cagacttgta tagcttgcaa tttgaaccgc tagcctctgc atctacaaaa ttgttttaca     19620
     tagagctcag agatattgtt taggaagcca ataaagcctg tggatcccca gcggtcggct     19680
     tagtataact tggtttgcat ttgatttata gctgttccat accagcttga gcgacacaca     19740
     atgttcttat aataatacat caagagattt cgaattaaca ttagtaattg tatccgagtg     19800
     gaaagatcat gtaatgagaa caatttattt ccctcgttga tgagtaaata agctattgta     19860
     cctcatctga acggttggaa tcgttcgagt ttcctattga ctgtgttcaa cgtagcgttt     19920
     ctctaacacc ggaattttat cattatgatt tgcatggtac aacggaaggt ttctaatgag     19980
     atccttatgc ttggtgcgac acctttgtag gtaacttgtt ggggtcacgg tttcggtaaa     20040
     ctccacgact caagtccttg ctctccaatc tggcaaatcc tattcccgta actacttcgt     20100
     cggctccttc cactaacgcc ttaaactcaa aagagcatgg tttcaaaaag catcgaagtt     20160
     caagtttctt tataaagctt accaacctct tgaaattatc ccttcggcgc ccaaatttca     20220
     catttccttc caaaacataa atcttagcat aaatcttcag gttagatgct cacaaaaagt     20280
     gagcggtacg agaatcgaac ccgtgtctcc accttggaag ggtggaatga taaccactac     20340
     actaaccgcc caacaaataa accttccatg atgagttcaa ttgatacatt ttcactagga     20400
     tacaattaac acattttaat gacccaaggt tcgattactt gcaagaacaa tttaaattgt     20460
     taggtaggac cacttatatc tgactattaa tcttcttgga atcttattct ccttctatga     20520
     acaatacctt agatctaaca tctttttata tatttttatc atcgtcaaag gaatcacttc     20580
     cattgtctgg cttcttggat ataatcctta ggtatgttat gacttgatat ttttatagta     20640
     tttagctatt ggttggcttt tggatagcat gttggataat tcttgatcac atgtcatgtg     20700
     agttcatgac acacttggag acagtaactc ttggtccata ttagttcctt ttgcataaga     20760
     cagctccgta ggaagttcga acttagccat tgtggttctg aaaaagatta caccggatac     20820
     atcataagtg gatagtctgt attagcgcat gtattccaag ccctcgtgta ttcaaaatgc     20880
     tccaattctc aagagaacga gacctaagag ttaggataaa caaaggccgg tggcccgtat     20940
     caaagatgac tatcggtagt cataaaaaag cggttaattt aacaagcaat atatgaactg     21000
     caatgaatcc tcacagcaca gattcatcca aaaaatcaca ttgataagct gacatgaaca     21060
     acaagaacac cgtaacgaag ggacaaagct catgcaattt cagtcaaaac ttttgcaaga     21120
     agttccggat accatttagc ggcgacatca cgatgcgatt tgatcctgtt acgaaatact     21180
     gcatagccag ccggatgctg agaaaaatct ggtcgatatt gaaaacctgt gtctattccc     21240
     cagcgatcta tggttttatc tctttcctct tttaatttcc aaacatcatg cgaaatgttt     21300
     gagacggcgc tttctttaga ctccaaatcc acagtccgga aaaaaggaat agataacctc     21360
     gttcccgacc ctttcctagg tctcaaaacc tgatgtatag tagctttaca cacaccacaa     21420
     gtaatggctt ctaatgtctg ccccacattg acgactaggc ttcctggaat attgtctaca     21480
     gatatccact ctcccttgaa attttgaact tgtaaagtat ccttatgatc agaggcctgg     21540
     tacacaaaag ttaagaagtc ggagtcctta tgaggtccga ctccttgtac tgcttcaaca     21600
     tcattcctat agtgagtatc agctggataa gcaacgatct tcattttgca ttgttgattt     21660
     tctttaaaat atgtatccag agcatttggg gaaagaccaa ttgattcagc tacaagtttg     21720
     gtgaaaatgc tggacagtct gctcattttg tcaatgtaac tagtcattgt gagtttaaaa     21780
     tagggcaaga ccctctcatc aggccataaa tttggacctt ccagctgttt gtacaggggt     21840
     ccgtccttag taggtgcagg gagctccgtt gcaaggtcta tttgctctct ccaatcgatt     21900
     ttacctgatg ttatttcatt gcccaatttt gtgtatccta aaaagtgagg tgagttgatc     21960
     atttcgactt tcttcttttc ttcctctgga agttcgaaaa actctattcc ctgctgtgtg     22020
     atgttttgaa agtcttgtgt tgttggacca taattaccaa agttggtcaa acgtaaaaat     22080
     cccacagtta taagggcatg gcgaagattt tctaggaact ttggcttagt ctcgttgtca     22140
     aacgcctgcc ccaaatcaat cacaggaatt gaaccgaatg acatattcat ataacgctgg     22200
     tactctgagt gaagaagaaa aaaaatggcg gcaccgcatg aggatggcca gcgtagaaga     22260
     accggtttta tatatgctca gatcaaaggg gtccccacct tttttttgta ttgtggcttc     22320
     ctatacgatc acttgacaaa aagacattga ctggtcaaag acattcaaag aaatagcggt     22380
     tgcaatggac aagcaagaaa actctggaaa atattttgca actggcttat atgctgaagc     22440
     ataacataaa gccgccgttc acctcgcttc gttatttgat ttccttgcgc gaggttgacc     22500
     tatcgatcct catcaccttg tccttctcac atattcactg tcgttccctt cgctggttcc     22560
     ttctacaccg ccagtaatcc tgatggatgg ctttatgcag atcacctgct tataatttca     22620
     cttcatcttt gttgacactt ttgcaatgat aacaaaggag aaaataagac aaatacatcg     22680
     gagcaagggt agttccgatg tttttaaggc ctacttttgt aattttggtg ttaacgatgg     22740
     aaaaagtaca atttgataca ttgggagtgt cttgaaggcc tgaccgtcca ccttttaggg     22800
     tatattttgt tagtttgccg ctgtggaatt tttcttcgaa tatcgccata atgctggata     22860
     ctttttcatc cgcgacacac acataattct ttcctaaggg tatagattat tcaactttat     22920
     ctcttggaag gcgaattttc tcatgcaatt tttggtggtc gtccttttag cgctagccag     22980
     caagcaaagg ctctgaagcg gcataacctt ataggttaaa acttacgttc aatctagaag     23040
     tagtggacaa gagccagagt tctttccaag gcatctcatg gatccatttt acagcttcta     23100
     tgggtgctaa aaaacaaaag aaacaaaaac agcacagaac taccggatct cttccaatcc     23160
     ccccgcttac tctgaacaat ttggtagtta tctaagggtt ctttttaact gatggttata     23220
     tgatttactg aaaaatttgt cctcctgtaa aagcaacagc gtctcgaagg gctctttatt     23280
     tttattagtt tgccagtctt cattttcaga atttcttgta tcggcttcca gcacaatgac     23340
     atcctcacaa aagaggttgt tcgaattcac cgctctcaag ttactcaagg gtacgcgaat     23400
     ataaagggaa ctttggattc ggtagtatca agcccactat gacattactg gtactacttc     23460
     aaactttggt gagtgaacta cggatcaaat gtgcctaagg caaaacgcca atattggaac     23520
     attctattgt gtcgtcgatt acaatagtaa attcgaaact gtccacgaat cttctcagtt     23580
     ccattaaatc ggcttagaac tgtgtcatac attacataac acttattgga atgtgtatcg     23640
     gaaaagcagc aataccctca tgccgcataa aaccatgcat tagggtgctt tgtgttcttt     23700
     catcgactgt tggtggctac agcggtaata ttaactgaat gattcgctga ccaacaattc     23760
     cgctctcaat attactacta ctgctcgttt acctgaggat acgtgttcgg gtgccatccg     23820
     tcgaatcact tgcgtcataa aaacgtgtgt acttgaaccg attaatctcg gcgagcgggc     23880
     gttattagcc actgtactat aacggaatag cttaagtcag caggggagca tctacttgaa     23940
     atagcagaat tgcatcacaa aagttgttac cattctcttg gtatttaaag accacaagta     24000
     ttttaaatca atgtgtctag cacatcctac aatgataacg ggatcccaaa aatgtagtgg     24060
     aaacaccaaa caacggataa taaggccact gaagaacaca tagcattgaa aggagaagaa     24120
     ggcctgtaac cgctatctgg ttcaaagaag ttctccgacc tctcccatcg agaagagtac     24180
     ttcgagtaat caatttaggt atctgctttt actacgaaaa gagaaacgta aatctctcca     24240
     ccgatcatca gagcttatga tattattaag gtttgttgcg tctcaacaaa atcgagacaa     24300
     gatttaacat cttccaaatt atttgacagg tacctgcgaa aaatgccaat agaaatgaac     24360
     tgtccccaaa ttaccacgat cttgaagtcc gtaaatccat catgcattga atggcaagat     24420
     gtatctactc cgaacaatgc cgctcgaagt attttttttt aggatcgtta caaatacgga     24480
     atatcaaata cacttttctt cgaggaaagc gagaataaat ttcaccgcag gaactaacga     24540
     aatagcatga agggcaaatg atacgggccg tgaaatgcgg caaagatata attggtgccg     24600
     cgaattgcaa gcgagcagat acgactctac tatctggtct ctaaactagc gtcggaacat     24660
     atcagattta ccacgaggaa tcaatttcct gaaaagagaa gacaattcaa aaaaaaaaaa     24720
     ttttgatcga aaataaaggt gaatacatat aacgaacctt tgtcagtata attggcctct     24780
     tgattccaat ttctttttgc ctctaccctg cttatttcca agcggtagcc ctcaacaagt     24840
     gttggttttt ttttgttttt cagcacctgt atgctctgaa gtctaaaata ctgattggct     24900
     ggttgcacat gcaaaatact taaattgcat actagaatgc aaaaagcatg agagcaggtt     24960
     tacttgtaat tgatgatgga tgtgaagaac agtgagagct tgcgttaatt cgtcactgca     25020
     ccatcttttt ttctaaatga agcactattg actttacaga ttcacatgct gttcattcgc     25080
     acggtatatt ggttctatgt gccagtaatc acgtagcact gtatataccg gagcgctgta     25140
     cacaatggtg ttacattgaa gatgcaaatc atcatcccta tgctaactaa ctgggtctgc     25200
     ttgcatcttt aggagtgaga ctttcagcac tagtttgatg tgatgtctca gatcccacat     25260
     ttttttatac ggcatgtgat attgaatgat gcacatgtag tagatacaca gttgaggatc     25320
     attgtggtat ttacaaactg attagagtga aacattgcac tgaagaaaga cattatcaat     25380
     gagcctttgg ttgtaagccc gatgagagtc tacaactagc ttagtagcgc ctttcgccat     25440
     catttaactc tacgccctgt tgagaggagg cattgtgtct ttttgttgat tatcaaattt     25500
     tgacagaatt ctgctgatat tatcaaaagg aacccggctt aagagcggca tgtaaagatt     25560
     gctaccgaag ccctatactg cgaagtcgtc gaaggaaaaa aaagtatttt tgggaatgaa     25620
     attaacaggc ataatataaa gatgaacaat ggtctaacca ctttgaattt agatggaagg     25680
     tattaaaaga cactttgaca agtggaaaat taccaataga ttcggctata ccgcgatgtg     25740
     gaaaaattct gatttagagt ctgaagcaga ccttgtgtcg ctgagtaaaa gagaaggtga     25800
     taaagagaat tttgaagcca aggatctgga tgaggtgagt agtacgttag atgatgacgg     25860
     aaaagcgtat ggagaacagt atagaacatg ttcgtggtta cacacgacgg ggctaatcct     25920
     atctgagtat attgtgttgg ccattatgtc atttccgtgg tcatattcgg ttcttggatt     25980
     gtttccaggg ttgctcctga ctgtattcgt tgcactgacg acgttgtaca caggtctgat     26040
     aatagcagaa ttttgtgaaa aattccccca tctgagaaat atctgtgata ttggacaagt     26100
     cctgtttggg ggttatagat gggcctggta tgctacggca atctgttttt tgctgaataa     26160
     tgctttgatc cagggtttgc atgtcttggt tggtgccaag tatttgaata caattacgaa     26220
     tcattcggtt tgcacggtgg ggtttgctgg tataacagct atcatatcgt tggttttttc     26280
     cttaccgaga aagtttatct ccatgtcatt ccttggatat tttgccacta taacaatgtt     26340
     tgtttcagtc atacttgcga tggtattcgc tggtgtacag tctcatccat atggatacga     26400
     tggtactccc gttgtgtata aggcattccc tgtaaaagga actacttatg ttagtggtat     26460
     gggagctttt ctgaatatta tctacacttt tgtgggtcaa gttacatatc cccagttcat     26520
     tgctgagatg aaaaatccaa aggatttcaa gaaagtactg tgggtcgttt gtatttccca     26580
     gatagtgcta tatgggttgg ttggttccat cgtttacgta tatgttggtg aaaaatacat     26640
     gtcagctcca gcatatgggt cattaataag agcatttaag atcatatcat tttcgttctg     26700
     tgtcccgacc atcgtgtacg ctggggcctt atatgccaac gtttctgcca aatttctttt     26760
     ttttacattc tttgaaaata agccagggta cgtttattcg tattcgctaa aaagttggtt     26820
     ggtatggttt gttatattag tggttttatg ggctgtagcc tttgtgattg ctgaggttat     26880
     tccatttttt tcggatttat tatctcttat gtcttctcta ttcgactgtt ggtttggttt     26940
     cgtcttttgg ggacttgctt acattaggtt gagaaaacac gagtatggtg aagctttttc     27000
     tttcaggaac ttaactttca agcagaagat caatttcatt ttgtcgtact gtttgatagg     27060
     tatagggttg tatattttgg gacccggatt atacgcatct gtgcagagta tcatcaatag     27120
     ctataaggcg gatctttatg gtactgtttt tagttgcgct tctaatggga tttagtgtat     27180
     atatattagt agatagatag aagcaacttg gttgcgttcg ttttagtgac aaaatactgt     27240
     tattgctttt taatctataa gtataggttg tcttttttga gcctccgagg ttctgaagac     27300
     atgctgaatc gagctttaga atttatcaac aataaaatga ataagatagt ttttacagaa     27360
     cctctcagcg ttcttttcgt ttacatctga ttgatagcac ttactaaggc atcttccatc     27420
     agctaactat gccagatgac atagttttta cggttgaaga tgcactgaat aaaatcacga     27480
     aatcgcaata attggaatgt tggaggtaga tatattggtt cttgagtctt ggctagctgt     27540
     tgctagcgct ctttgaagct tggaatatgc tatccatatt gaaaaaggag aatactttga     27600
     taaaaaaagt gtggcagcct ttatactagt agctcggtct tctataagct tgaatactgc     27660
     cgtgacatta acagctcatg gttcagaacg catagaagat ccttatagac agatcatata     27720
     acattgaaca gagctaaaca taacagtcgt tcgttagcgc ggctcagaat atttttgaaa     27780
     aggccgaact cataacaatg taacatcaac gagcaaagaa cagctttcga tccctttgga     27840
     aaatactacc taagtctggt ttctgaaata ttaatggatt caataaccac tgttccggag     27900
     tttcttatgg attgctttga ggaaaactat taaaaagtca gaactatact tccattttca     27960
     ctttgggttc ctgaaatttt gaagatcatg ctaaagatgg atcaatggtt cctcctaagt     28020
     aacagctaga gcattagttt tgcaatgttc tttctttgaa ccagaaattg aaatacctat     28080
     tggttcttaa ggatctaaac tgcttaaagt ggaccagcgt attcaatgat aagataagat     28140
     aaatgataga aaattttcct atcagttgat gtagctattc gtaaaaaaac atctccatgt     28200
     ttttcaagaa actatgacaa caacaggcat ctatcgttct tctaaacaca aacctaagtt     28260
     aaacgtggaa atgcccactg gacatggaga aggagatccc attttaccgg tgtactcttt     28320
     cagaaactct tttacctgga cacttcatga ggcatctaga aacagtccgt taatatttgc     28380
     attacctttt cttttaggaa ttgctctggc atcttttgga agaaaagaag cgatttgtct     28440
     tattgttatc ggtcttctga tcattatttt agcagattgg cccccattgc ataagaatta     28500
     tgttctatcc caaaacaaag aattgttcag caccatcgtc ttagcggtgg accccggtgt     28560
     agaggctaca aaatggagag aagcggcatc aaaaatgaac actgctcttt atgaacaagg     28620
     tttctggaaa acactgaatt tctttttcaa cgaaaaagag tgccgagacg gatttagaga     28680
     gcatgtcctg aaacttttac cttcttctga agcctcgaag cgctatcaac aagctatttc     28740
     caaacttttt atgagtttct tggaggatgt gccttcagaa tttgatattt taccaaggta     28800
     taggttctat gaatacttct cgaataaatg ctttatgttt ggggtattga tgctggcgat     28860
     ttcttccgca attggtatcc cagacgaagc caaaagaacg atgtattcta tttatgcata     28920
     cggcacagtc aagtatcttt atggtgcaat ccaaggtaaa cagttttcat tcctcgacgt     28980
     tgttccaaga gtaaaatttt tggcgactat aatgcatttt gctcctggta gtgatatcag     29040
     caagtgcgat gaaatcgctg gacacatgaa ctattactta agtagcaaaa aagactggga     29100
     tattccgcga gggtgcttta atgagggaaa agattgcttg aatttttaca aaactgcgtt     29160
     cgaaccttta atcaatagaa acaagcgtgg tggctacctt gaacttgagg atatcgttct     29220
     cgaaaccaat aaattatgtg gaaaaaatac aacaaaaatt atagaataaa taaaattgca     29280
     aacgcagaac ttagaccttc ttatttcctg tcgggatagc attcctttgt gaatttcgcc     29340
     atatctccac ctttatctcc cccaacctca ttttcgagat ttgatataac accatctacg     29400
     ttgatctggc tactgtcctg atcaaacttg aatttagatt ccatgtgggt aatgtcgatt     29460
     tccaacccaa ttataccttt tagctttcca tccagaaatg attccggtgc atccgacact     29520
     ttccatttgg ccttgaattc ctcaccttca ggacgctttc cctcttcctg gttcgtcaga     29580
     aggttcaaca tctttagaag ccattcttta tctccgcgta ttatttttgg tgtcccatag     29640
     acatggactg ctgcaaaatc ccatgtggga acgaatttgt gcgttttctc tttgagagga     29700
     taccaggatg gtgaaatgta ggaatctaca ctttggaagg tcactaagca cttggaagtg     29760
     ttctctagct ggtttgcatg ctgattcttc gccgaaagat gagcaattag cttgtgcttc     29820
     ccctcgggag attctacaaa gaaaaaggga atgtgactag cacacatatc ggaatcaggc     29880
     tgctcagatt catcaccttt tccgaaaccg aacaatccct tcgacacagg tctcgaagag     29940
     aatagagtac ccagcggata gtccttaatt atttggacct gtttctcaat gtcgtcgacg     30000
     ttatattgct taggaatgta catgtcgata tatacttatt atttcatttg aagggctatt     30060
     gaaactggtg ttggatatcc gtgcccttat ataagtgaag ctggttgttg taatacgata     30120
     tagccggtag gcacaacaat gcagtcacta tacaaccgac aatttaggaa gggctatccg     30180
     aggtatgtat cttgagggaa aaaagacgtc tgatagatta ggcacaatat ctgattggat     30240
     ttacattgtt acccgtccag ctgggtattt tcttcttgaa tcaaccatct gtttcagttt     30300
     gtcgcaatcg cttatcaaaa agaactctat ttcgggtaga ctaagcggga atcgaagcgg     30360
     gaatcgaaca acgccccaaa cgccttctca gagtttcttc cttcaatttc acacataagg     30420
     tggaaatgca tctccaccta atacaaatcc taagggcgaa gaagttaaac tacaaggtct     30480
     ctaccattga taaggatcat ataattggtt atccattgga tgattcaggt cttaccgtgc     30540
     aatttataaa taggttcggt tctgcaaatt ggttttaaac tgtgaaatat tccttccctg     30600
     cactaaatgc agcaaaattg tatacaaatg aatgattcac tagagttgta caagaattat     30660
     cctcaaaaaa atttgcaaga aaactgcaaa aatctgctgg gttatggacc aaactttgtt     30720
     ccagcagtta ttacacgagc caaaggatct ttcatctatg cgggtgatga aaaaatcctg     30780
     gattttactt ccggtcagat gtctacatta ctaggacatg gtcagcctga agttagtgag     30840
     acaattgctc gacatgctta tcaattggac cacttgtaca gcggcatgct gtctcctccg     30900
     gtcttagagt tggcagaaaa actcacggga ctactgcctg gagggttaga aagggccatg     30960
     ttcttgagca ctggatctga ggcaaatgag gctgctatca aattggccaa gacatatacc     31020
     ggtaagtttg agattgtggg attatcgttg tcttggcatg ggatgacagg tgcatcgaat     31080
     gctaccactt accaggatgg tcgcaaaaat cagggtccga tgattccagg aaatttggtt     31140
     ttacctgccc ctaatacgta tagatctatt ttccgcaaac cagatggatc ctacgattgg     31200
     gaaacagaga tggactatgg attcggtttg atcgatgccg cttctgtggg gtctttagcc     31260
     gcggttattg ttgagcccgt tttgagttct ggtggtatgc ttgtgcttcc cgatggttat     31320
     ttgaaaagat tgaaaatgca ttgtgagagg aggggaatgc ttttgattgt ggatgaagcg     31380
     caaacggcgt ttgggagatg cggtgcattg tttggatttg aagcgcatgg tgtagttccc     31440
     gacatcttgt ccctgagtaa aactctgggg aatggtatac cgttatcggc agttgttact     31500
     tcgaacaaga tagcagacaa aactgcttct gaacactttt tgttctatac tacacatgtg     31560
     aacgatcctt taccatgtgc agttggatct aaagtgattg atattgttat ccgtgacaat     31620
     ttagttcaaa actctacaaa tatgggggat cttttcagat ctgaaatagc acttctacaa     31680
     aagaaatacg atcaaattgg agacattaga ggtcgtgggt tgatgactgg agttgaaatt     31740
     attgatccaa aaactaagga ggctgatgta aagttagcag gtcaattggc tgacaaaatg     31800
     atggagttag gactttctgc aaatttgata cgtgttcctg catttggtgg tgtctttaga     31860
     atagctccac cgattaccat ttcacgggag gagattatgc taggagcttc aatctttgct     31920
     caaagtttca aagaagtcct aggatgaaca gtaattagca acataatctt ttcgtcttga     31980
     tcttatttat gctatattgt tgcgccgtac atgatctacg taaagcttgg agttttcggg     32040
     gttttgaagc cgattactca aatcaaaagt gtgtaaggac gtaaggtgag cattgagcta     32100
     ctttaaagct cgctacatct gatacaatga atgaatttga atacttagtg ggttctttat     32160
     taattgtttg gcattcagtt tcaaagaatt tctctccttt acgattatgc accgcgattt     32220
     caaattagcg aaaaagacaa aaagaaatgc gtcacggaca ggattcgaac ctgcgaaggc     32280
     atagcccaat gcctaattgc tatcttgatt aatagcaggg catcgcctta accactcggc     32340
     caccgggacg tcttcttagc agatagaggt ctaagttttc tgttttgtac gcccattcgg     32400
     tacacgtgca tttgacacca aaaactatct tagccatggg gtaagggacg ttcaaatatg     32460
     acgatcatct taaattataa acagcatgta tgtgaggaag aaatctaaaa taaaaataag     32520
     aaaaatttac agttaagaat aattgaataa atattttaaa aggatgaaga tcaagtcttc     32580
     atcatcagtc tctctttatc tttttttttt ccaaaataaa taaatatctt catgatttac     32640
     tacattctct atttttcttt agttgttatc agattctctc actttctaat gaatcagtct     32700
     ctgataaaat tcttatgatt tttttgttct ttttcttttt ttgtttcctc tcttgtaatt     32760
     cgaatatatt ttataagaca aagcatgcca ttcgttggat tagattcatc aaaaaacgca     32820
     gtcacctgtg gtgatggttg gttggactgg atggattttc acaaattaaa gtgctactta     32880
     caattcatca gcgtatggca atttggaaac atcaccaaca gcaacgtagt taaagtcacc     32940
     taacttgaag ttcttgatgg agtcaaagtt tagtggagtt ggagaaacaa cggtatcagc     33000
     ttcaatagcg tattgcaaag aaacgtaatc cttagcagaa gatagattca caccttgttt     33060
     caattgggaa acgacgttct tgatgtttgc ggaaacagtg tcggcatcgg cacctttaac     33120
     ggacaatacg aataggccag tagtgctttg tttatccaat ttagccttga aaatagatgg     33180
     agccaattgg gatagaggag aagtcaagta gcgggccaaa gcttcgtatt gagcgaaatc     33240
     ttgtttagac actggaatag caatggcagc agcagattga ccagcatgtc tagctctgtt     33300
     ttccttgtta atagatgtct ttggagtggc agtggagacc aaggaagtac cagaaggtaa     33360
     agagttcaac agagaatctg cgacgaattt tttcaaatcg ctttcgttaa caccttcacc     33420
     aacaatgtcg atattttcct tggtgtaaac ctttgatgca aattctttga tatcatctag     33480
     ggtaaccttt tccacaccat cgtaatggac tggattacct agaccgcgtc tgtaagtaat     33540
     gttgtaaagc aagtcttcag ctcttctgac ggggcagatg ttatgcagct ccaaatcgtg     33600
     cttagcggct ggcaaaacag attctggtaa ttcatatggt ctgaaagaag ttttgtaaag     33660
     gacgttaccc aatgcattca catagtaagg caaatcttct ttcaagaaag tagcagatag     33720
     agtaataaat tctctatcaa ccttggattc aaatccacca ccaagtaatt cggattctct     33780
     aaccaatctt agggctgatt taccactggt gttatggaaa ttgaaacgag acaatagatg     33840
     tgaaatacca tctttggtag cgtaacgaga accaccgtga actttaacgg caagcgatga     33900
     aactttgcca gcaccatcag tggcactaac ggtgtaacgt ctagcggctt gcttggcaaa     33960
     ttgtagtcta gtagcagagg aaagcatctt tttaaaacag cggcggtacg agggacctaa     34020
     agacttcgaa gggggagaca aaaggagaga agaaacaaat cgaactggta caattggatt     34080
     tcaaataatt caattcaatc tctcgtaacg gacccactaa atgaatttat tactatctaa     34140
     agatcaaaaa gtttatcgtt ggaacctttg tatatgatgc ttgttagatt cccgtctctg     34200
     agtttttcca attttgaaaa actttgcgtg cgcgctgagg tttcagggcg taaaagactg     34260
     cttgatgagg taaaaaaggg aggaataaga cgtatagggc aagttcccgt acgtttgagt     34320
     ccttataaat ctttcagact tgtagcacga atctcaatcc attaattccc ggctctttgg     34380
     gttcaaatgg cctactttaa ggttgaattg gcgctcaacc aatttttgac aacttatgat     34440
     tggttcgtct atcatgatct catatggcaa tcacgtggtc cgtgtatagc gatctatctg     34500
     tccaaaatca cgtgcttctg agcggttaca tactggataa ccaattcaat agtacaaata     34560
     cgaatacgaa tgttgataat atttctactc gttatgaatg tgatcttatt tgtgtgtata     34620
     taccgtcatg cacgtcaaaa caggggaaaa aatagtgaaa aagtgcctac cactatgttt     34680
     cttacataac agtcaaatcg ccaaatttct ccttgtaacc tggcacatcc catttaccct     34740
     tcttaaccat ttcttcaacc ttggcatcga tttctggtct aacctttgcc aaatcatcaa     34800
     cagtcaaatc atcaaatggt cttgcggatt cgatgttctt tagagtctct tgtagatcct     34860
     tcaattcctt ggcaacaagg gtttcggttt cctttgcgtt gttcaaagct tgggcttcaa     34920
     atgcttcaat ggtagatagt tgtttggaag cgtcaacggt aacaggtttg aaggccttga     34980
     cggattgttc gatttggtca acaactgctc tattcttcaa aacggaacgg tagtgggaga     35040
     aatcgacatc aactggttga gcttgcagtt cgaataaaac tcttcttgct tcgtcatttc     35100
     tctttttgaa gccggacaat tcggtggcag tcttaccagt taatttcaaa gtggaaataa     35160
     ctttagccca gtcaagctta ctagcagcag gtttggcgag agacattggt atctatggat     35220
     tcaattcaat tgattatacc ccctttgtaa taagagtttc ccttgctcgt atgtcgaagt     35280
     tgattgggat ttgggttggc cttacctacc tctcgttaat cgagggcatg aatttttttt     35340
     tttcttaatt tgtctcctgg ccaatgaact ttctaataaa aaatatacag tagggtaaca     35400
     catctagtgg tcatgtgccc aagagagggt aacacacttc tttgagatca catgattgat     35460
     aagctccgat cttgtccacg tgattgctac cagtttttcc gatgcgggaa agtttcaaca     35520
     atagaaggtg attaacgtat cgggggaatt gtcgtcagta gcgatagaga taattcgccc     35580
     gaatccttaa actccgatat ctccagatcg cattccattt gtccgtcaga ccatggtact     35640
     tccagacact atccggagct ggtttcccga ggattacccg tctctcagat aagttgtaag     35700
     gcatatccta ccatcaagat ttaagcatga gttatcagaa gtattggcat gatggttaaa     35760
     agaaaatgga ttaagattgt atttcaatct cttagcttat ttcgtttatg tgattatata     35820
     ttaaacgatc gccaagagtt aaaggctctg ttttccgttc tgctgtattt gtgtgttaac     35880
     aataagctgt cgttccagta atcctgttgt ttgaatggcc atagcacaac ctaacagcga     35940
     tgcaaagaga atatttagga gaggaaattg gtgaaaaata cgatactggt gatgaggata     36000
     cgccgagcag ttcgggtagt gcaggatacg taaggaaacc tcccagaagg tctactttag     36060
     cgtgtgttag atgccgtaga aaacatgtga agtgccccgg cggtgaccca tgctcgaagt     36120
     gttcggctgc cagaattgcc tgtgaatatt tggagcctaa taagaaatta acagtttcaa     36180
     tgaagtattt gcaacaactg caagaaaatt tggctgactt aaaaagggag aatgttaaat     36240
     tacaatcgat agtaaacacg gtgaattccg atgtaacaga gtccaaaatt aaggaaagag     36300
     ctacaactaa tggagatgag acagcaattg atgctagctc atataaggaa gtaccacttg     36360
     acgaaggcca tggtgcttat gatattgaaa aggagactac agacgatgtg gatccaccag     36420
     tttcgggtga tgaaatggaa ctcgtttcga attttgctca acgtagtggt agattggtag     36480
     aatcgcgaac gggccagcgg tatttcgttg ggtcatcttc catgacactt ttcggacttg     36540
     aaattcagtc tttgttatca aagtatttat cacataaagg tgggaatgaa gatgaaaata     36600
     ctttacctaa taatgaagat tataatgaaa atcctttatt acaggggcca cagtcgaatt     36660
     tggatcagat agacgttcta caagaagaag gtaatgctta taaaattgtt ttgaataaaa     36720
     acgaaggtaa tgatgatatt tctgttaatt tcaccctacc atcatactca tatgccatat     36780
     ttttagttga tacttttatc acttataatg atggttgctt ttatttcttc aacgaaggta     36840
     tggtaaagca tggattgaaa attgcctacg aaggtggtgc attctacaac gatcgtactt     36900
     tgcaaactat ttggttttgt aaagtgttat tgatctttgc cattggtgaa atgtacttgg     36960
     gaacttccaa taacgtaaat gggaataaga tcaaggatac tgctaaacta ccaggatcgg     37020
     gtttcttcga agaagcctct cagattttta gttgtctttt ttccagtggt cgtattgaaa     37080
     gtgtcactaa agaaggtggt attgaagtta tgcttctgta tgcgttttat ttacaagtgg     37140
     cagactgtac agtggcatcc tatttttatt ttggtcaagc cttgagagct tgtctcatat     37200
     cggggatgca tgtagatgca caaagagata atttaaccag attcgaattg gaacatcgaa     37260
     ggagactttg gtggactgtt tatatgtttg aaagaatgct aagtagtaaa gctggtctcc     37320
     ctcttagctt tacggataat actatttcta cagagttacc gggcgatttt gatatgagta     37380
     aaccgccccc cggttgtgaa cactacattt tccctgaagc tgaatacatt atcaactgtg     37440
     tgaaaatcgt tcgaatcaat gcccaaattt taaacaaatt ataccagcgt caaccaaata     37500
     ctaatattct tgcagcatta aagagtgtag tcaagcaact tttacaatgg agaaataatc     37560
     ttcccagttt tttgcaagtg gattttaccg aaaaacattt gaagatctca cgactctgtg     37620
     ctaatttatt cacagaatat tttcaaggta tgaatttggc catcagaccc cttctattcc     37680
     attttgcctc cgtacagttg aaaaaattta gaggtagtaa cacttacatc aacttacaaa     37740
     attactcaag tacaatttct gcgcttctca attgttcctt acaggcatca gtcaatacca     37800
     ttaggtcact ttgggcgctt atggaccaaa acatggttgc gctattcggg tatatggaca     37860
     gagaatattt gtttaccgcc tcttgtaccc ttgtgttgtt taatgcagct tttgggattc     37920
     atgaacaaac ttatgagcat ttggatcatg ctttaaatat tttcactaag atgagaaacc     37980
     tgggtaataa tcctgctggt ctaagaagga gtcagctact aacattgatg gctaactttg     38040
     acttccatgg aataatgaag gatatgattt gtgctcataa tgactcgttg aaaccagata     38100
     cacagtacga cgcccataat tttagaaatg ttaatatcgt ttctcaaact atgacagatt     38160
     ctgcatcgtt gtcagatatc atcaatgcaa ctttggccaa atcatcacaa ataaatttga     38220
     ccaagaaaga aacccaaatt atagaaaaaa atagcaatca atttgatccc ctgaacacag     38280
     ccgatgatgg tgaactgcaa gttctgcttg ataagatgac gaaagtaagt caaacggata     38340
     ataaactttg gaaagaaatt tcagatcaag ctatgtggtt aggtagtgct atggacccag     38400
     ctattgcccc agggaatgaa atggattttg gacaaggaaa aggttcaaat ttttaatttg     38460
     tataattaca tggttggaga ctatttattc tttaatatta tatgtattat tatgcaaact     38520
     gtttggtttt acggaagagt tgtgatttct tctctatcct cttgattcct aatttttaat     38580
     gcgcttggag atgttctctt gatcgtcctc tgcccagagc ctcaccctct tttgtgagtt     38640
     cataatttcc gtatggccca ataaaatttc actggtgttt acccgatgag tttccagtac     38700
     caatttgttt ctgattagtc tcttatcatt cttattcttg gcaattgaac tagcattcct     38760
     ctttaattgc tgttgtaaga ataagtcttg aagttccaaa gttgaggcag atgcaaatct     38820
     agtcaataag gtagaacctc cgtcttctaa tctttgtacc ttataaaaaa tgctgtcaat     38880
     catggtgtat aacctagcat ttaaataagg aagatttttt aaattggaca accattctaa     38940
     aatgcttctt tgtttcataa agtgaacgtc ctcatccgtc ttagtaccta aatctaggca     39000
     ttctagtacc cacgcaagct ggcggtaaaa attttcatag cccctgaact tttcattagg     39060
     tgttgtaaga tcctgcaaaa gagggaagtc attaggcatg ataaatggtg agttcaaaac     39120
     ccaacggaag gccgtctcat gaagtaaaga tcctgggttt acgagtagtc cagaaagacg     39180
     tgatatggca aaccaaatgc aagatgcaat cctaaatggt ttatcctcca actttgcctt     39240
     ttcgaaagaa aatacgattt tctttaatag gactgcgata atgtgcccat acttgaattg     39300
     actatcctct tccaaagaac tcaacattcc atatattatt ctcaaagaga ttttttggag     39360
     atcaccactc tcagctaatg ataatagtat gatctggaaa atatccgaca tcaaatacct     39420
     ttgaatctca aatttatacg ttgtggaacc atcttcagca gtggaggaag tgacaagacc     39480
     agcgccgctc tgtaaagaca ttagcatcaa aaactcagga tcataaatgg caccaactgt     39540
     attagacaaa tacactgtat tgtcgctgta aaaggagaaa agcgcttccc aattgaattg     39600
     gccaggtata ataggtctgt tcagtgggaa gttattaact gtgttaagaa tagtgttctt     39660
     atccagcgta ataaaagttc cttccctttc aagcgcaact atctttctgc taccatactc     39720
     acctgcagtt tcgttctcct cttccaaaag ttccagagaa caagattcgt ttatccagga     39780
     cgatgaagta atcgtttcaa tttctccaat tatctttaga atcattcggt cttcacaaga     39840
     catagttccg ccatataatt caataagttt tgactgaaca atgttggtac tgttctgctg     39900
     tggatccatc atgaataagg taaagattgt ggctgcagtt acgaagcgca agaagttatc     39960
     attgttttca accttcagcg catttttttc gttgtttaaa attccttgca gcattctagt     40020
     gcattgtaca tcttttcctt tgccgttcat tagaaggtga atcatatatt gtaacactct     40080
     cgaattattg acccaaaacc ctgttaatat aacttcatgc tgtgcctgta aataggtgtg     40140
     attcactttc gaccatatat tcactgaagc tgtcaatttt tccagttctg aaaggtataa     40200
     tgaaaagtct ggtgaaagtt cagttgcatt ggaaaagtat ttggtaccat ataaaattgt     40260
     tttgtttaac catgcaatca catttggatc atcgtaattg ttcactgatc taacgaattt     40320
     gattacttct gaactgtatt tctcatgata atttgtggta atatgtctca ccgccgataa     40380
     ttgttgattt tttgtcaaca tctcaggacg agagcagaat aatttgaggg caccagagga     40440
     aatttcctgg cgatccaatt tttcgcaaca atcatttatt acattttgta aaaattcttg     40500
     tagtcgagaa tcattacttt ctggtaagct gagagcggcg actagtgcca cttcagttcc     40560
     ttgaattctg ggcaagtaag acaaaagtag atcaaagtca aaccatttag agcgcgcgaa     40620
     tgtttcaaat gcaataggga atttttcaag ggactgtgca acgaaattct ctggttggaa     40680
     atcaattatt ttgtcttcag caataaattt ggccaacaat tgatctagat ttgaggaagg     40740
     cactttcata gcatactcga aaattttgaa agagactttt tggtttggaa tctcccacac     40800
     tttttgtaaa ataatgtcca aagattgcgg attgatttgt ttataatttt caagtatagt     40860
     tggagcatgt atcgtttgaa ggcaagtgca tatagctgaa gcgaacatca tggcattcgg     40920
     ttcatcactt tgtaaaatat ccatatggtc ttttaaccaa gcaaagataa actgttcgaa     40980
     agcagggtta ttcagattcg attcatgata taattgaaac agtgcttggg aagcgaaata     41040
     cgacttcata ttctcattat ccaaatagcc tgatactggt aataaattct ttattacttc     41100
     gggacttatt aaacggaatg aaacattcga atttgaaaaa tttgccagct tagctaataa     41160
     agtatctgtt acttctttga acattccatt gaaggtgata gccctgtcgc ggaccaagtt     41220
     ttgaagtctc caaattaacc ccacagcgtc tagttcattt acaggataac ggacaacttt     41280
     ggtcaattta ctatacggtg tgattgtgat atgttggaag aatgaagcgc cttgaaagtt     41340
     tgccaatttg aacgattcat ctgaacacag cttcttagtc ttggtttcat aattttcgaa     41400
     agtaagataa atatccaaat actccttagg cactccaaca aaactctcag ctagtcttct     41460
     aataccttcc gcagactcgc cacatattat aaaggttctc aataaaatgc agatccattt     41520
     agcggctgat tcgagagagc cttgaccatc aataaatttc cactggtcac aaagaaccac     41580
     taaaaatggt gaaatcttct cgtagtcctt tgacgagtcg acatagcgat atggcatttt     41640
     catgcaccga gatatggttt catctaataa tttccatatt ttattgactt cgtcattttt     41700
     atgatcctcg aaggataaga cttgcaaact gtagatcaaa atccagagag gagagcacag     41760
     cacttcgttg aatgctacgg taccatgaaa catatgctgc aatagttgag agattttgga     41820
     ggccacggca ttagtagaat tttttgaaga tgccatcttt aataatgaag tgaaaagaga     41880
     attttgtcca gctggggcat tccaccattt tgtttgggta ccatttagtt cttgaaattg     41940
     taagaaatta tctactatgg ccaaatcgat cccagaaaat tcatctttac gcataatatc     42000
     catgtaaata tttgaagatg gcatgttaat gctgaagaag ttagggaaag tcgtactgta     42060
     atatttcaac aataaagtga gtgataattg catgactttg ttgtttttgg ctgttagata     42120
     agattggttc atcacactgg taataattgt caagtctggt atgctttgat aaaatgaatt     42180
     ccttagaggt gctgatgcag aaccccaacc tttactttcg tataatttta agactttgga     42240
     taacttttgg aaagaaaata ccagtagctg acatgccaat tgcgtaataa tcattttctc     42300
     atgttgtaat gcttttgtta aggagatctt ggtcaagggt gcgggtaaga tcgcttgtat     42360
     cactaaatct aacgatggtg cagtttcact ctgaatattc gccatagatg taggaatctt     42420
     caaattaatg attctaccca acaacatcgt acaaccgaac caataagaag tcattttagg     42480
     atcatgagta ccatgagatg ccaaataatg acagtaaggt ggaactagtt ctgggacatg     42540
     atctaaaatt ttaagaacgg tagaagcctg catatcgctt tcccaaggtt tgaaattttt     42600
     caatgcatta aacaacaatt tgttatggat tctgaagtcc ttttgattaa ccgttaccgg     42660
     tacacccttt agagaagtat tgaaaggaga ttcttgatac catgggagat tatcagggaa     42720
     tgcaacacta ctttctggat ctgcaccata agctatgaaa aattcgttga ctttctttac     42780
     caatgacttg tttgaagagt agaaataaga ataaatcttg gaaagcgcca attcgttcaa     42840
     aatttgagtc ttggtcatct tcttaaaggc tttctcctgc acaaatttag tgcacaaaac     42900
     ttctacagtt tcttccatta attcagctgt atctgcctta tccatctgtt taaaccaggc     42960
     tcccataatc tttgaatttt gtataacgag atcccttctc agtagaggtg tacaatgaga     43020
     aattaatgat aaccaaaacc tgataaattc aaatctaata tgtagtctat gatttttatt     43080
     cgtggggtta aaactggaaa tatcgttttt gttgaccgta agaatcttgg gtaaactccg     43140
     taaggagaag tcgaagctgg aagtaaattc ttcaatatat tggcctgaat tgaaatcaat     43200
     catttctttc atcaaatgga ttgtcggtat cgtcaatgaa gcttttatat tgttcaaact     43260
     tctgtacaga accttcatgt agttgtctaa aattagtttg atcaagatac caccatattc     43320
     aagcgcattt gcattagatc tgagaaccac taatgtccgt gttaatagaa ttgtcgattc     43380
     tgttagtttt gcatggttat taacttgagc gtaataagac caactctgta cggcttgtga     43440
     gatgtaattc ttatggaaga attccagcaa tggaccaaaa tccttagaat catcctcatt     43500
     ttctaaacta tgcaccaaat tcgaaagatt aaccaacact tcatcatcca cattaccgct     43560
     ctgcttgtat ttattacgtc ctgccgattt ttcatggtca accagtggta tatcttgaga     43620
     cttcattata agttcagctc aaaagtagga ctaatcaaat gatgaaccaa agtctaaata     43680
     ggtactcgag ctaaacggaa gaatcttact ggcactctac tgtcatatgt atacacacta     43740
     ttgctcttct cccatctcat cgcgatgagc tttgaaaaat ttgggatcgt tgataatgat     43800
     ttttcaactg ggtatcgaaa tggtttatct cgactaccat tgtaacgttg aagataccaa     43860
     gagatattca actgaggacc attgatccta tcgtcactct cctcgaactt ggatccaaaa     43920
     tgtttgcaag gtttacaagg cccttacaaa aggttgctgc tgcaaggttt tattcgcaag     43980
     tatctgcgag tgccacgagt aagcaagcaa attccaagtt tgataaatca atcattaagc     44040
     ctatactagt agtaattgtg tttggtacga tgctatcgca tgttatgaat cagcaacgat     44100
     tggctgggga aatggaaaga aggtatgttc ttaagatgga aattctaaag gatttaatcg     44160
     agagagctag aaaaggtgaa atcaatatcg atgtacaaga agagctaaag ttagtgaata     44220
     aattatttga gcggaataaa gaagctagat ttttaaacga taaagaagca gaaaaattgt     44280
     cacaaatatc ttcttcgcaa aactattctg aagcggaagt tttacaaagc atgaataact     44340
     caacaagggc tctcgagaag gaatcgcttg acgacctctt gaaaagcatt atggatgaag     44400
     tatcagatga accaaaatct tcagctcgta aatctaatcc aaagcccaag cagcagcaat     44460
     ctggagaatt tatcactgac agggataccc tgagagaaaa ggcggaatat gaaagagaat     44520
     tgttacaata taaaccttct actgatgttc atttaattgt agagaatcca ggtgaattga     44580
     gttcagctgc aggggacact aaagttagca aatttttgta aaataaaata ataatggaaa     44640
     tgcaatgtat gagtaaaaaa ctaaaaaaaa ctaaaaaatc tctacttcac ctatgtcact     44700
     ctacggaatc tcttttcaat ccttattctc aagatctaga ttttttggtg atgattcatt     44760
     taaatcttca ttagaggcat tgtgcgtgtc ttccttacca tgaatggaag atggggaaac     44820
     gctagaacca cctcctgatg tagtggattt atcaagagcg tcagcatttg atgcaggggc     44880
     attatccttt gcttcattgt taccattcac gctttgggga gttataggct ttcctcttgg     44940
     attttgagtt aatgtggagg gatcgattaa attcctatca acaccgccaa ctgaagaagt     45000
     gttcatgata ggatcagggc ttggatgttc ggtgtctact gattcttcct tggaggttaa     45060
     ttgaccatct ttgggagaag aattcgattg atccattgaa gcctttatgc tatgttcact     45120
     ttcgttacca ctgccgtaag tgttagaacc accacttccg ttaacatcac cacttatatt     45180
     aacaggggaa ctctgtgcgg tgcttctgtt catggggaat cgaggtgaat cacccggtag     45240
     accacttaag ttttgtaaaa tttcggtagg tacactcctt aactggctta aatttggtga     45300
     tatttgttgt gaatccatgc ttgagggtcc cgtcatcatc ggagggactt tccactgctg     45360
     tgaagctgga tacatggggg attgtgacct cgtgggcaca aactctctag gtaactcatc     45420
     ggtcaacaat cctggaattt gagagagtaa tacgtggata cttttaagag catgacccga     45480
     tttgtcaaat gacttagatc ctactcttag gatccagatg taattgcgca gataatctct     45540
     tacaactact gcttcatctc tagtctgtgc tgtcacgtaa agcaaagctg caaaaatggc     45600
     tattagcatg agattgcccg tagaacatgt gtaccagaat gcattaatgt gttcactttt     45660
     caagtctctg acgaattcaa tagcagctac caatcttgtc ttggcggccg ttcgacagac     45720
     ttgaacgagt tcctttgggg tgtcttgctt taaagtagaa attatctttc gatgcaaagt     45780
     tatctccgca gcgaaatatg ctaaagttaa agtggcatta ggattaaatt tccgcggtac     45840
     gaatttgttc attgataatt gtggcggtaa ggagtggtac cactctctta attttaactg     45900
     taatggttta gctaatttga gcacttgttc gattctagtt gttatctttg tagcaccttc     45960
     agtgtaaaaa gtgtccataa tttcacccaa aattactgtt agggacacca actgttgaaa     46020
     cattagattt ccggaaacaa aatcttcatc agttggggac atatctatca aagatatgtt     46080
     acccatagaa ttctctggtc ccatactatt tctagacgtg gtatcttggg agccgctaat     46140
     gacgggagaa ttttgaggaa aatcctcttc tgtcaatagc ttaaccatcc aattcctgcc     46200
     caaaatcaag tgagaattac gagattcaac aagggcagtc catttttctt gtgtccatac     46260
     ggcccatgct aatcttcttc gcagtcctct ttcccacctg ggaagtctcc aatcttgaca     46320
     atcgatacct aatccgagtt cttcacataa agccacaagt gctgaacata gaacccagtt     46380
     atttggatat tcactacgac attgtaacat gagtaaccca gtttgtacta tacttaattt     46440
     gggtctttcg atcatttgaa aaaaggttcg atacgctatt tcatttaatt gttccaccac     46500
     atcgggctta gcgaatccaa ttagttttgg atgaaaatcc caccactgaa ttgataggga     46560
     atatattgat gccagtagtg gggctgttaa ctctctgtaa gatcttgagt acttttccaa     46620
     aaacaccctt tcatgtaaaa ttgggaaaca cggatgaatc aatttgaaaa aaatgtcaat     46680
     tagaacttta ccatgcggat aaaccaatcg ttctaccata tcaacttcct gttcttgctt     46740
     taagaaagct tgttcattaa aattatctct aagcacaaac aagacatctg gtgctacttt     46800
     ccttaaggaa accgaaggta ataattggat ttgatcgata ttgtccagct tgatatggtt     46860
     aatcaagttc aaatcgtatg aggatgttgg acccacgtac aatgaagatc tagggtattg     46920
     accactaggc tgtgatggga agggtggagg ttgttgctgt ggtggcagtg atacaggcgg     46980
     ttgctgctgt tgttgtcctt gttgtagcat attcacaaaa ccattattgt gcattgtagt     47040
     tggagttggt gccgaggaag cagcactggc gtgaatacta ctgctaccgt tgttgttatt     47100
     gttattatta ttattcatgg actcatgtaa attctgtaaa agttctgcat agtactgtgc     47160
     cacattatca ttattattta tcttcgccct cttcaaaagt ccttctaaat cgacgccatt     47220
     atcttgcctc tgatgcttgc cattaggatt catcgtgtct gcgactccca taaatttatt     47280
     cacattgtta ggaagatctg aaaacgtaca tttaatacct ttagtctcac attgaacaca     47340
     atctgctaaa tctggtacta atacacattt tgtctgtctt cgacggcaat gatcgcaggg     47400
     cctttctgta atcattgact tattattact attatgagca ttattggaag tagtagtgtt     47460
     gtggctgttg ttgttgccat tgttattgtt attagtacta gtattgttgt tactgtcaac     47520
     cttcccactt gtatcggcct cactgttttt tacactgttc ccgctgacat tattctcaac     47580
     tgtattgtta ctgcaattat tacgattgtt aatattattg ttattttccc caactgaagc     47640
     gcctgcactg gattctgggt actgcgaagc agaccttgtc aataggcttt ggtaatgctg     47700
     taaaagagca tctaaatttt gtctatcacc accattacca ctgttaccaa tatcagaggg     47760
     tcgtgtactg ggaaagttag cactattacc attgttgctg ttattactat tgtcattatt     47820
     attatcgcta gtactaggac ctacccccat cgaatttaga ttaagatctt gagttaaaag     47880
     gtgtgaatta tcattggcca atttttgcaa aatcattgca taattatcgt taaagctcaa     47940
     catctcatgg ttgccattgc ttttgtcata gaggttttga ttcttatcac cactcatatc     48000
     gtctgattcc ttttgccgat ctgtgcctga agacatccgt cagctctaat atcaacgcca     48060
     gaatttgaaa gttctcacta ctttttttct ctacctgact tcaacaccag ttctattgat     48120
     acacagaggt taaagactat actttatatt gttgttctat ccttcttaaa ctacctcacc     48180
     tataaaaagt atgtgaagat ttcttaagtt tcttttggtt cgaagattga ccctaagcca     48240
     tttgtactca tatacgaagc tgaaatttga catacttaaa cagtaatacc gatgagccat     48300
     atcgatctgt ttctaatata cgaattgatc caaatatgct tctgccacga atctagctct     48360
     tgcgttaaga aacaacttca tttcgctgat ttctttatcc acttcctcca taaattcgat     48420
     gataaaatct accaatttcc ccgttttcat agtttctgta tgtttatttg tgattaagaa     48480
     tgaaatgcta aatcctggca ttggcgaacg tcttaaaatg taaaaagatt ctgcacgttg     48540
     ttccaagaaa cgtgtgaatt tgtgtactaa aatctgttca atttcatctg cttgcttcac     48600
     cttaatacta acacggactg aatttacact tgattcgatt aagacttgtt cattttcgtt     48660
     acgagagatg tgaattggtt gcaatagaag ttctgcactt gtgttgggta cttccacttc     48720
     aggtctattg tgtctttcca cttcttgtga tgaaaagtta ctcaatgtta gagcagcttc     48780
     gagggaatag cgtacggcgg tcaaataagg acgtagtgat tgggacatga cagagtgata     48840
     gacaacgaga gaatacttca atggattgga ttctatggat ttaaatgtcg ataagagcta     48900
     cgatttcgac tatgccattt ccatggtagt ggtgaaatgc cccttttgaa aaatggcgag     48960
     tacgtagtgc gggtaatatt acttatcgtt acccggtata taagcaaata cattatttgc     49020
     cgctgacgta ttgctaaaga gagtaagcta gtgatagctg tagtgatctt gggatggcta     49080
     ttgtacgatc cctcttgtta tctttgtgta gaacagagtt tctctttaca agatatcttt     49140
     taaactgatc ggaagatgtt acatctttgg aagtcaaact taaccaacaa gacgtaaatt     49200
     gtggagctgt gaaaagggaa atggaaggaa ggaagcccaa gcggtctatc aagactatag     49260
     aaagaagcac tgaaattaga aaactacatg aaatagaccc atgtagctac cgctgattgt     49320
     cctaaagtgc tttaagactt taaagatatt acacgtgaat aacatgtgac tacagaagat     49380
     ctaaagtttt ggtaagatag tgccttatct gcatgaatag gaccattttt agtccaacca     49440
     atgctttgtg gtattttaat tagttataac gcttccctgg acttttgatt atctatttct     49500
     taaaagctta cagaatggct atatctaagg ttcgaactca ggcattttcg aaacttatcc     49560
     tgatgtatgt ctgtatacat gaacaagtct acaccaattc ttagacttga agtacatcct     49620
     ttcataatcc ttgatcatcc aagacggatt atgagagtcc attctccttt ataattcttc     49680
     tttctctcag tatggtcttt ctgccgccaa gtcatttgat ggtattaccc ggcacgatct     49740
     ccctcaacat ggaagatgag atgcatattc taaaggtatt aaaggctata tgtaactacc     49800
     cgtcataatg aataaatgaa taaggaaaag aattaatgag ttctgaatct ctatggaagg     49860
     aagctaaaga taccagtggt agaatttact attataatgc caagacgggt gaatctaaat     49920
     gggaaaaacc aagggaattg ctaagtgagc aggaactaat actcgcaaag catggttgga     49980
     aatcctcgaa aacatctgat ggtaaactgt actattacaa tgcacagaca aaaacttcaa     50040
     gatgggaatt acctgacttg cctgaattca agaaagaagt caaaaaggaa gacactacga     50100
     taactccaga ggacaaagaa cctgcacatg aaaccgccga tagatatgca aacccatctc     50160
     aaattctgca tacttctaaa aagcccaaag aagaggctgc aaaggagttt attcagatgt     50220
     taaaggataa tcaagtggat tccatatggt ctttcagtag aattatctcc gagttgggct     50280
     caagggaccc tagatattgg atggtagaag atgatccact ttataggcag cagctttttg     50340
     aagagtattt taccagcaga tcagaggaac aactgctcaa ggaacgcatg gagacaagca     50400
     aatttaatga agcattttgg aaaatgttaa agacaaaacc tcagattcaa tactatacaa     50460
     ggtggtcaac agcgaagcgt ttaattgcaa atgaaccaat ttacaagcac tcggtggtga     50520
     aggaatctgc taagaaacaa agatttttgg aatatgtcgc caacttaaga gaagaacatg     50580
     aaaaatctca acgacaactc aaatcacagg ccttgaaaga gttgcaggat tatttagaaa     50640
     atattcttct atcttcagat actggaacaa atggtaataa tactgatttc cctctgatga     50700
     aatggcaaag tttggccaac aactatctgt ttgaaaagaa caagagatat atggctaaca     50760
     agcattttaa aatactaact catgaagacg ttttacaagt ttatatggat attgccaaaa     50820
     aagtggaaaa aaacctggag gacaagttgg cagctttaca aaaggtaaac tatacaaaag     50880
     accgtgttgc tcgtgatggt ttcaaggaat tgcttcgatc ccctgatatc aaaatacgag     50940
     ctaattccaa atggcacgat atctacccgt taattaaaaa tgatccaaga tttttgcaga     51000
     tgttaggtac ttcgggctca tcaccgctag atctatttct cgatgtggta gaggaaaaat     51060
     caatcacggt cgcagctcaa aggtctattg cgcaaaatgt gctgattgaa aagagctttc     51120
     agtgggatga aagtgatgtt aataacagta gacaaaccat caagggtcat ttaagggata     51180
     atgaacaatt taccaatgta gatgattacg acatggattt aattatagac caattagaac     51240
     agctgcaagg tgagaaacaa agaaaacaga aacttcttga acaaagggcc ttcgaagaaa     51300
     agaaacactt tttcaaatta atgctacgaa gaatctatgg agttgtaaaa ccaaagcctg     51360
     aaacttggga agctgcatta aaagatatcc aacatacaag agaatatcga gaacttaccg     51420
     atgagtacgt taaaagacaa ttatttgatg aattcaatcc tgaaatacca catgctagac     51480
     ccaggccgtc tgttccttat aatccgaaaa aacggccatt ggggccagat attgaactcg     51540
     attactgaac acaattcaat atataagaga aaaaagagta tttatcattc gttacttaat     51600
     aatgcgctga tccctaggaa tcccattagt gccaattttg catatttgtt ctcagaaatc     51660
     caaatcgtta cgtatccaag ttgaggaacg taacccttta ccgtacctac aatatccctc     51720
     tccttttgta aatagatttt ctttctgcca tatagtggaa tatcgtcacc agcattgtta     51780
     tcacctttcg ttagcagtaa ttgtttattt ttgtcattat ggtgctctct gagaactctg     51840
     tgaacgatgg gaattgactt gtcttgcact tcatagatca ccacgtcacc tactttactc     51900
     ctttcatttc tattccataa gaaaagtaca tcacctcttt ggaatgcagg ctccatggat     51960
     cccgataaaa ccactacgat tggggaatgc gaattagtcg ctatagataa acctttccaa     52020
     aacataaagg ctgaagatag cacaaaacat aatttcagga acctggtcaa ttccaatctc     52080
     aaattcataa ctactcaaat acgactttct tgcaaggatt caacctactt cttttgaacc     52140
     tattttgggt ctgataatat ctttccgtta ccttgtccac taggacttca agaagttcga     52200
     ctcaatcaat gatgatgaaa aatagaatca catgattttc acgtgtatat acatattggc     52260
     ggttataata tcatatatct ttagcgtata cataagttca atatcatcta aaatttactt     52320
     tctctcttcc gacttctggc agagtttgta tattcttctt cctctgacgt ttccaagtca     52380
     ttcgcgaggt ttaattccgc taattcacct ttcatctggg aggacatgag ggaccattca     52440
     gtgtttaatg acatgcaata gtcgttaaaa tctttcaata tctcttgatc aaaaacacca     52500
     ccatttttca taactatttc tgaagcgcct tcgtaagttt ttgaccaatg catccatgct     52560
     aatccgtgta gaaaagaatc tgctaaatcg tcgtctttcc tcgtacccaa ttcaggaccc     52620
     gatccaatac aatcaagtaa cttgaacctt ttttgggaat ttaactgttg ttctacattc     52680
     gacctccaat gtggtgtcag attacacttt ttataacctt gtggagcaat agcatttttc     52740
     aaaatggttt tcaccaaatt aattctaatg gttttgctcg ttttagctgc atgaaaatta     52800
     tctgcgtcgt tgaaaggtaa atctttttgg ggttgcaaac ctgttgattg tgtaaatcta     52860
     ttataaagag tttttaacga ttttaaatcg caccagtatt gggccatctt ttgaggacta     52920
     gaggaatgca cgacgtagtc ggtattaaga tttccatgga tctgtttatt ccttaaatta     52980
     gaaaatagaa tatgttccat aacattcgat aaaaggacag attcaatcac atttttggat     53040
     gataatgatc tcattctttg tttttctaaa acgtacaggt ctgaaattgc caattcacta     53100
     gtaagcatgt ccaaaaggcc atgccccacc ttccaagtat ccattggatc cagtgacatc     53160
     ttcagacgat gcttccccaa aaatctttga caaagattaa tcttattcca atccaccaac     53220
     gtcggtaatt cgtcaccctt gtaccatttg aaaacagaat aggcaaaatt cgaaaccccg     53280
     gcatctatag cggttataga ggtttctccg tcttgcagct ttcgtaatct caatttttcc     53340
     aatttttcag cttgatccac tatgcttgtc ctaccttcgg acttattctt accaatattg     53400
     gcccccatac atgatcctaa tcttttcaaa gcacgtccat tggatttcct acaatacaga     53460
     tcaattgcct cgacggcagt acgactccct gaagctcttc ccatatcctg tgggccattt     53520
     cagtcaatga attgatgtat tgttcgaggt ccctggtgtt aaaagcgatg tgatgctgaa     53580
     aaattgtcta ggttttcgcg ccaggcggtg cgtcagagca caaaaaataa aataaaataa     53640
     atataatatt ataataaaat aaataataaa gattcgaagg tattgtaatt actactacta     53700
     cggaaactgt ataatcctag gatgtcctca tatggtagat ccaaaaaaga ccatttttgg     53760
     cgaaaatgtt acaggaaact ggcagaagtg agcgatgaca gccgtcggca gagtgtcaga     53820
     catcactcta ttagacgctg gaaaaatgta caggacccac gacatgtcga aaaacctatc     53880
     gcctttgatt attgggccgc attgactccg aagtcgaggt ctaagccctt tatgcctaca     53940
     tccattagta agccgagacc caaacgtact gtatcgggag ccgccactgc accagcctct     54000
     ggttgcagtt acagtaaaga ttcgttatct ccacagactt atagtacagc ggaaacgtcc     54060
     atacctaata atgattttga accacgacct acactagatc ctcgtagtaa cggtagtttc     54120
     cgaagtaata tcaaatcaaa cagattcaac aaggtaggtg aaatggaacc tggtttttgc     54180
     ctgggattca tgtctgacag tgcgactgga gcaagtgcta caagtgcttc agtttacagt     54240
     ggaggcgaga aaagcgatga ttcccaaaca agtttggaca gtggtatttt tgattcacga     54300
     agctttgaga gtctaataaa ttcattcgat tggtacgcta caaatgtctt taaaaggtta     54360
     gagacatcgg tattgtcttt tttaaactct aaagaaccaa acgaggataa aagtagtgct     54420
     atgtgctcta ctgtctcacc gctccgtagc gaactgccag attcagtatt aacaccctgc     54480
     accggtgcag ccacccagtg ggattacgca attgatgaag ccatctatgg tcaacatgcc     54540
     aaatgcttta tatgatatta tatatacaga tatactttat atgaaccaaa ctatactatt     54600
     actatcatta tcttcaactg catgataagc acatgataac gaaacattac cctccctaaa     54660
     cttttttttt tcctcttggc aggtgggaaa attgaaagcg tcataaggaa acatagttta     54720
     ttaattaaag gattttaaaa gggagaacag tggaaggcta gaaggggatc ataagtttat     54780
     tctggctagg aaagcaaata tttcagtcgg ttaaaattat atattacggt agtctccttc     54840
     tgtggatttt ccctgaggtt ttatcgcact ttttttttta actttctcat ctccggtagg     54900
     tgattagttg gttcaagtat aataggtaca tttagagatg gtatctatgg atgaacaagg     54960
     ggtcagtaga cctgaaacca aaccagtgtc cattcttaac agtaagccat cggtaatacg     55020
     aaaggacaac agtgtcaaaa ttggtaatgg taatgcaaat gaggagaaga aattagattc     55080
     acagctggaa caggtgaagc taacagacaa tcatgaagac atgcgaccta gaccaggtgc     55140
     ttcaaagaat tcttcttttg agaatggtag ttttatagct ggaacgagtg ctaatggatc     55200
     ggtggattcc tcgccgcaga aacaaagtgg tggtggcggt ggtggtactt ccgcagtgtc     55260
     atttacggtt tctgaagacc aaaagatttc gcaacatagg tattcgataa attctaaacc     55320
     agccaagccg acagatccaa gttcaggtgg ccaggacact gctctggcgg caaagcagga     55380
     ccatgactca cctgcagccg aaaaaagttc tatagtacac atgccaggag actttatcta     55440
     ttttgattct caagccagtg agaataaagc tccaacacca cgagagcatc cacaacaaca     55500
     ccagcaacaa catcctaaaa aagaattaat cgtacctaat tctggccctc aagtaccatt     55560
     tactgaattt ttccaaaagc aagatgataa aaagtttcac atattgttag gggccacagg     55620
     atcagtagca actatcaagg ttccccaaat cattgataaa ttatttaaac tttacacgag     55680
     agagaaagta tccattcagc taattgtcac aaaaccagca gaacactttt tgagaggtct     55740
     gaagatttca acggatgtta aaatatggag agaagaagac gaatggtcag ggtttaaaaa     55800
     aatgggtgat ccggtattac atcatgagtt aaaaagatgg gcagacattt tcctagtcgc     55860
     acctctatcc gcaaacactt tagctaagat agcgtacggt atctgtgaca atttattaac     55920
     ctgtgttctg agagattgga ctccatctat tccggtaatg gttgcacctg ctatgaacac     55980
     attcatgtat atcaatccga tgacgaagag acatctaagc atattgaagg aagatgcacc     56040
     ttacgtggag gtattgaaac ctgtagaaaa agtgttaatt tgcggtgata tcggtatggg     56100
     cggtatgaga gaatggaacg atatagtaga aattttacgc cgcaagatct ctgagatata     56160
     tagagctcga gatgagaagg acgtggccat gcaggctgag gaagaagaag aagaagagga     56220
     agatgaggat gaggatgatg atgaagatga agatgaggat gaacaaggca aaaagaatct     56280
     tgaggacgat gaagatgagg atgaagatga agatgaagac gatgacgatg acgatgacga     56340
     tgacgatgaa gatgatgaag acgacgatga cgaggtcgcc cagtagcgat cgctaggtac     56400
     caggtgtgcc atttatatag catagactaa tctcgatcat ccatcgcttt gtaactttat     56460
     aaggccgggt cacaaatggg cccttaataa tgggttcctc tgcatgggca atggtaaaaa     56520
     aaaatttgac cgactacact tagtgaacaa gacctttaaa tcattgataa tggagaaata     56580
     caacaaagaa taccattagc gatgtcattt ctaggtttcg gtggcggtgg ccaatctcaa     56640
     gtttcttctc aacaaaaagt ccaagctgct gaggcggagt tggaccttgt tacggatatg     56700
     tttaacaagt tagtggacaa ctgtcataag aaatgtatca gttcctcata cagtgaaggt     56760
     gatttgaaca aaaacgaatc caactgtctc gacaggtgtg ttgctaaata ttttgaaact     56820
     aacatcaagg ttggtgaaaa tatgcaacaa attggtcaaa atttccaagc tgctggtcgt     56880
     ctttgattga ttccatgtac atgtacatat aatattcaca aataaatata agtatatata     56940
     gatatatatt tacaagagta ttttctaatc gtcttaaaat cccaacgatt taagcattct     57000
     taatctaatc ccctccacac tgtttagttt gggacgtaca tccaagtaga tctgcgggcc     57060
     cttctcttga tcatcatcgc tgtagaagtc aataacgtag tcgatgcttt taccacagcg     57120
     attgatagac caatcgtgtc tatcaaatgg tttagagaat cccaggaatt gacttctaag     57180
     ccatgctctt ggtgtcagtt tcttagaatc acctttaaaa ctagtcaact gaattccccc     57240
     acatgattca ccaccttggt ccttttccca gaatttgata taattccaaa ctctttcatt     57300
     gaccgaatta tgcagtggca ccacagtttg catgtcttga gcatgaggat cccagttttt     57360
     ccttaacatg gcttcgtaaa actgcttctg agagggatag atccagttgg cttctgatcc     57420
     tgttctggga attgatgaaa tttgacgatt ttctggcaat gcaacgtttg tatgatattc     57480
     tggagtagct gccaattgtt ctgatgagca ttccacatcc tgtttcgcct gactcaacca     57540
     aacctctctt gattcatggt caactggaca tttagactct tgttgttgct cttgttcttg     57600
     ttgttgttgt ttcatagcag catgctttaa ccaaacttct cttgaattgt ggtctacggg     57660
     acatttagag tcgttagatt cgtctatggg ggaacttgac atggtttacc acttcgtttt     57720
     tagatatact ggtgcgatga gctgtatcat cggattgtac aagtttactt aatgaatcaa     57780
     cacttttttt gcatacatag aaaataagag ctgattacca caactacacc aatacaagcc     57840
     aagaaaagat caatataaag tttcaacagc cgtattagtt taatatgaat gctggttgcc     57900
     tatggataaa ttccttaaca agttctctgg aagcttgtac gcaacttggc aggtagaaag     57960
     gttttacaac atctcaaaat agggaaagat ctacattgaa ggaatattac attacgaatt     58020
     gcgatccgtg ttttataata aaactcacct ttctcagatg cctcggtatt agatttttac     58080
     atcaagatgt ttcatatggc cgttatctga ggtcgaaacg agtaatgcaa ggacctcaaa     58140
     aagtaaacct ttagcttctt tgcaattgaa tttgaggaaa taaaatacct ggaaccaatt     58200
     gaactattag caatgacaag tatttataac ggttagtcat ggatcatgaa cttccatttt     58260
     tggtatctca ttgatgaaca ttatataaaa aggtcaacaa gaattggaag tcgaatatct     58320
     tggaaagctc cttccttgaa cttattgatt gtaggtccat tctagctggt catgggatgc     58380
     acagcaagca cacatgtttt tgagaactat ggtgaagatg atccattttt gcagagtcag     58440
     aaggccaatg atgccataga acaaagtctt caattgggca aacagaacga taagaatgaa     58500
     acaaagctac tgctattggg tgcaggcgaa tcaggtaaat caactgtgct gaaacagttg     58560
     aagcttttgc acaaaggtgg ttttacacat caagaaagat tgcagtattc acaggtaatt     58620
     tgggcagatg cgatacaatc tatgaagatt ttagtcattc aggcaaggaa aatggagata     58680
     cccctagact gtgacgatcc gattaacaaa aggccgttgt ttgagtgtaa aagaatttta     58740
     ttgaaggcta aggcacttga tcatatcgat gccggtatgg ccggtggctc cgattttctc     58800
     aatgactacg tgcttaaata ctctgagagg catgagacta aacgtaaagt acagagtaca     58860
     ggtcaggcca gagcatttga tgaagatgaa aattcatggc tgcatgaaaa taaggataga     58920
     gccatgagtg gccaaactat catcgatgat gaggatggcg tggctcaaga tggtaaactg     58980
     gatttacaac agatattgca ggatcttgat gaggactcca gtaatgacaa catgtttctc     59040
     aaagaacgct tacaacaaca atggcaagaa caacagttac gacaacaaca gcacatctcc     59100
     aatcaagata ttgcacatgc catcgatcaa ctgtggaaga atgaccgtgg tatcaaacag     59160
     tgttttgcgc gctccaatga atttcagttg gaagggtccg cgccttacta ttttgacagc     59220
     attatgaaat ttgcagatcc tcaatacgtt tgtacagacg aagatatact aagaggccgt     59280
     gtgaagacaa caggtattac cgaaagtgac tttaccatcg gatcttctaa attcaaagtg     59340
     ctggatgccg gtggtcagag gtctgaaagg aaaaaatgga tccactgttt cgaaggcata     59400
     actgcggtac tcttcgtact tgccatgagt gagtacgatc aaatgttatt cgaagacgaa     59460
     cgtgtgaatc gtatgcacga atcgatcatg ctgttcgatg ctttgttaaa ttctaaatgg     59520
     tttcgagata cgccattcat actttttctc aacaagatgg acatctttga agagaaagtc     59580
     aagagaatgc ctattcgtaa atttttccct gattaccagg gacgtgttgg taattctgaa     59640
     gcgggtgtca aatacttcga aaacctattc ttgagtctta acagatctaa taataaacca     59700
     atttatgtca agagaacctg tgcaactgac acccaaaata tgaaatttgt tcttacagcg     59760
     gtaacggatc taattacgca acaaaattta aagaggagcg gtatcatatg attcatgtgc     59820
     tgttacagtc gttctggatt tcgatcttgt ttaatcatct gggtgcgtcg ttaagattcg     59880
     cttagtcaaa gggttcgaca tcatggaaaa gtataagagg ggcaactccg tacagacaat     59940
     gaaggagttt ctcatcaatt tctacatacc gatggttaac atcgacaagg attaagcatt     60000
     gaatatgtct ctacaaacaa gtaatttgaa tcgtattgtg gaaattccac tatcacaaat     60060
     tagaagaccc atcgcaccag tattagattt tggcaagatt gatgccatgg tctctaccat     60120
     ggaaggtaaa cccatggcaa gtgccacttg cagtttggaa caggctgagg attttaaggg     60180
     ccaattacct ccggttgacg tattatgcat tagagagaat ggtcaaacgt actatttcgc     60240
     atttggtgga tgccacaggt tccaggccta tgacagaaag gcagccagcg agcaaagcga     60300
     tgtactcgtt agggctaagc tggtccctgc aacgagacac caactaaaat tgtacgtggg     60360
     atcaagtgta gacgaaatgt tcaggtaaat acgataatta gtttaacgac tggatgatat     60420
     gtgtaggttt tgggatatga tattttttag cagaattgtc acgtgtaaag ataaagacac     60480
     tagaagccac agtaattacg tacaaagcga tgcactggat acgtcatgtg atctactcct     60540
     cgaaactctt tagctataca actcctccgc ggctaagtct gctcgaacta caaaccaatt     60600
     gaacagttag tattttgtta aagtgtcttt tagttagttc cccgccccca ccatcacgtg     60660
     cttccccgct ctcggatccg agacgcggat aatttttttt tttcataaaa ctccgcgtga     60720
     tccctccggc ggtaccctgg tcacacactt tcaaaggata accaagacat ataaaggaca     60780
     tgcatagaaa aaggacagta tcgatatttc tttacattga tacaggaagt aggtaagaga     60840
     tcgttatttt accatacaca taaaatacaa tcatgtttac cagagtcgct agacgtgctt     60900
     tcactactac cagagtcaat ccatacaagg tcactgttct aggtgccggt ggtggtattg     60960
     gtcaaccact atcccttcta ttgaaattaa accacaaggt taccgatttg agactttacg     61020
     atttgaaggg tgcaccaggt gtcgcagcag atctatctca cattccaact aactctaagg     61080
     ttagtggttt cgcacctgat aacaacgggt tgtctcaggc tctttctaac accgatgttg     61140
     tcttgattcc agcaggtgtt ccacgtaaac ctggtatgac cagagatgat cttttctcta     61200
     tcaatgcttc cattgtgaga gatttggctt ctgctgcagg tgaagctgct ccaaatgcca     61260
     agattttggt catttctaac ccagttaact ctaccgttcc tattgttgct gaatctttga     61320
     agaagaaggg tgtgtacagt ccaaacagat tgtttggtgt cactaccttg gattctatca     61380
     gagcctctag atttatctct gaagtccaag gtaccaaccc aactcaggaa cacgttaacg     61440
     ttgtcggtgg tcactctggt atcactattc ttccattgat ctctcaaact aaatacagca     61500
     acatggacaa ggccactaag gacgctttga tccacagaat tcaattcggt ggtgacgaag     61560
     tcgtcaaggc taaggacggt gctggttccg ctactttgtc tatggcccaa gctggtgctg     61620
     ttttcgccaa cgctgttctt tccggtctag ctggtgaacg tgatgtggtt gccaactctt     61680
     ttgttgactc cccattgtac aagagtgaag gtattgattt cttctcctcc ccaattactt     61740
     tgggtccaga aggtgttact aagattcacc caattggtga aatctccagt gaagaagctg     61800
     aattgttggc aaaggctaag gaaactctaa agaagaacat tgaaaagggt gttcaattcg     61860
     tcaacaacta agtaatgtca tgattattat gtccataacg ttgcgtattt aaataataaa     61920
     atcttgaaaa tattcgcttg atattgccga gtttaaaatc ttttcttgta aagcgcagct     61980
     cctaggtctc cttccagctg ctgtgtccga agatgtccat taggggcctt ttagtcgatg     62040
     atcaatcccg ttgtgagcat tggcatttgc cactggacgt aattgcttta aggtttaggt     62100
     gttgtgacga gtactatgca tgttattctt gtcatcaaca atgtactaac cacgaggtag     62160
     aaaagtactc cttagagaat tctcaatcat caccactaat aatgtgtggt atttgtaagt     62220
     tacagatgtc ctttgaacaa tatcgtcaat tggaatgtcc ccgttgtcat tcgcctttta     62280
     atcccggctg caaactacac taccatttgt attttgatcc ataataatca agtctaatca     62340
     ctgtcatgac ttcttagctt agctattggt atgtttagta aagatactcg gcctctaatg     62400
     ccttttggtg atgtaggcgt gctttctgat acctcttcac catggcctgc tattcgattt     62460
     tcatggtttt ctgtcattaa atacttgttc accaaatcag ctgtattgcc atgactattg     62520
     gttagagtat gactaccact gctcgttcta ccgccactac cactgctacg tcgattgtct     62580
     cttttggaag gtgaaatttc tgctgatgat cttgtctgtt tatccataga actgtttaat     62640
     gtgtctcttc cctgtaatga actggaggaa ttgcttaacg atgattcctt tgatgcaaac     62700
     cttgacgcta tattacccac tggtgattta gaacttgttg ctaatgaagg tctacgacta     62760
     gtagaaatcc taggtagatg tgggaatcca ctaccaatgg cagaccctcc actgccgcca     62820
     gccccatttt gtgaatatag tgaatatggc gaatttaatg ccagaatagg tgaaggtcca     62880
     tcatcgaaaa cagcccttga actttgtgta ggtgttctgt aagaaccaaa gttaggttta     62940
     gtaacgtttc caggcatttg tgcttccttt aacactttgg tatacagttt agtcgtttca     63000
     tatgtggatg caacgtcact tggcttccaa cctttcttat tttttacatg atcatccaca     63060
     atacctcctt gtaatataag catcttcata caattaattg atccatactc aaggcaaacg     63120
     tgcagtgggg tatctccata atcatcctta atggttaaat tggcaccaac gcccattaaa     63180
     agattaaaac attgaaaata atcgtgttga catgcaatgt gaactggtgt cttgccttca     63240
     tgacctctcc aatcgataag ttgcgggaag tattgtaata aaagatgtgt cgtttgttca     63300
     tgaccattca tcaatgaaag atgtgcacac gtattgccct taaaagttgt atgcacttct     63360
     tgcttatcat gcccacattg aatcaaatat acacatacca ggtatctacc ataatatgat     63420
     gcatagtgta gtgaactcca accgtttgtt ggatctatat tggtcaataa ctctgggaac     63480
     ctctttagca gccttttaac tacaagcaga ttaccttcaa taattgcatc tcttagtcta     63540
     actgatggat ctaccagcat actggataca atacaatctt actggggtga gatgaggtgg     63600
     tttagcagtg tatatcggta acatatcaaa ggtaaggcga aaccgaatca tcactacaat     63660
     tacaatgtac aactaaaaag tgctacttaa acactaagct ttcgtcttag aagtgtcgat     63720
     aggagtagta gaagacaacg ttatgtccac tgttacagtt agctacaatt tcagtcaatt     63780
     tcgagtcaaa gtgactccta gtatggtgct taacgatgta ctgtctcaaa gtcttcaaca     63840
     ctttagatta ttacaagaag gtggtagtgg aaaatggggg cttacccaca acgacaagcc     63900
     tgtggaattg gatctaccct ggagattaat gaatctacct actggcgtca agttagaact     63960
     aaaacccttg agtgatgatg gtggcgataa aattataaaa gttagggtac aagcgccagg     64020
     ttatagtgct aaagtggaat ctgttagtat caatgcaaac ttgagaacat ttttacagca     64080
     actgtcagaa agtgctaatt ggcccattca agatcctggt gctaaattgc agttcttcac     64140
     caagacgata cctataagcg aactgaatga tcaaacattg aaatccttgg ggatcatgga     64200
     atctctgtca atacgattaa tatttccatc ttcaacaacg acagacgcta gtgcaagtat     64260
     gccaatacca gctggaacaa ctcccgcaag agaacaagag gatacacaca ggaaagtgga     64320
     atcgaggaaa atccaccaat tacatcaggt ttccgcatat atcccctctg aaaagactat     64380
     cgcatctcaa ttaaacattc aagaagagaa tgatgatcct gaattgacag ttgcacatgc     64440
     aagaaggtac caacagatgg ttctaagaca gactggtggg cttggtggac ctatggttcc     64500
     cagaaggatt aaggaacaac aagaggcagc agctgctaga aggaagttgg tcgaagagtg     64560
     tcttgttaga gttagatttc cagatcgtac gcacatcgaa gttgctttta aaaatgacga     64620
     taccatgtct accatttacc agatcatttc aagcagtctt ttgaacgaac aactgcaatt     64680
     taaactctat caatcacatc cacatgttga gttaccacca agcgatcaaa aattggtaga     64740
     agatttagaa ttcggatcta aaactttact acttttcgaa tcaaacggca aaggcccttt     64800
     cttaaagggt agcattttaa aggatgcaaa ggatttagca gatgctgagg acgtgaagtt     64860
     agatagatct gataaagtcg aaaccaatga ccaggctgag aaacaggatt tagaaccggc     64920
     ccaacccgaa cccaagaagt caacaccggg caagtaccca aagtggttaa aattgagtaa     64980
     aaaatagagt gtctattata aaatttcact atttacacgg tttatcaatt ccgaaagatt     65040
     gtccttttct attttcaatt cattcattgc tccataaacg tcattgaatt gaatatcttg     65100
     aggattttta aatttaagca acattaatat ttgtggaagc aaatcatcaa cactatactg     65160
     gtggtccatt cgaggggtta aaatcaatcc acgaagcttt agttccttga cttttgccat     65220
     cgcttgtgca ttagattcct caacgctttt gccgtctgct tgatgtttct tactgattac     65280
     cactaataac tccttttcaa gaccctttgt cacatacaca atgaattggg tttcaagggg     65340
     gaatccatgt aattcagtca tcgtgcatag tactccggga acgattgccc agtccctgct     65400
     gcgcattaga gttgttaata tcatatagta catcttagta tcgggtaaca cattgtccag     65460
     ttggatcatt gcagtaaaca gggtccttac tggaaattca ggatgcactc gggttctctt     65520
     aataatcttg gcaacctggg tcttccaacc tgaataatta gatttcttct caaccctttc     65580
     caattcctta ttgaatattt tgtaatattt accataggct ctccacatct ccacataaag     65640
     tggcctggtt acatctctgc gattatagaa tctagtatgg cctgaatctg taaccaattg     65700
     cttaacgagt ttttctttca tgacttgatt tataatttca aaacatttat taaaattgtt     65760
     gaaatccctg taaaagatca aaagttttgc aagaagcacg gagttataag gcacaccatg     65820
     attctccatc ctttccacaa ttctctgaac ttttttctcc aaatcactgt gcatagactt     65880
     tgggaaacga tccttggata aagtaaaata ttccacaaag actgcatagt gatgaggctg     65940
     cacttctgga taaaattgtg ctccttccaa ctctggggaa ttcctagatt tcaacaaagc     66000
     ctcctccatc ttgaataata ggaaaaatgc ttccttttcc tttcctgtag ccagaagaat     66060
     ttttaacaat gcatggaatt tctttgatgg tgacaaatcc tcatcagcgg ttgccctttt     66120
     cctcacaaaa tcctccatta ctttggtcag ctcgggaaaa gatgccaggg atgcaacgtt     66180
     gttgaacaat agttcttgac taaaactgat atctatatca tgctcctttc tcacttcatc     66240
     aaacgatttt tgtagttcat ctaacttttc ttgcactgta gtaggattta aatgagggcc     66300
     caaggagttt ctcaactgct caaaactttg cagcagattg aacttcaatt gaacgatgag     66360
     gaatctgtaa ttttcatctg tgataccgtc tgtctctaag tatttcgcca ccaatttcat     66420
     tgcagtatga atgttcttcc tgaaaagatg atattcaatc aatgtaataa aatcataatc     66480
     acttgggggt gtcatttcat ttaaaaattc atcagcttga tcctctgtgg taaaattaat     66540
     catctgctta ccatcattac caggagcttc atcaaatctt ttacatccgt aaactgaaac     66600
     catttctaag aacctgtcgg taagtctatt agcacttttg atatcaccta tgagcaattt     66660
     acgcctcacc gctaatctga gaacttgtgt ggaaacataa ggatacattc caaaccgaag     66720
     atcagtagct atgaataatt tatcaaattt attcaaataa tttgctctca aagccaccat     66780
     catacctagt tcgtaccacc accgttcatc aactttgact ctgttacttt caaagagctc     66840
     gaaagctctt ttataaaacc cgtagtttac caaggaatct atgtagaatg attcattaac     66900
     cgggtccatt ctaacagtcc ccaaggaata caacagatta cctgctaaaa atatacctct     66960
     tttacgtctt ccttcaatgc ctattaactt agccaattcg aatacctgta ccaattgttc     67020
     taacgtaagt acgcttaggc cttgtgactt tctatcgtta agatctgtaa ggatttggta     67080
     gacgagatcc gtgtggttta aatagttctg actattttca gcagaatcaa ataaatcaga     67140
     gaacacagca tcttctaact gttccggagt ttcaatcggg agatctgatg gcttatcctt     67200
     cacttctttt gatttcttta attgatctgg tcccaattga ttcagcattt taatttcaat     67260
     ttcacactct ttcaacagat agtcaaataa aatttgcaat cgttcatttg gtcctaatgt     67320
     atccgttttc aattccttac tcagatttga gaggttctta gcgctttgcc tgacacctga     67380
     attcgcatgt tttaggtact gtaatattaa ttcctccata tacttgttgg agttccattc     67440
     ctcgaaaccc atctttttca aattttcctc agtttcatga gagtctttgg ctttgagact     67500
     gatttcacct gcgtctcgta gtaatccatt ctgttgtaga gctggaatgt gagttccagt     67560
     gggtagtctt cttcgtctgt aaaatcttgc ttgaatacgt acaacgtttc tcagggtaga     67620
     agtaaaccta aacatccgaa aagattggct acaacactct atgaaggata tattatccta     67680
     tattttgtga ttctttgtgc tgttgaaact tttgaactta gcccgatgac cttttggaag     67740
     cgatgagcta gcgtaaatca tctaacggaa aaatggttaa ctatacacac atatattata     67800
     tactatatta cacagggtat aagttttatt ttgaatctat accttagtta ttatttcttc     67860
     ttaccacttt tcagccttcc ttcgaatcca gctcttttca ccatagttga attaccctta     67920
     taagcactct tcatcttttg ctgtttagac cttttcacac ctttgttctg ctttctaatc     67980
     ttcaaatttt cttctcttct cttttgcttg tcggcctttg acgtcgttac tgctaattta     68040
     cgatctctcc actcttgttc tgaacgtctt ttctttgcct ctttacgctt taaagcctta     68100
     cgaagtaatt tctcatcatc ctttaacttt ataccttcag cttgcaacat ggcacgttgc     68160
     catttttcct tttccttagc atttatttga tccatttctt ctttagattc taatttagct     68220
     ttcttggctt ctaaaagttt taaatgtgcc ctgatatcgt ttttagcagg tcctttcttc     68280
     tttggtcccc tcttcagatg ctgtaagttt gaagttatct tattaccatc atcaaattca     68340
     atattttgat acataatgtc attagcatcc acttcaattt tcgctttttt agtaggtggt     68400
     tgagtctcga tatcactatc atcttcatca gattcacttt catcaccact tttattattc     68460
     tgctgctttt gagaatcgtt tttctgtttc ctaagatcca atctctgttt tctttcttca     68520
     ataatcgcct ctcttgaact aggtgcacct ctaacccttg taccaggagc tctacgtctt     68580
     tccttcatat cttgaatctt ggcttgcaat tttgaccgca gagcttctag attgggctta     68640
     ttctgagact tttgagattc cttattttct tgttcaacag acccttcttt atgttcctcc     68700
     tcagattctt cttctacagc aggagacttc tctggctctt ctggctcttc ttggtgctct     68760
     tcctcttcct cttcctcctc atcctccttc aaattgattt cattaccttc atcatcgaat     68820
     acaacatcaa tatcctcagt accatcaatt tcttcggaag gttcgtcctc cttaacctct     68880
     tgttcccgtt ccttctcttc gtccttcaac ttcttcaatt tttcacctgg taacaccaca     68940
     ggttttgcat ctttttccct ttctttcatt acttccaaag tactcagaga gttttcaccc     69000
     tgctgttcag gatctaattt cttctgttta tcctccttag actgcgtctt actcttcttc     69060
     ttagccttcc attgctcctg tgtctggtca tcgtagtagt acttagctgg aattagcgaa     69120
     agcaaacctt cgaaagcatt cgaattcgac cgcagcctct cttcgagcaa attagccatc     69180
     gtaggattca aataaacctt taacgtggta aatgaacggg cgaatcgacg tatattacct     69240
     attgatactt cttattacta tacagctact catctcatct catctcatct catcgcctgc     69300
     aaaatttttc agatgaaagg ccgggtaata tgttttattg ggggcataaa acgcgatttc     69360
     gccgccgaga tcaagatcat ctaaaattta cgaatcactc gtgagaagcc aaagaagctc     69420
     caatacaagg tgaaagggtt cattgagaac cttatatgac tggaggaaag ttgttatatg     69480
     gatattgaat gctttcatga atttttcccg cgttttctac gtgtttcact tcggcggcta     69540
     attttcccag gtcataaagt tgtttggtgg ttaagtaaaa atttgatact ctgagatcca     69600
     attaatagtt caagtgctct attcaccctt acatgtggag catcgtctgt tgtgagttta     69660
     tgtgaactgg aagtataccg aaaggtctca taatataaag aatgccaaca accttaacga     69720
     agcttgtctg tttcttttac ttcttcatga agacctaacc cgaacggcat catttggtga     69780
     aaaaaatgtt ccccgggtaa cgaaagcgat gagcatcggt tgttgctaaa attttattat     69840
     aaagatgaaa aattttcagt gtaatgaggt tcgaactttt cttcctttct ctcagaaggt     69900
     tttctagacc atcgctgctc aatgtcttcc actctttaca tcattgaaaa atctccaaga     69960
     ggccagctcg tctcagatct ggtaaagtat ttgaatcttg acgttaagat cgtcactgat     70020
     agagaatcag attcaacttt taagaaaaac tttccattag gaaagattcc tgcattcctt     70080
     ggcaaaaatg gtttcaaatt aactgaaacc atcgctgtca tctattaccg tatgttactt     70140
     tatgccttcc attttatttt ttttctttat gttgctaatt gtatgatgag aaacctttta     70200
     tcaatataca gttatccctg tctgaatgac aaatatgtcg agatttatta tactctgatc     70260
     aactagcttc ataaagaaat atgaatccgt tatgaacttt tactaacaaa caattctagt     70320
     tgtcaccttg accaatgacg aaaaaattca aaatcaacta gccggttcca ctgctgaaga     70380
     aaaggctagc atcttgaaat gggtttcatt tgccaactct gatgctgcta gagcagctgc     70440
     ttcagctgtc tttttactag ttggtctaaa acctttcaac aagaaggaat tagatacttc     70500
     tttggaagct ctagaacagt atgctcaggc ttttgaacaa agactttcgg aatacactta     70560
     cttggctact gaaaatgtca ctcttgctga tatcgtgtct tattacatct gggccttttc     70620
     attctcatct gctcttggcg ctgatttcag aaagaagcac cctcaattga caagatggtt     70680
     caacaccatt ggtgctcacc caagcgtgca attttctcac aagggtttca aacctgtgga     70740
     aaaggctctt gagccacctc aaggtaagaa gaaggagcaa aagaaggaac aaaagaagga     70800
     acaaccaaag caagaagccg cccaaaaggc tcctgctgct caacaaccag ctcaagagaa     70860
     gaaaccaaaa cacccattgg aagtattggg taagtcatct ttcccacttg aagactggaa     70920
     gagaaagtac atgaatgaag acactaggcc aagttcattg ccatggttct gggaaaacta     70980
     caaccctgaa gaatggtctc tttggaaggt tgaatacaaa tataacgatg aattgacttt     71040
     gacttttatg tccaacaatt tgatcggtgg tttcttcacc agattatttg catccgttaa     71100
     atacatgttc ggttgtttgg ttgtttacgg tgaaaacaac aacaacggta tcatcggtgc     71160
     catcatggtt agaggccaag attacgcaaa ggccttcgat gtggctccag actgggaatc     71220
     ttacaatttc accaaattgg acgctactaa gccagaagac aaggccttcg tcgaagacat     71280
     gtgggcttgg gacaagccag ttatcgtcaa tggtgaacca agagaaatct ctgacggtaa     71340
     agtcttgaaa tgattgaaat gtatactaat tattgtttag tgtttaatac tattagtacc     71400
     tgtactgata actcgatttt atactcctcg tgtcggatga cacaggggac agatgtgaag     71460
     gtctacatgg gctgctcttg ttaaacaaca acgcttacag atcgaagtag ttgaggttaa     71520
     cgattcaatc ggttgtcaag gggcttccgt tgttgattta gaactgctct gctttactag     71580
     aaatgtctac aactctgtac actgcaaacg atttcatact tttgtcacta cctcggaatg     71640
     cagcacctgc caattcttcc aattcaagtg cagattcttg gttacaaaat gaattgatcg     71700
     gtggtagggc atttgtatct gatttccaaa ttcctgaatt taaaataggc tcattagaca     71760
     gcttaattgt acaatctgaa gaattggcga aagcagataa ccaaattggt tcgtcgattg     71820
     gtaaaattgt tgagatttta actagtttaa acgaaagtgg atccaatgcc tataagactg     71880
     tccccataaa taacgtgcca gtacctgaat acttggaaaa ttttcaatgg atgacaagaa     71940
     agtttagact tgataagtca attgaagaat tgatgaaatt gattacggat gaatctacac     72000
     aattggattc tgatgttaga gcaactagta ccaattacaa caatgccaaa accaatttag     72060
     cgactgcaga aaggaagaaa acgggtgact tatctataag gtcattacac gatattgtta     72120
     aaccagagca ttttatcttg aactcagagt atttgactac ggtactcata gccgtaccta     72180
     aaagtttgaa atctaatttt gagaaaacct atgagacttt agccaaaaat gtggtcccag     72240
     gatccgctgg tatcatatca caggattcag agtacattct ttataatgta catcttttca     72300
     aaaaaagtgt acaggatttc aatgcagctg caagggaaaa gaaatttact ccaagggaat     72360
     ttgattattc agaagaattg attgaccaat tgaaacaaga gcacgattct gcagctcatt     72420
     tggagcaatc attgcgctca caattggtta gattggctaa ggctgcttat gcagatagtt     72480
     ttattaactg gttccacacg aaggcgcttc gtgtctttgt cgaatcagta cttcgttatg     72540
     gtttaccacc cgacttcaat actaagataa ttgcagtgcc accaaagaac ttgagcaaat     72600
     gtaaggctga acttacggaa gcatttggat atttgagcgg taatgcattt gcaagaaaca     72660
     aacaaggtaa aattgtgaag gaagacgcaa gtcttcacca atatgcggct ctagtggata     72720
     cagaatacga accatttgtc atttacacca tctctctgtg aaggtaataa ataacttttt     72780
     ttttgttctt agccgtaaaa attatataga ccccctgatg aaatgtcagc accaactgac     72840
     ccaagaatct aaggttacat cgtcatctta ttctgatctt tactcttcat cgtagttaag     72900
     tgattttttc acgccggatc gatttacgca cacgtagtag agattagacc ctctcgctga     72960
     aaaactatct aaaccaatta ctacgcttac tgccaagttg ataaaaggtg ccgacgggtt     73020
     gcttcaacca atcttttgac catgcagtct atttcaaacg gttgtaccga tgcaattgtc     73080
     cagcctacct ctattagggt tgtgttgagg ttaaaaccac ttattgatga agcggccaag     73140
     ctgtcatatg tggaagatgg cgctggatcc ttatcgttac aagatttccc acaagtagct     73200
     ggtaaggcaa ctttctttag tgatgcaaat gataccaata aatttcgatt caataaagtt     73260
     tacgacgtag gtgtgagaca acaggaagta tgtgaagata tcattggtga caatgtaatg     73320
     gaactcctag caggtttcaa tgtaagcata atggcctttg gatcagaagg gtctggtaaa     73380
     acatatacta tgttcggtaa tgatcacgag gaaggtatag ttcagcggat gtgccaatca     73440
     atctttgatc aattggataa gttacatgaa gatagtggca atgaatcaac tatcagtata     73500
     aatttcttcg agttatttgc tgagaatgtt tatgatctct tatctcttca gaaaaattca     73560
     aaagttttga agacatccag tgataccaaa acacatactt tgtctgttaa gggtcttcga     73620
     actgtcagcg tcaattccgt ttatgagctt ttagcttata ttaatgaagg tcaccttcgt     73680
     aggtgtcatt cggattctca ttataggaaa tctagatcta gtgccttttt aaatattaca     73740
     gtggaacaaa ggaataaaaa ggaggagacc ttgaagcata gcgttttgca actaatagat     73800
     ttagccagtt ctgataaatt ggataagaat ttgaaatatg atatttcaac cgatgagatg     73860
     aaatctacca attcatctat gcaaaatttg catcaagtag tttatggact atcggaatta     73920
     gaatcaccat cctcaaagaa ccatagctct aaacatactc atcgtacctc tcgtctggca     73980
     aaatttttac aacaggcaat tggtggtgat agcaagacta cagccgtgat gctttcttcc     74040
     accgataagg cggatagaga aaatactgta atcactctat cgttgggctc cagactcaga     74100
     tcaatccata actttccagt acaaaacaaa atgggactta attctaaagc tcttctcgat     74160
     cttagactaa agaatatgag cacaagggag gatagttatt tgactcgaat aaaatatttg     74220
     gaagatgaag ttagtaaatt gggtggtacc attcagcaga ataaaaacca agtttccaca     74280
     aacaaatctt tgaccgaaaa gaatatgaag ttaatggatc aattagaatt atatcgtaaa     74340
     tctcaacaaa ctcagaaatc cggttctgaa gaagagaatt taacgtctca acaaaatgga     74400
     aggattcaaa atgagatgtc tgaagtttta gataacctaa tggaaaaatg cgaaagagta     74460
     attcaattac agatgagatt ggatgaagaa ttacgccaaa agtcacaaat gtcgcagcaa     74520
     ctcaactaca aggaatcaaa ggctcaggct cttgaagcta tgaacgttaa gcttttagaa     74580
     caactgaaca ccaacgaaaa tgaaatgagg aacgttctca ataccaattc aattctgcga     74640
     aaagagatgg aaaaatggat gcatgtagct aaaacacgtt cagaaaaaat cgaagaatta     74700
     caaaatgaga tccaagaacg tcaggttgga aatgtccctc aaaatggtct attgtttccc     74760
     ccaggagaat tgaatcatat tagagatgcc tctaagaata aaaagggcaa ttggttattc     74820
     ggtaattcca gtaataacgc tctagggacc agaaaaatat ctaatctatc caatagtaac     74880
     aatctaggga ccaggaaggt atctaatgta tccactagta gtgccgtgac gataaattcc     74940
     caagaatcta atagctctaa gacatcccat agaggactta accttcatgc agttcgacta     75000
     ccttcaggca ttgagaacga aaactctagt gacaaaaaca atccttagaa tactcgagct     75060
     ctgtcatttc atgtaccaac ggacattata atattaccca attttgaccc accatatatg     75120
     gcaaagatta gaagacaaaa ttttgccatt acttgtgcat aggcggcaat gggagacagt     75180
     agtttacccc aggaaaattg taaggaaaat ctcttaattg caaaagtaat gaagaaaaat     75240
     ctccaaacgt atttgctcgt ggaaaagtgg tatactgcgc taaaagtata ctgtgtgaaa     75300
     gtgctgatac aagtgatcag ttgtgatacc cttgtcaaga ttttttcaaa ttttgataaa     75360
     cttcgatcta tattatcaat tgctcccagc gtggtattta gtttcaggga aatttgttga     75420
     aaagtgtcat taatctgatt attccacgat tgaaaatctg tattcatcaa gtatgtggca     75480
     gatttccaat cttctaacaa atcttctttg atgttagaca attgaggagc taactcctct     75540
     attatagagg gcaacaagga tactcggagt tcttctacag ctctcaactg agattgttta     75600
     acatcatctg taactagatc catatttttt ttggtattct cgaagaatag ttgcatttcg     75660
     tcattcatct gagtttgacc atgtctttga aattggtaga tttcctgcat aagatttttc     75720
     atttgcttca aactgtctaa attttcattt tggacttcaa caatttgttg agatatttca     75780
     tcattcttta aatccataat tataccatct atcatatgtt gcaacgaatc catactttgc     75840
     atgaacccga cattctgctt tttaatgaat tgtgaatttt gaactattaa actctgcata     75900
     tcatcttgat acccttcgaa ttcggtttgc ttatccttaa atgtttcatc aaattgtttt     75960
     aaatattctt taaacaattg ggcaatcgtt tgtaaatgtt cgtctgatga tgattccaca     76020
     tttgacatca tgttatagaa atgtcgggta aaattatcgt taatttcact ttgtatgttt     76080
     gtaatattga ggaataagga caatatctgt tccttttcgt aagggagaga attttcaaaa     76140
     catatggaag ataaccgctg ataattccca ctgtaagtcg tccaccattg agcagaagat     76200
     tctagctgta tcatacaatc catcatagaa tcagtttgtg tgtttttaca agagtctggg     76260
     atatgtccca agcctgcaac ctggaattca catatggata atttaactgc ggtttccact     76320
     ttaaatgaag attctatgga ttcaacacct tgcttcaaac atataggtag aaaagttcta     76380
     agagcatccc tcacacaact agattttaaa aatgggaaat ttctttgtaa agtctcatct     76440
     gatacaatat catccctaaa gttgcttgaa agtagccttt gctgaacgct ttccacaact     76500
     tcagcggtat ggcattggat tacaagcaat aagagattcc atgataagaa atgcaatagc     76560
     gatctcatgt tcttcctagt atttcccttc acagtctaag ccatgttgaa agtagttgtt     76620
     caattacttg ttttaccaac ttttcttaca cgtctttcat aacacctttg atatatgacg     76680
     tatcaccatg attaatatca ttatcattat cacaattatc tacatgaata taatagaagt     76740
     acatgaataa aatgccaaat ggaaatttta ttgagaagat tctgtcgcac ctgctgcttt     76800
     accactgagt gattcaattt cttgactaaa gggtttaaga gctgccacta aatgcggaac     76860
     cctaaagata tcttcccaag tagtagctgg aatgaaccgt aacaggttac tctcataacc     76920
     catagctatc agttcattca tgacatctgc ctgaccagca ctgacaagtt tcaactcttg     76980
     ttttatagct tctgtgaaaa gctttggtgt atcaaaagta gcacttattg atgatctagc     77040
     cctcagtgac atcttcgaat acaatggcag aacatactcc caaatgaaga tcttacgcat     77100
     ctgaacaaca ccccctggat aattggtaga atctgtaaca ccttcttgtg acgctgataa     77160
     tagtgaagct atggaattag gtgtgaaata ggatgggtat tgtttgaaga accctgcgat     77220
     tgcagaccaa ttattgaatt tggcaaactg aagggcaaac gctttgacaa atttggctgg     77280
     taaattgtta tcgtagtaag gtaaaacagt acgatggagt tcgtataggt ttgcagattt     77340
     atacctgttg ttcttcccca tatgcgttgt tgcctcgatc atagaaagaa gcgttacatc     77400
     aaatacctcc cttgtgttat gcaccttctc tgtaatgaca gttaatagac tgtaaagctc     77460
     accgaaatgt ctacagtaag gtactagggc agcaaagaaa agtggtgttt gagctctttg     77520
     taataaaggt ctaaaatcag aaatgtatgc aaaccttttc aaagttcttg tatctatatc     77580
     ctcatcacgt actttggatt ctaccaactg caaatatttg acagataaat cttctctgag     77640
     cgcccaacca tttaaaataa gatgactgag taatttttta ctgtgattca aatcaccact     77700
     cataatatgg aattctaata tgcattgggt tactaaaggg tcaaattgta attcacaagc     77760
     attagtgtag aatttttgat tcactgcgtc aatcaactga tggtatgcat tcactaattc     77820
     cttcgtgacg ggcaacctgt tcctttgcat tgataaaacg agctgtagaa tcaaagtttc     77880
     tgctactttt aattgatcaa tatcggcttc catgtgtgat ttaattgatt ctataattgc     77940
     tatcagttta ccttcagaat taacgtggtg ttgcaataag tatatataaa catcttcaca     78000
     gaataaattt ttttccctat cattgacaag ttcatccaca attgagtcaa gggcagctga     78060
     attcaaatgc ttagtacgtt cagatccgaa caactccgtc actttgtcca caagtggtac     78120
     attggatcta tgcaacttac tcggagttat aagtttctct ggttgaccct ccaaagtacg     78180
     atatatcaca ccttcagctt cttttcttcg agaagcatac ccctgtaacc atacattgac     78240
     acctttaacc gtatcgaatt tgataaatcg attcctaagc aatggctttc ctttccaatc     78300
     tgtaacaagt gcaggaacca ctttaagacc ttctaataat ttacctctaa cttctttaga     78360
     acatgccgat agctcagctg ctctagtagg tgtataaaat ggatgaatta tttgatgcgg     78420
     caatggggtc aatccattct tttgataccg ggacttttga tccaggaaaa agttcctagg     78480
     aatatgacgg ggtttcgtgg gcatcagaaa ttaactagaa cgctgaattc ctcctaaagc     78540
     atctactttc cacgctcttg caatgaatga gtattggttg attcgatgtc cctcattgtt     78600
     gaaaaatttc agacgtgcga agcgatcaat cgatagtact tgtataagtc aactcgggtt     78660
     cgagaagggg tttactatga tcatcgctac gaataatgga gggaattctt gttctatctc     78720
     tccaatcgtg catcgaatga gtttcaattg tattagctct tgagctctgc aatgtttcgt     78780
     aattcttgat tgaaactgta cttctcaaat tccaaagtaa ggagcagcaa acggcgatga     78840
     caattgtagc cggtaacatc aaccaaccag gccagcatag atcagagctg aacaccaaaa     78900
     ggtccaccag gaacgacaat aggcagatga gaaatgtggg tagtgagaaa agtgcaatcg     78960
     ataaaagaaa catgggagaa tttgccagtt gctggtgact cataagaaaa atcagtacgt     79020
     ataacgtcaa tgtaatagca aatgaaagtg gatgtaccac cagtaatttg gtgacactat     79080
     attttaagcc cgatggtaaa gtaggtactt tgtttggtgg cattggatgt ggtgcgaact     79140
     ctagtgaata accgattttc cgtgaactgc atttgtgaat attagtatta cagtatccaa     79200
     agactccata ttcaaaaccc ggcgaagtgg aaagaggtat agatgatagc ggagttgata     79260
     tgatcgcgaa caattgaaaa atgagagaaa ccgtaagcag tgctagacag aatttgactg     79320
     ctagtttcat agcaagtttc ctgaacgatt cctagatgtg gctaatttga acgctgatcc     79380
     agtgcgaaga cgtatttgac gttcggtgtg atttgatgat gaaaattggg ttcaagatat     79440
     ctaacgataa gccgttgata aaaagcttaa aaaaccgatt aacagccaca tttaaattta     79500
     atatatgtgt agagaataga gtcccgtggg ttatcgtttg gcattcttaa tggttttcca     79560
     ggggtaactc tttgataaga cgcttaatgg tcatggggac taatgtgacc taatctcact     79620
     tgctatttga gaagtatcag agctaacgtg atgaaattct ctggaaactt ttttcgaaac     79680
     gtaaagtggt tacaaattct cataccctcg ttaataagcc ggtgttcttg ttcttatctt     79740
     actgtgcttg tcgattttcg attgttatcg aagtaataat actggtgtat aatgcaaatc     79800
     accgtcaatc actagaacca tagtactggc atcttattag ccgccatcag tattccgatg     79860
     gatttgcaca ttcaatgcaa ttcattatct ttcctaagac agtgttctac tgctactgta     79920
     agttgttaac gtccaagcaa ctaatttcct aagacagaat cgcactgtta cttcctaata     79980
     cgtcagtatt ctaaaataat agcgtgattg ttcagtctcg tttccgccga tttccttttt     80040
     agtttttgga tttttgtccc tctcacttat tgggacgaat gtcaaaaatt ctcttcccaa     80100
     ttgaaattaa tcctgtcgga gttaagaact ccgttaggga cagtttccct tttggtttat     80160
     gcagggccag cctttctgaa actgaccctg catttggtat gaccgcttta cgtatggctg     80220
     ttttttttac aattccactt tagtgtatgt accattcaat taaaagggca ttgttggcat     80280
     ttcctcattc gagtaccatt cattgacgtt tgcctgcatt cccaatgaag atcaaagttc     80340
     tcccatttgt ccctttcatc ttcgtaaatc tcggacttag tgtattacta ggactgtgtt     80400
     gctggtctag gtgggttttc gagggaaacc gattgaagaa gtctcgacat aaattattag     80460
     tacattttat ctcgttccgt aaatcgtctc tttgattgca gattgtatac caaaggccaa     80520
     tacccagtaa ttggcttctt taaacactcg ccgctaccca aggcgcaaga acgcattgtg     80580
     ataagatgca tgtccagtta ttcttagcac atctgaaccc ttgattttat tcgaatacgt     80640
     aacggggaaa tctactaatt tcttgcattc gttagtgctg atatcaaaat cgattacact     80700
     ttaatggatc aaatagtaca cttatatcgc agctcctcct taaaagaaca aaatgatcac     80760
     ttaaatttat tgagcaaccg acatcttgct gcaactgcca atgtaactgc cctgttacac     80820
     gctgttcttt taaaaaagaa ccaaaacagt cgctgttcgc ttcgctcaca gcttcaaaga     80880
     aacatgcaat agttcaagtt cgtcttcccg ctcagctccc attctataaa ttcccactcg     80940
     ccatcattct gcgtagaagt atcgcgtata tgatagcggc taccgagatt ctgactcaag     81000
     cgagattacc ctgcccatca cgtgatacag agatacagcc atactactta tccaattaca     81060
     taacctacgt atccagtttg ctccccaaaa tatcgaacat attactacct ttatcgccta     81120
     tagcttcatc gtccttgtac atcttccgat atcaacctcg agtaatcttt tcgtaagata     81180
     tgactgaaaa aatcctcatc agcatctcat cgctaccacc gccgccctac aataacagaa     81240
     agataaaaac ccgtcaagca taaccgctct gctctttccc tgcccccatc gccggtatgt     81300
     tactaccagt tcaagttcat agtgatgaga tcctctccca catcctttct catgatacaa     81360
     caattctaat cggtgaaact ggttcgggta aatcaaccca aattccacag ttactcttaa     81420
     aatatggtaa aatcgcaatc acacaaccac gtagggtcgc tgcgattaat ttagccacta     81480
     gggtcgcaca agaaacaaat tcaagagttg gtgatactat tggttactca gttcgtttcg     81540
     atcacaggac ttcatcaaaa acaagatgca aatacgttac agacggtatg ttgctaagag     81600
     aaatgattaa tgataaagag ctaaagaact acgatactgt tattatcgat gaagcccatg     81660
     aaagaacagt tttgactgat ttaattatcg gtttccttaa ggaactacag ggacggagaa     81720
     aattgcgtat agttatcatg tcggctacat taaacgccga atcttttagc cgatttttcc     81780
     acaatgcccc tattttacat gttcgtggta gaagattccc agtacaacaa ttatacctta     81840
     gagaaccgtg cgatgatttg gtcgagatag ctattcgttg tgtggtacaa attaatgcgg     81900
     gggaacccct cggtgacgta ttgtgttttt taccgggaca agaagagatc gacagggctg     81960
     taactttcct cgaaagaatt ggaccggaga ttagaagtag gggattccca gtcatggtcg     82020
     gtatgccact ttatgcttca ttaccaccat cagaacaatt gaaagttttc caaaggatca     82080
     aaggtaaaca acaatcacgt aaaattattt tctgtacaaa cgttgcggaa acatctatta     82140
     cagtccccgg tgtaaaatac gttgttgatt caggattacg tagggttaaa gtttggagac     82200
     acgcattaaa cttgtctacc ttgcttaccg tcccagtttc gcgcgcctct gcacaacagc     82260
     gttccggtag agccggtcgt gaatgtgcag gaaaatgcta ccgattattc caggaatcag     82320
     attttgagaa aatgccagca gttacagaac cagaaatcgc gcgatgtgac gtcacagaac     82380
     cattactgtt gttaaagcgt catggtgtag atgatgtttt gaattggtca tggtttgaac     82440
     atccggggaa ggaatctatt ttgcaagctc ttggagaact gttactatta ggggcattag     82500
     atgcaaaggg atcgttgaca cccctaggat atagaatgtc atctttacca ctgccaccgc     82560
     agttaggtgt tgttctaata gccgccgaag ataaacaaaa gcactgcctc gacacttgta     82620
     ttgatattgt tgcgtgcctg agtgtggaga atgttctgct gtctccaccg tgggaacaaa     82680
     gggatatagt caatgaacgc cgtacagcca tctgccaccg tgcatcacgt tggggagatt     82740
     tggtgctcta caaggaattg tgggatcact actttagaac ctccttgacc ggcgatgaga     82800
     aaaaaacctt ctgccaagaa ctatacgtaa accaaagggc aatgcgacag gtgcaaaaag     82860
     tgcgggggca actacggagt ctattccgat tacatgagga tcctgacccc accgcacacc     82920
     acgcccttga gactgaagaa atccccgcag tcattacatg ttttttatct gggtacccta     82980
     agaacttagc aattttacac ccagaccgtt cacacaagat tgttaccacc ggtgaaacgg     83040
     ttcaaccaca ccctgcttca actcttttca cacagcgcaa gaccgattgc cccgcgatcc     83100
     tctacacgga atacgtttat acgtcaaaag gttacgctag gaatgtttct aggctcgaat     83160
     tatcatggtt aagttcgtaa ttgcgtaacc cgtggaaaag gttgccgttc aaccgagagc     83220
     aacaggacaa cggtgtacat ttagagtccg ttttgtccca atgacgtacc tatatggttt     83280
     tttatataca atactatata cggccagcca gccacattct ttcttatttt tgacattccc     83340
     actttctgac gtttcccctc cccctcttct cattcccttt ctccgctcca ctacgggccg     83400
     cacggcacgg cattaacatg cacaaacaca cagggtcgct ttttttctta cgcttccctc     83460
     gaatactgat ccccgcgtag ttacttggaa gcaatgctac aggctcttct tcgagcaact     83520
     agggctaaga acgggacgta cggagttgga gactcggcgt gcattctgta tgtgtgtata     83580
     gtgccgtccg tgcaaaaaga tcatataaaa ggaattgtat taacaaggat ctgtaagttt     83640
     tttccgtaat caatgaagat ataaaatatt gcaacgaaat ctaattgctt cctacttaag     83700
     tctccatctc gaaaggacaa gcttagtgat tcagccaaag acataggaca taatcaagtg     83760
     ctatggctgc aagtagtgtg agtgaaaagg atatacctcc agataaccgt catacgatgg     83820
     gggacttaga gaaaggttca ttaattgaat ccgccagttc cagtagggaa cgctattcta     83880
     ctattgcaaa aaaagaagat gggaatgaaa agcaaactta cggtggggaa actcccccat     83940
     cttccgactc tcccgttgta cgggggaacg gcgcggagtc attaccccgc gatcttcccg     84000
     agggtgattc ttacgatcag cttgggttcg aacccccaaa ggggataaag gcatacatgt     84060
     tctctagaac tgcccacgcc ggtgcaaggg gtttaagact tcgagttctt tgttcggcta     84120
     ctgctgtgat tgcgttcttg cttttcggat atgatcaggg tctgatgtcc ggtgttatta     84180
     gtggtgatga atttaacaac gaatttcctg caacgaaaga gaaggcaact cataaaagaa     84240
     ccactgttgt tattcaaggt gctgttaccg cttgttacga actgggatgt tttgtcggtt     84300
     cagtctttgt tatgtttttc ggtgaaaaaa ttggtagaaa gccttgtatt attatgggtg     84360
     ctttgatcac aattgtcggt gctaccattt ctactgttgc attccatcac gcatggggtt     84420
     tgggtcaatt tgttgtgggt cgtgttgtta ctggtgttgg tactggtttg aatacatctt     84480
     ctattcccgt gtggcaatca gaaatggcta agcctaatgt tagaggtcgt ctaattaact     84540
     tggatggttc taccattgct cttggtacga tgattgccta ctggttagat ctgggctttt     84600
     cctttattaa gaactctgtt caatggagat tccccgtctc actgcaaatt ctgtttgccc     84660
     tagtactatt ctttggtatt attcaaatgc ccgaatcacc acgttggtta attggacaaa     84720
     agcgtgttca agaagccaag tatattctcg cctgtttaaa cgattgcagc atggacgatg     84780
     acgaaattgt cgccgaagtt accatgttga ttgacaccgc tagaagattt gaaaataaga     84840
     agcgcagcat caaggatcta ttgaccaacg gtaagactca aaatatgaac cgtgccatta     84900
     ttgctgcctc cacccaattc atgcaacaat tcactggttg caatgctgcc atttattatg     84960
     ctactatttt gtttcaacaa actttgaaaa ggtctcgtac tgtagcattg atcgttggtg     85020
     gtgctttctc taccgtctat ttcttctcga ccatacctac cttctactta gttgaaaact     85080
     taggtcgtcg tcccatgttt ttaatcggtg ttaccggtca gtgtttgtcg tttgtcatta     85140
     catttgcttg tttgacccat cctactccag aacacggtaa aggtgccgct gtcggtcttt     85200
     tcttgtttat cgtgttcttc ggtttggcta tgttgccact accatggatt tacccacctg     85260
     aggtcgcttc tatgagagtt cgtgctgcta ccaatgcttt gtcaactatg tgtaactggt     85320
     tgacaaactt tgctgtcgtt atgtttacac cagttttcat tcaaacttct cagtggggta     85380
     cctatttctt cttcgcttta atgaacttca tctatatccc agttgtcttt ttgttttacc     85440
     ctgaaactgc aggtagatca ttggaggaaa ttgatgtcat tttcgccaag gcccatgtgg     85500
     aacacgctca accttggaga gttgccgcca agttacctaa gttatcaatg actgaagttg     85560
     aggactactc cagtgccttg ggtctgtacg acgacgaaaa cgaaaaggag ggtattgaag     85620
     gtggagaagg agatgaagaa ccacaggaaa atgcactttt caccgctgag ccattgaacg     85680
     gctcttcttc gtcgcgtgaa tctgagcggg ctcctcacgc ttaatcttta cttcactttt     85740
     aatgcttacc cttttctctt ttttgtctga actgcaaggc gtgcagctga gacaatcagg     85800
     gattgtaaaa atatgttgaa gttattttca tcttatcttt gttgtttaat tcacgagaaa     85860
     cgaaggacaa aaaaaatcat aatcataact ttaagctgtg caggctagtg gacagtaata     85920
     tccagctcaa tttaattatt atataacttt tcttttattc ttcctttttg tttaaggtta     85980
     tactgatcga tattttagaa ccaatcaaat tacattagta ttaaagtact aatttatcta     86040
     tcaatttata cctctttttt ttttttgttt ttgacacctt ttttgattca aaagatctgg     86100
     ccagggctct atctactcca cctttccacc tagttacatc ggtaatgtag tcctgcccgc     86160
     cgtcttcccc tcacagccgt acaattacgt cttatctttc gtgtttaccg tgctacaatg     86220
     taacaccgtc cccgcaccgt gatatttaca caccattcgc tccccacaag tgtacgtatc     86280
     gcaccgccgt tctccgacat gccacacagt atttcagaca gccgcattag ccccaggcga     86340
     gtatgcaacg ggcaagtatg caacgggcga cggtaccccg gaagtgtgcg tatgaacaat     86400
     cagccgtaag cagaaagagg ggatgtgtga agtcctaaat gggacccttg ctccgcattt     86460
     tccgtatata gtataagggc ccttgcgccg agtagcgcca tttgcccacg tcacaattcc     86520
     atgagcttaa tactaccgga ttcccgggat aacgtcataa gaactataag cggtaaaatc     86580
     ggtctactag tgccaaatgt agcttagtaa cgtatcatgc tggaacgcta ccatggggtt     86640
     tacttagaaa cgttcggagt aatattccca ctatggcggg taggttctcc ccacttgcta     86700
     gcagaccgtt gtacgtctag ttctttcgga actacgctgg gggagataac taggcgctaa     86760
     ggaaggggtc ataaccactg tttagcttga agaatggtca atcagtttca attatataaa     86820
     ctgaaggatt attctcttgc tttctagatc ccgactggtc gttttcgttg tagatcctag     86880
     ttttaaatag acacatatat acaaatagta aaagtaagaa cccacccgtt acttatctgc     86940
     tattcaataa cttttaataa cgttaacaga gacaatgggt aaaagaacac aaggtttcat     87000
     ggactatgta ttcagcagaa ctagtacagc tggtctcaaa ggtgcgagac tcagatatac     87060
     ggcagcagct gtcgctgtta ttggatttgc acttttcggt tatgatcaag gtttgatgtc     87120
     aggtcttatt actggtgatc agttcaacaa agaatttcca ccaacgaaat caaacggtga     87180
     taatgatcgt tatgctagtg ttattcaagg tgcagttacc gcttgttacg aaattggatg     87240
     ttttttcggt tcactgtttg ttcttttctt tggtgacgct attggtagaa aaccattgat     87300
     tatttttggc gctataattg tcattattgg gactgttatt tctacagcac ctttccacca     87360
     cgcttggggt ttgggtcaat ttgttgttgg tcgtgttatt actggtgttg gtacaggttt     87420
     caacacttct actattccag tgtggcaatc tgaaatgacg aaaccaaata ttagaggtgc     87480
     aatgattaat ttggatggtt ctgttattgc ttttggtact atgattgctt actggcttga     87540
     ttttggattt tcctttatta attcaagtgt tcaatggaga tttccagttt ctgttcaaat     87600
     tatatttgct ttagttttat tgttcggtat cgttagaatg ccagaatcac cacgttggtt     87660
     aatggcaaag aaaagacccg cagaagctcg ttacgtgtta gcttgtttga atgatttacc     87720
     cgagaatgac gatgcaattt tagctgaaat gacatcttta cacgaagctg tcaacagatc     87780
     ttcgaaccaa aaatctcaga tgaaatcatt gttctctatg ggtaagcaac aaaattttag     87840
     ccgtgcgttg attgcatctt ctacccaatt tttccaacaa tttactggtt gtaatgctgc     87900
     catttactat tctaccgttt tgtttcaaac tactgttcaa ttggaccgtt tacttgcaat     87960
     gattctaggt ggtgtctttg caactgtcta cactttatct acattgccat cattttactt     88020
     ggtcgaaaaa gttggtcgtc gtaagatgtt tttctttggt gcattgggtc aaggtatttc     88080
     attcatcatc acatttgctt gtttggttaa tccaacaaag cagaatgcaa agggtgccgc     88140
     tgttggttta tatttattca ttatatgttt tggtttggca atcctagaat taccatggat     88200
     ttatccacct gaaattgcat caatgagggt tcgtgcagct actaatgcca tgtcaacctg     88260
     tactaattgg gttaccaatt ttgcagttgt tatgtttaca ccagttttca ttcaaacttc     88320
     tcaatggggg tgttacctgt tcttcgcggt tatgaatttc atctatttgc cagttatctt     88380
     tttcttctac ccagaaaccg ccggtaggtc gttggaagaa atcgatatta tttttgccaa     88440
     ggcccatgtc gatggtacat taccatggat ggttgctcat cgtttgccca agttatcaat     88500
     gactgaagtt gaagactact cacaatcctt gggtcttcat gatgatgaaa atgaaaagga     88560
     ggaatacgat gagaaggaag ctgaggcaaa tgctgctttg ttccaagtgg aaactagttc     88620
     taaatcacca tcatctaatc gtaaagatga tgatgcacca attgaacata atgaagttca     88680
     agaatcaaat gataattcat caaacagctc taatgtggaa gcaccaattc cagtacatca     88740
     taacgatcct taatcatgat aataataata ataatgcctt ttgattatcc gaattataac     88800
     gatctaattc ctctttttgt tttgttgtat ttttaatcct tttggttcct ccatatgtat     88860
     tctaggaagt cagtttcatt tgaattgcat tttttttctc cctcttccac ttcgaacttt     88920
     atttctatgt aatattttta caattttatt tatgtgacga ctggtatgac tctttataca     88980
     taagaggtga tcaagagaat atataatacg aacagtttta atttttcaac gtagctgtag     89040
     ctgtccttcg tcctcttctt cttcttcgtt taaggaaaaa cacaatcgga gagtaataag     89100
     aaaatgaagt tttctagtgt tctcaagcaa agtgctaaat atgctgccca tgttcccaag     89160
     agtggtgtat ttcctcgagg tttccaagtc ggttccatag cgtctggcgt taaaaagaat     89220
     ggtaatttag atctaggtgt attggtcaat accaacaagt cttatgaatc ctcggcagct     89280
     tccgtcttta ctaccaacaa atttaaagct gcacctgtta tattatctca gagagtttta     89340
     gaagaaaaaa atggtaaggg tattaatgct attgtagtta attccggctg tgcaaattcc     89400
     gttactggtg aagttggtct tcaagatgct actcaaatgg ccaagctgat tgatgaaaaa     89460
     ttgggtgcta cgagtccttc tacacttatt atgtctaccg gtgttattgg tcagagatta     89520
     cagatggata agattagtaa aggtgtttca cagctttttg ctaacaattc ctttggtagt     89580
     gatttcaaca gttggttaaa cattgctaaa tcgatttgca ctactgatac tttcccaaaa     89640
     ttaattactt caaattttac tctaaagaat ggtactcagt ataccttaac tggtatggct     89700
     aaaggtgctg gtatgatttg tcctaatatg gctaccttgt tgggttttat cgttacagat     89760
     ttacctattg agagtaaagc attatctaaa atgttgaaat ttgctactga tcgttccttt     89820
     aactgtatct cagtggatgg tgatatgagt accaatgata ctataaatat gattgcaaat     89880
     ggtgccgtca agacagatga aattacagag gattcacctg aatttttgca agttcgtgac     89940
     caggtgactc aattcgccca aaaattagca caactagtgg ttcgtgatgg tgaaggtgca     90000
     actaaattcg tcaccgttaa agtgcaaaac tcttcaacat ttgctgatgc taaaatcatt     90060
     gcagaatcga tttcaaactc tatgcttgtg aagactgctc tttatggtaa ggacgcgaac     90120
     tggggtcgta ttctttgtgc aattggttat gctaaactgg acaatttaga ttctttacaa     90180
     actgacaaat taaacgttag ctttgtcgct actgataatt cagaaccaag agaattgaaa     90240
     ttgttggtca atggtgttcc tcagttgaac atcgacgagg aaagagcttc acagatcttg     90300
     gcattacctg atttggaagt gctcgtagat cttggtactg gtaacgaaga agcccaattc     90360
     tggacctgtg acttgtccca cgagtacgtt acaatcaatg gtgattaccg ttcttgagaa     90420
     aggggtttgt aaaatacgtt ttttatttca taattataat aataataata gtaatagtaa     90480
     taattataat acatttgcta tataaaaatc atggagtaaa aaagttatct tacgatatat     90540
     cattttgggg atggtaattc tacttgatca tttaaatagt ttatcaaact ttgagggtct     90600
     aataatggag ccttgaaata ttgtctcttg ggcagaattg ctaacacatt aatgatatcc     90660
     tcaggaatac caattttatt cttttgcttt ttatttgatt gtaatttgtc ttgagtttca     90720
     cgagttctct ttaatgaaga tcccgttaat tctgtcaaat ctgaagatga caatagatcg     90780
     tctgccagat atgttagttc taattccttt atcagatttt cctcttgaat tctataacga     90840
     tcggtaaaga tttcaatcat attctcctga ggaaatcttt cgaagaatct attctctaat     90900
     gaataaacgt tttgtaaatt accaaatttt gattcataac taatcatttt cttgtaaatc     90960
     gattttaaac cggttaaatc ttgaatcttt tctactgagg tttcaaaaag tgtctttatc     91020
     tgtgagtctc tattgagcag aattaaaaaa tccaaatatt tgttcacgta aagagcatca     91080
     gtttggaaat atttgagtcc caattctaaa actttacatg gtgttttgta gtcattttga     91140
     ttttgaaatt ccaaataggc attttcgata taaatatcat gggtcaatat cctttttaat     91200
     ttacgacatt ttccaaatac cattcttgcc gctgataatc ctgccaacct tttcatcgca     91260
     ttcatataca cacaaaacac gaatgtcaat ttttttcttt gcttgaaaac tggcatgctg     91320
     tcgtcatctt gctcatttgc catagcttgg taaccttgca ataacgcatt cgtacaatct     91380
     tcgaaacatc ttttcacctc atcaaattta ttatcagttt cgtaggactc tgcaagttta     91440
     aaagttaagg agggggaatc cgaatttgcc aagactgcag tatataatat ctgttgacgt     91500
     tcagatacgt ccggaatgta catagcatag tcgtaccaca tctctgcagc aaaaagcatg     91560
     tattggacgc tttgtttgta aatgtaagtt attcttctat tcaataaatc ctggttcaat     91620
     gacattttgt tctccttttc ccaatggatc caatttaacc agatttgcag ttgactcgga     91680
     tccattcctt cccccgtttg aggaacgttg tttttattgg ctgtcgaaac actaactgga     91740
     tatgaccttc ttaacccctt tgtaatgtga gaccactctt gatacaaaga tctagctttc     91800
     atatattccg acgataattc accaatgaat tttctagcgg ttaatgaatt cacatcttgt     91860
     tcccattcag tataacgatt ccacattttt tcaatatttt caaatggaac acaaagcatc     91920
     cttttgtaga gggtcctaat catatctaat cgttgttgtt cctcccattt attgacaggc     91980
     ttccattgtt ccaaaaagct cagataatcg ttccaaaatt gtgaggactt aggttcaaaa     92040
     attgcacatt tatccattac taattcaaat gcctttacta caactgctct tgcctcttga     92100
     ccacctgtaa ttaaattgtt tctccggcga acgtaatcca aataagtaga ccataatggt     92160
     agatcgttat tcgccaattt acctgaaaga cattgtgcta acattttttc cacgaattca     92220
     aattcatccc tttgtaattc tcccttcaac tgtaaagtcc atagtggtga atatgtgggg     92280
     aatttatcat gtaaactgtt ataaacttct cttgactctt gaaaagaatc cttagattcg     92340
     taatactgca ctagctctaa atatggtaat atatctgctg gatttaactc gatcttacga     92400
     cgaattccat taactatatc gttatcacct tcattccctg gcaatccatt tggttggtta     92460
     gtccctaccg aaagttcagg tgtagcagca ctagacatct ctaggggggt cagggaaaga     92520
     cgactaagga ggttataggc cgagggaaaa ggatcttttc taacaaagac cttattcctt     92580
     gagattgggt tggtagttcg tcgagtttct ccgtattacg gtggttggtg ctctttctac     92640
     agcttgtatt ggtgatgatt tggtgaaaaa ttctaagatg cgggttacct cttcgcatta     92700
     tacaatatga attataaagg taggaaatca gttaatattg gacccattgg tcatttttga     92760
     gcagttcaaa gtatcatgag tgaattcagc atatccgttt acctttgggg tgaaacaggt     92820
     aaaccgagtt tagtgtcccc agagagtatt gcactctttt ggtttttgaa cagttactat     92880
     ggggattaca agtcaataga ggtagtgttt gccaataata cagatctttc ccctaatgaa     92940
     gagttaccac ttctcgtgga aaatggtaag aaatggtcgg gatttgttga tatagttagc     93000
     tatttgatgg aaaagatgca aaataatgat gatgtggaaa ctacactctt gaaagatggc     93060
     ttattagagt ttactggtga attgagtgtg ctcacagagt accagatgta tttgaataaa     93120
     atcaactatg aaacttttac tcgtaaggcg ttttctcagc tgttgcactg gcctatgtgg     93180
     tataatactc cgatgaatta tagaactaga gcaagacaga gatgttcaaa caccttggga     93240
     tatttgatgc acgatgatga tcccgatagt ttagaatcgc tcgaattaga atctacacgt     93300
     ttaccacagt ctaaggcatt ccaagcgact caagatcgta agatgcgcag taaagaggaa     93360
     ttgcagaacg ttaaacacaa tttacaatat ttgacaagac ttaaggatta tctaaggacg     93420
     tggtcacagg ttaggaatag tatcccccac caaaatgata caattccagc ggactttcta     93480
     ttgtgggcta atctgttcgt acagttaaat ctaccagacg gcgagaaggt aggtcagcag     93540
     gttaaggatg cggttaatga cgactttcac cagcttgttc aaagtaagat tgatcaactg     93600
     tcatctttgg aacctcgggt gttccaaagg gaccccattt tccaagaaca aggcaacgtc     93660
     atcatgtcaa tatatcacta cgtgcataaa ttcgtttaat tcagttttgt ttagttcctc     93720
     ttgggtttat gtataccctt atagacaaaa taaaacatta cggtaccatc agaattagct     93780
     aatgccagtg taattctcct ggcatctggc gggcatagct gatcaaatat aagatctaga     93840
     catttgaacg tcaactttcc agccttgtac tgcgacatct caatgggaag tacatattct     93900
     atcccatggt cgttttcgtt tccaccatca tcgtcgttac tcagtttatg gggtggttta     93960
     ccttcgatga tttgtaacgt ttggccctgc cattcaactt gctcatctct tgtcctcaat     94020
     tgctcccaca gttgggcgta tgccaagtta tcccatacta acctaaatgt ggactcacca     94080
     attctattgg ttacatctgt ataatcagaa tccatacttt gaggtctttt ataggttaag     94140
     caagcggtta tttaaccatg cgatgagctt caacaatttt tcactaaaac ttcgcatgga     94200
     attgcttatt tcaacatgtt caagaacaac agtacagaaa atcatctaag aatacaagat     94260
     atacttctgg gcgacttttt ttagaccgtt gaaggtagtg tttgtttgaa ctaacgcatt     94320
     aactttgcta catgagaagc cgttttcaga ttttagccag tttcctgctg tttttactac     94380
     acattaattg ggtaaatggc tataggccaa ttgtacaacc gggagagaag ttaactacat     94440
     ccgaagagcc aaaaccatgg tatagaacca tttatggtga caaagtagag attgtcacac     94500
     ctaccgttgt tgcaggtgtt actttttcac gtaaaccatt agagacgcct gatccattgg     94560
     aaccatgggt ttcattaaat aaaaatggta tacctaaaac tatcaagcct gaaattaaga     94620
     atggtagaac caagaatggg catcctgatt actccacctt tttcaaagaa gttcacacca     94680
     aaactcttgg ttatgatgat ttgaaggcgg agaatatgga ttacggtgat gtacatgagg     94740
     aagaggtttt tgaagatgaa gatgagactt atacttcttt gaatcccatt gttagatgta     94800
     ctcccaagag gtattttaat aagggccatt ccaagaacat tcccagtgaa ccattttgta     94860
     ctccacatga agattctatc tggaatgtgg gtaaaactta tttcttgacc tggtatactc     94920
     acttcttcag ggatgaacat tcgaatgaag ttgtcgaaag agtcaggatt catatggcct     94980
     acatcagaga gaaatctaat gagaagggtg ttttgaaaag agatgcacca tctgctactt     95040
     ttttccattc tgaatggatt aaaaatgcag acggtgttta cccaatagaa attcttcacg     95100
     aatggttaca aggtgtaaga actcgcaaaa ttgttatctc tgtgcaacca gaaactgtat     95160
     cggatgcaga gtttgatcca ttgacacacg gtgtatttgt gtatttggat gaaggtagta     95220
     gagtctacaa gcaaactaat aaagaattgg cattgaatga tgcgggtatt actgatgata     95280
     aatggtacta cgtggtggtt tcaattccca cagccgtgat tgttgcactt gtattgatgt     95340
     acttctttat tattgccaat cgtagataca gtgatttttc agaggttacc aacaaggcat     95400
     ggcaaaagaa acatcgtgtt ctaggtaaag ttaccgattt taagaagtac aaaaacatga     95460
     agaatagacc ctactcagaa ttgcctatgc ataataaggg aaatccaggc aaacagagtt     95520
     aatatttatt taatagttta tgtataaccc tcaaatccat ttctgtctag cggcaacttc     95580
     acaaattttt tccagtatga taacacgggg atccggttta aaagaatgta ataattcacc     95640
     accgtcacca ccgctttcat cgagcatttc atcgttagtg ccattttgag actcagtatc     95700
     gccatcatca cctacatctt caatgtagta gaaaaatggt tctagtacga tcattatttt     95760
     ccaaaaattg atggatccac agttttggaa aagtacatcg attaagctag gtaaatattc     95820
     caattcgacg tattcctcag cgcaacatac aaattcatcc aattcgtaat cctgttcatc     95880
     agccgatagt gtcgaataca tctctgatag cagagtcaat tctttactga tcgtcttggg     95940
     gatatcttga cgcgcctgcc ataacaattt ttgggctctt tgtaatcttt cctgcgtaac     96000
     acaatcacca acctcatatg tttctgccac acttttgccc aattttaatg gatccttcgt     96060
     atcaccaggt gctggtaaaa acccattgtg ttcacttttc tccattagtt cattatattc     96120
     attgtacaat gaaataatct tcatcattgg cttgtacaac tgttggcaaa ctttcatttc     96180
     agaatgcggg acaatcactt gctctaaata gtggttcatt agtccctcca taaaattggc     96240
     ccaaatggat gaaaaaacgt aattctcatc ataagtagac tctgtaaaat cttgattaat     96300
     gttttgacgc ataatatgtt ccgttagtga aaagattgca ttttttttag tatcattttc     96360
     cgttttatta tggttgtggc gatttgaatg tgttttatta tccttgtcct catcaatatt     96420
     cgtagtggca ctatcatcgt tttgatcctt atccatccag tattcgggac cacctctttg     96480
     agacagagtg actagcaata ggaagaattt gattttaacc catggtccta gcgaatggac     96540
     gtagttatcg gatatcttat tgacgtcatg atcaatcttt ttgtggatac acttgatgaa     96600
     tttctcaatg tagtggctct tacgaatatc atatttctcg ttgagatatt cgactgaagt     96660
     gatcaaattg taatcagtac cttcaaaatc catacacttg ctaaatctga atcttttttt     96720
     cggtctcgta gtcttgggtc tacgatggcg atgcatatta cctcttacca agttcctagg     96780
     ttttcgatca tttgtcttgc atggaggtaa accacaattg caagtacact cttctcgtct     96840
     aacttcatcg gaggagagca tatcaactgt attacttggc cccttccctg tttaatactc     96900
     gtttgattct taaccttgga gtgacaaaaa gtcgatcttt atatgtatat taaatattga     96960
     aggcgaattg acaacgaaaa ataggtgaaa aatcctatgt acaaagatgt aaagacattt     97020
     agattctgct aatattccct tacgttaatc atgagttaat actaatcaat agaaattata     97080
     cttatagtca taataatatt aacagaaata gtatagaatc gaaggtcttc tgtgtttaaa     97140
     ccattgagag aaaaacagga aattagagat aaagatgaat tattgtagag ttttgaaaaa     97200
     ttatttggaa gaagttttag atacttcttt ggtggtttcg tgatcccgta atttttgttc     97260
     ttcttctagt gtgcctcctt cagacttgcc agattttgca tatacttggt tagtctcaat     97320
     ttcttcatca tcgtcttctt cgagcaaatc tgttgcaggg atctggagat cctcgatgac     97380
     tttctcctcg acattttgca aatccatgag accatagatg gtaattgtaa ttagaccaag     97440
     tacacccgcc acgcatgaaa atacaaatgc cacataaccc ttggctgtga atccacttgg     97500
     aattgatttt tcctgtttgt tttcaagagc caaattgaac cagtctgtgg tgccagcagc     97560
     attaccttca atggggacac cagaattttt acaaacgcgt ttatgggagt ctgttaagta     97620
     ttgcgatggg ttggattgaa ttccttctgg atcttccaca agaacaattg ctagcccttg     97680
     tatcaaatgc cattcgatgt gacagtggaa aaaccaaaca cctggattat cagctctaaa     97740
     tctaatgacg aaatttgatt gcggtcttac gtaaatcgta tctctcaaca ttgggtattc     97800
     ggggaaactt gtatggttct taggatcaaa tggaagcgga ggatcgttat catcaacagc     97860
     gcctgcacga gcaattgttt gaaagacgtg accgtgtaaa tggaatgggt gggtacctgt     97920
     atcttgactg ttgagaacga tttcgacgat ttcgtttctc ttcaagacaa aggtattcgt     97980
     gttagtacca tagatgtaac tgttactggc atatttaccg gcagatagaa cagtcatcaa     98040
     agtggggacc tttggtgtag tataagtgat attgttgaag aaagcatagt ttttaccact     98100
     gattaaatta tccatggcca ccgtcaattc aattctgtga tctggttctg gtagcaattc     98160
     ctgtttatga taaggcacca aatagaaatc atcgaggaaa ttgtcaagag aattcacata     98220
     tgcttcttcg ggcttaggtt tactggaatc gtaagtcata taagaagtct ggtttaacaa     98280
     caaatgtttg ggaatcttat caagcatgct atcgtcgtat ttctgcataa tagcataatt     98340
     tttatcctta ttatccttcg tcctcaccag aacagaatac ctctgagcaa cggtgatata     98400
     cagcatatct gtcgcattct tttcggtaac gacaccatca acttcaacaa cctccatttc     98460
     gtggtcttca agccagaaat attgtgagac gaacccaccg gtattaacaa tacgtaacag     98520
     ataagtctta ttgggttcca cgttccacgt caagtttctg gtattattga tcagtaaatt     98580
     ttgtgggatg ggttcagcac cagttggatt agtcaatgat aagaaagctg gtttcaactt     98640
     agccacagtc tgatcgtacc actcaccaat ttcaagcaac acttcttcat cgtaatcgta     98700
     ggggaaattt ttgttatttt caccatcatc aatgatgaat aaacctctca taccatcttc     98760
     atactgagca tccgtgtgcg aatggtacca gtaggcacct gcattgtcag aaaccgtaaa     98820
     gttataggta aaagtatcat tagggctgat tggacattgt gttaagaatg gtggtccatc     98880
     catctgagtg gaaccatttt ggaacatacc gtgaacatgt aaagtagtat tagaatcgtt     98940
     aaacccatta gttaaattga taataactct gtcgcccttg gtgacacgaa ctgatggcca     99000
     aggaaattca ccattacagg taaccacctc tcttctcttg ataccatctg gattggcgta     99060
     accccatcca gtggtccagt tgtaaacatg agtggcacct aaaacctgct ggaagagcag     99120
     aaacactagc gccaagctta gaatcatcgc agtccaaatg cactcagctc gtagtgatgg     99180
     atgataagag ggaactatat aacgcgatgt taaaagcctt gagtcttttc aagcaatggt     99240
     gaaggtggct acggtttaaa taagaattta tgaggtatga agagaaatat aatttgagag     99300
     aatgggtcga gtatgtggca agcgttgcac ccgttgcaca catggtctta gtatcacttg     99360
     tgcagaggaa tacaaaaaaa aaaaaaaaaa gttgttgatc aataccggtg taaatgttca     99420
     aaagaaggaa ttcgttcgtt aattagaccg gatatgacgg tactgcacga cttcattagt     99480
     ggggaaagtt cggttgtgca cccttcgaaa tactgcaccc attttcgaga aaagagtccg     99540
     aagattgata tttaccatag atacaagtat tatgtgcgcg aaaacctgta gtagtaaggg     99600
     tcgtaaaagt aatagtaata agaaatgaaa agtatgggtg attctcccat agtgccttgg     99660
     aaggttggtg ctcgatgaat tgtatgagaa ttaatagaaa gatatgcagt tggtgtgtgg     99720
     gtgtctgacc aacgaagtgt gtgggtgctc tgtagatagc cgctgaggtg gggaaatagg     99780
     aggaggggag atgggcggca agacgaactt gaactccaac ctgtaagcga agcgaacagc     99840
     aactgttttg gctcttttca aaagaacagc ttatcgtcaa cgcgacggcg gctgcaacac     99900
     caacatttct cactcgttga cacacctcgt tggacgtcgg cggattgttc ttttaaaaaa     99960
     gaaccaaaac agctcttact cgcaacgctc gtaatcttca aacatacaat atgttaacgg    100020
     gctcatcaca ggcgctctgc cagcaatgaa ttcttatggg gttctatata tgcatatatg    100080
     tctccttcct agcgcgtgtt gagccgcttg tatttatttt tcgttcgaga acgggccaat    100140
     tcgaacaaac aggtgagaaa aagggaacgt taacccagta gacgactgca ccatgcagga    100200
     tagacgagtt ttctagttgt aactcgtaac tatcacaatc tgtaagaagc acttgcggtc    100260
     ttcatcgcga tcaaccggct gtcaggtaca gttcgtggga tcatttaacg atttattccg    100320
     gcttttagcc atcgctttaa gtgacttctg gacttggcgg agccgtaaat cattgtagat    100380
     ctcgtaaatc aaaaaattct cgcatgaaaa accaacacca ttaatttccg gcctgtatag    100440
     attacgcgaa gagcttcttc accctcttca caataccatt gtttccacga ttggtgcttc    100500
     tcttagcgct accgcccctg aagctgcgga acgttctcga tatcgtcgtt gtgtcagcat    100560
     gctcataatt atctgtaggc ataacttgag aatcctgtgg tgtcaccaat tcgtaaagaa    100620
     ccaacttttc gctgttgtcc aacggacgtc caacaccttc gtaacgagtt aaatatggac    100680
     cagtgtattc agtgcttatc attgtaattt gtatttttgt tgttgttgtt gttgttttat    100740
     ttcaaaagaa ttgcaagaga tctattgatt ttaccatgat gaaattcgtt cacattatat    100800
     atgatgggtt ggttcttgtg tcggatccct tccgatagct gttgtcttgg aagtgagcca    100860
     gtagatctaa agcttcttta ctaagaaaaa gcggctgaca aataagctta aacgttccgc    100920
     gattccattc ggtaaccgct ccttctggta ttagttgttc ttttttttgg aagcttttga    100980
     aaatctatag aatcgtaatg cgtgccccac aaggtttcgg acattttgag actatcatgt    101040
     atacgtcatt cgcttgtaac tttttccaga acttctacaa acataggtaa ttccacgctt    101100
     ttcacaccaa attttttgcg agaaaaatta aaacgtaata agccaccgat tgcttattac    101160
     gttgctaaac aaaagcatta ttcttgacgt aattgaattt atctgccttt atcttccggt    101220
     taaagtgtct gagtgtccca aatagggtgg caacggcaag gaactgatat ctagatatgc    101280
     tatgctgaca gtgttgtcca gggtgtcgcc gatgctgtca aacaaataat attcattcga    101340
     atacctaact agtaatatct ttctaggacc taaaatagcc gctgagcata tatgtgggtc    101400
     atctcatagc gccgtgtaga tcatgtgcgg cgatacaaat ttgtgaagca aaactccgag    101460
     agacccataa aggataatgg gggttaggga ttaaggagca ccagggattc catcctttga    101520
     tcttctgctt ttcccccagc aggtaccaga aggtctccaa agggtctcag gggtgtcgta    101580
     tataagagta agttgagaga ttcgaaactg ggggaccatt tgtagtttca tctctatgtc    101640
     gtaagcgatt tcccaaagca ccatgcaaca agacttcttg gtaaacttcc tcatgggtgg    101700
     tgtgtctgcc gccgtcgcca aaacatgtgc agcccccatt gagagagtga agcttatgat    101760
     gcagaatcag ggtgagatga tgaagcaagg cgccttagac agacgttatg ccggtattgc    101820
     agaatgcttc acaaggacta taaagactga gggtcttctt tctctctgga gaggtaatac    101880
     tgccaatgtt ttacgttatt tccctacgca agctttaaat tttgccttta aggataagat    101940
     taaggcaatg ttcaatgtcg gtagagacca aggatatgga cgctggttaa gtgctaacat    102000
     tgcatctggt ggtgctgcag gtggtctttc tttaggtttt gtgtattcct tggattatgc    102060
     aaggacaaga ctggcagccg atgcctctca tcacggtgca gaacgccgtt ttaaagggct    102120
     ggccgatgta tacaagcaaa cttatgccac tgatggtatc cttggtcttt acagaggatt    102180
     tgcgccttct gtggtaggca tcatggtcta cagaggtctt tactttggtc tctacgattc    102240
     tataaaacca gtgcttctca cgggtaaatg ggagagatca tttccggcat ccttccttct    102300
     ggggtgggtg gtcactacag ctgcttctac tgcgtcttac ccattggaca cagtgagaag    102360
     acgtatgatg atgacctcag gtcaacagat caagtacaca ggtgcttggc attgtttgac    102420
     tagtatctat gagcaagaag gcttcagagc attcttcaaa ggatgcggtg ccaacatagt    102480
     aagaagcatt gcagcggctg gtgtcatctc actgtatgat caactccagt tgttaatgtt    102540
     tggtaagacc tttaaataag tagacgaagc gatgagatag gtaactatat ttacaataaa    102600
     tacacatgaa cactctaaga ttcaccattg gtaaggctta aagtaaccat caaaactcga    102660
     tgagttccat tgaaagattt ctttcgcaac caccgcttat tatacagtct tcattggctc    102720
     agttgcgtta tttggttctt agtgaaggtt taccgacagg aaatgacaag aatatacaga    102780
     ggacaagatg ttatacgtgg tcagtcttat ctagaacttc gatggaacgt tgcacacaga    102840
     tatacatttc atatgtgcag ctaggatccg ccccccagcc aatttatcat aagatcaaga    102900
     atgatacctt tagaacttta caaacagatc ccaaattcat aactacagta tctgaagacg    102960
     cattactgcg atgtctttcc agttttgcat ggcagtgtat tgaattgaaa aacgtacaag    103020
     atccaagatt acctcctcaa ttgagtactt atgtgcaggg aatgaacgtt ctattagcac    103080
     ctttacttta ctcatgcccc tctgaaccga tggcatttca gctattttcc acgttatgtt    103140
     accaaataat ccctacctat ctgaacagta atttaacagg tgttcacaat ggggctaaat    103200
     tgttggacat atgtctgaag attattgatc caaaattgag caaattttta agtgataatt    103260
     tgctaacagc agagatctat gggatacctt ccatcttaac gttgtgcagt tgtaataggc    103320
     cattagatca agtttgcaaa ttgtgggatt ttatgtttgc atatggattt cacatgaata    103380
     ttcttttcgt cgtggctatc ttagtgacca ttagacacca aattttaaga tcagaatcac    103440
     caatgaatct actgactaga caactaccag aatttgacgc tgacgaaatt atcaaactag    103500
     gtgttggatt tctcgccaaa attccgcaaa gtgtttattc tttactggtg gagcatttaa    103560
     caaacttaaa catcaagatt ccatataacg attattaaag gaaatttaca tatattataa    103620
     aatgcccaaa gtctcaaaat cggattctgc cacgtagcag caaagtacac tacgtccatt    103680
     gaactttcta tgcggtaagt tttccatggc tgcttcagca gattctacat cctgaaattt    103740
     aacgtaaaca tttccaacgc cttctccaat gcgttccaaa ttgagtctaa agtctgcact    103800
     tggctttttc atccttacgc tttccacctt gtgcagcgta gattctaaag ttgttttcac    103860
     ttcttgggca aatgcttcta gtttcaaatc aagcggatca acaaggttca ttagcagcaa    103920
     cactcgtgac ggtactctaa cttgatctgt agccaattta ggcaatcctt ggaaagtcat    103980
     gtaagatata ttttgcttca tgtgagattc attaggttta aaccatcgta aacttccgtt    104040
     cgcagacggt tcttcttcca cttcaactaa tgcacaacct gtaaataatc tttcttggtt    104100
     ctcttgagaa attgtgaata tgggctccat gaagactact ttgaaaccct gatcggtcaa    104160
     ttctttttct tcaccatgca ccaggccttc taccgccaaa atttcaggcc cacataacct    104220
     ctcagaacta tctacctgtt gaacgtattc ttgcggtctt tgccaatcac taccatcaaa    104280
     atctaattcc ttggatataa aagaacgaca actgagtact attgtagtgc agacagcgtc    104340
     attaaattcc aatactaggt gggacggtcc ctgtactact tcttttacat gatactcacg    104400
     atctattgct tgtacaaacc cattcaaata agcttcgatg cgattcaaat ccattgaatc    104460
     tgtagttcca cgtacaatta ttctacaaga cattctggaa aatatcaaat ggttaccatc    104520
     tgcatcctcg aaaagaatcc ttgtacgccg attattagtt cccccttgtg caataacttt    104580
     ctccaacttg tcacgatcta attcatgagg tttaccaggt tgtgggaata atttacttag    104640
     ttttgctctt tcagttggca cgctttcaaa accctttgga gtaatatccc attttgttgg    104700
     tctcatcctc tttctttcac ctaacggtac cacatgggca agatcctcct ctctaaattt    104760
     gcctacactt gtattggagg ccgcattacc ttggtatcga ctgtactgtg gcctaggagg    104820
     gaatcttttc tgttgctgtt gcgcctgata ccttgatctt ggattgctct gatgtctctt    104880
     gggataattg ggaccggagt agccattttt ataaccccta ctcccatcat ctctattcct    104940
     ctgtctttta ttattatgca tttcatcacc ggccaaagcg gttctcttgt tagaacttgg    105000
     ctcgttactc atcgacgcaa taatcttgga tctgagatct tctaaggcgt gttcattatc    105060
     atcattcccc atagttcaac ggttgctaat gtccacagat attcctactg cttgctggtg    105120
     atgataatat tgcttactta tgggtattat tttctgacgt gacgaagttg gaaaagtttt    105180
     gaacagatca ttaaaactta aagacgtcag gaatcatcgg aaagacagtg gaacttgtta    105240
     ttttgaagct ttcacgttcg tgaaattggt gagattcaat atgaggaata gtatagttct    105300
     tttgctgatt tccatttggt caatttggtg tcattttacg cttgcagcgg ttgttggtgt    105360
     cgattatggc cagcaattta ttaaggcaat ggtggtttca ccaagagccc ccatggaatt    105420
     gatctttaca ccagaagcaa agaggaaaga aatatcagga ttagctataa agagtttagg    105480
     tggtgacaag ggggaaattg aaagaattta cggatccgcc ctaggttcca tggccactag    105540
     attccctaag aatactcttt tgcacgtcaa atctctcctg ggtaagacta ttaatgatga    105600
     aggagagatt tctacctatt tgaatgagca tccaggtatt gatattgttc ctaacaagag    105660
     aaattcgttg tcatttgttg tcggtgatga acaataccca gtggaggaag taacagctat    105720
     gaatttacaa gagaccataa acagggccaa tttattgctg agggaaaagg atcctagtgg    105780
     tagtgatttg gtagataaat tggctcttac ggtaccagaa tattttgatc aatatcaacg    105840
     tagggctcta ttagactctg gatccttaac tacggatgca ttggacacat atttagttcc    105900
     agatggatta tccgtggtaa tcaatttcgt attaaagaaa agagatttca aaggtaaatc    105960
     ttactacgtg gtttacgata tgggtggtgg ctccacaaaa gcttcgttgt tctccattga    106020
     gcaaccagaa aatgaaacag aaccattaag gattgaattt ggtggttatg ggtatgactc    106080
     tcaattgggt ggttccaact tcactttgca agtggctagt ttgattgaaa acaaattttt    106140
     atccaaacgt aaagatatta cagctgaaaa attacatcgc aaccctaagg cagtggcaaa    106200
     aattgtacaa gcagccgaaa aagctaaatt aatcctgagt gccaattctg aagcttctat    106260
     tagtattgaa tctgttttgg aagatgttga ttttaagaca aagatcacta agcaagaatt    106320
     tgaggattca ttgagtgata gtgcttctga aatcgtgaaa ccaattaaag ttgctttaga    106380
     tggccaattc tgggatgaaa aaatcgatcc taaacaagtg tcaggtatca ttctaactgg    106440
     tggatctagt agggttccta tcgtacaata caaattggcc gaatatatgg gcgagaacaa    106500
     aatactcaag agtgtgaatg ccgatgaagc agctgtagat ggtgctacca ttagaggtat    106560
     aaagcttttt gaagctttca gaaccaaacc attgaatatt actgaacgtt ccatttctga    106620
     ttatgccgtg actttgaatc aaaagggtga aaatgttgtg gtattcccca aaggtacggt    106680
     cttccccact aagaggactt tggaacttgg caatgcaaag gatcttccaa aagatttcga    106740
     tattaaatta tgggaaaatg gattaccatt tcaatctgtg aagaccaaga catctggcgc    106800
     agacgatatc tattcacccg aaaaatgtcc taacggcgtc atctataacg ctaccttctc    106860
     aatttcacaa aacagattat tcaatttgga taaagttgag gctatctgct tgaaggatgg    106920
     gtcctcttcc gtagaaaaac ctcagaatga aactggtaag aagagtaatt taggctcttc    106980
     taaacgttca gtgaaattga ccatttcgag tgaaggctct aatattaagg ccatgtcttc    107040
     agatgagcag ttgagactca gagaatatat tagaattcta gatcaaaaag atgccgctag    107100
     atttgaactt gaagaagcaa agaatttgtt agaagctctc ctatatgatg ctagatctta    107160
     tttggaattg gaagaggttg tagaaaaagg acctcaaagt tacttgggca aattgtccga    107220
     ggcagtcacc aaacatttgt catggctgga agatgaggct gatgaaacta ctaaattgga    107280
     agtcattcaa agaagcagcg aagtgcaaca gctaagagat aaactggaag catatttaca    107340
     gtcactttct gagcccctag attctaagca gttccaaagc attctaaaca atgccaccaa    107400
     gcttttagag caaattgatt taactcaaat aaatcagcaa gaacaagtcg cttctctaaa    107460
     ggataaattc gaagaactgg gacataacgt tgaagaacag tacgcaaaga ttaaactgcc    107520
     acatcatatt gctgcaccat tgagcagttg gaacgatacc gtttctgcat tcaaggaagt    107580
     gattaaatta gttgaatacg ctaaatctag tgcctttaaa aagatgggca gggaacaatt    107640
     atttgaaatt aaatcagcct ttgacatcgc atccgctgaa ctggaatcta taatagatta    107700
     ttttggtaag gctcgtgatt atcgcctaca tgaattgcaa gcgtggatac agaaggctga    107760
     gaagaccaag aaaagaaagg aggagagatt gaaaaagaag atggaggaca aggaaaagga    107820
     aaaggagtct aagagttcat caactgtttc aggtaatcca agtaccgctg aaagcgaatc    107880
     ttccacagtt cccactacta caacaactgc ttctgcttct gcttccacca cgtccccaca    107940
     aaacaaacaa gggacaagct cttcaaccgc cacgactcca ttgcacgatg agttgtgaat    108000
     gtttttcatg tcattccatt ttttcctttt tcataaacat ctttaagtca tgtacacact    108060
     gaaatgtaga tacaagttaa ccgttattgg ttcaaaatgt ttttcataat tttatcaatt    108120
     gcatcattat ctatatctgc ttactgtcta ttcaacgaga tttttaaacg taaagggttc    108180
     atatgggtat ccatcacctt caaaaaattt ggacattgct tccacccagt gtaaacgtag    108240
     agagtgcagc atagccgatg taccttccat gagcaccagt atgcatacag taagaacgaa    108300
     ccacatggcg aaaaggagaa ccactctagt cacagcaagc ggcgagccgg agtttttagg    108360
     tgagaatgca tttttgatgg tcatgtccca aagcacactt gacaactgag catgtgccag    108420
     tgatagcgcc catagacgta agtaggatgc cgtgtgggaa atgcagttga gacagaattc    108480
     aatcgtgtga attacttggt ggatcataac ttcaccaaaa ttgaattctt cattctcttc    108540
     gtgtccatgg tagtccgtga caatcatccc atcaccctcg gtagcctgta gatctgcagt    108600
     caattcatca actccttcac ttctgtttac tgattcgtac ccattcaaac taactccact    108660
     atgttgcttc ttcaaagtaa gtggtttgta taataacaac caaggaatac aagcgagagc    108720
     tgcaagcaag aggagaatct gtagaacatt ttgaccggaa taaagttgat catctatgtg    108780
     accaggtgat agaaacatgt ttatcagcat gttcaataaa cttggtgctg gtttgttgtc    108840
     tttgatccaa tcctttgacc atttgtaaag gatggcccat gtcaagtatc cgaagataga    108900
     ttgcatgaat atcaaacctg gaagaaaatt accaatgata tccaccctcg actttttgta    108960
     tctataattg accaaagaga acatgaaaga ataagtcatg tgcaggaacc ccatgatgac    109020
     agataatttc attttgtagg agttggtata aattaatccg ttgtctgtac catgccaggc    109080
     atggtccaac ccgaatgggt acgtacccgt ttgctcagcc acaatgctct cacctttttt    109140
     gaagtttgaa ggccacttcc aacctgattt gaaaatggtc attgatttgg agaaaatatc    109200
     gttgtataac aaaccagtgt atactgaaaa ggcacccatt agagtaataa cgtaccttcc    109260
     tgtgaaaaca atatcaaaga tttctccacg ttgcatagtt tcaaacttct tttccatcat    109320
     taacaagaaa actccaatta acatcagtat gaaaccgtgt cccaagtcac cgaacataat    109380
     ggcaaacata aaagggaaag ttacaatagt ggccaaccca ggattcactt ctttataagt    109440
     tgcagtacca taagcatcac aaatggattg gaatgcttgt gtaaatttat ttgttctgtg    109500
     atacgttggt ggtgctctat tagtatgtat aacacttacc acggtactat attcggaacc    109560
     tacagtttca ctatagtcct tcattgcatc tgaaatagtt gtaagttcta aagttggtaa    109620
     ccagccttct gcaaccaacc catgagtttc ttgtttgaaa aggtttaaag ttgcataaat    109680
     gtatttttct cttttgacca ttgcattcca aactggtaat tgatcggata ccactaacag    109740
     ttcagcatgt agagtggatt ccgtagcgta agcaatctgt tgaatttctg agattctatc    109800
     gttcaatttt tggatttctc tatgagtaca atgagccaac gatacgactc taccatttaa    109860
     tgagtctacc acacgttgaa ctttctgtaa tagatactca ccatgtgtga aaacgaaaaa    109920
     acagtctttt tccacttttt caccattttc taatagaggt tcatcaatgg caaaattttg    109980
     gaaaataaga ttaccacgta ataatcgcca aagaattcta ttcaatactt ctactttgtc    110040
     tctcctaatg gagcctgcga tcatgaatct atcgtggaat ccaatttcta gcaaattttg    110100
     atcagcttcg aattccatct ggtcgttcaa ggcttcctgt tgttgttgct gttcatcagt    110160
     tggttcagta ccgtcttcaa aagaaaaagt gtcacttaaa gtttcactca actcgtcgag    110220
     attcaatcta aattcatcta catctctcaa ttccctctct tcacgtccca tacgtccaaa    110280
     caaacccgga tggctctgta agaaacgagt aacttcaaat ataacgtatc tctgctccaa    110340
     gagaccgttt aatttttctt ttaaatttgt aagagaatca tctaaccttt tcacacgtcc    110400
     ttcgaattca tgaatttcac ccattgcagc attgataata tcgtgagaat gggtttgcat    110460
     ttcggaaacc aattgagtca cactgggacg ttgaatatca ttgccctgtt catctgtatg    110520
     taaaatatat ttccaggtag cttctgcatg tttgtcacta acttcttgca tgtaaaggac    110580
     caatctttct acttcatcca gttttctaat ttgacccaca tatcctcttt ggaatgcagt    110640
     taagtcctta ttaaggtctc gaaacatcaa ggtgcccaga ttacctaaga gacacgcaat    110700
     ctctctggaa atctccagtg gaatgtacag ctgcacatat gtcatatccg cagagcctat    110760
     atcacctcct gttagtattc aattcataat ttctcatttc taacatagtg ttctcaacat    110820
     acggaatata gcctcttctc taaccatttt caatgtttac aaggactact ctagcaaata    110880
     cgtagcacaa tttcaatttg caatcctttt ccaaaggctt gaagagtcta attagtccca    110940
     aatggccttt gaaagtctga tttgataatg tattgtattt tgtagttctt tgattacttt    111000
     cgctcctaca tgtcgttaat cgcgaggcca tcaaaaaagg tccttaagta aactgatgat    111060
     tacaaagaac tcttccaatc aaaactaagt aggatagctt caaaaggaaa cacttccacg    111120
     ttatttagag gtgaaatttg gagagtacga ttgtgaattt gttaggatag catttttttc    111180
     gtctccaata tgactcttga gactccaacg agtaatgttt tccagtcgcc caaggctgtt    111240
     gattctaaga agacaaccca taagacatcg acggtggaac ctcttgtgag ttttattttt    111300
     ccggatgtta gagcattaca tgagatacga ttagaatctt ttgtcgagct gcagtataag    111360
     gagattaccg tgcatggatt tgaaatatac gttgtggaac aatgggcagc tgagaggaaa    111420
     ctctctacag tgattacttc atatacgggt aattcacagg atacaattca tgcagtacaa    111480
     gtggtattgc ccaaggatcc cgaaaaatgg ccgggaaggt ttaaagaata ctacgaggat    111540
     ctatctattt tcgccaaggc cagagttatg cccaagggtt caattttcat tactaatttg    111600
     gccaccgttc catctacttt aaacctattg catgtagaat gtggtgatgt gagagcaatt    111660
     tggaaagatt ttgaagttaa ttttgactta aagagactgc gatgtggtgg taggtctgcc    111720
     ttactccttg gcgggacttc cacagcggct gaagataaat ttgggcaact gtacaaaatt    111780
     tcaattgatt tcggtgaacg taaggttttg ttaaaagaac tggaacaatg tgaacatttc    111840
     ccacacttac aaaggaatta tcaccctgtt attgaattag ttaccatgat ccaggtctgt    111900
     ttgagctatt tcaaccttta tcattctgca aaagatggat tactttgtga taagactgaa    111960
     gctgcagtgg caaatttctg gtcaaagtta gctaaatatt attttggcat tgagagacca    112020
     aaaaatgaag gtatttcggg acctgccaca gttgcagcac taataagttt agtcttgagt    112080
     tgctattaca agttacaagt ggaagattgc atatcttcca aagatccatt tgaggaagaa    112140
     gagttttttg ccggtatcta cagtttccag aaaaaacatg gaatcaccag gggtacaaat    112200
     cctgtttatt tggatgattt gactttgcaa agattatttg aagtgtctgc aaagacttcg    112260
     agttcagata tattcaaatt taaaaaagtg gttaaatcaa cggtatctga tattactggt    112320
     aagggtaatc cgatgcatct ttgtaatgaa atattgacga cagatttaga tgtaatggtt    112380
     aaaaatatcc atagtggatc tattggtctt ctttggaggg gtaaaggaag attacgcagg    112440
     aatttttata aaggttatga caacttttgt gaaattaaat tctctagagg tgatcccgaa    112500
     ttactcttag aaaaacaggc aaatgaaatg caaggcgatg gttctgagtc ccaggaatca    112560
     acatcttcag ctgatcagga gaaaaatgtt tttgataata atttggttag atatagcact    112620
     tcaagttcat cggtatcggc atcatcaatg ttttgtaatt acgacaagac gacttatgcg    112680
     accaattttg gcttgaataa actttatcat ggcgaatatt ttagaaggaa ttcgatgccg    112740
     tttctgtcgg atggtactca cgatccaatg ttggaaacaa aaaaaaatga tgatacggtg    112800
     aagggactgc atagatccaa ttcgttatca caggtacagg acgtagttga gccatggagt    112860
     ttaccatttg atccttccgt ggtaagaatg gcaagagatt tattgaaaat caataactta    112920
     atacaggttc aagagaggga agaaaaggag aaacaaactt acatgcgtga aaatgaggta    112980
     tgtcatgctg gtcatggtga atcctttgac actgatttcg atcatgtatt aagtggttta    113040
     caaggttgtc atcaggttta caatcataaa gtcaagaaat tagaggaaaa taataaggaa    113100
     gtggaaaaaa aacagttgtt actatttgga gagatgaggg cattgagttc actgacatca    113160
     aaatttaaat atgatatggg tattttggat atgagaatga gagatgttga ggaaagtata    113220
     tcacagtttg ataagaaatt agctgcggta caaaaattgc ttgtcgatca aggattaggt    113280
     aaagctttgg gtacagaact cttagtggac aaggaacaat tagaaagctg cttaaaagat    113340
     ttcttagaag ctgaaaatac caaatatgag ggtctttgct gcagaatgtg cagtaaaaaa    113400
     tacttcaagc aaattcacaa tgatttgaag gcatggactt catgggcttt taataaattc    113460
     ttcaataaag ataccaaatt gaccgaaaat gaggaaatta tgtagaattt tgatttttgt    113520
     atcatatggg taagtcaata gatatattat accggttttc caacattttt aatttagatt    113580
     gaaatttaat gaagtccttc gaatttttcg gtactaaatt ccaatctatc tcttgcacca    113640
     agtgtttgaa ctcttgaata accaactcgg atttcccttt actgacgtta atttcatttc    113700
     gcagcacctg acagctcata tccagccttt gaccattcac cgtaaatttc tcatctatga    113760
     aattcgttac atctttcgaa gctgctagtt tcctttcgat gacaaaattc ctaattgagc    113820
     ttaggtgttc gttgatttca ttgataagta accaaacttt attgttcata tactcctgta    113880
     actcaatctg ctttactaat tcataattct gcataatcaa ttgatcctct tccgtagggg    113940
     tcgatatttt atcgaacaat tctttctttc tgggtgaaac attaccactt aattgttcat    114000
     aattaacgta tgactgctta gccaatcttt taaacagatg ttctacttta tccctttctt    114060
     gacgattagc tcggcattca gcactcaata tcttagtcag ttgtagaatg tattcgaaat    114120
     tatcactact ggaaccatcc atagtgagca gaataaggtt tacaaaacac tagcagcctt    114180
     cttcaataga attcgccaat attacccaag cgtcgttgta gtacgatagt acgcagaacc    114240
     tttaccgacc ttgatctttt gattagtagt gtatcgttag gaaaataaca catgctgata    114300
     cttttccatt atatcgtatt gttaattcat cctaaacata gatggacagt gaagcggtgg    114360
     ctcaatggta gagctttcga ctccagttag atcctggaaa tttccggaat tggcaatcga    114420
     agggttgcag gttcaattcc tgtccgtttc attcaaatta attttttttt tgtagatccc    114480
     catgataata aaagtacagg agggaagaac tcccatattt gaatagctct ctatatcaat    114540
     cacatttaga cctacctttt aaaatcaatt aaatcaaatt atttacataa tctacaaacc    114600
     ctttctccta ttaacttatt ccaaatgaaa aaaatcgtgg aaatatttgg aacaaggaat    114660
     tgtagctccc atccttgcac agagtaggaa gattccactg aattttctat gcaatgaata    114720
     agtttcctcg ggtggtgggc acaacctttc atctaacatt aatccaatat tagctcttat    114780
     tctatcggag actgtctgat ctctaaaact aaagggtttg tcaattggcc cggaaaatgg    114840
     ctcacccaag gtaataacac tgcgtacatg tgcatccacc atcgcttgtg attcgagacc    114900
     attcaaatat cctaaatctt gtgataattt acgcaccatt tcatgatccc ctagggtagc    114960
     ataagtcagt aactttctgt aatcactaat aaattcatct gggaaaaccc tagaggcacc    115020
     aaaatctagt agttcaatct tgtgagtctt gtggttgtaa agaaaattgg cccagtttgg    115080
     gtccgtttgc atacaatgaa ataccgcaat ttcttgcaag cataacttca tgatattgcc    115140
     agcaatgtaa tcctttaagt gttgaggtgt tgatggtgct aacttcatta tttctatacc    115200
     ctccatgcga ctcatggtaa taacattgct agtggttaaa tctgggtaca cgtgaggaac    115260
     ttcaaaaaca gggtcatcct ctagtaattt ttcaaattgc tgtaaacatt gggcctctct    115320
     cacataatca cattcccatt ttaattcttt tctagcgttg tcgatagttt tatctagaaa    115380
     taaccccttt ggtaataatc tagaggcccc caacaccatc atgatattgt ttaaatctga    115440
     atcaatagaa tccttgacac ccgggtattg aatcttgacg acaactttat caccatttgg    115500
     tagaactgca ttatgtacct gaccaatact agcagctgca atggggattc tgtcaaattt    115560
     agcaaagtta gatttccaat tatcaccaaa ttcagctttt agcactttat ccaattgtct    115620
     ctggggcatg taatgagcac tattctgtac acgagataga atttcgtaaa ggtctctggg    115680
     caacacttta tcgtcttgga atgacagaat ttgaccaact tttagagcag cacctctcat    115740
     ttgtgaaaat gtcttcgtta tacgttccac attggaatcc gataaaatca gttgtttcca    115800
     agttggagtt ctccctttgg cgacttctgt tataccttca gtggcagcat gaataccaac    115860
     acccgctgct aacgaaccgt agtggaaaag acgtgctaat cgagatgacg gcacttccga    115920
     gctttgtaat tcccgttgtg gtctttgaga ttcctgctgt tgtaatagac ggctctactc    115980
     aattgttagt cacataattc ctgtacaacc tattaatcat aatcacagcc atgtagtttt    116040
     attacatact tcttcttcag gtggtacttt ggtggaagta ctgtactccc ttgtaccctt    116100
     agtggtaggc cccaccttct ttctagattt ctttagatga ggttttccac tatgtaaatt    116160
     cctcgtgtct tctgccagtt tcttagcttc ctcccattta ggatcataaa accactggta    116220
     ttcgttcaga ataggtctag taagagttga agtattaatc catgaaccca atgattcttt    116280
     accaatatcc catgagccac tcaatacact tctcgctgat gaaccaaggc agtatatgtg    116340
     gtaaagggtt cttctggtgc tcattcttcc aatacgaatt caagatccaa ttcaattttc    116400
     tcttgattga atgacgatgg aggacctgta tatatttcgt tccgttagta gtcgtggttt    116460
     gtcgtaaatg ttcgccaact tctcaccttt ataggcgtcg ttaacaggaa aagtgaaaga    116520
     aaccgtagaa accatacaga aagaaagaga tgacacaggc ttgttaataa gatgccaatt    116580
     gacatctaaa tcaattctag tggatcattg ataggacact atgcttggtt atccacaata    116640
     ttgcttttcc acgtgacctc ggaatagttg aaaattttca atgcgatgag atgagatgag    116700
     ctactactac aactactact accactcatt ctgttactta ttatcgatat atcgagagat    116760
     ataagtgatc acagtcttgg attgatagaa tatgggtact aaaagaagac tatctgaaaa    116820
     ggcagaacac gtaagtgcgt tagagagctc tgtgcctgaa agagcagcag agattgcaga    116880
     ggaattaaat aaaaagcatc cacaccaaac agaggagaaa cttgtgcatc atgatctcgg    116940
     tgagtttaat tctatggtac gtcatcatac aaatgcttca caagcacaaa agctagaaga    117000
     cggcaaagtt aatcccttca ctggtagacc gttcactgcc aagtatgtgg atatcttgaa    117060
     gattagacgt gaattaccag tacatgcaca gagagatgaa tttttgaaaa tatatcaaga    117120
     gaaccaaatt atggttttcg ttggtgagac aggttctggt aagactacac agatcccaca    117180
     atttgtgctt ttcgatgaga tgccacactt acagaataca caagttgcat gtacacaacc    117240
     acgtcgtgtt gctgccatgt cggtggctca aagagtagca gaagaattag atgttaactt    117300
     gggtgaagaa gttggttatt ccatcagatt tgaaaataaa gtttccaata agactatcct    117360
     taaatatatg accgatggta tgcttttaag agaagctatg gaggatcatg acttgaaacg    117420
     ttattcatgt atcatattgg atgaagccca tgaacgtact ttggcaacag atattttgat    117480
     gggtctgctg aagcaagttg tggtgagaag accagatctt aagttaatcg tcatgtctgc    117540
     cactttagat gctaagaagt ttcaatcata tttccacagt gcaccactac ttgcggtccc    117600
     aggtagaact ttccctgtgg aattgtacta tacaccagaa tttcagaggg actatctgga    117660
     ttctgccatt cgtaccgtct tacaaatcca tgctactgaa ggagcaggtg atgtcctatt    117720
     gtttttaaca ggtgaagacg agatcgaaga tgccgtaagg aaaattcaac tagaaggtga    117780
     tcaattggtt agagaagaag gttgtggacc tttaaccgtt taccccttgt acggttcact    117840
     gccaccacat atgcaacaac gtatctttga acctgcacca gaatcgcata acggtagacc    117900
     aggtagaaaa gttgtgattt ccaccaacat tgcagaaact tctttgacca ttgatggtat    117960
     tgtttacgtg gtagatccag gtttctcaaa gcaaaaagtt tacaacccaa gaattcgtgt    118020
     ggaatctttg ttggtgtcac cgatctcaaa ggcttctgct caacagagag ctggtcgtgc    118080
     tggtcgtacg agaccgggaa aatgctttag attatacaca gaggatgcgt ttaagaaaga    118140
     attgatcgaa cagagttatc cagaaatctt acgttcaaat ttgtcctcaa cggttttgga    118200
     attgaagaaa ttgggtattg atgatttagt gcactttgat ttcatggatc caccagctcc    118260
     tgaaactatg atgagagcat tggaagaatt gaactatcta gcatgtctaa acgatgatgg    118320
     tgatttaaca ccattgggcc gtttagcttc acagttccca ttagatccta tgcttgccgt    118380
     tatgctaatt ggatcatttg aatttcattg ttcacaagat atcttgatca tcgtggccat    118440
     gctttcagtc ccaagtgtct ttattcgtcc aacaaaggat aagaaacgtg ctgatgaagc    118500
     taagaaccaa tttgctcacc cagacggtga tcatataaca cttttgaacg tctattacgc    118560
     tttcaaatct gatgaagttt acgaatatgg tgtccaaaaa tggtgtaggg ataattattt    118620
     gaattacaga tctctggctg ctgctgataa cattagagtg cagctggaaa gaatcatggt    118680
     tcgttacaat cttgaattaa acactacgga ttatgaatcc cccaagtact tcgataacat    118740
     tagaaaggcg cttgcatcag gattctttat gcaggttgca aagaagcgtt ctggtggtaa    118800
     aggttacatt accgttaagg ataaccaaga tgttctagtg catccaagta cagtattggg    118860
     acacgatgcc gaatgggttg tctataacga attcgtctta actacaaaga attatatcag    118920
     gaccgtcact tcggtgagac cagaatggtt aattgaacta gcacctgctt attacgatat    118980
     tcatagtttc caaaagggag atgtgaggta ttcaattgaa agagtcaagg aaagaatgga    119040
     acagatgcaa gaattgcaca acgataaaca caagaagaag ggaaagaaag aaggaaagga    119100
     gaaacacaag catacttaga catgtgtact cagttgaaat aatagaaatt gtataataat    119160
     aactgaactg gttataaaat cactttttgg cttgagcgct gagtcttgtg actccgaagt    119220
     ccttgtttgt catagtgcgg ctgtacttaa tcgcccatat ggggaagggg ggatgaactt    119280
     caccacacat taattgcaat actagtgtgg tcaactcaga gaaggaaata caagatccct    119340
     atctctacac ctcgatagct aagaagtaca tagtattatg actggtttaa gtgaatcctt    119400
     tttacagcta acaatgctgg gagacggcag cccaaatgaa gatgtcttac aattgttgat    119460
     gtattccaac tttcgtgaac aactgagtga atctgcacag gagctgcaca acataacgga    119520
     caggattctt gtccatcggg cgtcaagatc agtaacttcg atagaagctc acggtcttat    119580
     tttaccactg atggcgatgt tgatagagag cagggaaagg gcaaaaagaa tctatagaga    119640
     tgcattatca tcaagaatga gtactaccac cgattggaat attgatccgc tgtgtgacga    119700
     agtgcatgag gaattaataa ggactaatga tttgttaaaa ctgtacccaa gaagggagtc    119760
     attgtggtaa ttgggaacaa atttggaaat aaaacgtcat tgtatgatat ggacgtaaat    119820
     gactaggtaa gtaggtgatg atcgacgtta tggttatcta gaattttaaa taattaagaa    119880
     ctgaatacat gggtacgaat tgctcttttg aagtggtata caatgcgtga atgctttgat    119940
     tcatgaacaa aacaataaaa ttagtaactg aattttttcc aattgtaaga atccttaacc    120000
     aatacaaaca aacttcgaaa acttcagcaa aattatctac aaatgctcca aaattcctat    120060
     tttctggttc tactaacgat tattgtattt gtatttgtat cggtattaca ataaataata    120120
     tctatgaacc gccaatggta aagaccgggt aacggatgac atataaaatt tttttggtat    120180
     ccgttataaa aacgaagggt gattacgaaa agaatcattt cccttccttc aagataccat    120240
     caacgacaag gaccagtgga aagatagata agatgtctag tgaacaatat acagagaatc    120300
     tgaagatcat agttgccgag aagctcggta cactagaaaa tttcaacgaa gatatcaaat    120360
     atgtggcaga atacattgtt ttactgatgg taaacggagg aactttagag aacgttgtac    120420
     atgaattatc gactctgttc gactctgtgt cgacagaggc tctgaccgat gttgttcaaa    120480
     cagctttctt tgccctggaa gctctacagc aaggtgaaac tgtggatagt attgtaggta    120540
     agataagagg tgttttacag caaccagttc aacaagagca acaaccacag ccacctcagc    120600
     aagagcaaca gcagcagcaa cagccccctc aacctccagc acctatgtca gcttttggtg    120660
     gtatagtatc gacagagcct cccgctaaat tgaatactac tgatttccaa ccaaatttcc    120720
     agcagagaaa cggtgctgtt ggtaaaggtg gtcgcggcgg tcgcggtggc cgtggtgcaa    120780
     ctcgtggtgc cggcaggggt gccagccgca acggcaacgc cagattcaac ccactagcta    120840
     aagcactagg tataaacggt gagggtgctg gtaatttgaa ttttgtgcat agtaagaagg    120900
     agggtcgttg taaagttttt cctcgttgcc ccttgggtaa gtcatgtcca cacgcacatc    120960
     ctactaaggt gtgtaacgac taccccaatt gtcctaaacc acctggcact tgtgaatttt    121020
     tgcacccaag tgaagatgaa gaattaatga gagaaattga aagaactcgt gaagagtttc    121080
     aacaaaggaa ggccgcttta cttgctgcca aggctaaacc ggtgcaaaca ggtattgtta    121140
     tctgcaaatt cggtattttg tgttctaatc ctctatgtcc ctttggtcac ccaacgccgg    121200
     ctaatgaaga tgctaaggta ttggaactaa tgtggtgtgc aaacaatcta acgtgccaag    121260
     acccaagttg tactcgcgct cactcttcgc tatccaagat tagagatgtg acgcctttag    121320
     gaggtccaaa gaaaccacct gtggttatgg ctccacgtcc tgtggaaaaa tcgttggagc    121380
     aatgtaagtt cggtactcat tgtaccaaca aacgttgcaa atacagacat gctcgctcac    121440
     acatcatgtg ccgtgaaggt gctaactgta caagaataga ctgtcttttc ggacatccaa    121500
     ttaatgagga ttgtaaattt ggtattgatt gcagaaatcc aaactgtttg tttagacacc    121560
     caaccggtag aaatatcgat gccaatacga acagtggtaa tggtggagcc gctaatgctg    121620
     aaaatactgg tgttggcgaa ggtttttcta ctagtcagag gttatttgcc attcccgagg    121680
     gcccccacat cgaacaatca caagcacaag gcggtggcgg tttgccctcg atatatgctc    121740
     cagctaatgc acaaaatatg gatcaggaca cggatatgaa ttaagtgtaa ctgttaatat    121800
     tattaattcg ttttcaatgt aatgtaataa aataaaaaaa aaataaagaa aaaagaatgg    121860
     aaaccatttg cacaagtggt tgtcaagagg aaaatcattt gcataaatgg ttgtagtatc    121920
     ttgagtaact ttgcactggt agtatagatg tagtcacaga ttcttgccgt aggcatatct    121980
     tggataaaag tatcttgcgt aagcttcttg ttcttaacct tgattttcaa tcttagaatt    122040
     ggtgtcaaaa cgctagcggg tcaagtcgtc ctaagaacga cgacaaccag ggcgacataa    122100
     gataaagact accaaagatc aatcaagttc aacacaacac aactcatgaa attagagcta    122160
     agttacaaac gttaaaaatt acaaacttag acacatccgc gcttagaatc tcttcttttg    122220
     cacagcagct tcgtcggcgt agatgtccaa tggagaaact ggcaaagcgt gttcggccca    122280
     caagtttgga gtcaagaaac cgtaagtgtt accgatagca gcgaaagcag ccttcaaagt    122340
     gttttccaaa gttctggtgg aaccggtgga ttgagtgtaa acatcttcca aaccggccaa    122400
     ttccaacaac ttcttaacac ctggagaagc gacgatacca gaacctcttg gagctggaat    122460
     caatctaacg gtaacggaac cacacttacc ggaggtcttg gtagccaaag agtgaggttc    122520
     acccaagttg ttaccccagt aacctcttct gattggaata acagacaact tggcgatcat    122580
     gataccagct ctgatggcac cagcaacttc cttggcggtc ttgataccca aaccgacgtg    122640
     accgttggag tcaccaacga caacgacagc cttaaatctg gttctttgac cggctctggt    122700
     ttgcttttga actggcttga tgttcataac ttcatcggac aaacctggca acaaagtgtc    122760
     aatgatttgg aattccttga ctggcaaaga gtgcaagaaa atttcttcga tggtagttag    122820
     cttaccagct ttcaccaatc tacccaactt ggtgacaggg acccatccct tttcttcgac    122880
     gtttctacct cttctttgga aacgacctct gtttctaccg gcgaaaccgc ctcttctttg    122940
     ttctggagct gcagcagaca tgtcggaatg gttcacggaa agttgatgta ggtaactttc    123000
     gatcgacaat ggtatttttc acctaagaaa gacactaatc aactactgta ttttgcactc    123060
     tacttgctca tcgacgtata cttcctagct ggtattgatg ttgaaaattt caggattgcg    123120
     tcgatgcgtt atcgagtcag aatcgcctgt agaaggaatt ttaaatttga aaagagaaaa    123180
     aaaagagata tcgcaaaggc aaaatgtacg ggtgtagtac atggaggtac gggtgcagat    123240
     agtcattttt agagagagat cacacaatac gaacaatata tagtcacgtg attgtttatc    123300
     gattctatac tatatcactt ttccttctcc tctccccttt ttccctttga agggacaata    123360
     aagagcaagg ggactttact actaaagctg aataagatca attgctacat aaagcagctt    123420
     ttgactacaa ttagtactca gaactataca ataaaagtac ttatacgagt ctgatttaga    123480
     gtaaatatta tcgatttcag gaacatgtca gagtatgttt ttttatagca cgatacaata    123540
     ctatacggca tcgttttata tttgtcctat cgtttattgg cccatgcatc aatactaact    123600
     cgtatcatta agaaacgaag aaaagttctc tcaaaaggct agggctgaag ctagaaagac    123660
     cgctgatcaa ctcaagaagg atggagaagc cgctaaggat actgtagaat cttggacgga    123720
     acagcttaag aaatgtgtcg agactgcatc aacgagtgtc tcaaatgggg tctcacaggc    123780
     agtttcccaa gctcgtagtg caactgcaac tgctgctgcc aaggctagat ccattgcagg    123840
     tagatcatgg gaagaattgc ataacccggt agttttgttg aactttttac tgggttctgg    123900
     tgcattggcc ggattgattg caggatacgc tcaatatgat actagatatc taaaaggtaa    123960
     aagtgatggt gtcattttgg caacagttag cggtgcttct gccattgtag caatcgatgc    124020
     tcttttgtcg gctaagtact acaacaaata taggaaatga ttgaatgaag tcattgtagg    124080
     ggaggaagaa agaaataaat gaataaatac tatattcgat atgaccaaag taaataaggt    124140
     aaaatttatt caaatcttaa tctctacgtc tttgtatatc tttatgtttt tatttacgct    124200
     gcatgtcaag agttcatatc cttttcactc tacatgatag ataggttgaa ccgacaatgg    124260
     atttagacga atcttatgtg gacgacagaa gagaaagggc caatgagcca ctatatatac    124320
     caccaatagc tgcggaacca actacatcaa taaacttagc tcaaactctt ttccaaccgt    124380
     cagaatttga cgaaagtttg gaagatcaat tggctcaaag tataagctca tgcgatagaa    124440
     gacatccatt agtatctaca gagattccaa atgtgttccc tcatcggtat gacaagaatt    124500
     ttttaatcct aacatcagct ggtaaaccta tttatgcaat gaaagatggc gatggtacga    124560
     ttgcgtacat gggggttatc catacgataa tgaactactt caaattgaaa gaggatcagg    124620
     acttaagatg tattgagaat ggtgatgtca gatttgcatt tttagaccgt gaacctattg    124680
     tcctagtggc atattcggca agaggtgaaa ctagtaacga gttattcagc caattggatt    124740
     ttctacattc atacttacta tcatcattaa gtgaaaggca actatcaaaa atattcagca    124800
     aaagacagaa tttcgatttg agaaatttcc ttgaatctac agatttcgaa aaccttgatg    124860
     agatttgttc attactatgt gaaaggctgt atcctgatgc actgttgggt gcactaaggt    124920
     cgctatccat gaagaaatcc catagagctc agttgcatga ggccatgtct caacaattga    124980
     ccaaagaaaa ggatttacca agaggaactc ttttatacgg actcattgtg gcgcctgaga    125040
     ataaattatg ttccgtgtta cgccccaaag gtcatacttt gcatacaaca gatttacacc    125100
     ttttattctg cttaatattc cataggttcc agaacttaga cgatagtcaa gagctttggg    125160
     tccccatatg ttttcctaaa tttaacgcta acgggtttct ttacggttat atcaaattct    125220
     tacccaagtg caattccatt ttagtactga taagcgctca aaaggatgca ttcttcaatt    125280
     taaaatcatt tgctgatcat ttaatcaagg atatttccag taatggcctc ctagaagaaa    125340
     tccataaggc caagggattt aagattagtg atattccggc accgttggta catcatttca    125400
     tttacaaatc taaaaagcac gttcaatacg tgatgccaga attagaactt cacagtgata    125460
     ctgaacccga acaattgata gagttagaac ggaaatttat gacctattac caacaaattc    125520
     ataactctgt ggtgcgtgat gatggattgg ctttcaacaa atcatgtcta aattttatca    125580
     gatgggattc cgatgcgatt gaaccatcag aagaaccaat tgccatgttg ggtttaggtt    125640
     ggattacacc caaatttgag ctctatttga tatgtaataa tggtgtggat gataaacacg    125700
     ttatctttga gagtgcaaag agaattattt cgtggtgtcg aaagcatgaa tcaaggttgt    125760
     ttgttaatga aggtgctata ttttaacaaa aaaaaagttt tgaaagtttt attattatta    125820
     ttattattac tattgttatt attacttacc ccaatgaacc attcgcctcc ttcacccaag    125880
     attcagagac gtgcaaatcg gggaattttc ctattctgcg gatcttcagt ttgtctcgat    125940
     ttcattatgg atgtggccac ttcttcacca aattttttta tcagtttctt ataaaagagt    126000
     ccacaagcgt tgcacagtgt cgtaggtcca ctaggacctt tcctccattc aggcgtttcc    126060
     gtcgatgaac agtgtaaaca tctcatatgt gcatttctat ttttaccaga ttttgaagtc    126120
     ttaccaattt tacccatatg ctttcggtca tcatcagaca agctgatgaa aacgctatcg    126180
     cttttcgtat taggactact agatggtcgg tacggtgaat agttattatt gttatttttc    126240
     tctaatggta caggtgttgg tgttgatcta tctgatgata atggtgaata tgttaaagtt    126300
     ctttctgaag acatgctaga gctgcgcggc gcaatagcct tttccctttg agcagaaggt    126360
     gcttctggta aaggggtggt gacattaacg atggatacta ccgatgatga tctcgattta    126420
     taactttcct catggaattt tacatttttt tccctagtac tgggtttttc tac