(data stored in ACNUC16935 zone)

EMBL: D17296

ID   D17296; SV 1; linear; mRNA; STD; ROD; 2545 BP.
XX
AC   D17296;
XX
DT   13-APR-1994 (Rel. 39, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Rattus norvegicus mRNA for polyubiquitin, complete cds, ten completely
DE   repetitive ubiquitins in tandem and one ubiguitin-like protein.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-2545
RA   Hayashi T.;
RT   ;
RL   Submitted (24-JUL-1993) to the INSDC.
RL   Takashi Hayashi, Jikei University School of Medicine, Biochemistry; 3-25-8
RL   Nishi-Shinbashi, Minato-ku, Tokyo 105, Japan
RL   (E-mail:tahayash@ddbj.nig.ac.jp, Tel:81-3-3433-1111(ex.2226),
RL   Fax:81-3-3435-1922)
XX
RN   [2]
RP   1-2545
RX   DOI; 10.1016/0167-4781(94)90020-5.
RX   PUBMED; 8018730.
RA   Hayashi T., Noga M., Matsuda M.;
RT   "Nucleotide sequence and expression of the rat polyubiquitin mRNA";
RL   Biochim. Biophys. Acta 1218(2):232-234(1994).
XX
DR   MD5; 445519007a4cad7897cbcf34c47d5147.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2545
FT                   /organism="Rattus norvegicus"
FT                   /strain="Wistar"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="lambda gt10"
FT                   /clone="19A2"
FT                   /tissue_type="cerebral cortex and hippocampus"
FT                   /db_xref="taxon:10116"
FT   5'UTR           <1..33
FT   CDS_pept        34..2466
FT                   /codon_start=1
FT                   /gene="UbC"
FT                   /product="polyubiquitin"
FT                   /db_xref="GOA:Q63429"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:5L9U"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63429"
FT                   /protein_id="BAA04129.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEP
FT                   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ
FT                   IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
FT                   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FT                   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVK
FT                   AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG
FT                   KTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL
FT                   VLRLRGGMQIFVKTLTGKTITLEVEPSVNTKKVKQEDTRTFLTTVSRKSPSCACSWV"
FT   mat_peptide     34..261
FT                   /product="ubiquitin"
FT   mat_peptide     262..489
FT                   /product="ubiquitin"
FT   mat_peptide     490..717
FT                   /product="ubiquitin"
FT   mat_peptide     718..945
FT                   /product="ubiquitin"
FT   mat_peptide     946..1173
FT                   /product="ubiquitin"
FT   mat_peptide     1174..1401
FT                   /product="ubiquitin"
FT   mat_peptide     1402..1629
FT                   /product="ubiquitin"
FT   mat_peptide     1630..1857
FT                   /product="ubiquitin"
FT   mat_peptide     1858..2085
FT                   /product="ubiquitin"
FT   mat_peptide     2086..2313
FT                   /product="ubiquitin"
FT   mat_peptide     2314..2463
FT                   /product="ubiquitin-like protein"
FT                   /note="AA 781-810 are different from previous repeat"
FT   3'UTR           2467..>2545
FT   regulatory      2527..2532
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 2545 BP; 688 A; 738 C; 681 G; 438 T; 0 other;
     cttttgtgag gactgcagcc aacaccgctg acaatgcaga tctttgtgaa aaccttaact        60
     ggtaagacca tcaccctgga ggtcgagccc agtgacacca ttgaaaatgt caaggcaaag       120
     atccaggaca aggagggcat cccccctgac cagcagaggc tgatctttgc aggcaagcag       180
     ctggaagatg gccgcaccct gtcagactac aacatccaga aggagtccac cctgcacctg       240
     gtcctgcgcc tcagaggggg catgcagatc tttgtgaaga ccctgacagg caagaccatc       300
     accctggagg tcgagcccag tgacaccatt gaaaatgtca aggcaaagat ccaggacaag       360
     gagggcatcc cccctgacca gcagaggctg atctttgcag gcaagcagct ggaagatggc       420
     cgcaccctgt cagactacaa catccagaag gagtccacct tgcacctggt ccttcgcctc       480
     agagggggca tgcagatctt tgtgaagacc ctgacaggca agaccatcac cctggaggtc       540
     gagcccagtg acaccattga aaatgtcaag gcaaagatcc aggacaagga gggcatcccc       600
     cctgaccagc agaggctgat ctttgcaggc aagcagctgg aagatggccg caccctgtca       660
     gactacaaca tccagaagga gtccaccctg cacctggtcc ttcgcctcag agggggcatg       720
     cagatctttg tgaagaccct gacaggcaag accatcaccc tggaggtcga gcccagtgac       780
     accattgaaa atgtcaaggc aaagatccag gacaaggagg gcatcccccc tgaccagcag       840
     aggctgatct ttgcaggcaa gcagctggaa gatggccgca ccctgtcaga ctacaacatc       900
     cagaaggagt ccaccctgca cctggtcctg cgcctcagag ggggcatgca gatctttgtg       960
     aagaccctga caggcaagac catcaccctg gaggtcgagc ccagtgacac cattgaaaat      1020
     gtcaaggcaa agatccagga caaggagggc atcccccctg accagcagag gctgatcttt      1080
     gcaggcaagc agctggaaga tggccgcacc ctgtcagact acaacatcca gaaggagtcc      1140
     accctgcacc tggtccttcg cctcagaggg ggcatgcaga tctttgtgaa gaccctgaca      1200
     ggcaagacca tcaccctgga ggtcgagccc agtgacacca ttgaaaatgt caaggcaaag      1260
     atccaggaca aggagggcat cccccctgac cagcagaggc tgatctttgc aggcaagcag      1320
     ctggaagatg gccgcaccct gtcagactac aacatccaga aggagtccac cctgcacctg      1380
     gtccttcgcc tcagaggggg catgcagatc tttgtgaaga ccctgacagg caagaccatc      1440
     accctggagg tcgagcccag tgacaccatt gaaaatgtca aggcaaagat ccaggacaag      1500
     gagggcatcc cccctgacca gcagaggctg atctttgcag gcaagcagct ggaagatggc      1560
     cgcaccctgt cagactacaa catccagaag gagtccaccc tgcacctggt ccttcgcctc      1620
     agagggggca tgcagatctt tgtgaagacc ctgacaggca agaccatcac cctggaggtc      1680
     gagcccagtg acaccattga aaatgtcaag gcaaagatcc aggacaagga gggcatcccc      1740
     cctgaccagc agaggctgat ctttgcaggc aagcagctgg aagatggccg caccctgtca      1800
     gactacaaca tccagaagga gtccaccctg cacctggtcc tgcgcctcag agggggcatg      1860
     cagatctttg tgaagaccct gacaggcaag accatcaccc tggaggtcga gcccagtgac      1920
     accattgaaa atgtcaaggc aaagatccag gacaaggagg gcatcccccc tgaccagcag      1980
     aggctgatct ttgcaggcaa gcagctggaa gatggccgca ccctgtcaga ctacaacatc      2040
     cagaaggagt ccaccctgca cctggtcctg cgcctcagag ggggcatgca gatctttgtg      2100
     aagaccctga caggcaagac catcaccctg gaggtcgagc ccagtgacac cattgaaaat      2160
     gtcaaggcaa agatccagga caaggagggc atcccccctg accagcagag gctgatcttt      2220
     gcaggcaagc agctggaaga tggccgcacc ctgtcagact acaacatcca gaaggagtcc      2280
     accctgcacc tggtcctgcg cctcagaggg ggcatgcaga tctttgtgaa gaccctgaca      2340
     ggcaagacca tcactctgga ggtcgagccc agtgttaaca ccaagaaggt caaacaggaa      2400
     gatactcgta cctttctcac cacagtatct agaaagagcc cttcttgtgc ttgttcttgg      2460
     gtttgatggg gaggtgtctt agttttccct atcttttaag ctgttaacaa gtttcattgc      2520
     actttgaata aagttcttgc attcc                                            2545
//

If you have problems or comments...

PBIL Back to PBIL home page