(data stored in SCRATCH zone)

EMBL: D14313

ID   D14313; SV 1; linear; mRNA; STD; VRT; 5271 BP.
XX
AC   D14313;
XX
DT   06-AUG-1993 (Rel. 36, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Gallus gallus mRNA for deltaEF1, complete cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Testudines + Archosauria group; Archosauria; Dinosauria; Saurischia;
OC   Theropoda; Coelurosauria; Aves; Neognathae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-5271
RA   Funahashi J.;
RT   ;
RL   Submitted (29-JAN-1993) to the INSDC.
RL   Jun-ichi Funahashi, Inst. Devel., Aging and Cancer, Tohoku Univ.; 4-1
RL   Seiryo-machi, Aoba-ku, Sendai 980-77, Japan (Tel:81-22-272-9499,
RL   Fax:81-22-272-3982)
XX
RN   [2]
RX   PUBMED; 7904558.
RA   Funahashi J., Sekido R., Murai K., Kamachi Y., Kondoh H.;
RT   "Delta-crystallin enhancer binding protein delta EF1 is a zinc
RT   finger-homeodomain protein implicated in postgastrulation embryogenesis";
RL   Development 119(2):433-446(1993).
XX
DR   EuropePMC; PMC360209; 8355679.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5271
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="13 day embryo"
FT                   /clone_lib="lambda gt10 and 11"
FT                   /tissue_type="lens"
FT                   /note="clones RS12-119, RS12-118 and RS12-32"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        12..3356
FT                   /codon_start=1
FT                   /product="deltaEF1"
FT                   /function="delta-crystallin enhancer binding factor"
FT                   /db_xref="GOA:P36197"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR008598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36197"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="BAA03259.1"
FT                   /translation="MADGPRCKRRKQANPRRNNVTNYNNVIEANSDSDDEDKLHIVEEE
FT                   SITDAADCDASVPEDDLPTDHTVLPENSEREGSTNSCWEDEGKETKEILGPEAQSDEVG
FT                   CTVKEDECDSDAENEQNHDPNVEEFLQQEDTAVIYPEAPEEDQRQGTPEASGQDENGTP
FT                   DAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLDRHMTSH
FT                   KSGRDQRHVTQSSGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSG
FT                   SYSSHISSKKCIGLMPVKGRARSGLKTSQCSSPSLSASPGSPARPQIRQKIENKPLQEQ
FT                   LPVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSGGSPLQATSSPQGVVQAVVLPTV
FT                   GLVSPISINLSDIQNVLKVAVDGNVIRQVLENNHANLASKEQETISNASIQQAGHSLIS
FT                   AISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKEHSVPTNSCKNEKLPEDLTVKSE
FT                   KDKNFEGETNDSTCLLCDDCPGDLNALQELKHYETKNPPQLPQSSGTEAEKPSSPAPSE
FT                   TGENNLSPGQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAG
FT                   QISVQSSGPSSPEQVKISSPTDNDDQAATTNESEPQNSTNNSQNPANTSKSQTSSGGST
FT                   QNGSRSSTPSPSPLNLSSSRNSQGYTYTAEGVQEEPQMEPLDLSLPKQHGELLERSTIT
FT                   SVYQNSVYSVQEEPLNLTCAKKEPQKDNSITDSDPIVNVIPPSANPINIAIPTVTAQLP
FT                   TIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQETPPKQTQANGSQDERQ
FT                   DTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKR
FT                   PHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKRE
FT                   AEERDSTEQEEVGQEVLSSEHAGARASPSQIDSDERESLTREEEEDSEKEEEEEEEKDV
FT                   EGLQEEKECRKLQDVEEEEEVEEEEEEEEGKTEGNKNDDVVNRASNAEPEVIQSNGQVS
FT                   EEKTNKA"
FT   polyA_signal    3383..3388
FT   polyA_signal    5254..5259
XX
SQ   Sequence 5271 BP; 1785 A; 1012 C; 1065 G; 1409 T; 0 other;
     gcgagaggat catggcggat ggccccaggt gtaagcgcag gaagcaggcg aacccgaggc        60
     gcaacaacgt caccaattac aataacgtga tagaagcaaa ctcagattca gatgacgaag       120
     ataaattgca tatagtggaa gaagaaagta taactgatgc agcagactgc gatgcaagtg       180
     tgccagaaga tgacttgcca acagaccaca ccgtgttacc agaaaacagt gagagggaag       240
     ggagcacaaa cagctgctgg gaagatgaag gaaaagaaac aaaggaaatc ctggggcctg       300
     aagctcagtc agatgaagtt ggatgtacag taaaagaaga tgaatgtgat tctgatgcag       360
     aaaatgaaca gaaccatgac cctaatgttg aagaattcct tcaacaagaa gatacagctg       420
     ttatttaccc tgaagcacct gaggaggacc agagacaagg cacaccagaa gctagtggtc       480
     aggatgaaaa tggaacgccc gatgcatttt cccagctgct cacctgcccg tactgtgaca       540
     gagggtacaa acgcttcacc tctctgaagg aacacattaa ataccgccat gaaaagaacg       600
     aggataactt cagttgctcc ctctgcagtt acacgtttgc gtatagaaca cagctggacc       660
     gccacatgac gtcgcacaag tcaggacgag atcagagaca tgtgacgcag tccagtggta       720
     atcgaaaatt caagtgcact gaatgtggaa aagcttttaa atataaacat catctaaagg       780
     aacacctacg aattcacagt ggagagaagc catatgagtg cccaaactgc aagaaacgtt       840
     tttcccattc tggttcatac agctcacaca taagcagtaa gaagtgtatt ggtttgatgc       900
     ccgtaaaggg tcgagctcgg tcagggctca agacgtctca gtgctcctcc ccttcccttt       960
     ctgcatcgcc cggtagccca gcaagaccac agatacgaca aaagatagaa aataaaccct      1020
     tgcaagagca acttcctgtt aaccaaatta aaactgaacc tgtggattat gaattcaagc      1080
     ccatagtggt tgcttcagga attaattgtt cgaccccttt gcagaatggg gtttttagtg      1140
     gtggtagccc gttgcaggca accagttctc ctcagggtgt ggtgcaagct gttgttctgc      1200
     caacagtggg tctggtgtct cccataagca tcaacttaag tgacattcaa aatgtactta      1260
     aagtggcagt ggatggtaat gtaataaggc aagtattgga aaacaatcac gctaatcttg      1320
     catccaaaga acaagaaaca atcagcaatg catctataca acaagctggc cattccctca      1380
     tttcagctat cagtcttcct ttggttgacc aagatgggac aaccaaaatt atcatcaact      1440
     acagcttgga gcagccaagt caacttcagg ttgttcccca aaatctaaaa aaagaacatt      1500
     ctgttcctac aaacagttgc aaaaatgaaa agttaccaga agatcttacg gtgaagtctg      1560
     agaaagataa aaactttgaa ggagagacca acgatagcac ttgtcttctt tgtgatgact      1620
     gtccaggaga tcttaatgca cttcaagaat taaagcacta tgaaacaaaa aatcctcctc      1680
     agcttcccca gtccagtgga acagaagctg agaagcccag ctcccctgcc ccatcagaaa      1740
     ctggggagaa caacttatct cctggtcagc cacccttaaa gaacctttta tcgctcctaa      1800
     aagcatatta tgcattaaat gcacaaccaa gcgcagaaga gctttcaaaa atcgccgatt      1860
     ccgtgaacct accactggat gtggtaaaaa agtggtttga aaaaatgcaa gctggacaaa      1920
     tttctgtgca gtcttctgga ccatcttctc ctgaacaagt taaaataagc agtcccacag      1980
     ataacgatga tcaagcagca actacaaatg agagtgaacc ccagaacagc acaaacaact      2040
     cacaaaatcc ggccaataca agtaaatctc agacttcatc agggggatca actcagaatg      2100
     gttcgcgcag tagcacgcca tccccatcac cactaaacct ttcttcatca agaaattcac      2160
     agggttatac gtacacagca gagggtgtac aagaagagcc acaaatggaa cctcttgacc      2220
     tttcactacc aaagcaacat ggagaactgt tggaaagatc taccataact agtgtttacc      2280
     agaacagtgt ttattctgtc caggaagaac ctttgaactt aacttgtgca aaaaaagaac      2340
     cacaaaagga caacagtatt acagactctg atcctattgt aaatgtaatc ccaccaagtg      2400
     ccaatcccat aaatattgct atacctacag tcactgccca gttacctaca attgttgcca      2460
     ttgctgacca gaacagtgtt ccatgcttga gagctcttgc tgccaataag caaaccattt      2520
     tgattcccca ggtggcttat acgtactcta ctacagttag tcctgcagtt caggaaacac      2580
     caccaaaaca gacccaagcc aacggaagtc aggacgaaag gcaggacact agctcagaag      2640
     gagtatcgaa tgtagaagat caaaatgatt ctgattcaac acccccaaag aaaaagatga      2700
     gaaagacaga aaatgggatg tatgcatgtg atttgtgtga caaaatattc cagaagagca      2760
     gctcattatt gagacataag tatgaacaca caggtaaaag acctcatgag tgtggaatct      2820
     gtaaaaaagc cttcaaacac aaacaccatt tgatcgaaca catgcgactg cattctgggg      2880
     agaaacccta ccaatgtgac aaatgcggga agcgcttctc acactcgggg tcgtactctc      2940
     agcacatgaa tcatcgctac tcctattgca aaagagaggc agaggagcgt gacagcacag      3000
     agcaggagga ggtgggacag gaggtgctca gcagcgagca tgctggtgcc agagcatcgc      3060
     catcgcagat cgactccgat gagagagaga gtctaaccag ggaagaagag gaagatagtg      3120
     aaaaagagga agaggaggag gaagaaaagg acgtagaagg acttcaggaa gaaaaagaat      3180
     gtagaaaact acaagatgta gaggaggaag aagaagtaga agaagaagaa gaagaagagg      3240
     aagggaaaac tgaaggtaac aagaacgatg acgttgtaaa tcgagcaagc aatgcagaac      3300
     cagaagttat acagagcaat gggcaggtgt cagaagaaaa aacaaataaa gcttaaatga      3360
     tagttttttc tatatggaaa aaaataaatc agtaatgaag atcgttctat attatacatg      3420
     cttttcatgg aaacacggta gcctgcatac tgtgatttct gttcactact gtgtaaaaaa      3480
     atatatatat aaaaaaaaag aaaaaagaaa aaaaaaagaa atccaggtgt gcctgaacct      3540
     caaacttagt aatttttcac acagttttca aagttaggaa caagtttgta acatgaagca      3600
     gattagaaaa atacagtgac tctggaagca aaggtttaac aggttgtagg aaacctgatt      3660
     tattagacaa gcatctggca ttgtttgttt tatcagtatt aattctcatt cttacgttca      3720
     ttaattttta agctgtacaa ttgggagaga tttatatgat tttttttttt tttatggcaa      3780
     aacatttcct aaatccgctt cagtatttta ttatgttttt aaaatgtgag aacttctgca      3840
     ctacagaatt cccttctgca gaaacctcta acagtgcttg gctacctttg taaattcaac      3900
     ctagaaggta gcggttataa cattagatgt tgtagtagag catattatca tttaaagtgt      3960
     attgttagcc ttaagaaagc agatgataga agaaccgaag tttcttactc atgtggttaa      4020
     aaatgtagtt gaaaagattg ttgttgagtt ctgattgcag ggactaacag tgttaatacc      4080
     ggtaaggaca gcaaagtcgt caaaatcagt gtttgtaatt gtgttttgag tatgtagtaa      4140
     caatatgaag gatatgatat gaagctttgt atctcctttg gccttatgca agacctgtgt      4200
     gctgtaagtg ccatttatca gtattacaaa ggctctcacc ggcctttctc caatgcgtgg      4260
     cctacaataa ctagcatttg ttgatttgta tcaaacttct aatctaatca tgggggaaaa      4320
     aacactcagc catcagagaa gtaagaacac tggtatcttt cattatttaa ttatttggtg      4380
     gtatttttgg ttaatacctg acttgcagaa tttctctacg ataattacaa gggaaatttt      4440
     ctaatctgct ttattgcttt atcagtttac tttaatttca gacacataca tgacatgtta      4500
     tctggctcat aagtattttc aaatgttagt tattatggac cccatttatt aacaatgtta      4560
     gctgattttt acctatcagt attattttat ttcttttagt ttatagatct gtgcaacatt      4620
     ttgtactgta tgtctccaaa cctggcagta ttaataccct tcttactgac atatgtacct      4680
     ttttagtttt agaaaacttt tatatttatg tgtcttattt ttatatttct ttatttatta      4740
     cacagtgtag tgtataatac tgtagtttgt attaatacaa taatatattt tagtatgaaa      4800
     atttggaaag ttgataagat ttaaagtaga gatgcaatcg gttctcttgc attgagattt      4860
     gatttaacag tgttatgtta acatttatac ttgccttgga ctgtagaaca gatgaattaa      4920
     aatgggaatg tattaatttt acaattgcaa tcaattcatt ttacctttac ccagttttta      4980
     atataaagct cttaaatttt gaaattcact gtgtgactaa tagcatgatg ctctgcagtt      5040
     ttattaagag attagcctaa ccataaaact ctcatttcct tagtaagcca aattagagta      5100
     atcttataaa cagtgttggg aacaacgttt aacttttttg tgccaatttg ttcctgtatt      5160
     catgtatgta tgttacaaat ctgaaacttc atttttaagt tccttgttac atcatggtca      5220
     ttttctagtt ttttaccaga ctccccatct cacaataaaa tacgtcaaca a               5271
//

If you have problems or comments...

PBIL Back to PBIL home page