(data stored in SCRATCH zone)

EMBL: D14465

ID   D14465; SV 1; linear; genomic DNA; STD; PRO; 1311 BP.
XX
AC   D14465;
XX
DT   23-DEC-1993 (Rel. 38, Created)
DT   26-FEB-2008 (Rel. 94, Last updated, Version 11)
XX
DE   Bacillus subtilis alkA gene for 3-methyladenine DNA glycosylase, complete
DE   cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1311
RA   Morohoshi F.;
RT   ;
RL   Submitted (18-FEB-1993) to the INSDC.
RL   Contact:Fumiko Morohoshi National Cancer Center Research Institute,
RL   Virology Division; 5-1-1 Tsukiji, Chuo-ku, Tokyo 104, Japan
XX
RN   [2]
RX   DOI; 10.1093/nar/18.18.5473.
RX   PUBMED; 2120677.
RA   Morohoshi F., Hayashi K., Munakata N.;
RT   "Bacillus subtilis ada operon encodes two DNA alkyltransferases";
RL   Nucleic Acids Res. 18(18):5473-5480(1990).
XX
RN   [3]
RP   1-1311
RX   PUBMED; 8376346.
RA   Morohoshi F., Hayashi K., Munakata N.;
RT   "Bacillus subtilis alkA gene encoding inducible 3-methyladenine DNA
RT   glycosylase is adjacent to the ada operon";
RL   J. Bacteriol. 175(18):6010-6017(1993).
XX
DR   MD5; 5ff4a12dffd56815f3f98966469c5eb2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1311
FT                   /organism="Bacillus subtilis"
FT                   /strain="168T"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="EMBL3a-168T"
FT                   /clone="F411"
FT                   /cell_line="Bacillus subtilis 168T"
FT                   /db_xref="taxon:1423"
FT   protein_bind    199..228
FT                   /bound_moiety="AdaA"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   regulatory      221..226
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      243..248
FT                   /regulatory_class="minus_10_signal"
FT   misc_feature    255
FT                   /note="transcription initiation site"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   regulatory      289..294
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        304..1215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="GOA:P37878"
FT                   /db_xref="InterPro:IPR000035"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37878"
FT                   /protein_id="BAA03361.1"
FT                   /translation="MTWHEVNDVIVITLPEIFDMNANLGYLTREKNECMYEIENNIITK
FT                   VIAIGEIRSLVQVSVINNKQMIVQFLNDSRPVEQWKREEIVKYIHEWFDLDNDLTPFYE
FT                   MAKADPLLKMPARKFYGLRVIGIPDLFEALCWGVLGQQINLAFAYSLKKQFVEAFGDSI
FT                   EWNGKKYWVFPPYERIARLTPTDLADIKMTVKKSEYIIGIARLMASGELSREKLMKMNF
FT                   KDAEKNLIKIRGIGPWTANYVLMRCLRFPTAFPIDDVGLIHSIKILRNMNRKPTKDEIL
FT                   EISVPWKEWQSYATFYLWRVLY"
XX
SQ   Sequence 1311 BP; 453 A; 216 C; 243 G; 399 T; 0 other;
     ctctttatgt ccgttattga tactatccgg catttatctc acctctcctt acaatgctca        60
     tctaattctt tgaattgaat cccaatttaa attttcgaca cgcgtttttt atatcttggg       120
     ccatttttat ctactcccgt ttagcattct tgataactac actataacct cataaataga       180
     aaaaaataag gtggttagaa tgtaatagca agataacaaa atgagtaaag atgattatgt       240
     gataaactaa tttcaaccag cgtgagtttt cttataatta tttaagataa ggagaatgaa       300
     aaagtgacat ggcatgaagt caatgatgtt attgtcatta cattacctga aattttcgac       360
     atgaatgcga accttggcta cctaaccagg gaaaaaaatg aatgcatgta tgaaatagag       420
     aacaatatca ttacaaaagt tatagccatt ggggaaattc ggtccttagt gcaggtaagc       480
     gtaatcaata ataaacaaat gattgttcaa ttcctaaacg attctagacc tgttgagcag       540
     tggaaacggg aagagattgt aaaatatatt catgaatggt ttgatcttga taacgattta       600
     actccatttt atgaaatggc aaaagcagat ccattactta aaatgcctgc ccgaaaattt       660
     tatgggttgc gagtgatcgg cattcccgat ttatttgaag ctttatgttg gggagtttta       720
     gggcaacaaa ttaacttagc cttcgcgtac tccttaaaga agcaatttgt agaagcattt       780
     ggcgattcta ttgaatggaa tggtaaaaag tattgggtgt tcccaccgta cgagcgaatt       840
     gcacggttaa cccctaccga cctggcagat attaaaatga cggtgaaaaa aagtgaatat       900
     atcattggaa tagccagatt aatggcaagt ggagaattat cgagggaaaa attaatgaaa       960
     atgaacttta aagatgctga aaaaaactta attaaaatac gaggaatcgg tccttggaca      1020
     gccaattatg ttctaatgcg ctgccttagg ttcccgacag cttttccaat cgatgatgtg      1080
     ggtcttattc attcgataaa aatattacgt aatatgaacc gaaagcctac gaaagatgaa      1140
     atcttagaaa tatcggttcc atggaaagaa tggcaatcat acgctacctt ttatttatgg      1200
     cgtgtccttt actgaatcat ttcaacttta accggaatgt actcaataaa aaaagaatga      1260
     actttaaaac ctaatcccac aagtacattg taagtgcgac ttctagaatt c               1311
//

If you have problems or comments...

PBIL Back to PBIL home page