(data stored in SCRATCH zone)

EMBL: D30762

ID   D30762; SV 1; linear; genomic DNA; STD; PRO; 10000 BP.
XX
AC   D30762;
XX
DT   15-MAR-1995 (Rel. 43, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 15)
XX
DE   Bacillus subtilis DNA around 28 degrees region of chromosome containing
DE   yckA-H genes.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-10000
RA   Yamane K.;
RT   ;
RL   Submitted (23-MAY-1994) to the INSDC.
RL   Kunio Yamane, University of Tsukuba, Institute of Biological Sciences;
RL   1-1-1 Ten-ohdai, Tsukuba, Ibaraki 305, Japan (Tel:81-298-53-6680,
RL   Fax:81-298-53-6680)
XX
RN   [2]
RX   PUBMED; 7704252.
RA   Ogasawara N., Fujita Y., Kobayashi Y., Sadaie Y., Tanaka T., Takahashi H.,
RA   Yamane K., Yoshikawa H.;
RT   "Systematic sequencing of the Bacillus subtilis genome: progress report of
RT   the Japanese group";
RL   Microbiology (Reading, Engl.) 141:257-259(1995).
XX
RN   [3]
RX   PUBMED; 7704255.
RA   Fujishima Y., Yamane K.;
RT   "A 10 kb nucleotide sequence at the 5' flanking region (32o) of srfAA of
RT   the Bacillus subtilis chromosome";
RL   Microbiology (Reading, Engl.) 141:277-279(1995).
XX
DR   MD5; 59e933ecbafe14e45421f48a77a997b2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10000
FT                   /organism="Bacillus subtilis"
FT                   /chromosome="28 degrees region"
FT                   /strain="168trpC2"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="lambda DASHII"
FT                   /clone="110"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        complement(149..829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckA"
FT                   /product="homologue of glutamine permease of H. influenzae"
FT                   /note="ORF1"
FT                   /db_xref="GOA:P42399"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42399"
FT                   /protein_id="BAA06425.1"
FT                   /translation="MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIG
FT                   LFISLARMSKLALLRWPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFS
FT                   LNSAAYIAEINRSAISSVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLD
FT                   LIKASSLAAMITVPELLQHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKY
FT                   AHYV"
FT   CDS_pept        complement(839..1408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckB"
FT                   /product="homologue of FliY of E. coli"
FT                   /note="ORF2"
FT                   /db_xref="GOA:P42400"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="PDB:2IEE"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42400"
FT                   /protein_id="BAA06426.1"
FT                   /translation="MLTAVNSGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKD
FT                   DLSGIKTLKDLKGKKAAGAATTVYMEVARKYGAKEVIYDNATNEQYLKDVANGRTDVIL
FT                   NDYYLQTLALAAFPDLNITIHPDIKYMPNKQALVMKKSNAALQKKMNEALKEMSKDGSL
FT                   TKLSKQFFNKADVSKKIDADVQDVDL"
FT   regulatory      complement(846..855)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(1421..1429)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      2185..2193
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2207..2536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckC"
FT                   /product="unknown"
FT                   /note="ORF3"
FT                   /db_xref="GOA:P42401"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42401"
FT                   /protein_id="BAA06427.1"
FT                   /translation="MFISLVVLLYSILLPMFWRGYLIGKRICGIRIVKKDGSQVSLLTM
FT                   FLRVIVAGLVYCITFGLGLIASLILIAVREDKRTLHDLIAGTYVTYATPGEEELNADEE
FT                   IRKSE"
FT   regulatory      2603..2607
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2618..2950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckD"
FT                   /product="unknown"
FT                   /note="ORF4"
FT                   /db_xref="InterPro:IPR024485"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42402"
FT                   /protein_id="BAA06428.1"
FT                   /translation="MKRITINIITMFIAAAVISLTGTAEAAEKQQQSPANVTLTDQQKK
FT                   EIEQLEAEILKKRKDVISKYVQYGILPKERGEHIKNHLDKHFEMMKQNGFVPKHHPHPH
FT                   KFEKRH"
FT   regulatory      3088..3092
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3104..4537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckE"
FT                   /product="beta-glucosidase"
FT                   /note="ORF5"
FT                   /db_xref="GOA:P42403"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42403"
FT                   /protein_id="BAA06429.1"
FT                   /translation="MIHQHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIP
FT                   GKTFKGTNGEIAVDHYHRFKEDVALMAEMGLKAYRFSVSWPRVFPKGKGEINEAGLAFY
FT                   DSLIDELLSHHIEPVLTLYHWDLPQALMDEYGGFESRNIIEDFNHYCITLYKRFGDRVK
FT                   YWVTLNEQNYNFNHGFITAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIG
FT                   PSFAYSPAYPLSSHPEDILAFENAEEFTNNWWLDMYCWGTYPQIPFRCLEKQGWAPTIE
FT                   AGDMDLLAKGKPDFVGVNYYQTITYERNPLDGVSEGKMNTTGQKGTNQETGIPGVFKTK
FT                   KNPHLTTSNWDWTIDPIGLRIGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRID
FT                   YLRSHLEQCRQAISDGVDLIGYCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTSDLKRL
FT                   KKKSFYWYQDVIKTNGESL"
FT   CDS_pept        complement(4574..4972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comJ"
FT                   /product="competent specific protein"
FT                   /note="ORF6"
FT                   /db_xref="GOA:P12669"
FT                   /db_xref="InterPro:IPR020354"
FT                   /db_xref="InterPro:IPR038691"
FT                   /db_xref="PDB:4MQD"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12669"
FT                   /protein_id="BAA06430.1"
FT                   /translation="MIKSWKPQELSISYHQFTVFQKDSTPPVMDWTDEAIEKGYAAADG
FT                   AISFEAQRNTKAFILFRLNSSETVNSYEKKVTVPFHVTENGIHIESIMSKRLSFDLPKG
FT                   DYQLTCWTVPAEMSDLHADTYIIDAVSV"
FT   regulatory      complement(4982..4989)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(4999..5310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comI"
FT                   /product="DNA entry nuclease"
FT                   /note="ORF7"
FT                   /db_xref="GOA:P12667"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12667"
FT                   /protein_id="BAA06431.1"
FT                   /translation="MAFPSDRYPETAKHIKDAINEGHSEVCTIDRDGAEERREQSLKDV
FT                   PSKKGYDRDEWPMAMCKEGGEGASVEYISPADNRGAGSWVGHRLTDYPDGTKVLFTIQ"
FT   regulatory      complement(5323..5328)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(5616..7337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpC"
FT                   /product="methyl-accepting chemotaxis  protein TlpC"
FT                   /note="ORF8"
FT                   /db_xref="GOA:P39209"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39209"
FT                   /protein_id="BAA06432.1"
FT                   /translation="MLIKRFKMKLGTKILCLVFVVILLFSASVGTVMLKEITESMKQMA
FT                   TEKAKGDLALSSTYIDDVMSGDWQVKNNKLYKGQTQINGNEDIVDLLGEKTGDTITIFQ
FT                   GDTRVATNVMKNGERAVGTQASSEVIAAVLKKGKRFYGQADVAGSSYQTAYMPLKDQNG
FT                   NIIGMLYTGANQSILASLTQSLFTQFAIVLVIVIMVSVILVLVFTRKINKRLTALKSAF
FT                   ESAGNGDMTIEVSDKTGDELSELSVYYNKMRMKLNDTIQTVQQSALQLASASQQLSAGA
FT                   EETNQASEKITEAVQQIANGAQDQITRIENSESSLKQASADIRDISANTAPIADKGQLA
FT                   QSKADIGQKEIANVQAQMDAIHQSIQKSGEIIHQLDGRSKQIEQILSVITQIADQTNLL
FT                   ALNAAIEAARAGEQGKGFAVVADEVRKLAEESQQSAGQISKLIIEIQKDMNRSARSVEH
FT                   VKTEAAEGVTMIQRTRDAFKEIAAATGEISAEISDLSASVTNISASAHQINDSFAANTA
FT                   DIKESTKNTRQAAALTEEQFAAMEEITAASETLSQLAEELTGIISQFKMINQAENG"
FT   regulatory      complement(7342..7346)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(7448..8005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckF"
FT                   /product="unknown"
FT                   /note="ORF9"
FT                   /db_xref="GOA:P42404"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="PDB:1M3S"
FT                   /db_xref="PDB:1VIV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42404"
FT                   /protein_id="BAA06433.1"
FT                   /translation="MKTTEYVAEILNELHNSAAYISNEEADQLADHILSSHQIFTAGAG
FT                   RSGLMAKSFAMRLMHMGFNAHIVGEILTPPLAEGDLVIIGSGSGETKSLIHTAAKAKSL
FT                   HGIVAALTINPESSIGKQADLIIRMPGSPKDQSNGSYKTIQPMGSLFEQTLLLFYDAVI
FT                   LKLMEKKGLDSETMFTHHANLE"
FT   regulatory      complement(8014..8018)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(8115..8642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckG"
FT                   /product="unknown"
FT                   /note="ORF10"
FT                   /db_xref="GOA:P42405"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017553"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42405"
FT                   /protein_id="BAA06434.1"
FT                   /translation="MELQLALDLVNIPEAIELVKEVEQYIDVVEIGTPVVINEGLRAVK
FT                   EIKEAFPQLKVLADLKIMDAGGYEIMKASEAGADIITVLGATDDATIKGAVEEAKKQKK
FT                   KILVDMINVTDIESRAKEIDALGVDYICVHTGYDLQAEGKNSFEELTTIKNTVKNAKTA
FT                   IAAASNLIHCQK"
FT   regulatory      complement(8651..8659)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      8908..8913
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8928..9236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckH"
FT                   /product="homologue of hypothetical 17.6 kDa protein in
FT                   rplI-cpdB intergenic region of E. coli"
FT                   /note="ORF11"
FT                   /db_xref="GOA:P42406"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42406"
FT                   /protein_id="BAA06435.1"
FT                   /translation="MIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLRERE
FT                   QDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMEVIDIDKNVMKESL"
FT   regulatory      9796..9800
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        9810..>10000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAA"
FT                   /db_xref="GOA:P27206"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27206"
FT                   /protein_id="BAA21034.1"
FT                   /translation="MEITFYPLTDAQKRIWYTEKFYPHTSISNLAGIGKLVSADAIDYV
FT                   LVEQAIQEFIRRNDAMRLR"
XX
SQ   Sequence 10000 BP; 2766 A; 2019 C; 2212 G; 3003 T; 0 other;
     gatcacgaaa gagcttgatc aatgcctgtt gactgagtat gaatttgatt ccgactggtc        60
     gctgtttgag gacccgttta aatggaagct gaatcaatag aaaaaaagcc gtcccatggg       120
     gaacggcttt ttttaatgaa acgtttgttt aaacataatg agcgtatttt ttctcaagga       180
     tattctgaaa gaccgcggca atggagcaga tggcccaata aatgagagcg gtcagaatat       240
     acatggtcat ataatcaaac tctctgcccc cgatgatttt cgcatgctgg agcaattccg       300
     gcactgtaat catcgcagcg agagaggacg ccttgatcaa gtcgagcaat acattggcaa       360
     gcggaggcag cgcaatacgt atcgattgcg gcaaaatgat gcccctcatc gtctgccaat       420
     aggaaagacc cagcgaggat gcggcttccc actgtccttt ttcgacggat gaaatggctg       480
     aacggttaat ttccgcaatg taggcggcgc tgtttaggct aaagccgatt aaagcagccg       540
     tgacagcgga aaattcaatg ccgatataag gaaacccgaa ataaaggata aacaaaatca       600
     ccaaaatcgg aacgcctcgc ataaatgaga tatagagctt cgccggccat cttaacaaag       660
     caagtttaga cattctggcg agtgatatga acaggccgat cacagttccc gcaaacatgc       720
     ttacaaaaga gatgagcagt gtataaccaa tgccttttat gacataaggg aacgattcaa       780
     tggccagctt cgtgttgaaa atatattccc actgaatgct attgatcatg gcgtccgatt       840
     acaaatcaac gtcctgaacg tcggcatcaa ttttttttga tacatctgct ttattgaaga       900
     attgtttcga cagtttagtc aaagagccat ccttgctcat ctctttcaat gcttcgttca       960
     tctttttctg aagtgccgca ttgctttttt tcatgacaag ggcctgtttg ttcggcatgt      1020
     acttgatgtc aggatgaatt gtaatgttga gatccgggaa tgccgcgagc gcaagtgtct      1080
     gcaggtaata gtcgtttaaa atgacgtcag tgcgtccgtt ggcaacatct tttaaatatt      1140
     gctcattcgt cgcattatca taaatcactt ctttggcgcc gtattttctc gcgacctcca      1200
     tgtagacggt tgtagccgcg ccagccgctt tcttcccttt taaatccttg agcgttttaa      1260
     tccctgataa atcgtctttt cggacaattg ccgtgccgta tgaatattta tatggagtgg      1320
     aaaatgcgaa cttctcctca cggtccttcg tcacatcgat gtcattcgcg gctgcgtcaa      1380
     cctgtccgct gttcaccgct gtcagcatcc cgtcaatgcc catctccttg aactcaacct      1440
     tcagccccaa gcgttttgcc gcttcacgaa caacttcaac ctcgtagccc gtcagcttat      1500
     cagagccaga gtcagtatcg tgataagaag tgggatagag cgtacctgat gtagcgacta      1560
     cgattttccc tttatcctta atctgctccc agcctgtatc cttggaatcg gcttcatttt      1620
     tgccggaaca ggctgccaat ataagaaaga aagcccattg tgaaactgaa tataacggct      1680
     ttggaatgca tgaatgattt cacctatagt tcccccaatc tgttaatcaa ctaaaaagat      1740
     agcattgaac ataaggggtt gcaatatgtt gatcgcgttt tcaaaaagtt cgaattgtgt      1800
     atacaaaaag catgggtggg tgtttaaaag cgtctatgaa gggaagaggt gatgaaaaaa      1860
     ggaattgtcc aaggatgaat gccagacgta ccaaggaaac gcatgtgaaa gtgaaggatg      1920
     cagcagaccc gtcactcatc tatgccaata ccggaagaaa tggtcaagag gcatgaaacc      1980
     gatcttcaga ataaatttaa gtcttgctga tgcccctaag gcatatgata tattcgatga      2040
     gaaagaaaat ggaaacattt aaaccataat ggggagtcaa atgaatattt acaaaccagc      2100
     cggattttgg atcagacttg gagctgcatt gttagactac attatagtct ccgtgccgct      2160
     tttgctgatc tattggctga ttacaggaaa agacccaaac gacagcatgt tcatcagttt      2220
     ggttgttctg ctgtattcta ttttgctgcc gatgttttgg cgcggttatc ttatcggaaa      2280
     aaggatctgc ggaatcagaa tcgtaaaaaa agacggatca caggtcagtc tgttaacaat      2340
     gtttttacgg gttattgtag ccggcctggt ttactgtata accttcggac tcggcttgat      2400
     cgccagcctg attctgattg ccgtacgaga agacaaacgg accctgcatg atttaatcgc      2460
     gggaacatat gtcacttatg cgacaccagg tgaagaggaa cttaatgctg acgaagagat      2520
     tagaaagagc gaataatggt tcgctctttt tatttttatg cataaaaaat acaaggcagc      2580
     aaaacatatg aaaaatagga ttggaggaat aaaatggatg aaacgaataa ccatcaacat      2640
     tatcacaatg ttcattgcag cggctgtcat ttctctgacc ggtacagctg aggccgctga      2700
     aaaacagcag cagtctcccg caaatgttac actgacagat cagcaaaaga aagagattga      2760
     acaactggaa gcagagattc ttaaaaagcg caaagacgtg atctcaaagt atgtacaata      2820
     cggtatcctg cctaaagaaa gaggagaaca catcaaaaat cacttggaca aacactttga      2880
     aatgatgaaa caaaacggct ttgttccaaa gcaccatcct catccgcata aatttgaaaa      2940
     aagacattaa gattttaagc atccaatggg aattgggtgc ttttgcgtta tttacaggta      3000
     ggcaatatta gctgagctgt tccgcgacta acatcgagtt gatatgaaac gcgtttcata      3060
     gcctatgata ggtttatcaa ataattcagg agtgataaac actatgatcc accagcatcc      3120
     agaatctttt ccgaaacatt ttttgtgggg ctctgcttct gcagcgtacc agattgaagg      3180
     cgcttggaat gaagatggca aaggcccttc tgtttgggat gtgtttacga aaataccggg      3240
     caaaacgttt aaaggaacca atggcgagat tgcggttgac cattatcacc gatttaaaga      3300
     agatgtcgct ctgatggctg agatggggtt aaaagcatat cgattttccg tcagctggcc      3360
     acgggttttc ccaaaaggaa aaggagagat caatgaagca ggtctagcgt tttacgatag      3420
     tctgattgat gaattgcttt ctcatcacat cgagccggtt ctgactttat atcactggga      3480
     tttgcctcaa gcgcttatgg acgaatacgg cgggtttgaa tccagaaaca tcatagagga      3540
     ttttaatcac tactgtatta ctctttataa acgttttgga gacagggtga aatattgggt      3600
     tacgttaaac gaacagaact acaattttaa tcacggattt attacagcca tgcatccgcc      3660
     tggagtgaaa gacagaaaac gattttacga agcaaaccat attgcgtttc tggctaatgc      3720
     aaaagccatc gaatcattta gagaatatgt gcctgaaggc aaaataggtc ctagctttgc      3780
     ttattctccg gcttaccctt tatcaagtca tccagaggat atactggcat ttgaaaacgc      3840
     cgaagaattt acgaacaatt ggtggcttga catgtattgc tggggaacct acccgcaaat      3900
     tccattccgc tgcttggaaa aacagggatg ggcgccgaca attgaagcag gagatatgga      3960
     cctgctcgcc aaagggaagc ctgattttgt aggtgtcaat tattatcaga cgatcaccta      4020
     tgaacgaaat ccgcttgatg gtgtgtcaga agggaaaatg aatacgacag gccaaaaggg      4080
     aaccaatcag gagacgggga tacccggagt gttcaaaacg aaaaaaaatc cgcatctgac      4140
     aacgagcaac tgggattgga caattgaccc aattgggctg cgtatcggtc ttcgccgaat      4200
     tacaagccgc tatcagcttc cagtgtttat aacagagaac ggtttgggtg aatttgataa      4260
     agttgaggac ggcactgtac aggatgatta tcgaattgat tatttgcgtt cgcatcttga      4320
     gcaatgcaga caagccatca gtgacggtgt cgatttaatc ggctattgca gctggtcgtt      4380
     tactgatctg ttaagctggc tgaacggcta ccaaaaaaga tacggatttg tatatgtcaa      4440
     tcgtgatgaa gaaagcacat ccgatttaaa acgcttgaag aaaaaaagct tttattggta      4500
     tcaagatgtc atcaagacaa acggagaaag tttataaaga gtccctgaga gttattctct      4560
     caggggtttt tcattacaca gaaacagcat caataatata agtgtcggcg tgcaaatctg      4620
     acatttcagc cggcacagtc cagcatgtca attgatagtc tcctttaggc aaatcaaagg      4680
     acagtctttt agacatgatg ctttcaatat gaattccgtt ttctgtgaca tgaaaaggaa      4740
     cagtcacttt tttttcgtag gagtttactg tttctgaact gttcaggcga aaaagaataa      4800
     aggcctttgt atttcgctgt gcctcaaagg aaatggctcc gtctgccgca gcatatcctt      4860
     tttcaatcgc ttcgtcagtc caatccatta caggaggtgt agaatccttt tgaaatacag      4920
     taaattgatg atatgaaatc gaaagttctt gcggcttcca tgatttgatc aatgtgctgt      4980
     tcctcctcta tgtactgttt actgaattgt gaataaaacc tttgtgccgt ctgggtaatc      5040
     ggtaagccga tgcccgaccc aagagcctgc tccgcggttg tcagcgggag aaatgtattc      5100
     tacagaagct ccctcaccgc cttctttgca catggccatt ggccattcat ctctgtcata      5160
     cccctttttg gaaggtacgt cctttaatga ttgctcgcgg cgttcttcag ctccgtctct      5220
     gtcaatagtg cacacctctg agtgcccctc atttatcgca tccttaatat gcttggcagt      5280
     ttcgggatac cggtcagatg ggaaggccat tgtttcatca tattctttcg tttgagacgt      5340
     tttttgatca gctgagaaaa agtctccttt tatcaggccg acagctgcag ctgctatgat      5400
     gacgatgacg agaagtatcg tttttatgat gtccgtcgtg atgttcacct cccgctttta      5460
     aaactgacac aagagtaatc cagaaagcat ttggtgtaaa ggtttaaatt ttatgtttta      5520
     cgatcagttt attgcagaaa tcgtaatttt agcagatcga aatatttgtt ttcagcaaaa      5580
     tacgattgcc aatttacaat aatgatagta agtcatcagc cgttttcggc ttgattaatc      5640
     attttaaatt ggcttatgat accggtaagc tcctcagcta attgagaaag tgtttcagaa      5700
     gctgcggtaa tctcctccat tgcagcaaat tgctcctctg ttaatgcagc cgcttgccgg      5760
     gtatttttag tagattcttt aatgtcggcc gtattggctg caaaggaatc atttatttga      5820
     tgtgcactgg ctgaaatgtt tgttacagat gctgataaat cactaatctc ggcgctgatt      5880
     tcacctgttg cagctgcaat ttccttaaat gcatctctgg tgcgctggat catggtgact      5940
     ccttctgcag cttctgtttt cacatgctca acagatcttg cagaccggtt catatccttt      6000
     tgtatttcta tgatcagttt tgaaatctgc cccgcagact gttgagactc ttctgctaat      6060
     ttccgtactt catcagcaac aacagcaaag ccttttcctt gttcaccggc tctggcagct      6120
     tcaatcgctg cattcagcgc aagcaggttt gtctgatcag caatttgggt gatgaccgat      6180
     aaaatttgct caatttgttt agagcggccg tctaactggt gtatgatttc tccgcttttc      6240
     tgaattgact ggtgaatcgc atccatttgc gcctgtacat ttgcaatttc cttttgtcca      6300
     atgtctgctt ttgattgagc gagctgccct ttgtcagcga taggggcagt atttgcagaa      6360
     atatcccgga tgtctgctga agcttgtttt aatgagcttt cactattttc aattcgggtg      6420
     atctgatctt gggctccatt tgcaatctgc tgtacagctt ctgtgatttt ttctgaagct      6480
     tgatttgttt cctctgctcc ggctgagagc tgctgagagg ctgacgcaag ctgaagggct      6540
     gattgttgta cggtttgtat ggtatcgttc agcttcattc tcatcttatt ataatagacg      6600
     cttagttctg aaagctcgtc accggttttg tctgacacct ctattgtcat atctccgttt      6660
     ccggcacttt caaaggcgct ttttaaagcg gtcagccgct tgttgatttt tctggtgaaa      6720
     accaagacaa ggatgactga taccataatg acgataacaa gaacgatagc gaattgagtg      6780
     aaaagtgatt gtgtaagtga tgctaaaata ctttgattag ctccggtata cagcatgccg      6840
     atgatgttcc cattttgatc ttttaacggc atgtatgcag tctgataaga agaacctgct      6900
     acatctgctt gtccgtaaaa acgctttcct ttctttaaaa cagcggcaat aacttcagaa      6960
     gaagcctggg tgccgacggc tctttcgcca tttttcatga cattggttgc aacacgagta      7020
     tcgccttgga aaatggtaat ggtatcacct gtcttttcac caagcagatc aacaatatct      7080
     tcatttccat tgatttgtgt ttgcccttta tagagcttat tgtttttcac ctgccagtcg      7140
     cctgacatga catcatcaat ataagtgctg cttaaagcga gatcaccttt cgctttttca      7200
     gttgccattt gtttcatgct ttctgtaatt tccttaagca tcacagtgcc aactgatgcc      7260
     gaaaacaaaa gaatcaccac gaaaacgagg caaagaattt tagttcctag cttcatctta      7320
     aatcgtttta tcaacataat tcctcccttt acgatttgca ggtcatatta cttatcgggt      7380
     ttttgggttt aaagttttat tttagaaaaa ataaaaccgg cctgatcttc aggccggttg      7440
     tgtgatgcta ttcaaggttt gcgtggtgag tgaacatagt ttcagaatcg agaccttttt      7500
     tctccatgag ttttaaaatc actgcatcat agaagagcag caaagtttgt tcaaataatg      7560
     atcccattgg ctgaatggtt ttatagcttc cgttagactg gtctttaggg gaaccaggca      7620
     ttctgatgat gaggtccgct tgttttccga tgcttgattc cggattgatg gttaaagcgg      7680
     caacaattcc gtgtaagctt tttgcttttg ctgcggtatg aatcaagctc tttgtctcgc      7740
     ctgatcctga gccgataata actagatctc cttcggcgag cggcggagtg agaatctcac      7800
     ctactatatg ggcgttgaag cccatgtgca tcagtctcat cgcgaaggat tttgccatca      7860
     ggccagaccg ccccgcaccc gcggtgaaaa tttggtggga tgaaagaatg tgatcggcaa      7920
     gctggtcagc ttcttcatta gaaatataag ctgctgaatt gtgtaactca ttgagaattt      7980
     ccgctacgta ttcagtcgtt ttcatcggag ttatccttgg acaatcagct gcttcatttt      8040
     tgaagctgtt tccgccttat cagctgcgct tgtaattccg cccccgacaa tgacaaggtc      8100
     aggcttttgc tggatcactt ctggcagtgt atcaagtttg atgccgccgc gattgcggtt      8160
     tttgcgtttt ttacggtatt tttgattgtc gttaattctt cgaaagagtt tttgccctct      8220
     gcttgaagat catagccagt gtggacgcag atgtagtcaa caccgagtgc gtcaatttct      8280
     ttcgcacggg attcgatatc tgtcacgtta atcatgtcca ctaagatttt cttcttttgt      8340
     tttttggctt cttctactgc gcctttaatc gttgcatcgt ctgtagcccc taaaacggtg      8400
     atgatgtcag cgcctgcttc cgacgctttc ataatttcgt agcctccggc atccatgatt      8460
     ttcaggtctg caagaacctt caattgagga aatgcttctt ttatttcttt aacggctctt      8520
     aggccttcat tgatgacgac cggtgttccg atttcaacta cgtcgatgta ttgttctacc      8580
     tctttgacaa gctcaatggc ttccgggatg ttgacgaggt ctaatgcaag ctgtaattcc      8640
     attgttgatc cactcccttt tcgaattatt gttcattcta taggttcctt cttttgttga      8700
     gaagtaggca ctttgaagtc aacaagttac ttggaggata ctgtgaggag agacaatcag      8760
     atttctttcg cttgatttta tgagtgagta taatgaaaaa agagtctgca aaaaagtaag      8820
     taagtgatga tacgtatcta acatacaaaa aggttactaa ggggggattc tatttgagcc      8880
     ggatggacga caaaaggttt aattgtgaga aggaattaac gcttgcagtg attggcggta      8940
     aatggaaaat gctcatttta tggcatttag gaaaagaagg cacaaaacgg ttcaatgaat      9000
     taaaaacatt gattcctgat attacgcaga agatcctcgt gaatcagctg agagagcgtg      9060
     agcaggatat gattgttcac agggaagtgt atccagttgt cccgccgaag gttgaatatt      9120
     ctctgacccc gcacggagaa agcctcatgc ctattcttga agccatgtat gagtggggga      9180
     aaggctatat ggaagtgatt gatatcgaca aaaatgtcat gaaagaatcg ttgtaagacg      9240
     ctcttcgcaa gggtgtcttt ttttgccttt ttttcggttt ttgcgcggta cacatagtca      9300
     tgtaaagatt gtaaattgca ttcagcaata aaaaaagatt gaacgcagca gtttggttta      9360
     aaaattttta tttttctgta aataatgttt agtggaaatg attgcggcat cccgcaaaaa      9420
     atattgctgt aaataaactg gaatctttcg gcatcccgca tgaaactttt cacccatttt      9480
     tcggtgataa aaacattttt ttcatttaaa ctgaacggta gaaagataaa aaatattgaa      9540
     aacaatgaat aaatagccaa aattggtttc ttattagggt ggggtcttgc ggtctttatc      9600
     cgcttatgtt aaacgccgca atgctgactg acggcagcct gctttaatag cggccatctg      9660
     ttttttgatt ggaagcactg ctttttaagt gtagtacttt gggctatttc ggctgttagt      9720
     tcataagaat taaaagctga tatggataag aaagagaaaa tgcgttgcac atgttcactg      9780
     cttataaaga ttaggggagg tatgacaata tggaaataac tttttaccct ttaacggatg      9840
     cacaaaaacg aatttggtac acagaaaaat tttatcctca cacgagcatt tcaaatcttg      9900
     cggggattgg taagctggtt tcagctgatg cgattgatta tgtgcttgtt gagcaggcga      9960
     ttcaagagtt tattcgcaga aatgacgcca tgcgccttcg                           10000
//

If you have problems or comments...

PBIL Back to PBIL home page