(data stored in SCRATCH zone)

EMBL: D13303

ID   D13303; SV 1; linear; genomic DNA; STD; PRO; 2782 BP.
XX
AC   D13303;
XX
DT   23-APR-1993 (Rel. 35, Created)
DT   26-FEB-2008 (Rel. 94, Last updated, Version 9)
XX
DE   Bacillus subtilis genes for sigma factor H and ribosomal proteins.
XX
KW   protein secretion machinery SecE; transcription antitermination factor.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-2782
RA   Yoshikawa H.;
RT   ;
RL   Submitted (25-SEP-1992) to the INSDC.
RL   Contact:Hirofumi Yoshikawa The University of Tokyo, Ins. Molecular and
RL   Cellular Bio-sciences; Yayoyi 1-1-1, Bunkyo-ku, Tokyo 113, Japan
XX
RN   [2]
RP   1-2782
RX   DOI; 10.1111/j.1365-2958.1993.tb00910.x.
RX   PUBMED; 7968510.
RA   Jeong S., Yoshikawa H., Takahashi H.;
RT   "Isolation and characterization of the secE homologue gene of Bacillus
RT   subtilis";
RL   Mol. Microbiol. 10(1):133-142(1993).
XX
DR   MD5; 8b068a198378cdd0c7c9b1b220784974.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2782
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..319
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /gene="spo0H"
FT                   /product="sigma factor H"
FT                   /db_xref="GOA:P17869"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17869"
FT                   /protein_id="BAA02557.1"
FT                   /translation="NSYASLDKPIFDEESDRTLLDVISGAKTLNPEEMIINQEEFDDIE
FT                   MKMGELLSDLERKVLVLYLDGRSYQEISDELNRHVKSIDNALQRVKRKLEKYLEIREIS
FT                   L"
FT   CDS_pept        412..561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="GOA:Q06798"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06798"
FT                   /protein_id="BAA02558.1"
FT                   /translation="MRKKITLACKTCGNRNYTTMKSSASAAERLEVKKYCSTCNSHTAH
FT                   LETK"
FT   CDS_pept        595..774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orfE"
FT                   /product="E.coli SecE homologous protein"
FT                   /db_xref="GOA:Q06799"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06799"
FT                   /protein_id="BAA02559.1"
FT                   /translation="MRIMKFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFVIFFAL
FT                   LDTGISQLIRLIVE"
FT   CDS_pept        953..1486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /product="transcription antitermination factor NusG"
FT                   /db_xref="GOA:Q06795"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06795"
FT                   /protein_id="BAA02560.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEEE
FT                   TDIKNGKKKVVKKKVFPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLLPG
FT                   EAETILKRMGMDERKTDIDFELKETVKVIDGPFANFTGSIEEIDYDKSKVKVFVNMFGR
FT                   ETPVELEFTQIDKL"
FT   CDS_pept        1654..2079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /product="ribosomal protein L11"
FT                   /db_xref="GOA:Q06796"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06796"
FT                   /protein_id="BAA02561.1"
FT                   /translation="MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNVMGFCKEFNAR
FT                   TADQAGLIIPVEISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIED"
FT   CDS_pept        2173..>2782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /product="ribosomal protein L1"
FT                   /db_xref="GOA:Q06797"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06797"
FT                   /protein_id="BAA02562.1"
FT                   /translation="MAKKGKKYVEAAKLVDHSKAYDVSEAVALVKKTNTAKFDATVEVA
FT                   FRLGVDPSKNHQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADFVGDTDYINKI
FT                   QQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAIGEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEDEKLVENFTTMYDTILKAKPAA"
XX
SQ   Sequence 2782 BP; 916 A; 482 C; 627 G; 757 T; 0 other;
     gaattcctac gcctcattag ataaaccgat ctttgatgaa gaatcagacc gaacgctgct        60
     ggatgtcatt tcaggagcga aaaccttaaa tcctgaggaa atgatcatta atcaggaaga       120
     atttgatgat attgaaatga aaatgggaga actattaagt gatttagaga gaaaagtact       180
     cgtcttatat ctcgacggga gaagttacca agagatttct gatgaactga accgacatgt       240
     gaaatcgatc gacaatgccc ttcagcgtgt gaaacgcaag ctggagaagt acttggaaat       300
     tcgcgaaatc agtttgtaat aggaatttat gctatattga cagtattttt ctgactatga       360
     tatgttacta aagataagaa ctaatgtcta tttagaaaaa ggtgtaatga catgagaaaa       420
     aagattacgt tagcatgcaa gacatgcgga aaccgtaatt atacgacaat gaagagctct       480
     gcatcagcgg ctgagcgatt agaagtaaag aaatactgca gtacttgcaa ttcacataca       540
     gctcatcttg aaacaaaata gtttttgcgc ttttaaattg tggaggtctt ttacatgcgt       600
     attatgaaat tctttaaaga tgttgggaaa gaaatgaaaa aggtaagctg gcctaaagga       660
     aaagagttaa cgcgttatac cattacggta atttcaacag ttatcttttt tgttatcttt       720
     tttgccctcc ttgacacagg aatttctcaa ttaattcgtt taatagttga ataatgatca       780
     gcaatacgtg ctataataga tcataatatt acttgccaaa acccgttcag cgggtttttt       840
     attgtggctt aaaatgaaag ttatcatagg cttgccgcct attttttgaa gcgttatggt       900
     aattcactaa aaccaaatgc ggggagggaa ggactggaca gtcctgaata gaatggaaaa       960
     gaattggtat gttgttcaca cgtactctgg ttatgagaat aaagtaaaag ccaacttgga      1020
     aaagcgtgtt gaatcaatgg ggatgcagga taaaattttc cgtgtagtcg tacccgaaga      1080
     agaagaaacg gatatcaaaa acggcaagaa aaaagtcgtg aaaaagaaag tattccctgg      1140
     ttatgtgctt gttgaaattg taatgacaga cgactcttgg tatgtcgtcc gcaacacgcc      1200
     gggcgttact ggattcgtag gatctgccgg gtcaggttca aaaccgacgc cgcttcttcc      1260
     gggggaagca gaaaccattc tgaagagaat gggcatggat gaacgaaaaa ctgatattga      1320
     ctttgaactg aaagagaccg tgaaagtaat agacggacct tttgctaact ttacaggatc      1380
     aattgaagag attgattatg ataaaagcaa ggtcaaagtt ttcgttaata tgtttggccg      1440
     tgaaacgccg gttgagctgg aatttaccca aatcgataaa ttgtaatgtg aaaaaacttg      1500
     aaattgctat atataaatga taatatagca aaggtacgtc ttggacttat ccaaggcaac      1560
     tagcatgata tttcgtcatt catataaaga atgaaacctt gagtgggagg gtttacccta      1620
     ttaccacatc acggacttaa ggaggtgtgt ctcgtggcta aaaaagtagt taaagttgta      1680
     aaattgcaaa ttcctgctgg aaaagctaac ccagcaccac cagttggacc tgcacttggt      1740
     caagccggtg ttaacgtcat gggattctgt aaggagttta acgctcgtac agctgaccaa      1800
     gctggtttaa tcattcctgt tgaaatttcg gtttacgaag accgttcatt tacatttatt      1860
     acaaaaactc cacctgctgc agtattgctt aaaaaagcag ctggaattga gtctggttct      1920
     ggtgaaccaa accgtaataa agtggcaacc gttaagcgcg ataaagtacg cgaaatcgct      1980
     gaaacgaaaa tgcctgactt aaacgcagca gacgttgaag cggcaatgcg catggttgaa      2040
     ggtactgccc gcagtatggg tattgtaatc gaggattaat ttgtttcttg tcgggttgcg      2100
     agttttaaca agttcgcaac ccttattcgt gggaggttat ccgctataac cacataagga      2160
     ggaaatttta aaatggctaa aaaaggtaaa aagtacgttg aagctgctaa gcttgtagac      2220
     cattctaaag cttacgacgt ctctgaagca gtagctctcg ttaaaaaaac aaacacagct      2280
     aaattcgacg ctacagttga agtggctttc cgtttagggg ttgacccctc gaaaaaccac      2340
     cagcaaatcc gtggagcagt tgtgcttcca aacggaactg gtaaaactca gcgcgttctc      2400
     gttttcgcaa aaggcgaaaa agcgaaagaa gctgaagctg ctggtgcaga tttcgtaggc      2460
     gatactgact acatcaacaa aattcaacaa ggctggttcg atttcgatgt tatcgtagct      2520
     acacctgaca tgatgggtga agttggtaaa atcggtcgtg tacttggacc aaaaggttta      2580
     atgccgaacc ctaaaactgg tacagttact ttcgaagttg aaaaagctat cggcgaaatc      2640
     aaagctggta aagttgaata ccgcgttgat aaagctggaa acattcatgt tcctatcggt      2700
     aaagtttctt tcgaggatga aaaacttgtt gagaacttca caacaatgta cgatacaatc      2760
     cttaaagcta aacctgctgc ag                                               2782
//

If you have problems or comments...

PBIL Back to PBIL home page