(data stored in SCRATCH zone)

EMBL: D30689

ID   D30689; SV 1; linear; genomic DNA; STD; PRO; 11604 BP.
XX
AC   D30689;
XX
DT   15-MAR-1995 (Rel. 43, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 14)
XX
DE   Bacillus subtilis DNA around narB region (nasB operon and nasA gene).
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-11604
RA   Yamane K.;
RT   ;
RL   Submitted (11-MAY-1994) to the INSDC.
RL   Kunio Yamane, University of Tsukuba, Institute of Biological Sciences;
RL   1-1-1 Ten-ohdai, Tsukuba, Ibaraki 305, Japan (Tel:81-298-53-6680,
RL   Fax:81-298-53-6680)
XX
RN   [2]
RP   1-11604
RA   Ogawa K., Nakano M.M., Zubar P., Yamane K.;
RT   "Nucleotide sequence of 11604bp around narB region";
RL   Unpublished.
XX
RN   [3]
RX   PUBMED; 7868621.
RA   Ogawa K., Akagawa E., Yamane K., Sun Z.W., LaCelle M., Zuber P., Nakano M.;
RT   "The nasB operon and nasA gene are required for nitrate/nitrite
RT   assimilation in Bacillus subtilis";
RL   J. Bacteriol. 177(5):1409-1413(1995).
XX
RN   [4]
RX   PUBMED; 7704252.
RA   Ogasawara N., Fujita Y., Kobayashi Y., Sadaie Y., Tanaka T., Takahashi H.,
RA   Yamane K., Yoshikawa H.;
RT   "Systematic sequencing of the Bacillus subtilis genome: progress report of
RT   the Japanese group";
RL   Microbiology (Reading, Engl.) 141:257-259(1995).
XX
DR   MD5; 035d52d25f3a48b971cb4f7bac42bcce.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11604
FT                   /organism="Bacillus subtilis"
FT                   /strain="168TrpC2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        complement(828..2093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasA"
FT                   /product="nitrate transporter"
FT                   /note="ORF2"
FT                   /db_xref="GOA:P42432"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42432"
FT                   /protein_id="BAA06351.1"
FT                   /translation="MKLSELKTSGHPLTLLCSFLYFDVSFMIWVMLGALGVYISQDFGL
FT                   SPFEKGLVVAVPILSGSVFRIILGILTDRIGPKKTAVIGMLVTMIPLLWGTFGGRSLTE
FT                   LYAIGILLGVAGASFAVALPMASRWYPPHLQGLAMGIAGAGNSGTLFATLFGPRLAEQF
FT                   GWHIVMGIALIPLLIVFILFVSMAKDSPAQPSPQPLKSYLHVFGQKETWFFCLLYSVTF
FT                   GGFVGLSSFLSIFFVDQYQLSKIHAGDFVTLCVAAGSFFRPVGGLISDRVGGTKVLSVL
FT                   FVIVALCMAGVSSLPSLSMGYGPIVCRNDGARNGKRRSIPARAAALPQRNRHGDGNRRC
FT                   GRRNRRVFLAEHLRISQTDDRHICYRFITFPVSRCWRLHLCLPQAITGGKAGARKAARR
FT                   MFRILTDTRLCVSFLFSLDFQQ"
FT   CDS_pept        2273..4585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasBA"
FT                   /product="electolon trasporter subunit of nitrate
FT                   reductase"
FT                   /note="ORF3"
FT                   /db_xref="GOA:P42433"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42433"
FT                   /protein_id="BAA06352.1"
FT                   /translation="MKKQRLVLAGNGMAGIRCIEEVLKLNRHMFEIVIFGSEPHPNYNR
FT                   ILLSSVLQGEASLDDITLNSKDWYDKHGITLYTGETVIQIDTDQQQVITDRKRTLSYDK
FT                   LIVATGSSPHILPIPGADKKGVYGFRTIEDCQALMNMAQHFQKAAVIGAGLLGLEAAVG
FT                   LQHLGMDVSVIHHSAGIMQKQLDQTAARLLQTELEQKGLTFLLEKDTVSISGATKADRI
FT                   HFKDGSSLKADLIVMAAGVKPNIELAVSAGIKVNRGIIVNDFMQTSEPNIYAVGECAEH
FT                   NGTVYGLVAPLYEQGKALASHICGVPCEEYQGSAPSAALKIAGIDVWSAGKIQEDERTT
FT                   SIKIYDEQAGVYKKALFVDDKLRVILFGDTRDKQRLLDSLLKQRDISIAKKQIIEPETS
FT                   GPLFESMPSSETICQCNTVTKGAIEDAVHTNSLTTVEEVKHCTKATGSCGGCKPLVEDL
FT                   LRYMTNSEYTKPASTPSFCSCTDFTEDDIIAELQRRPFTNPAEVMNQLDWKTKNGCSTC
FT                   VPAIQYYLEMLYPGFVQPEPATEETCILIPQMYGGRTNAEQLRTIANIIEAYSIPDVSI
FT                   THGQRLKLSGIKPADLPNMKKDLKMPVYTNEHRHALQSIKACTCGQNRSIQQLAAQIER
FT                   QLEMLPLPAPISISLSCETDCTEAALQDVGAIRTQAGWDIHIGGVRGTHARSGALFCVT
FT                   ENEDSTAGMIKGLIQYYRETDHYLEGVHQWIDRLGIVHIREVLFEEDLRAQLLESLQTD
FT                   LSLIQNPTVETGAYKKG"
FT   CDS_pept        4694..6724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasBB"
FT                   /product="catalytic subunit of nitrate reductase"
FT                   /note="ORF4"
FT                   /db_xref="GOA:P42434"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42434"
FT                   /protein_id="BAA06353.1"
FT                   /translation="MQLVEQTIVTRKKYTAIGIDNPTTQGRLCIKGMNAHQHALNSSRI
FT                   TRPLLKKNGEFMPVSWEEALNHIKDQVTMIQTEHGHDAMAVYGSASITNEEAYLLGKFA
FT                   RVGLQTKYIDYNGRLCMSAAATAANQTFGADRGLTNPLSDIPHTRVIILAGTNIAECQP
FT                   TIMPYFEKAKENGAYFIAIDPRETATTKIADLHLKIKPGTDAALANGLVKIIIDEQLIN
FT                   EDFIQSRTNGFEELKQHTDSLDLNDIAEQTSVSLVDIRKAAVKFAKETSGMLFTARGIE
FT                   QQTDGTAAVKGFLNMVLITGKIGKPYSGYGAITGQGNGQGAREHGQKADQLPGYRSIEN
FT                   EEHRAHIAKVWGIHQDDLPRKGVSAYEVMEKINDGDIKGLFLMCSNPAVSSPNANLVKK
FT                   ALRRLTFFVAIDLFISETAKYADVILPASSYLEDEGTMTNVEGRVTLREASRPCPGEAK
FT                   HDWQIICDLASALGKGRYFSYTSAEDIFNELREASRGGIADYSGISYGRLRREGGIHWP
FT                   CPESDHPGTGRLFTESFAHPDQKAALSVIPNEPPVPKEKPTADYPLYLTTGRVMSHYLT
FT                   GVQTRKSAALAARHFESFMEIHPQTAATYNIEDRVLVKIESPRGSITVRSKLSEQIRKD
FT                   TVFVPIHWADAQNVNDLIGEALDPACKMPGFKVCAVRIIPI"
FT   CDS_pept        6846..9263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasBC"
FT                   /product="subunit of nitrite reductase"
FT                   /note="ORF5"
FT                   /db_xref="GOA:P42435"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42435"
FT                   /protein_id="BAA06354.1"
FT                   /translation="MGKKQLVLVGNGMAGVRAIEEILSVAKDEFQITIFGAEPHPNYNR
FT                   ILLSKVLQGDTDIKDITLNDWDWYEENNIQLYTNETVIKVDTENKTVITDADRIQPYDE
FT                   LILATGSVPFILPIPGADKKGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARG
FT                   LLNLGMDVSVIHLAPFLMERQLDATAGRLLQNELEKQGMTFLLEKQTEEIVGDDRVEGL
FT                   RFKDGTSIEADLVVMAVGIRPNTTLGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEH
FT                   RGIAYGLVAPLYEQAKVLAKHMCGIETKPYEGSVLSTQLKVSGVEVFSAGDFNESEEKK
FT                   AIKVFDEQDGIYKKIVLRGNQIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPL
FT                   SQEAGTSITAAMSDDEIICGCNGVSKGAIIQAIQEKGCSSTDEIKACTGASRSCGGCKP
FT                   LVEEILQHTLGSDFDASAQKEAICGCTTLSRDEVVEEIKAKGLSHTREVMNVLGWKTPE
FT                   GCSKCRPALNYYLGMINPTKYEDDRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSTD
FT                   LRKIADVVDKYEIPLVKMTGGQRIDLIGVKKEDLPKVWEDLDMPSGYAYGKTLRTVKTC
FT                   VGEQFCRFGTQDSMALGIALEKKFEGLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDG
FT                   GWELYVGGNGGTHLRAGDLLMKVKTNEEVLEYAGAYLQYYRETANYLERTSAWLERVGL
FT                   SHVQSVLNDPEKRQELNGRMNETLSVHKDPWKDFLEDKQTSKELFENVVTTS"
FT   CDS_pept        9295..9615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasBD"
FT                   /product="subunit of nitrite reductase"
FT                   /note="ORF6"
FT                   /db_xref="GOA:P42436"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42436"
FT                   /protein_id="BAA06355.1"
FT                   /translation="MVNKDVTKVCIGKIEELPEQLGKTVYIEDKELAVFKLSDGSIRAI
FT                   ENRCPHKGGVLAEGIVSGQYVFCPMHDWKISLEDGIVQEPDHGCVKTYETLIEGEHVYL
FT                   VY"
FT   CDS_pept        9676..11127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasBE"
FT                   /product="S-adenosyl-L-methionine:uroporphyrinogen III"
FT                   /note="ORF7"
FT                   /db_xref="GOA:P42437"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42437"
FT                   /protein_id="BAA06356.1"
FT                   /translation="MIMKNGIVYFVGAGPGDPGLLTIKGKQALKEADVILYDRLANPKL
FT                   LEFASPDCQFIYCGKLPNRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEA
FT                   DALHEHGIRYEMVPGITSGIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEG
FT                   LARSVQTLVFYMGVKNLSYICQQLISYGKSPSVPVIVIQWGTWGRQRSVKGTLENIQQK
FT                   VQEHQITNPAIIVIGDIVNFQTHSWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADL
FT                   IEWPKWRTENMPVNEEILRKIGTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAA
FT                   SEQAKTELEKRGFLVTAIQPDSEKRLVVGSRHAVENMQKHESCSFYITHENVIDDRFTH
FT                   MIQRTISESPLHMVICPNKLSVQQLINGGEQIGILPEPSASRPPIVCIGDDSAAGIYGF
FT                   TAVQEQDELLAFIHNQHAEKKLLHT"
XX
SQ   Sequence 11604 BP; 3369 A; 2863 C; 2746 G; 2626 T; 0 other;
     caacaaatct cgggttttca taggccgttt ctgtcacggc tttttcatca ggccgcttca        60
     ataccggatg cagtctcgca gaagcatttg attctgcggc gtgacgcaaa tcagctttaa       120
     catcacttgg cagcgatgcg gcccgggtga atatccggcc caaatgcttg accgttcccc       180
     tctgattatg ggcactgtat tcgctgattt ccttggagca agggcacaga gtcgttactt       240
     ttgctgagat gccggcacgc tgtttaaacg gctgatcttt gcgataggtg acagacatga       300
     atatatcagc atgcatcaaa cccgctttct caagcttcgg gcttttccgt tcgaaaaacc       360
     acggaaacct cacttcaact gtggcagatg atgtgtccat gttttctgca agctctttcg       420
     taaattgctg aagagaggaa aatgagagaa tccagccatt ttgatgatag acttgcagca       480
     gctctgttaa ccggctcatg ttaatcccct tctgatttct cggcaaatta caagtcattg       540
     taaagttcgc agccgttgtt tgctcggcag gcatcatggc agaagtgatt gtgactggat       600
     gggacacatt agctacacct acatgctgaa tgtcaaaaaa ataatccttc ctgatatttt       660
     gcaggtcctt cattttctct ttttccactg gtttctcgcc tttgatcgga ctgaccgatc       720
     caaagtattg aagacgctcc gtttttttcg ggagcagcgt atgttgattc attcagaaaa       780
     ctcctctcac taacaaatcg taataattac tatttatttt gatcggttca ctgttgaaaa       840
     tcaagagaaa ataaaaaaga cacgcacaaa cgcgtgtccg tcaaaatcct aaacatccgc       900
     cgggctgctt tccgcgctcc agcttttccg ccagtaatag cctgcggcaa gcacaagtgc       960
     aaacgccagc agcgcgatac aggaaacgtg ataaaccgat agcatatgtg cctgtcatct      1020
     gtttgagaga tcctaagatg ttcggcaaga aaaaccctcc gattcctccg gccgcaccga      1080
     cgattcccgt caccatgccg atttctttgc ggaagcgctg cggcacgagc tggaatactg      1140
     cgccgtttcc cattccgagc cccatcattc cgacaaacaa taggaccata acccattgag      1200
     agagatggca ggctactgac tccggccata cacagtgcca cgatgacaaa caatacagaa      1260
     agaactttcg tgccgccgac acgatctgaa atcaagcccc cgacaggccg gaaaaagctc      1320
     cccgccgcca cacataatgt aacgaagtcc cctgcgtgaa tttttgacag ctggtattga      1380
     tcaacaaaga aaatagataa aaagcttgag agcccgacaa atccgccaaa tgtgacgctg      1440
     tacagcaggc agaaaaacca tgtttccttt tgcccaaaca catgcagata gcttttgagc      1500
     ggctggggag acggctgtgc aggggaatcc tttgccatgg atacaaaaag aataaagacg      1560
     atcaataatg gaattagcgc aattcccatg acaatgtgcc agccgaactg ctctgccaga      1620
     cgagggccaa acagggttgc aaacaacgtg ccgctgttcc ccgctccggc aatccccatc      1680
     gcaagtccct gcaaatgagg cggataccag cggctggcca taggcagcgc tacagcaaag      1740
     cttgctcccg ccacgccaag cagaatcccg atggcataca gctcagtcag ggaacggccg      1800
     ccgaatgtcc cccaaagcag cggaatcatc gtcaccagca tcccgatcac tgccgttttt      1860
     ttcggtccga ttctgtccgt taaaatacca agaatgatac gaaacacaga tccagataaa      1920
     atcggcacag ctacgacaag ccctttctca aaaggagaca ggccaaaatc ctgagaaata      1980
     taaacaccca gcgccccaag cataacccat atcataaaac tgacatcaaa gtataaaaag      2040
     gaacagagca aagtgagtgg atgaccgcta gttttcagtt ccgacagctt cataagattc      2100
     ccctttctag accctcatta ttttacattt tctgaatcaa ggatatagga ccattatttt      2160
     ctggaaaaga catgtgtaag tttttgtgac acgtttaatg cgttaacaat gcattgtgac      2220
     ataattttta ataggagaaa acttacgagc ttcgccaaag gaggtctgat acatgaagaa      2280
     acaaagatta gtgttagcgg gaaacggcat ggccggaatc cgctgtattg aagaagtatt      2340
     aaagctgaat cgccacatgt ttgagattgt cattttcgga agcgagccgc atcccaatta      2400
     caatcgcatt ctcttatcct ctgtattgca gggtgaagcg tcactcgatg atattacact      2460
     gaacagcaag gattggtacg acaagcacgg gatcacgctt tacacaggcg aaacggttat      2520
     tcagattgat acagatcagc agcaggtcat cacagatcgg aaacgcactc tgtcgtatga      2580
     caaattaata gtggcaacag gctcctcccc tcatattctc cctatccccg gggcagacaa      2640
     aaaaggtgtc tatggatttc ggacaataga agactgccaa gcgctgatga acatggccca      2700
     gcactttcaa aaggctgcgg taatcggagc cggcttatta ggactggaag ctgcagtagg      2760
     tttacagcat ctcggtatgg atgtcagcgt cattcaccac tccgccggca ttatgcaaaa      2820
     acagctcgat caaacagcgg cgcggctgct gcaaacagag ctggaacaaa aaggcctaac      2880
     ctttcttttg gagaaagaca ccgtctccat ttccggcgcc acgaaggcag accgaatcca      2940
     ttttaaagat ggctcttcat taaaagcaga cttgattgtg atggcggccg gcgtcaaacc      3000
     gaatattgaa ttggctgtat ccgctggaat caaagtgaac cgcgggatca tcgtgaatga      3060
     cttcatgcag acaagcgaac cgaatatcta cgccgttggt gaatgcgctg agcataacgg      3120
     aacggtgtac ggattggtgg ctccgcttta tgagcaggga aaagcgctcg ccagtcatat      3180
     ttgcggcgtt ccatgtgagg aatatcaagg ctcagcacca tctgcggcgt taaaaatagc      3240
     tggaatcgat gtgtggtcag caggaaagat ccaagaggat gaacgcacga cgagcatcaa      3300
     aatctacgac gaacaagcag gcgtttataa aaaagcgctt tttgtagatg acaaactgcg      3360
     cgttatttta ttcggagaca cccgtgacaa gcagcggctt ctcgacagcc tgcttaaaca      3420
     acgagacatc tccattgcca aaaaacagat catcgaaccg gagacaagcg gccctttatt      3480
     tgaatccatg ccttccagtg aaacgatttg ccaatgcaac acagtgacga aaggcgcgat      3540
     tgaagacgcg gtgcacacga atagcttaac aactgttgag gaagtcaagc actgcaccaa      3600
     agccactggg tcctgcggag gatgcaaacc gctcgttgaa gaccttttga gatacatgac      3660
     caacagcgaa tatacgaagc ccgccagcac accttcgttt tgcagctgta ctgattttac      3720
     agaagacgac atcatcgctg agcttcagcg caggccattc actaatccgg cagaagtgat      3780
     gaaccagctt gactggaaaa caaaaaacgg atgcagtact tgtgttcctg cgattcaata      3840
     ctatctggaa atgctgtacc ctgggtttgt ccagcctgag ccagccactg aagagacatg      3900
     catcctgatt ccgcaaatgt acggcgggcg gacaaacgcg gagcagctaa gaaccatcgc      3960
     caacatcatt gaggcataca gcattcccga cgtatccatt actcacggcc aaaggctgaa      4020
     gctttccggg atcaagcctg cggatctccc gaacatgaaa aaagacctga aaatgcccgt      4080
     ttacactaat gaacaccgac acgcgctgca aagcatcaaa gcatgtacat gcgggcaaaa      4140
     tcgatcgatt cagcagctgg cagcccaaat cgaaagacaa cttgagatgc ttcccttacc      4200
     cgctcccatt tctatcagct tatcatgtga aacagactgc accgaggccg ccctgcaaga      4260
     tgtcggcgca attcggacac aagctggctg ggacattcac atcggcggcg tccggggaac      4320
     tcatgcccgt tcaggagctt tgttttgcgt gactgagaac gaagacagca ctgccggcat      4380
     gatcaaagga ctgatccagt attatcggga aacggatcat tacttagaag gtgttcatca      4440
     gtggatagac cgtctcggga tcgttcatat cagagaagtg ctattcgaag aagacctaag      4500
     ggcacagctg ctggaaagcc tccaaacaga tctgtcactg attcaaaacc cgactgtaga      4560
     gacgggcgca tataagaaag gatgaggcat tttgactgaa cgactgctta gatatttccg      4620
     tgataaacag caagacgtcc aatcagaaaa aacatatgac actcaatgcc cgttttgcag      4680
     catgcagtgc aaaatgcagc tcgtggaaca aaccatcgtc acgcgcaaaa agtacactgc      4740
     gatcgggatt gataatccta cgacacaggg tcggctatgc atcaagggca tgaatgctca      4800
     ccagcatgcc ttgaactcct cccgcatcac ccggccgctg ctgaagaaaa acggcgagtt      4860
     tatgcctgtt tcctgggaag aagcactgaa tcatatcaaa gaccaagtga caatgatcca      4920
     aactgaacac ggacatgacg ccatggcggt atacggaagc gcctcgatta caaatgaaga      4980
     ggcgtatttg ttagggaagt tcgcacgagt aggcttacag acaaaataca tcgactacaa      5040
     cgggagactt tgtatgtccg cagcagccac cgcagccaac caaacattcg gcgcggacag      5100
     aggcttaacg aatcctttat cagacatccc ccacacccgt gtgatcattc tggccggcac      5160
     caatattgcg gaatgccagc ctacgattat gccgtatttt gaaaaagcga aagaaaacgg      5220
     agcttacttc attgccattg atcctcgtga aacagcgaca acgaaaatcg ccgatcttca      5280
     tctgaaaatc aaacccggca cagacgccgc ccttgccaac ggtctcgtca aaatcatcat      5340
     tgacgaacag cttataaacg aggatttcat tcaatcacga acaaatggat tcgaagagct      5400
     gaagcagcat actgactcgt tggacctgaa tgacatcgcc gaacagacga gtgtctcgct      5460
     ggtggatata agaaaagctg ctgtgaagtt tgccaaggaa acgtccggca tgctgtttac      5520
     agcccgcggg attgaacagc aaaccgatgg aacagcggct gtgaaaggct tcttaaacat      5580
     ggtgctgatc acaggaaaaa tcggcaaacc ttactcgggc tacggggcga tcaccggaca      5640
     aggcaacggg caaggcgcca gagagcatgg ccaaaaagcc gatcagcttc caggctaccg      5700
     ttctatcgaa aacgaagaac accgggcgca tattgcgaaa gtgtggggaa tccatcagga      5760
     tgatctcccg cgaaaaggtg tctcagccta tgaagtgatg gaaaaaatca atgacggcga      5820
     catcaaagga ctgttcctca tgtgctccaa ccctgctgtt tccagtccaa atgcaaatct      5880
     cgtgaaaaag gctttaagaa gactgacatt ctttgtcgca atcgatttgt ttatttctga      5940
     gactgcgaaa tacgcagatg tgattttacc tgcctcctct tacttagaag atgaaggcac      6000
     catgacaaat gtagaaggac gcgtgacatt aagagaagca agccggccat gccccggcga      6060
     agcaaagcat gattggcaga tcatttgtga tctcgcatcc gctctcggca agggccgcta      6120
     cttttcttat acgtcagcgg aggatatttt caatgaattg agagaagcga gccgaggcgg      6180
     gattgccgat tattcaggca tctcatacgg caggctcaga cgtgaaggcg gcattcattg      6240
     gccgtgtccg gaatctgatc atcccggaac tgggcgcttg tttacagaat catttgctca      6300
     tccggatcaa aaagcggcat taagtgtgat tccaaacgaa ccacctgttc caaaagagaa      6360
     gccgacagcc gattatccgc tttatttaac gacaggcaga gtcatgtctc actacttaac      6420
     aggcgtccaa acaagaaaaa gcgccgccct tgccgcgaga cattttgaat cgtttatgga      6480
     gatccatccg caaacagcag cgacctacaa tatcgaggac cgtgtactgg taaaaataga      6540
     atcgccgcgg ggaagcatca ccgtccgcag caaattatca gaacaaatca gaaaagatac      6600
     cgtttttgtt cccatccatt gggcagacgc tcaaaatgtg aatgatttaa tcggggaagc      6660
     cttagatcca gcctgtaaaa tgcccggttt taaggtatgc gccgtccgaa tcatacctat      6720
     ttaaattttt cataaaattt ttagaacttt tcgtatattt tgttacattt tataacatgt      6780
     atcttaaata ttcctttttg ctgtgctacg ctggaaaaaa catttgataa ggagcggatc      6840
     atctgatggg aaaaaaacag ctagttcttg ttggtaatgg aatggccggg gtaagggcca      6900
     ttgaagagat actgagtgtt gctaaagacg agtttcagat cacaattttc ggtgccgaac      6960
     cgcatcccaa ttacaaccga atccttttgt caaaagtgct tcaaggcgat acagatatta      7020
     aagatattac gttaaacgat tgggactggt acgaagaaaa caacattcaa ttgtatacaa      7080
     atgaaacagt catcaaagtg gacacggaaa acaaaacagt catcacagat gcagacagaa      7140
     tccagcctta cgatgaattg atcctggcga caggatcggt cccttttatc cttccgattc      7200
     cgggcgcaga caaaaaaggc gtcacagctt tccgggacat aaaagataca gacacaatgc      7260
     tcgccgcgtc aaaacaatat aaaaaagctg ccgtcatcgg cggaggacta cttggtttgg      7320
     aagcagctcg cggactgctg aatctcggca tggacgtgtc cgtcatccac cttgccccat      7380
     tcctgatgga gcgccagctt gatgcaacgg caggacgcct gctgcaaaac gagttagaaa      7440
     aacaaggtat gaccttttta cttgaaaagc aaacagaaga aattgtcggt gacgaccgtg      7500
     tcgaaggcct ccgattcaag gatggcacaa gcattgaagc tgatttagtc gtcatggctg      7560
     tcggcatccg cccaaataca acgctcgggg ccgagagcgg cattccggtt aaccgcggca      7620
     tcatcgtcaa cgattatatg cagactgaaa tcccgcacat ttacgcggtc ggcgaatgtg      7680
     ccgagcaccg aggaatcgcc tacgggcttg tggcgccgct gtatgaacag gcaaaagtgc      7740
     tggcaaagca tatgtgcggc atcgaaacaa aaccgtatga gggctccgtt ctctccacac      7800
     agttaaaggt atcaggcgtc gaggtcttct ctgccggtga ctttaacgaa tcagaggaga      7860
     aaaaagcgat taaagtcttc gatgagcagg acggcatcta taaaaaaatt gtcctgagag      7920
     gcaatcaaat tgtcggtgct gttttattcg gcgacagcag cgaaggcaat cgcctgtttt      7980
     ctatgattca aaaagaagcc gatatctctg aaacctctaa aatatcaatc ttacagcccc      8040
     tcagccagga agcaggcaca agcataaccg cagcgatgag cgacgatgaa atcatctgcg      8100
     gctgtaacgg cgtgtcaaaa ggtgcgatta ttcaagccat acaggaaaag ggctgctcgt      8160
     caacggacga aatcaaagca tgcaccggcg catcccgctc atgcggaggc tgtaagccgc      8220
     tcgtagaaga aatcctccag catacgctcg gatcagactt tgatgcgtca gcgcaaaaag      8280
     aagccatttg cggctgcacc acattgtcga gagatgaagt cgtagaagaa atcaaagcca      8340
     aagggctgtc acatacaaga gaagtcatga atgtgctcgg ctggaaaacg ccagaaggct      8400
     gttctaaatg ccgacccgct ctgaactact acttaggcat gatcaatcca accaaatacg      8460
     aggatgaccg gacatcccgc tttgttaatg aacgaatgca cgccaatatt caaaaagacg      8520
     gaacatactc agtcgttcct cggatgtacg gcggcgtgac caactccaca gatttgcgca      8580
     agatcgccga tgtcgttgac aaatatgaga tcccgctcgt gaaaatgaca ggcggccagc      8640
     gaattgatct tatcggcgtg aaaaaagaag accttccgaa ggtatgggaa gatcttgata      8700
     tgccatcggg ctacgcgtac ggaaaaacgc tccgcacagt gaaaacatgt gtaggcgagc      8760
     aattctgccg cttcggcaca caagactcca tggcactggg cattgcgctt gagaaaaaat      8820
     tcgaagggct gaacacgcct cacaaagtca aaatggccgt gtctgcctgc ccgcgaaact      8880
     gtgcggaatc cggcattaag gaccttggcg ttgtcggcat cgacggaggc tgggagcttt      8940
     atgtcggcgg aaacggcgga acccatttgc gtgccggcga tttgctgatg aaggtgaaaa      9000
     caaatgaaga agtcttagaa tacgcgggcg cttacctgca atattacagg gaaaccgcaa      9060
     actatctgga gcgtacgtcc gcatggcttg agcgcgtcgg tttatcccat gtccaatccg      9120
     tgttaaacga tccggaaaag cggcaggagc tgaacggccg aatgaatgaa acactctctg      9180
     tccacaagga tccgtggaaa gactttttag aggataaaca aacctctaaa gaattatttg      9240
     aaaatgtcgt gaccacatca taatgacaaa aactatcatt gaggaggaat ggacatggta      9300
     aacaaagacg taacaaaagt atgtatcgga aaaattgaag aattgcctga acaattaggc      9360
     aaaacagtgt atattgaaga taaggagctc gcggttttca agctttcaga cggaagcatc      9420
     cgcgccattg aaaaccgctg tccgcataag ggcggcgtcc tggcagaagg catcgtcagc      9480
     ggtcaatatg ttttctgccc gatgcacgac tggaaaattt ccttagaaga cggaatcgtc      9540
     caagaacctg accacggatg cgtcaaaaca tatgaaacgc tgatcgaagg agaacatgtt      9600
     tatctcgtat attgatcaaa agaccggatc acttttctag tggtccttca ttttttacag      9660
     tgacggaagg atgacatgat catgaagaac ggaatcgtat atttcgtggg agccggaccc      9720
     ggcgacccag gcctgctcac catcaaagga aaacaggcgc tcaaggaagc agatgtgatt      9780
     ttatatgacc ggctcgccaa cccgaagctg ctcgaatttg catcaccgga ctgccagttt      9840
     atttattgcg gaaaactgcc aaaccgccat tttatgaaac aaaaagaaat taacgccctg      9900
     ctggttgaaa aagcattaaa tgggttaacc gtcgttcgct tgaagggcgg agatccgagc      9960
     gtattcggca gagtcggcga ggaagcagat gctcttcatg agcacggcat tcgctatgaa     10020
     atggtgccgg gaatcacctc tggaattgca gcgccgctat atgcgggcat ccccgtcacg     10080
     catcgggatt ttgcatcgtc ttttgccatg attacagcgc atgataaatc attaaaaggc     10140
     acgccgaacc ttgactggga agggctggcc cgaagcgttc aaacccttgt tttttacatg     10200
     ggtgtcaaga acttgtctta tatttgccag cagcttattt catacgggaa atcgccttct     10260
     gtccctgtca ttgtcatcca atggggaacg tggggccgcc agcggagtgt gaaaggaaca     10320
     cttgagaaca ttcagcaaaa agtgcaggaa caccagatta caaaccctgc gattatcgtc     10380
     atcggagaca tcgtcaactt tcaaacacac agctggtttg aaagcaaacc gctcatcgga     10440
     cggcatttga tggttgtgac tcatggcgaa gatgaagacc cgcttgcaga caagctgcgc     10500
     gattccggcg ccgatctcat cgagtggccg aaatggcgga ccgaaaacat gcctgtcaat     10560
     gaagaaattc ttcgaaagat tggcaccttt gaagacgttt ttttcacatc gcgccgggcg     10620
     gtttgtgaat ttttcagagc actggcttct cagaaaatcg acatccgcca gctgacagcc     10680
     aaactgagtg cagcatctga gcaagcaaag acagagcttg agaaacgggg ctttcttgtc     10740
     accgccattc agcctgattc agagaaacgt cttgttgtcg ggagccgcca tgcagtggaa     10800
     aacatgcaaa agcatgaatc ctgttcgttt tatatcactc atgaaaacgt catagatgac     10860
     cggttcaccc acatgattca gcgtaccatc agtgaatccc cgctgcacat ggtcatttgc     10920
     ccaaacaagc tgtccgttca gcaattgatc aatggtggcg aacaaattgg cattttgccg     10980
     gaaccgtcag caagccgccc tcctatcgtc tgcataggcg atgactcagc tgccggcatt     11040
     tatggattca cagccgtaca agaacaggat gaattgctag ctttcatcca caatcaacat     11100
     gcagagaaaa aactccttca cacctgatgg caagcagccc ttttcctcaa gggctgtttt     11160
     atttatgcac caatttttta tgatgggtgg aatacatcgc catattctcg gccttagggt     11220
     ccagataagc cttggcactg ttgaccgctg tcgggccttc cgtaaatccg ccggcaatca     11280
     atctcagctt gctttcataa aaagccgcgt cgcccgccac aaacacgccc ggaagattcg     11340
     ttcgcatatg tctgtcagct ttcacccttc cttcttcaat ctccagcccc cactccatca     11400
     tcggcccgag atcaattttg aacccatgat taatgatcag ctcatcaatt tctatgtctt     11460
     tcctctggcc agactcagta tgacaaacgg tcacgctttt gatgccctct tcatctccgt     11520
     tcaactgctc cagccgataa ggcgtaagca cccgcaccga tgattgcttc attttcgtca     11580
     cgctgctttc cattccgccg aatt                                            11604
//

If you have problems or comments...

PBIL Back to PBIL home page