(data stored in ACNUC16935 zone)

EMBL: D16554

ID   D16554; SV 1; linear; mRNA; STD; ROD; 1115 BP.
XX
AC   D16554;
XX
DT   13-APR-1994 (Rel. 39, Created)
DT   11-JAN-2003 (Rel. 74, Last updated, Version 10)
XX
DE   Rattus norvegicus mRNA for polyubiquitin, complete cds, four repetitive
DE   ubiquitins in tandem.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1115
RA   Hayashi T.;
RT   ;
RL   Submitted (26-JUN-1993) to the INSDC.
RL   Takashi Hayashi, Jikei University School of Medicine, Biochemistry; 3-25-8
RL   Nishi-Shinbashi, Minato-ku, Tokyo 105, Japan
RL   (E-mail:tahayash@ddbj.nig.ac.jp, Tel:81-3-3433-1111(ex.2226),
RL   Fax:81-3-3435-1922)
XX
RN   [2]
RP   1-1115
RX   DOI; 10.1016/0167-4781(94)90020-5.
RX   PUBMED; 8018730.
RA   Hayashi T., Noga M., Matsuda M.;
RT   "Nucleotide sequence and expression of the rat polyubiquitin mRNA";
RL   Biochim. Biophys. Acta 1218(2):232-234(1994).
XX
DR   MD5; b015573d274481914b59945e5359ccd9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1115
FT                   /organism="Rattus norvegicus"
FT                   /strain="Wistar"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="lambda gt10"
FT                   /clone="22B1"
FT                   /tissue_type="cerebral cortex and hippocampus"
FT                   /db_xref="taxon:10116"
FT   5'UTR           <1..63
FT   CDS_pept        64..981
FT                   /codon_start=1
FT                   /product="polyubiquitin"
FT                   /note="highly homologous with human UbB gene."
FT                   /db_xref="GOA:P0CG51"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CG51"
FT                   /protein_id="BAA03983.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGY"
FT   mat_peptide     64..291
FT                   /product="ubiquitin"
FT   mat_peptide     292..519
FT                   /product="ubiquitin"
FT   mat_peptide     520..747
FT                   /product="ubiquitin"
FT   mat_peptide     748..978
FT                   /product="ubiquitin"
FT                   /note="extra C-terminal tyrosin extension (AA 305)"
FT   3'UTR           982..>1115
FT   regulatory      1102..1107
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1115 BP; 287 A; 330 C; 288 G; 210 T; 0 other;
     ctgtgagggt gtttcgacgc gctgggcggt ttgttccttc atcgcattcg ttaacaggtc        60
     aaaatgcaaa tcttcgtgaa gaccctgacc ggcaagacca tcaccctaga ggtggagccc       120
     agtgacacca tcgagaacgt gaaggccaag atccaggata aagagggcat cccccctgac       180
     cagcagaggc tcatctttgc cggcaagcag ctggaagatg gccgcaccct ctctgactac       240
     aacatccaga aagagtcaac cctgcacctg gtcctccgcc tgaggggcgg catgcagatc       300
     ttcgtgaaga ccctgaccgg caagaccatc accctggagg tggagcccag tgacaccatc       360
     gagaacgtga aggccaagat ccaggataaa gagggcatcc cccctgacca gcagaggctc       420
     atctttgccg gcaagcagct ggaagatggc cgcaccctct ctgattacaa catccagaaa       480
     gagtcaaccc tgcaccttgt cctccgcctg aggggcggca tgcagatctt cgtgaagacc       540
     ctgaccggca agaccatcac cctagaggtg gagcccagtg acaccatcga gaacgtgaag       600
     gccaagatcc aggataaaga gggcatcccc cctgaccagc agaggctcat ctttgccggc       660
     aagcagctgg aagatggccg caccctctct gattacaaca tccagaagga gtcaaccctg       720
     cacctggtcc tccgcctgag gggcggcatg cagatcttcg tgaagaccct gaccggcaag       780
     accatcaccc tggaggtgga gcccagtgac accatcgaga acgtgaaggc caagatccag       840
     gataaagagg gcatcccccc tgaccagcag aggctcatct ttgccggcaa gcagctggaa       900
     gatggccgca ccctctctga ttacaacatc cagaaagagt caaccctgca cctggtcctc       960
     cgcctgaggg gtggctatta attcttcagt ctgcattccc ggcgggcact gatggcatta      1020
     ctctgcactc tagccatttg ccccaattta agtttagaaa ttacaagttt cagtaatagc      1080
     tgaacctctg ttaaaaatgt taataaaggt tttgt                                 1115
//

If you have problems or comments...

PBIL Back to PBIL home page