(data stored in SCRATCH zone)

EMBL: D15050

ID   D15050; SV 1; linear; mRNA; STD; HUM; 5316 BP.
XX
AC   D15050;
XX
DT   05-MAR-1994 (Rel. 38, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Homo sapiens mRNA for transcription factor AREB6, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5316
RA   Kawakami K.;
RT   ;
RL   Submitted (16-APR-1993) to the INSDC.
RL   Kiyoshi Kawakami, Jichi Medical School, Immunology Division;
RL   Minamikawachi-machi, Kawachi-gun, Tochigi 329-04, Japan
RL   (Tel:81-285-44-2111(ex.3370), Fax:81-285-44-5476)
XX
RN   [2]
RP   1-5316
RX   PUBMED; 8138542.
RA   Watanabe Y., Kawakami K., Hirayama Y., Nagano K.;
RT   "Transcription factors positively and negatively regulating the Na,K-ATPase
RT   alpha 1 subunit gene";
RL   J. Biochem. 114(6):849-855(1993).
XX
RN   [3]
RX   DOI; 10.1126/science.1840704.
RX   PUBMED; 1840704.
RA   Williams T.M., Moolten D., Burlein J., Romano J., Bhaerman R., Godillot A.,
RA   Mellon M., Rauscher III F.J., Kant J.A.;
RT   "Identification of a zinc finger protein that inhibits IL-2 gene
RT   expression";
RL   Science 254(5039):1791-1794(1991).
XX
DR   Ensembl-Gn; ENSG00000148516; homo_sapiens.
DR   Ensembl-Tr; ENST00000320985; homo_sapiens.
DR   Ensembl-Tr; ENST00000361642; homo_sapiens.
DR   EuropePMC; PMC116128; 11711622.
DR   EuropePMC; PMC1231143; 16113252.
DR   EuropePMC; PMC310970; 11076865.
DR   EuropePMC; PMC517414; 15322016.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5316
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="Hela"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        4..3378
FT                   /codon_start=1
FT                   /product="transcription factor AREB6"
FT                   /note="7 zinc finger domains (172-193AA, 202-222AA,
FT                   242-262AA, 270-292AA, 906-926AA, 934-954AA, 962-981AA)"
FT                   /note="DNA binding protein"
FT                   /note="homeodomain (581-640AA)"
FT                   /db_xref="GOA:P37275"
FT                   /db_xref="HGNC:HGNC:11642"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR008598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="PDB:2E19"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37275"
FT                   /protein_id="BAA03646.1"
FT                   /translation="MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEE
FT                   SVTDAADCEGVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDRKEGQEILGPEAQADEAG
FT                   CTVKDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGHDENGTP
FT                   DAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSH
FT                   KSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSG
FT                   SYSSHISSKKCISLIPVNGRPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQ
FT                   LSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTV
FT                   GLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVIS
FT                   AISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSE
FT                   KDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSA
FT                   TGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAG
FT                   QISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
FT                   TNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSLPKQQGELLERSTIT
FT                   SVYQNSVYSVQEEPLNLSCAKKEPQKDSCVTDSEPVVNVIPPSANPINIAIPTVTAQLP
FT                   TIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQ
FT                   DTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKR
FT                   PHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKRE
FT                   AEERDSTEQEEAGPEILSNEHVGARASPSQGDSDERESLTREEDEDSEKEEEEEDKEME
FT                   ELQEEKECEKPQGDEEEEEEEEEVEEEEVEEAENEGEEAKTEGLMKDDRAESQASSLGQ
FT                   KVGESSEQVSEEKTNEA"
XX
SQ   Sequence 5316 BP; 1615 A; 1141 C; 1245 G; 1315 T; 0 other;
     atcatggcgg atggccccag gtgtaagcgc agaaagcagg cgaacccgcg gcgcaataac        60
     gttacaaatt ataatactgt ggtagaaaca aattcagatt cagatgatga agacaaactg       120
     catattgtgg aagaagaaag tgttacagat gcagctgact gtgaaggtgt accagaggat       180
     gacctgccaa cagaccagac agtgttacca gggaggagca gtgaaagaga agggaatgct       240
     aagaactgct gggaggatga cagaaaggaa gggcaagaaa tcctggggcc tgaagctcag       300
     gcagatgaag caggatgtac agtaaaagat gatgaatgcg agtcagatgc agaaaatgag       360
     caaaaccatg atcctaatgt tgaagagttt ctacaacaac aagacactgc tgtcattttt       420
     cctgaggcac ctgaagagga ccagaggcag ggcacaccag aagccagtgg tcatgatgaa       480
     aatggaacac cagatgcatt ttcacaatta ctcacctgtc catattgtga tagaggctat       540
     aaacgcttta cctctctgaa agaacacatt aaatatcgtc atgaaaagaa tgaagataac       600
     tttagttgct ccctgtgcag ttacaccttt gcatacagaa cccaacttga acgtcacatg       660
     acatcacata aatcaggaag agatcaaaga catgtgacgc agtctgggtg taatcgtaaa       720
     ttcaaatgca ctgagtgtgg aaaagctttc aaatacaaac atcacctaaa agagcactta       780
     agaattcaca gtggagagaa gccatatgaa tgcccaaact gcaagaaacg cttttcccat       840
     tctggctcct atagctcaca cataagcagt aagaaatgta tcagcttgat acctgtgaat       900
     gggcgaccaa gaacaggact caagacatct cagtgttctt caccgtctct ttcagcatca       960
     ccaggcagtc ccacacgacc acagatacgg caaaagatag agaataaacc ccttcaagaa      1020
     caactttctg ttaaccaaat taaaactgaa cctgtggatt atgaattcaa acccatagtg      1080
     gttgcttcag gaatcaactg ttcaacccct ttacaaaatg gggttttcac tggtggtggc      1140
     ccattacagg caaccagttc tcctcagggc atggtgcaag ctgttgttct gccaacagtt      1200
     ggtttggtgt ctcccataag tatcaattta agtgatattc agaatgtact taaagtggcg      1260
     gtagatggta atgtaataag gcaagtgttg gagaataatc aagccaatct tgcatccaaa      1320
     gaacaagaaa caatcaatgc ttcacccata caacaaggtg gccattctgt tatttcagcc      1380
     atcagtcttc ctttggttga tcaagatgga acaaccaaaa ttatcatcaa ctacagtctt      1440
     gagcagccta gccaacttca agttgttcct caaaatttaa aaaaagaaaa tccagtcgct      1500
     acaaacagtt gtaaaagtga aaagttacca gaagatctta ctgttaagtc tgagaaggac      1560
     aaaagctttg aagggggggt gaatgatagc acttgtcttc tgtgtgatga ttgtccagga      1620
     gatattaatg cacttccaga attaaagcac tatgacctaa agcagcctac tcagcctcct      1680
     ccactccctg cagcagaagc tgagaagcct gagtcctctg tttcatcagc tactggagat      1740
     ggcaatttgt ctcctagtca gccaccttta aagaacctct tgtctctcct aaaagcatat      1800
     tatgctttga atgcacaacc aagtgcagaa gagctctcaa aaattgctga ttcagtaaac      1860
     ctaccactgg atgtagtaaa aaagtggttt gaaaagatgc aagctggaca gatttcagtg      1920
     cagtcttctg aaccatcttc tcctgaacca ggcaaagtaa atatccctgc caagaacaat      1980
     gatcagcctc aatctgcaaa tgcaaatgaa ccccaggaca gcacagtaaa tctacaaagt      2040
     cctttgaaga tgactaactc cccagtttta ccagtgggat caaccaccaa tggttccaga      2100
     agtagtacac catccccatc acctctaaac ctttcctcat ccagaaatac acagggttac      2160
     ttgtacacag ctgagggtgc acaagaagag ccacaagtag aacctcttga tctttcacta      2220
     ccaaagcaac agggagaatt attagaaagg tcaactatca ctagtgttta ccagaacagt      2280
     gtttattctg tccaggaaga acccttgaac ttgtcttgcg caaaaaagga gccacaaaag      2340
     gacagttgtg ttacagactc agaaccagtt gtaaatgtaa tcccaccaag tgccaacccc      2400
     ataaatatcg ctatacctac agtcactgcc cagttaccca caatcgtggc cattgctgac      2460
     cagaacagtg ttccatgctt aagagcgcta gctgccaata agcaaacgat tctgattccc      2520
     caggtggcat acacctactc aactacggtc agccctgcag tccaagaacc acccttgaaa      2580
     gtgatccagc caaatggaaa tcaggatgaa agacaagata ctagctcaga aggagtatca      2640
     aatgtagagg atcagaatga ctctgattct acaccgccca aaaagaaaat gcggaagaca      2700
     gaaaatggaa tgtatgcttg tgatttgtgt gacaagatat tccaaaagag tagttcatta      2760
     ttgagacata aatatgaaca cacaggtaaa agacctcatg agtgtggaat ctgtaaaaag      2820
     gcatttaaac acaaacatca tttgattgaa cacatgcgat tacattctgg agaaaagccc      2880
     tatcaatgtg acaaatgtgg aaagcgcttc tcacactctg ggtcttattc tcaacacatg      2940
     aatcatcgct actcctactg taagagagaa gcggaagaac gtgacagcac agagcaggaa      3000
     gaggcagggc ctgaaatcct ctcgaatgag cacgtgggtg ccagggcgtc tccctcacag      3060
     ggcgactcgg acgagagaga gagtttgaca agggaagagg atgaagacag tgaaaaagag      3120
     gaagaggagg aggataaaga gatggaagaa ttgcaggaag aaaaagaatg tgaaaaacca      3180
     caaggggatg aggaagagga ggaggaggag gaagaagtgg aagaagaaga ggtagaagag      3240
     gcagagaatg agggagaaga agcaaaaact gaaggtctga tgaaggatga cagggctgaa      3300
     agtcaagcaa gcagcttagg acaaaaagta ggcgagagta gtgagcaagt gtctgaagaa      3360
     aagacaaatg aagcctaatc gtttttctag aaggaaaata aattctaatt gataatgaat      3420
     ttcgttcaat attatccttg cttttcatgg aaacacagta acctgtatgc tgtgattcct      3480
     gttcactact gtgtgtgtgt gcgcgtgcat tgattactat ccatttcttt agtcaacgct      3540
     ctccacttcc tgatttctgc tttaaggaaa actgtgaact ttctgcttca tgtatcagtt      3600
     ttaaagcatc ccaggcaaag atcatctaca gattctagga attctctccc ctgaaatcaa      3660
     aacctggaga cttttttttc ttattttagt tgagaagttc ataaactgct caaggattag      3720
     ttttccagga ctctgcggag gaacggcagg aagaacctca gagagggcag aggtgacttc      3780
     aaagtgctgg ggactccgtc ctgagggtca cttggccctg agcccctgcg tgcccttgcg      3840
     gaagcccaga agcttcttcc tgctgcacct cccgtttccg ctgctgctga cgtttatgca      3900
     tttcatgatg gggtccaaca agaacacctg acttgggtga agttgtgcaa tattggaggc      3960
     tgactgtagg gctgggcagc tgggagacag gctcatggct catggctcat ggctcagggc      4020
     ggtgcctgcc ctgggccggg acccccctcc ccacccccca cctaggcttt ttgggttttg      4080
     ttcaaggaag gtaaagtgag aggtttaggt cagtgttttt aagtttttgt ttttttttta      4140
     aagcaaatcc tgtatatgta tctacatggg agataggtag acactactta tttgttacat      4200
     tttgtactat acgtttgtgt tccaggtttc agcttccctc gctcctgttg ttaagaagcg      4260
     tccctgtcag cacaggtgtg cattgaggaa ggggccccag ggccttcgct ccctcagcac      4320
     tggggtggag gcggcaggaa ggggcggccc ttacctggca ggtctgggcg cacctttagc      4380
     aggtggactc cgtggggctc caccagccag aagcctctgg aaggcaacga aggcaatgct      4440
     gctccctgag tccagtcccc gcccccaaac ccagcccagg tgccttcagc tacttcggct      4500
     tcttaaaccc tgcagtgtta aacagaggca ttgagaaagg ggaaaggcgg gtatttttaa      4560
     aagccaaaga ttgacccaag ttacttgagg gtagggaggc gggcccagtg caggaggctg      4620
     catccctggc ctgctggtgc ccaccggggg ctgtgcctgt gccgggccgc aggaagctgg      4680
     ctgcccccat tcctgctgct gctgctgctg ctgctctgtg gctgtttcaa agactgggcg      4740
     aaaggctgtc cggagggcag accaggtgcc ttgccgcaga gaaaacacca aagtctcctg      4800
     ttcgctcata aagaagtttt tgggatggga gagaatccag accatcttgg ggcagccagg      4860
     cccttgcctt catttttaca gaggtagcac aactgattcc aacacaaaac cccttcccct      4920
     ttttaaaatg atttctgttc taatgccata gatcaaaggc ctcagaaacc attgtgtgtt      4980
     tcctctttga agcaatgaca agcactttac tttcacggtg gtttttgttt tttcttattg      5040
     ctgtggaacc tcttttggag gacgttaaag gcgtgtttta cttgtttttt taagagtgtg      5100
     tgatgtgtgt tttgtagatt tcttgacagt gctgtaatac agacggcaat gcaatagcct      5160
     atttaaagaa ctacgtgatc tgattgagat gtacatagtt ttttttttta ccataactga      5220
     attattttat ctcttatgtt atcatgagaa atgtatgcca aatgattagt tgatgtatgt      5280
     tttttaattt aatatttaaa taaaatattt ggaagg                                5316
//

If you have problems or comments...

PBIL Back to PBIL home page