(data stored in ACNUC27125 zone)

EMBL: D26125

ID   D26125; SV 1; linear; mRNA; STD; HUM; 1155 BP.
XX
AC   D26125;
XX
DT   12-JAN-1994 (Rel. 38, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Homo sapiens mRNA for 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase DD4,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1155
RA   Hara A.;
RT   ;
RL   Submitted (09-DEC-1993) to the INSDC.
RL   Akira Hara, Gifu Pharmaceutical University, Laboratory of Biochemistry;
RL   Mitahora-higashi, Gifu, Gifu 502, Japan (Tel:81-58-237-3931(ex.274),
RL   Fax:81-58-237-5979)
XX
RN   [2]
RA   Winters C.J., Molowa D.T., Guzelian P.S.;
RT   "Isolation and characterization of cloned cDNAs encoding human liver
RT   chlordecone reductase";
RL   J. Biochem. 29:1080-1087(1990).
XX
RN   [3]
RP   1-1155
RX   PUBMED; 8172617.
RA   Deyashiki Y., Ogasawara A., Nakayama T., Nakanishi M., Miyabe Y., Sato K.,
RA   Hara A.;
RT   "Molecular cloning of two human liver 3 alpha-hydroxysteroid/dihydrodiol
RT   dehydrogenase isoenzymes that are identical with chlordecone reductase and
RT   bile-acid binder";
RL   Biochem. J. 299:545-552(1994).
XX
DR   MD5; 9ee1ae41fe13a87d199962bbdf946494.
DR   Ensembl-Gn; ENSG00000198610; homo_sapiens.
DR   Ensembl-Tr; ENST00000263126; homo_sapiens.
DR   Ensembl-Tr; ENST00000380448; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1155
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="lambda gt11"
FT                   /clone="11"
FT                   /tissue_type="liver"
FT                   /note="Caucasian"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..968
FT                   /codon_start=3
FT                   /product="3 alpha-hydroxysteroid/dihydrodiol dehydrogenase
FT                   DD4"
FT                   /EC_number="1.3.1.20"
FT                   /note="dihydrodiol dehydrogenase isozyme DD4"
FT                   /db_xref="GOA:P17516"
FT                   /db_xref="H-InvDB:HIT000101140.12"
FT                   /db_xref="HGNC:HGNC:387"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="PDB:2FVL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17516"
FT                   /protein_id="BAA05122.1"
FT                   /translation="PKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFR
FT                   HIDSAYLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKL
FT                   QLDYVDLYLLHFPMALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGV
FT                   SNFNCRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRH
FT                   KLWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENIQV
FT                   FEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPFSDEY"
FT   regulatory      1135..1140
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1155
XX
SQ   Sequence 1155 BP; 330 A; 265 C; 269 G; 291 T; 0 other;
     atcccaaata tcagcgtgta gagctaaatg atggtcactt catgcccgta ttgggatttg        60
     gcacctatgc acctccagag gttccgagga acagagctgt agaggtcacc aaattagcaa       120
     tagaagctgg cttccgccat attgattctg cttatttata caataatgag gagcaggttg       180
     gactggccat ccgaagcaag attgcagatg gcagtgtgaa gagagaagac atattctaca       240
     cttcaaagct ttggtgcact ttctttcaac cacagatggt ccaaccagcc ttggaaagct       300
     cactgaaaaa acttcaactg gactatgttg acctctatct tcttcatttc ccaatggctc       360
     tcaagccagg tgagacgcca ctaccaaaag atgaaaatgg aaaagtaata ttcgacacag       420
     tggatctctc tgccacatgg gaggtcatgg agaagtgtaa ggatgcagga ttggccaagt       480
     ccatcggggt gtcaaacttc aactgcaggc agctggagat gatcctcaac aagccaggac       540
     tcaagtacaa gcctgtctgc aaccaggtag aatgtcatcc ttacctcaac cagagcaaac       600
     tgctggattt ctgcaagtca aaagacattg ttctggttgc ccacagtgct ctgggaaccc       660
     aacgacataa actatgggtg gacccaaact ccccagttct tttggaggac ccagttcttt       720
     gtgccttagc aaagaaacac aaacgaaccc cagccctgat tgccctgcgc taccagctgc       780
     agcgtggggt tgtggtcctg gccaagagct acaatgagca gcggatcaga gagaacatcc       840
     aggtttttga attccagttg acatcagagg atatgaaagt tctagatggt ctaaacagaa       900
     attatcgata tgttgtcatg gattttctta tggaccatcc tgattatcca ttttcagatg       960
     aatattagca tagagggtgt tgcacgacat ctagcagaag gccctgtgtg tggatggtga      1020
     tgcagaggat gtctctatgc tggtgactgg acacacggcc tctggttaaa tccctcccct      1080
     cctgcttggc aacttcagct agctagatat atccatggtc cagaaagcaa acataataaa      1140
     tttttatctt gaagt                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page