(data stored in ACNUC1829 zone)

EMBL: D29963

ID   D29963; SV 1; linear; mRNA; STD; HUM; 1486 BP.
XX
AC   D29963;
XX
DT   28-MAY-1996 (Rel. 47, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for CD151, complete cds.
XX
KW   CD151; membrane glycoprotein; transmembrane 4 superfamily.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1486
RA   Hasegawa H.;
RT   ;
RL   Submitted (15-APR-1994) to the INSDC.
RL   Hitoshi Hasegawa, Ehime University School of Medicine, First Department of
RL   Internal Medicine; Shigenobu, Onsen-Gun, Ehime 791-02, Japan
RL   (E-mail:hitoshih@m.ehime-u.ac.jp, Tel:089-964-5111(ex.2114),
RL   Fax:089-960-5299)
XX
RN   [2]
RP   1-1486
RX   PUBMED; 8627808.
RA   Hasegawa H., Utsunomiya Y., Kishimoto K., Yanagisawa K., Fujita S.;
RT   "SFA-1, a novel cellular gene induced by human T-cell leukemia virus type
RT   1, is a member of the transmembrane 4 superfamily";
RL   J. Virol. 70(5):3258-3263(1996).
XX
DR   MD5; f3abda2ecd368d3e8a1932641daa0b40.
DR   Ensembl-Gn; ENSG00000177697; homo_sapiens.
DR   Ensembl-Tr; ENST00000322008; homo_sapiens.
DR   Ensembl-Tr; ENST00000397420; homo_sapiens.
DR   Ensembl-Tr; ENST00000397421; homo_sapiens.
DR   Ensembl-Tr; ENST00000530726; homo_sapiens.
DR   EuropePMC; PMC190191; 8627808.
XX
CC   Sequence updated (8-Jun-1994) by:
CC   Hitoshi Hasegawa
CC
CC   Sequence updated (14-May-1996) by:
CC   Hitoshi Hasegawa
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1486
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="library of H. Hasegawa"
FT                   /clone="SFA-1"
FT                   /cell_type="HTLV-1 infected T cells"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..1486
FT   CDS_pept        85..846
FT                   /codon_start=1
FT                   /product="CD151"
FT                   /note="membrane glycoprotein"
FT                   /db_xref="GOA:P48509"
FT                   /db_xref="H-InvDB:HIT000101324.12"
FT                   /db_xref="HGNC:HGNC:1630"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48509"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="BAA06229.1"
FT                   /translation="MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYAYYQQLNTELKENLKDTMTRRYHQSGHEAVTSAVDQLQQEFHCCGSNNSQD
FT                   WRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
FT   regulatory      1467..1472
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1486
XX
SQ   Sequence 1486 BP; 274 A; 458 C; 442 G; 312 T; 0 other;
     tcggacgcgt ggtagcctag agtcctgggg agcttctgtc cacctgtcct gcagaggagt        60
     cgtttccagc ccggctgccc caggatgggt gagttcaacg agaagaagac aacatgtggc       120
     accgtttgcc tcaagtacct gctgtttacc tacaattgct gcttctggct ggctggcctg       180
     gctgtcatgg cagtgggcat ctggacgctg gccctcaaga gtgactacat cagcctgctg       240
     gcctcaggca cctacctggc cacagcctac atcctggtgg tggcgggcac tgtcgtcatg       300
     gtgactgggg tcttgggctg ctgcgccacc ttcaaggagc gtcggaacct gctgcgcctg       360
     tacttcatcc tgctcctcat catctttctg ctggagatca tcgctggtat cctcgcctac       420
     gcctactacc agcagctgaa cacggagctc aaggagaacc tgaaggacac catgaccagg       480
     cgctaccacc agtcgggcca tgaggctgtg accagcgctg tggaccagct gcagcaggag       540
     ttccactgct gtggcagcaa caactcacag gactggcgag acagtgagtg gatccgctca       600
     caggaggccg gtggccgtgt ggtcccagac agctgctgca agacggtggt ggctctttgt       660
     ggacagcgag accatgcctc caacatctac aaggtggagg gcggctgcat caccaagttg       720
     gagaccttca tccaggagca cctgagggtc attggggctg tggggatcgg cattgcctgt       780
     gtgcaggtct ttggcatgat cttcacgtgc tgcctgtaca ggagtctcaa gctggagcac       840
     tactgaccct gccttgggcc ttgctgctgc tgcacccaac tactgagctg agaccactga       900
     gtaccagggg ctgggctccc tgatgacacc caccctgtgc catcaccata acctctgggg       960
     accccaacct cagaggcagc ttcaagtgcc ttttcgtgcg caccaatgcc cagcagggga      1020
     ggtgaggggg gctggcgggg cgaagtttgg ggggtgtttt gtggggctcc ccggacatac      1080
     tctctgcctg gtggtcagat gcaggttgga aggggccttg ctgagtggcg caaggccgag      1140
     atcgttccca gcagggggag aaacccttca caccccaggc ccttcaggaa ctggggcttt      1200
     gccttgcagc cacatggccc catcccagtt ggggaagcca ggtgagctct gacccttggg      1260
     cctgggcctc tgcccctccc aacccagccg tcgtctccct cgacagcgcc cctgctgtct      1320
     tccccaccgc agtcaccacc acccgaaatg ccacgtggtc actgtgcact gccctgttca      1380
     tgtgcctctg cggggcaggg ccttcctggt tttgtacact gctgtaccca gatgcctaca      1440
     accatccctg ccacatacag gtgctcaata aacacttgta gagcag                     1486
//

If you have problems or comments...

PBIL Back to PBIL home page