(data stored in ACNUC7421 zone)

EMBL: D30808

ID   D30808; SV 1; linear; genomic DNA; STD; PRO; 21548 BP.
XX
AC   D30808;
XX
DT   15-MAR-1995 (Rel. 43, Created)
DT   06-JUL-2007 (Rel. 92, Last updated, Version 12)
XX
DE   Bacillus subtilis DNA, around 24 degrees region.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-21548
RA   Yamane K.;
RT   ;
RL   Submitted (24-MAY-1994) to the INSDC.
RL   Kunio Yamane, University of Tsukuba, Institute of Biological Sciences;
RL   1-1-1 Ten-ohdai, Tsukuba, Ibaraki 305, Japan (Tel:81-298-53-6680,
RL   Fax:81-298-53-6680)
XX
RN   [2]
RA   Ogasawara N., Fujita Y., Kobayashi Y., Sadaie Y., Tanaka T., Takahashi H.,
RA   Yamane K., Yoshikawa H.;
RT   "Systematic sequencing of the Bacillus subtilis genome: progress report of
RT   the Japanese group";
RL   Microbiology 141:257-259(1995).
XX
RN   [3]
RA   Ogawa K., Akagawa E., Nakamura K., Yamane K.;
RT   "Determination of a 21548 bp nucleotide sequence around the 24 degrees
RT   region of the Bacillus subtilis chromosome";
RL   Microbiology 141:269-275(1995).
XX
DR   MD5; b7b6bb5a38dcb384c1119404b02bc34b.
DR   EuropePMC; PMC107033; 9515903.
DR   GOA; P42253.
DR   InterPro; IPR000192; Aminotrans_V_dom.
DR   InterPro; IPR015421; PyrdxlP-dep_Trfase_major.
DR   InterPro; IPR015422; PyrdxlP-dep_Trfase_dom1.
DR   InterPro; IPR015424; PyrdxlP-dep_Trfase.
DR   InterPro; IPR020578; Aminotrans_V_PyrdxlP_BS.
DR   RFAM; RF00230; T-box.
DR   UniProtKB/Swiss-Prot; P42253; YCBU_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..21548
FT                   /organism="Bacillus subtilis"
FT                   /strain="168TrpC2"
FT                   /mol_type="genomic DNA"
FT                   /note="24 degrees region of the Bacillus subtilis
FT                   chromosome"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        247..1191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbB"
FT                   /note="ORF1"
FT                   /note="high affinity potassium transport system (KdpE)"
FT                   /note="homologue of high affinity potassium transport
FT                   system"
FT                   /db_xref="GOA:P40759"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013972"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40759"
FT                   /protein_id="BAA06466.1"
FT                   /translation="MRFFIADDDRAVRSILRQIIEDEDLGEAAGEADDGSQVEGHMLQF
FT                   KQIDILLIDLLMPGRDGIETIRQIQNTYSGKIVMISQVEAKEMVGEAYSLGIEYFIHKP
FT                   INRIEIVTVLQKVKERIELEHSIGAIQHSLSRLVNRTERKARPQQKSDSGLKEAGTFLL
FT                   SELGMMGEGGAHDLMAVLQYLAEHEQSEPHEKQSPSLKQIFTQVAVRKLGTGASQTEVN
FT                   REMKASEQRIRRAIIHSLHHFASLGTTDFSNPKFETYASKFFDFPVVSQKMKELQSKDA
FT                   KPLAPARINMKKFIHVFFLEAKLLHETMKQRRI"
FT   CDS_pept        1418..2344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbC"
FT                   /note="ORF2"
FT                   /note="homologue of 5-keto-4-deoxyglucarate dehydrogenase"
FT                   /db_xref="GOA:P42235"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42235"
FT                   /protein_id="BAA06467.1"
FT                   /translation="MSRIRKAPAGILGFPVAPFNTQGTLEEEALFQNIEFLLNEGLEAI
FT                   FIACGSGEFQSLSQKEYEQMVEVAVSAAGGKVPVYTGVGGNLSTALDWAQLSEKKGADG
FT                   YLILPPYLVHGEQEGLYQYAKTIIESTDLNAILYQRDNAVLSVEQIKRLTECEQLVGVK
FT                   DGVGNMDLNINLVYTIGDRLGWLNGMPMAEVTMPAYLPIGFHSYSSAISNYIPHISRMF
FT                   YDALKNGNDELVKELYRHVILPINDIRKQRKGYAVSLIKAGMEIMGLNVRNTARPPVGP
FT                   VEKDHYQQLEAILKQPADRFPKKAATV"
FT   CDS_pept        2374..3840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbD"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="ORF3"
FT                   /db_xref="GOA:P42236"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42236"
FT                   /protein_id="BAA06468.1"
FT                   /translation="MSVITEQNTYLNFINGEWVKSQSGDMVKVENPADVNDIVGYVQNS
FT                   TAEDVERAVTAANEAKTAWRKLTGAERGQYLYKTADIMEQRLEEIAACATREMGKTLPE
FT                   AKGETARGIAILRYYAGEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIP
FT                   IWKMAPALVYGNTVVIKPATETAVTCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAE
FT                   HDGVNAVTFTGSNQVGKIIGQAALARGAKYQLEMGGKNPVIVADDADLEAAAEAVITGA
FT                   FRSTGQKCTATSRVIVQSGIYERFKEKLLQRTKDITIGDSLKEDVWMGPIASKNQLDNC
FT                   LSYIEKGKQEGASLLIGGEKLENGKYQNGYYVQPAIFDNVTSEMTIAQEEIFGPVIALI
FT                   KVDSIEEALNIANDVKFGLSASIFTENIGRMLSFIDEIDAGLVRINAESAGVELQAPFG
FT                   GMKQSSSHSREQGEAAKDFFTAIKTVFVKP"
FT   CDS_pept        3924..5291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbE"
FT                   /product="glucarate dehydratase"
FT                   /note="ORF4"
FT                   /db_xref="GOA:P42237"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42237"
FT                   /protein_id="BAA06469.1"
FT                   /translation="MKKDFASVTPAGKKTSVRWFIVFMLFLVTSINYADRATLSITGDS
FT                   VQHDLGLDSVAMGYVFSAFGWAYVIGQLPGGWLLDRFGSKTIIALSIFFWSFFTLLQGA
FT                   IGFFSAGTAIILLFALRFLVGLSEAPSFPGNGRVVASWFPSSERGTASAFFNSAQYFAI
FT                   VIFPPLMGWLTHSFGWHSVFVVMGIAGILLAVIWLKTVYEPKKHPKVNEAELAYIEQGG
FT                   GLISMDDSKSKQETESKWPYIKQLLTNRMLIGVYIAQYCITTLTYFFLTWFPVYLVQAR
FT                   GMSILEAGFVASLPALCGFAGGVLGGIVSDILLKKGRSLTFARKVPIIAGMLLSCSMIV
FT                   CNYTDSAWLVVVIMSLAFFGKGFGALGWAVVSDTSPKECAGLSGGLFNTFGNIASITTP
FT                   IIIGYIVNATGSFNGALVFVGANAIAAILSYLLLVGPIKRVVLKKQEQDPDQSLPV"
FT   CDS_pept        5328..6695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbF"
FT                   /product="glucarate dehydratase"
FT                   /note="ORF5"
FT                   /db_xref="GOA:P42238"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42238"
FT                   /protein_id="BAA06470.1"
FT                   /translation="MSSPIQEQVQKEKRSNIPSISEMKVIPVAGHDSMLLNLSGAHSPF
FT                   FTRNIVILTDSSGNQGVGEVPGGEHIRRTLELSEPLVVGKSIGAYQAILQTVRKQFGDQ
FT                   DRGGRGNQTFDLRTTVHAVTALEAALLDFLGKFLQEPVAALLGEGKQRDEVKMLGYLFY
FT                   IGDRNRTTLPYQSDEQSDCAWFRLRHEEALTPEAIVRLAESAQERYGFQDFKLKGGVLR
FT                   GEEEIEAVTALSKRFPEARITLDPNGAWSLEEAIALCKGKQDVLAYAEDPCGDENGYSA
FT                   REVMAEFRRATGLPTATNMIATDWREMGHAIQLHAVDIPLADPHFWTMQGSVRVAQMCH
FT                   DWGLTWGSHSNNHFDISLAMFTHVAAAAPGRITAIDTHWIWQDGQRLTKQPFEISSGCV
FT                   KVPDKPGLGVDIDMEQVEKAHEIYRKMNLGARNDAIPMQFLISNWEFDRKRPCLVR"
FT   CDS_pept        6765..7466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbG"
FT                   /note="ORF6"
FT                   /note="homologue of protein A which gene locates upstream
FT                   pyruvate dehydrogenase gene cluster"
FT                   /db_xref="GOA:P42239"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42239"
FT                   /protein_id="BAA06471.1"
FT                   /translation="MYEGLEDLKVDTVNRKTLAKQVIERIVHLLSSGQLRAGDKLPTEM
FT                   ELMDILHVSRPVLREALSSLETLGVITRKTRGGTYFNDKIGMQPFSVMLALATDNLPAI
FT                   IEARMALELGLVTIAAEKINEEELQRLQKTIDDIANSTDNHYGEADKEFHRIIALSANN
FT                   PVVEGMIQSLLITHAKIDSQIPYRERDVTVEYHKKIYDALAQRDPYKAHYHMYEHLKFV
FT                   RDKILKGMDEK"
FT   CDS_pept        7557..8018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbH"
FT                   /product="hypothetical protein"
FT                   /note="ORF7"
FT                   /db_xref="GOA:P42240"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42240"
FT                   /protein_id="BAA06472.1"
FT                   /translation="MAMNLRKNQAPLYIKVHEIDNTAIIVNDGGLPKGTVFSCGLVLEE
FT                   DVPQGHKVALTDLNQGDEIVRYGEVIGFADETIKRGSWIREALVRMPAPPALDDLPLAN
FT                   RVPQPRPHLKDIHLKDTEMRMAVRGQKISSASRQVFNVLLAFWIMQSNE"
FT   CDS_pept        8173..9087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbI"
FT                   /product="hypothetical protein"
FT                   /note="ORF8"
FT                   /db_xref="GOA:P42240"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42240"
FT                   /protein_id="BAA06473.1"
FT                   /translation="MVIGLGCEKLLPERIASENDDDILSLQDHRGFAAMIQSILEMAEE
FT                   RLIRLNSRTRVSCPVSDLVIGLQCGGSDAFSGVTANPAVGYAADLLVRAGATVLFSEVT
FT                   EVRDAIHLLTPRAVSKEVGQSLIKEMKWYDSYLRRGDADRSANPSPGNKKGGLSNVVEK
FT                   ALGSVAKSGTSPISGVLGPGERAKQKGLLFAATPASDFVCGTLQLAAGMNLQVFTTGRG
FT                   TPYGLAAAPVLKVSTRHSLSEHWADLIDINAGRIATGEASIEDVGWEIFRTILDVASGR
FT                   KQTWADRWGLHNDLCLFNPAPVT"
FT   CDS_pept        9657..10286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbJ"
FT                   /note="ORF9"
FT                   /note="homologue of Orf4 of macrolide 2'-phosphotransferase
FT                   of E. coli"
FT                   /db_xref="GOA:P42242"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42242"
FT                   /protein_id="BAA06474.1"
FT                   /translation="MLKGTPAAGIDLEQKQYVWNMDHQPPSDDFVRTLADILAELHGTD
FT                   QISAGQSGIEVIRPEDFRQMTADSMVDVKNKLGVSTTLWERWQKWVDDDAYWPGFSSLI
FT                   HGDLHPPHILIDQNGRVTGLLDWTEAKVADPAKDFVLYQTIFGEKETARLLEYYDQAGG
FT                   RIWAKMQEHISEMQAAYPVEIAKLALQTQQEEHINMALEALGVTSD"
FT   CDS_pept        10870..11808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbK"
FT                   /note="ORF10"
FT                   /note="glutathione-regulated potassium efflux system
FT                   (KcfC)"
FT                   /note="homologue of glutathione-regulated potassium efflux
FT                   system of E. coli"
FT                   /db_xref="GOA:P42243"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42243"
FT                   /protein_id="BAA06475.1"
FT                   /translation="MRAEEQSKIREAAAGTIFLLIGTVCFASKSIWIKWAYQMGAEPDA
FT                   VLLYRQLLAVPLFWLIFLIYRPPMPDGKKKGDLWKACGAGVFCFFLSPLLDFIGLNHVS
FT                   AMVERILLMSYPLFVFGFTACRDRKMSSIQDLFAVLAVMFGLFLALGGWNAELFQANMI
FT                   GAVFILLSSAVYAGYLVLSGHLVHQIGGIRLNAYGMTAAGAAMMLYTGIKSAAGMNTPM
FT                   AAYPLSMYGLFAVIAVVTTVIPFVLMLEGIKRIGAQRAAAISMAGPILTIFYGALFLGE
FT                   RLGLIQVIGCGGVFFVITGMEYRKLKTGKKE"
FT   CDS_pept        11905..12585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbL"
FT                   /note="ORF11"
FT                   /note="homologue of Enterococcus faecium vancomycin
FT                   resistance gene product"
FT                   /note="homologue of vancomycin resistance gene product
FT                   (VanR)"
FT                   /db_xref="GOA:P42244"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42244"
FT                   /protein_id="BAA06476.1"
FT                   /translation="MLVEDDHSISEMVDHYLTKEGFGIVHAFDGEEGIRLFQQGSYDLV
FT                   LLDIMLPKLNGMDFLKIIREKSNIPVLMISAKDGDVDKALGLGFGADDYIAKPFSMIEL
FT                   TARVKAAIRRATQYSAEEPAVNKVIRIHQLAIDIDNVSVLKNGEPLQLTSTEWQLLCLF
FT                   ASNPKKVFTKDQIYRSVWNEEYFDDQNIINVHMRRLREKIEDDPSSPQYIKTLWGIGYK
FT                   LGEF"
FT   CDS_pept        12587..13063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbM"
FT                   /note="ORF12"
FT                   /note="homologue of PhoR of B. subtilis"
FT                   /db_xref="GOA:P42245"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42245"
FT                   /protein_id="BAA06477.1"
FT                   /translation="MTVLWVAAVIALACLNVIQFIMKKKRDGNLAYTADQLSYMLSRDS
FT                   AGQILLPTDDHALKDLLVNINLIVENRQQIRIDERLIAITVWDRGKGISETDQQRVFER
FT                   LYTLEESRNKAFQGSGLGLTITKRLTEKMGGIISVQSKPYERTAFTITLKRMTY"
FT   CDS_pept        13513..14058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbN"
FT                   /product="branched-chain amino acid transport protein"
FT                   /note="ORF13"
FT                   /db_xref="GOA:P42246"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42246"
FT                   /protein_id="BAA06478.1"
FT                   /translation="MVNLKQIDKKPVKTFSLGMKQRLGIARAILTKPDLLILDEPVNGL
FT                   DPLGIKKIRQLFQVLSKEYGMTLLISSHLLGEIEQIADTIGVIRDGRLLEEVSMEDVRG
FT                   QNTEYIELLTPNQTRACFVLEKELQLTNFKILNEKTIRIYEAEASQAAISKALILNDVD
FT                   TWINEHKSIRRWRIISSN"
FT   CDS_pept        14195..14620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbO"
FT                   /product="hypothetical protein"
FT                   /note="ORF14"
FT                   /db_xref="GOA:P42247"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42247"
FT                   /protein_id="BAA06479.1"
FT                   /translation="MWLISYSEKADGGVSFQSTDEAFLIIGTFVRAVFIVFGAVLIVKL
FT                   VISEYKNKTILVMFTYPISRKKLLTAKLMIAGGLTFITILLSNILIAAGFFWLNSICHF
FT                   IPGELTSEIISQQAVKMAVFAFGAAGTSLVPIFFGDA"
FT   CDS_pept        complement(14847..15233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbP"
FT                   /note="ORF15"
FT                   /note="homologue of NADH-ubiquinone oxidoreductase chain 5"
FT                   /db_xref="GOA:P42248"
FT                   /db_xref="InterPro:IPR019649"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42248"
FT                   /protein_id="BAA06480.1"
FT                   /translation="MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTIVLGVISY
FT                   LLGDLYVLPKWNNMIATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIVMAIGE
FT                   YCFHFYMMSKEIGKKHYLETRTDS"
FT   CDS_pept        15547..15975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbQ"
FT                   /product="hypothetical protein"
FT                   /note="ORF16"
FT                   /db_xref="GOA:P42249"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42249"
FT                   /protein_id="BAA06481.1"
FT                   /translation="MAVVRATSADVDLMARLLRAEAEGEGKQGMLLVGNVGINRLRANC
FT                   SDFKGLRTIRQMIYQPHAFEAVTHGYFYQRARDSERALARGSINGERRWPAKFSLWYFR
FT                   PQGDCPAQWYNQPFVARFKSHCFYQPTAETCENVYNTF"
FT   CDS_pept        16081..16812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbR"
FT                   /product="hypothetical protein"
FT                   /note="ORF17"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR019303"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42250"
FT                   /protein_id="BAA06482.1"
FT                   /translation="MATIDLQKKSVKIVLEKKQLTKVTARVGLVLDITGSMRPLYKNGT
FT                   VQNVVERILAVADQFDDNGLLDVWVYDNEFPRLKPVSEKDFPGYVDREILNNDRLHKFG
FT                   RNDEPPVMKDVLRNMLRRNRARILLSLFLSMTGAVKSQSNRLIEASSDKPVFWQFVGIG
FT                   NGNFDFLNKLDTLEGRVIDNTNFLHIEEIDRISDDELYDALLAEFPFWLKEAKEKGIVR
FT                   EQEPPAEKPKKKGFFSRLFSK"
FT   CDS_pept        17376..18764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbS"
FT                   /product="hypothetical protein"
FT                   /note="ORF18"
FT                   /db_xref="GOA:P42251"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="PDB:2YEQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42251"
FT                   /protein_id="BAA06483.1"
FT                   /translation="MPKQAVPVKWEVAKDEHFRKIVRKGTEMAKPSLAHSVHVEADGLE
FT                   PNKVYYYRFKTGHELSPVGKTKTLPAPGANVPQMTFAFASCQQYEHGYYTAYKHMAKEK
FT                   LDLVFHLGDYIYEYGPNEYVSKTGNVRTHNSAEIITLQDYRNRHAQYRSDANLKAAHAA
FT                   FPWVVTWDDHEVENNYANKIPEKGQSVEAFVLRRAAAYQAYYEHMPLRISSLPNGPDMQ
FT                   LYRHFTYGNLASFNVLDTRQYRDDQANNDGNKPPSDESRNPNRTLLGKEQEQWLFNNLG
FT                   SSTAHWNVLAQQIFFAKWNFGTSASPIYSMDSWDGYPAQRERVINFIKSKNLNNVVVLT
FT                   GDVHASWASNLHVDFEKTSSKIFGAEFVGTSITSGGNGADKRADTDQILKENPHIQFFN
FT                   DYRGYVRCTVTPHQVESRLSGDAICDRAGRSHFHAGFIRLPERPNRVEKGIIHNNPRRG
FT                   EAIR"
FT   CDS_pept        19324..19869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbT"
FT                   /product="hypothetical protein o131"
FT                   /note="ORF19"
FT                   /db_xref="GOA:P42252"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42252"
FT                   /protein_id="BAA06484.1"
FT                   /translation="MMLSGICAIAASIPVAAYQLWRFVAPALTKTERKVTIMYIMYIPG
FT                   LFALFLAGISFGYFVLFPIVLSFLTHLSSGHFETMFTADRYFRFMVNLSLPFGFLFEMP
FT                   LVVMFLTRLGILNPYRLAKARKLSYFLLIVVSILITPPDFISDFLVMIPLLVLFEVSVT
FT                   LSAFVYKKRMREETAAAA"
FT   CDS_pept        complement(19866..20513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /product="pyrrolidone carboxy-peptidase"
FT                   /note="ORF20"
FT                   /db_xref="GOA:P28618"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28618"
FT                   /protein_id="BAA06485.1"
FT                   /translation="MRKKVLITGFDPFDKETVNPSWEAAKRLNGFETEEAIITAEQIPT
FT                   VFRSALDTLRQAIQKHQPDIVICVGQAGGRMQITPERVAINLADARIPDNEGHQPIDEE
FT                   ISPDGPAAYWTRLPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHISRTSPHIR
FT                   GGFIHIPYIPQQTIDKTAPSLSLDTIVRALRIAAVTAAQYDEDVKSPGGTLH"
XX
SQ   Sequence 21548 BP; 5836 A; 4639 C; 5647 G; 5426 T; 0 other;
     aattccaggt ggaagacaat ggccccggga tttccgagaa aatcggagac attgtgtttg        60
     acccgggctt tacttcaaaa tatgacgaat ttggcacgcc ttctacgggt atcggacttt       120
     cctacgtaaa ggaaatcgtg acagagctag aaggggatat cacgtttgat aatcagcagc       180
     ggggagtggt gtttgccatc aggctgcctg tccggcattt gattcagaaa gggtgaacca       240
     aaagctatgc gtttttttat tgcagatgat gaccgtgcgg tgcggtcaat tttaaggcag       300
     atcattgagg acgaagatct cggggaagct gctggtgaag cagacgacgg aagccaagtg       360
     gaagggcata tgctgcaatt taagcagatt gatattttat taatcgatct gttaatgccc       420
     ggaagagacg gcattgagac gattcgtcag atccagaata cgtactccgg caaaatcgta       480
     atgatctctc aagtggaggc gaaggaaatg gtcggggaag cgtactcgct cggcatcgaa       540
     tattttatcc ataagccgat taaccgcatt gaaattgtca cggttctcca aaaggtgaag       600
     gagcggatcg agcttgaaca ctcgattgga gccattcagc attctctaag ccggcttgtc       660
     aatcggactg aacggaaagc gcgtccccag cagaagagtg acagcggttt aaaagaggca       720
     ggaacattcc tgttgtccga gctgggcatg atgggagaag gcggcgcaca tgatctcatg       780
     gcggtcctgc agtatttagc agaacacgag caatccgagc cgcacgaaaa acaaagccct       840
     tcgctaaaac aaatattcac ccaagtagcg gtacggaagc tggggacagg agcctcacag       900
     acggaagtca atcgcgaaat gaaagcctcg gagcagcgta tccgcagagc gattattcat       960
     tcgctgcacc attttgcttc actgggcaca actgattttt cgaatccaaa atttgaaacc      1020
     tatgcatcga aattctttga ttttccggtt gtcagccaga aaatgaaaga actccaatcc      1080
     aaggatgcaa aaccccttgc acctgctaga ataaatatga aaaaattcat ccacgtgttt      1140
     tttttggaag caaagctttt gcatgagacg atgaaacaaa gaaggatata aaccaaacag      1200
     ccggctgacc aggctgtttt tttgctgcgc agaatcccgg ccggacagtg atttaccgct      1260
     tttttataaa atatcagaaa ataaagatat tgacttattg tttatttgtc ttacaattaa      1320
     acaaaaggat atatgggaag gagcggatgt gaaagaaaaa ttaataaaag cgcttacaga      1380
     tagaggccgt atacacaaat aacaggaggt tatgttgatg agccgtatca gaaaagcacc      1440
     cgctggaatt ttaggttttc cggttgctcc ttttaacaca caaggaacac tggaggaaga      1500
     agctcttttt caaaacattg agtttttgct gaatgagggc ttggaagcga tatttatcgc      1560
     ttgcgggtct ggtgaattcc aatctctcag ccagaaggaa tatgagcaaa tggtggaagt      1620
     cgcagtctcg gcagccggag gaaaggtgcc ggtctacacg ggggtgggcg gcaacctcag      1680
     cacagcgctt gattgggcgc agctgtcgga gaaaaaaggc gccgacggct acttgattct      1740
     gcctccgtat ttggtgcatg gcgaacagga ggggctgtac cagtatgcga aaacgattat      1800
     tgaaagcact gacttgaacg cgattcttta tcagcgcgat aacgcagttc tctctgttga      1860
     acagatcaaa cgtctgaccg aatgtgaaca gcttgtcggt gtcaaagacg gggtaggaaa      1920
     tatggatttg aatatcaatc tcgtctatac gatcggcgac cgcttgggat ggctcaacgg      1980
     aatgccgatg gctgaagtga cgatgccggc ttatctgccg atcgggttcc actcttactc      2040
     ttcagcgatt tcaaattata tcccgcatat ttcgcgaatg ttctatgatg cattgaaaaa      2100
     cggaaatgac gagcttgtga aggaactcta tcggcatgtg attctgccga tcaacgacat      2160
     tcgcaaacaa cgaaaaggct acgccgtatc cttgattaaa gccggtatgg aaatcatggg      2220
     tttgaatgta aggaatacag ccagaccgcc tgtcggcccg gttgaaaaag atcattatca      2280
     gcaattggaa gcaattttga agcagccggc tgaccgtttt ccgaaaaaag ccgcgacggt      2340
     ttgaccagaa aaaacacgaa aggggcaatg ggcatgtctg tgatcacgga acaaaacacg      2400
     tacctcaact ttattaacgg agagtgggtt aagtctcaat caggcgatat ggtcaaagtc      2460
     gaaaaccctg ccgatgtgaa tgatattgtc ggatatgtac agaattcaac ggctgaagat      2520
     gtggaacgtg ccgtcaccgc cgccaatgaa gccaaaacgg cttggagaaa gctgacgggt      2580
     gccgagcgcg gccaatactt atacaaaaca gcggatatca tggagcagcg cttggaggaa      2640
     atcgccgcct gtgcaacgcg tgaaatgggt aaaacattgc cggaagcgaa gggagaaaca      2700
     gcccggggga ttgccattct gcgctattac gccggagagg gcatgcgaaa aacgggtgac      2760
     gtcattccgt ctactgacaa agacgcgctc atgtttacca cccgtgttcc gctcggtgtg      2820
     gtcggtgtga tttctccgtg gaacttccca gtggcgattc cgatttggaa aatggcgccg      2880
     gcattggtat acggcaatac cgttgtcatc aaaccggcga cagaaacagc tgtgacatgc      2940
     gcgaagatca ttgcctgctt tgaggaagcg gggctcccgg caggggtcat caatttggtg      3000
     acaggcccgg gttctgttgt cgggcagggg cttgctgagc atgacggtgt aaacgccgtt      3060
     acgtttaccg gttcaaatca agtcggaaaa atcatcgggc aagccgcttt agcgagggga      3120
     gccaaatatc agcttgagat gggcggcaaa aaccctgtca tcgtagctga tgacgctgac      3180
     cttgaagctg cggcagaagc tgtcataacg ggggccttcc gttcaaccgg ccagaaatgc      3240
     accgcgacaa gccgtgtcat cgtacaaagc ggaatttacg agcgctttaa agaaaaactg      3300
     ctccagcgca ccaaagatat tacaatcgga gacagcttaa aagaggatgt ctggatggga      3360
     ccgatagcca gcaagaatca gcttgataac tgcctgtcat acattgagaa aggcaaacag      3420
     gagggcgctt cccttttaat aggaggagaa aagctggaga acggaaagta tcaaaacggc      3480
     tattatgttc agcctgccat ctttgacaat gtgacatctg agatgacaat tgcccaggag      3540
     gaaattttcg gtccggtgat cgccttgatc aaggtggact cgatagagga ggcgctgaac      3600
     atcgccaatg atgtgaagtt cggtttaagt gcatccatct tcacggaaaa catcggccga      3660
     atgctttctt tcattgatga aatcgatgcc gggctggttc ggatcaatgc agaaagcgca      3720
     ggtgttgagc tgcaggcgcc ttttggcggc atgaagcagt cgagctccca ctcccgagaa      3780
     cagggtgagg cagcgaagga ctttttcaca gcgatcaaaa ctgtttttgt gaagccgtaa      3840
     tggtgctgga aagaggcgtg cgtctctttc ccggtttatc acaaccagca tatgattctc      3900
     tactttgaaa aggagaagat actatgaaaa aagactttgc gagtgttact ccggcgggca      3960
     aaaaaacgtc cgtgcgctgg ttcatcgtgt ttatgctgtt tcttgtgacc tctattaact      4020
     acgcggatcg agcgacgctt tccatcaccg gagattccgt ccagcacgat ttgggattgg      4080
     actcggtcgc catgggatat gtcttttctg cctttggctg ggcctatgtc atcggacagc      4140
     ttccgggcgg ctggctgctg gaccgttttg gttcaaagac tatcattgcg ttaagcatct      4200
     ttttctggtc gttttttacg ttgctgcaag gggcgattgg ctttttctcc gccggcacag      4260
     cgattatcct gctgtttgca ctgcgttttc tggttggttt atcagaagcg ccttcatttc      4320
     ccggaaacgg cagagttgtt gcctcatggt ttccaagctc cgagcgcggg acagcttcag      4380
     ccttttttaa ttcagcacaa tacttcgcaa tcgtcatttt tcctccttta atgggctggc      4440
     ttacccactc tttcggctgg cattccgttt tcgttgtcat gggtattgca ggcattcttc      4500
     tggctgtcat ctggctaaaa acggtgtatg aaccgaaaaa acatccgaag gttaatgaag      4560
     ctgagcttgc gtacatcgaa cagggcggcg ggctgatttc catggatgac agtaaaagca      4620
     aacaagaaac agaatcgaaa tggccgtata tcaaacagct gttaacgaac cgcatgctga      4680
     ttggcgtgta catcgcgcaa tactgtatta cgactctcac ctatttcttt ctcacatggt      4740
     ttccggtata tttggttcag gcccgcggca tgtctattct tgaagctggg tttgtcgctt      4800
     ccctgccggc gctgtgcgga tttgccggcg gcgtgcttgg gggcattgtg tcagacatct      4860
     tactcaaaaa aggccgttca ctgacctttg caagaaaagt gccaatcatt gccggcatgc      4920
     tgctgtcttg cagtatgatt gtctgtaact acacagattc agcatggctc gtcgttgtca      4980
     ttatgtcgct cgcgtttttc ggaaaaggct tcggcgcatt gggttgggct gtcgtgtcgg      5040
     acacgtctcc gaaagaatgt gcaggattaa gcggcggttt gttcaacact ttcgggaata      5100
     ttgcctcaat tacaacaccg attattatcg gatacattgt caatgccact ggatctttca      5160
     atggcgcgct tgtgtttgtc ggcgctaacg cgattgcggc gatcctcagc tatttgctgc      5220
     tggtcgggcc gatcaaacgg gtcgtgttaa agaaacaaga acaagacccc gatcaatcgt      5280
     tgcctgtcta atatttatga aagcgcttta taaagggagg aaaatgcatg agttcaccga      5340
     tacaagagca ggttcaaaaa gaaaaaagat cgaatattcc ctcaatttct gaaatgaagg      5400
     tgattcctgt tgcgggacat gacagcatgc tgctgaatct aagcggagca cacagcccgt      5460
     tttttacccg gaatatcgta atcttaacag acagcagcgg aaatcaggga gtcggcgagg      5520
     tgcctggcgg agagcatatt cgccgcacac tggagctgtc agagccgctt gttgtcggaa      5580
     aatctatcgg tgcgtaccag gcgatattgc aaacggtcag aaagcagttt ggcgatcagg      5640
     acaggggagg gcgaggaaac cagacgtttg atttgcgcac cactgtgcac gccgtcaccg      5700
     cactggaagc ggctttgttg gatttccttg gaaagtttct tcaggaaccg gtcgcggctt      5760
     tgctgggcga agggaagcag cgtgatgaag taaaaatgct cggttacctc ttttacatcg      5820
     gcgaccgaaa tcggacgacc ttgccgtatc aaagcgatga gcagtcagat tgtgcgtggt      5880
     tccgtctgcg ccatgaggaa gcgctgacgc cggaggccat tgtgcgtctt gccgaatccg      5940
     cacaggagcg ctatggcttt caggatttca aattgaaagg cggggtgctg cggggagaag      6000
     aggaaatcga agctgttacc gcattatcga aacgttttcc agaggcaagg atcactcttg      6060
     atccgaacgg ggcatggtca ttagaggaag ctattgcatt atgcaaagga aagcaagatg      6120
     tgctcgcgta tgcggaagat ccatgcgggg atgagaatgg ctactccgct cgtgaagtaa      6180
     tggctgaatt ccgccgcgcg acagggcttc cgactgcgac aaatatgatt gcgactgact      6240
     ggcgggaaat gggtcacgcg attcagctcc acgcggtcga tataccgctg gctgatccgc      6300
     atttttggac gatgcaaggg tcggtgcggg ttgcgcaaat gtgccatgat tggggtttga      6360
     catggggctc gcactccaac aaccactttg atatttccct tgcgatgttt acccatgtgg      6420
     cagcagcggc tccggggcgg atcacggcga ttgataccca ttggatctgg caggacgggc      6480
     agcgattaac gaaacagcct tttgagattt cttctggctg tgtcaaggtg ccggataagc      6540
     ctggactagg cgtcgatatt gatatggaac aagtggaaaa agcgcatgag atctatcgga      6600
     aaatgaattt aggcgcacgg aatgatgcga tcccaatgca gttcctgatc agcaactggg      6660
     aatttgaccg gaagcgcccg tgtcttgtgc gataagtttg attgtaaata ttgtcatatc      6720
     cgctattttg tcttacaatt gaacaactga agggagagtt gttcgtgtac gaaggtttag      6780
     aggatttgaa agtcgataca gtcaatcgga aaacattagc caagcaggtc atcgaacgga      6840
     ttgtccattt attatcgagc ggacagttga gggccggaga caaattgccg acagaaatgg      6900
     aactgatgga cattttgcat gtcagcaggc cggtgctacg ggaagcactc agttcacttg      6960
     aaacgctggg cgtcattacg agaaaaacac gagggggcac atatttcaac gataaaatcg      7020
     gcatgcagcc attttccgtc atgcttgctt tggccactga taatcttccg gctatcattg      7080
     aagcgcggat ggcgctagaa ctcgggctcg tgacaattgc cgcggaaaaa atcaatgagg      7140
     aagagcttca gcgtttgcag aagacgatcg acgatattgc caacagcact gacaatcatt      7200
     atggtgaagc ggataaagag ttccatcgaa ttattgcgtt aagcgccaat aaccccgtcg      7260
     ttgaagggat gattcagtcc ctgctgatca cccatgcgaa aattgacagc caaattccgt      7320
     acagggagag agatgtaacg gtcgaatatc acaaaaaaat ctacgacgcc cttgcccaaa      7380
     gagatccgta caaagcacat taccacatgt atgagcatct gaaatttgtc cgtgacaaaa      7440
     ttctaaaagg aatggatgaa aaataatggt gagcaaccgc agttgaaacg taagagctgc      7500
     ggttttttta aaccaattta gaaaacgctt actaaaatat gaggagtgat tttcatatgg      7560
     cgatgaacct caggaagaac caagcccccc tttacatcaa agtgcatgaa atagataaca      7620
     ccgcgattat tgtaaatgat ggagggctgc caaagggcac tgttttctca tgcgggctcg      7680
     tacttgaaga ggatgttcct caaggccata aggtggccct caccgatctc aatcaagggg      7740
     acgagatcgt gcgttacgga gaggtgatcg gatttgctga tgagacgatc aaacgcggga      7800
     gctggatacg ggaagccctc gtgagaatgc ccgctcctcc ggcgttagac gatcttcctc      7860
     tcgcaaacag ggtgccgcag ccgcgccccc acttgaagga tatacatttg aaggataccg      7920
     aaatgcggat ggcagtgcgg ggacaaaaaa tatcctcggc atcacgacaa gtgttcaatg      7980
     tgttgttggc gttttggatt atgcagtcaa acgaataaaa gaagagctgc tgccgaaata      8040
     cccaaatgtc gatgacgttg tgccgctgca tcatcaatac ggatgcggcg tggcgatcaa      8100
     tgcgcccgac gctgtcattc cgatccgcac gattcaaaat cttgcgaaga tccgaacttc      8160
     ggcggtgaag taatggtaat cggattggga tgtgaaaagc tcctcccgga aagaattgcc      8220
     tccgaaaatg atgatgacat tctatcgctc caggatcacc gaggttttgc ggcgatgatc      8280
     caatccattt tggaaatggc ggaggaacgg ttaatcaggc tgaacagcag aacccgggtg      8340
     tcatgccctg tttcggatct ggttatcggc ctgcaatgcg gcggcagtga tgcgttttcc      8400
     ggcgtgacgg cgaaccctgc cgtggggtat gcggctgatt tattggttcg cgcaggtgca      8460
     acggttttgt tttctgaagt gacagaggtg cgggatgcca ttcatttatt aacgccgcgg      8520
     gctgtcagta aagaggtcgg acaatcgctg atcaaagaga tgaagtggta tgacagctat      8580
     cttcggcggg gagacgcaga ccgtagcgca aacccgtcac caggcaataa aaaaggcgga      8640
     ttatccaatg tggtggaaaa agcgttaggt tcggtagcga aatcaggcac aagccccatc      8700
     tccggcgtgc tcggccctgg tgaaagagca aagcaaaaag gcctgctgtt cgcggcgaca      8760
     ccggcaagcg attttgtgtg cggcaccctg cagctggctg cgggcatgaa tttgcaggtg      8820
     tttacgacag ggagaggaac accatatggc ctggctgctg cgccggttct gaaagtatcg      8880
     acgcggcatt ccttatcaga gcattgggct gatttaatcg atatcaatgc cggccgaatc      8940
     gcgacaggag aggccagtat cgaagacgta ggctgggaaa tcttcaggac gattttggat      9000
     gtggcaagcg gccgcaaaca aacgtgggca gaccgttggg gtcttcataa tgatttgtgc      9060
     ttgtttaatc ctgctccagt gacttgattc atgtttttat agcggaaaga tggaatatgc      9120
     tgtaaaatga aaatcagcgt ataggaaacg gaggggttac agcatggcat tcattagatt      9180
     ccgagtgaca cgaattcaat agtgaacacc tctcgcctga atgcgagaga atcgggatga      9240
     atccgcctat gtatgagccc ttatatggtt atcaaaaaag agggtggcgt gcctgccctt      9300
     tttggtgcct tcaagcatcc cttctctcta ctgcaggccg gagcatgaga aaggggaaat      9360
     gggatgacaa accttaacga aaaacagctt atcactgaga ttgtcgggct tgcacgcagc      9420
     caaggtttga cggttcattc ctgagaacgc gcaattgaat gaaacccgga atggactttc      9480
     aagttgtatt ttggccagga cgacacaggt atgccatggg tgctgcgaaa accgcgcgaa      9540
     gtgatgttgt ggaaagagca tctgcagaag gcattacgct tgcctttctc cgcacgaaac      9600
     tgtctgctga tgtgccggac tagagaattc atacaccgga attgatcgct taccccatgt      9660
     taaaaggaac gccggctgct ggaattgact tggaacaaaa gcaatatgta tggaatatgg      9720
     atcatcagcc gccgtcagac gactttgtcc gcacacttgc cgacatactg gctgaattac      9780
     atggcacgga tcaaatatct gctgggcaat ccggaataga agtgataagg ccagaagatt      9840
     tcaggcaaat gacagcagac tctatggttg atgtgaagaa taagcttggc gtatctacga      9900
     cgctttggga aagatggcaa aagtgggtag atgatgatgc atactggccg ggtttctctt      9960
     ctttgataca cggcgatctc cacccgccgc atatccttat cgatcaaaat ggacgtgtca     10020
     caggacttct ggattggaca gaagcgaagg ttgctgaccc agccaaggat tttgttcttt     10080
     atcaaaccat tttcggagaa aaagaaactg cccgtttgct tgaatactat gatcaagcag     10140
     gcggccgaat atgggcaaaa atgcaggaac acatctcaga gatgcaggcg gcgtatccgg     10200
     tggaaatcgc caagctagct ctgcaaacac agcaggagga acacatcaat atggcgctgg     10260
     aagcacttgg tgtaacatcg gattaagaat tgacttcgtt tcatgaaccg agtattataa     10320
     actctacaaa taatagaacg gattaacaat cgtgaggaag agcaagtacg catcagaatg     10380
     gaggttcaga gagtcggtgg caggtgtgaa ccgatcctcc cctgatgccg aatgggcttc     10440
     tgaattgctt tgctgaacgg atagtaggcg atgccgggtt tctctccccg ttaccaagag     10500
     aggagtatcg aaacataggt tttctgtact tagagtgaac ggctgtatag ctgttaataa     10560
     aggtggtacc gcgagaccct cgtcctttgc ataggacggg ggttttttgt gtttcttaaa     10620
     ggaggtgacg gccaatgtac gatggctggt ggtggcatag cagatgagtt agaaaggagg     10680
     atatcaaatg gtcattgcaa ctgatgatct tgaggtcgca tgtcctaaat gtgaaagagc     10740
     gggagaaatc gaaggaacac cttgcccggc ctgcagcgga aaaggtgtta ttctgactgc     10800
     tcaaggatat acgcttctcg attttatcca aaagcatttg aataagtaaa ggagaaaagc     10860
     tgagctgaga tgagagcaga agagcagagt aagattcgtg aggccgcagc aggtacgatt     10920
     tttttgctga tcggaacagt ttgttttgcg tctaaatcga tttggataaa atgggcatac     10980
     caaatgggtg ctgagccaga tgccgtgctg ctatacaggc agctgctggc tgttccgctg     11040
     ttttggctga tttttttaat ataccgtcct ccaatgccag acggtaagaa aaaaggagac     11100
     ctatggaagg cttgtggcgc gggagtgttt tgttttttcc tgtctccctt gcttgatttt     11160
     atcgggctga accatgtatc cgcaatggtt gaacgtatat tgctgatgag ctatccgttg     11220
     tttgtgtttg gattcaccgc gtgtcgtgac cggaaaatgt cctcaattca ggaccttttc     11280
     gcagttctgg cggtcatgtt tgggcttttc ttggcgctgg gcggctggaa tgctgagctt     11340
     ttccaggcga atatgattgg agctgtattc attttgttat cttcggccgt ctatgctggt     11400
     tatcttgtcc tttccgggca tctcgtccat caaatcggag ggatccgtct caatgcatac     11460
     gggatgacag ctgctggagc tgccatgatg ctttacacag ggataaaatc ggcggctggc     11520
     atgaatacgc caatggcagc atatccgctt tctatgtatg gtttgttcgc agtaattgca     11580
     gtcgttacca cagtgattcc atttgtccta atgcttgagg gcataaaacg aatcggggca     11640
     cagcgagccg ccgccatttc aatggcaggg cctatcctga cgatttttta tggagcttta     11700
     tttctcggtg aacggctcgg gctcattcaa gtcattggat gcggtggcgt attttttgtc     11760
     attacgggca tggaatacag gaagctgaaa acaggaaaaa aagaataatt tttataaaac     11820
     acacacgttt ttcaattaca ataagtgtaa ttacgtgtgt gttttttgat tttgtaaagg     11880
     ttaggtgagg agatgcagcg catattgctt gtagaagacg accactcaat cagtgaaatg     11940
     gtggatcatt atttaacaaa agaaggcttt ggaattgtgc atgctttcga cggagaagag     12000
     ggcatccggc tgtttcagca gggttcatac gatttggtcc tccttgatat catgctcccg     12060
     aagctgaacg gcatggattt cctgaaaatc atccgggaaa aaagcaatat accggtctta     12120
     atgatttcgg caaaagatgg agatgtggac aaggcattgg gactgggctt tggggcggat     12180
     gattatatcg ccaaaccgtt ttcgatgatt gagctgacag cccgagtaaa agccgcgata     12240
     cggcgggcga cgcaatattc ggcagaggag ccggctgtga ataaggtgat ccggattcac     12300
     cagcttgcga tagatataga caatgtttcc gttttgaaaa acggagagcc gctccagctg     12360
     acgtcaacag aatggcagct gctgtgctta tttgcatcaa atcctaaaaa agtgtttacg     12420
     aaagaccaaa tctaccgttc cgtttggaat gaagagtact ttgatgatca gaacatcatt     12480
     aacgtacata tgcggcggct cagagaaaag attgaggatg acccctcctc ccctcaatat     12540
     attaaaacgt tatggggcat cggttataaa ttaggagagt tttagaatga cagtgctatg     12600
     ggtggccgct gtcatcgctc tggcgtgtct gaatgtgatt caattcataa tgaaaaagaa     12660
     gcgggacggg aatctggctt acacggctga ccagcttagc tacatgctca gccgggattc     12720
     ggcaggacaa attttgcttc ctacagacga tcatgcgctc aaagacttgc ttgttaacat     12780
     caatcttatc gttgagaatc gtcagcagat ccgaattgat gagaggctca tcgccatcac     12840
     cgtatgggat cgcggaaaag ggattagtga aaccgatcag cagcgggtgt ttgagaggct     12900
     gtacacactg gaagaatcca gaaataaagc atttcaagga agcggcttgg gtttaaccat     12960
     cacaaaacgg cttacagaaa aaatgggagg catcatatcc gtccaaagca agccgtacga     13020
     acggactgca tttacgatca cattgaaacg catgacatat taatcgtaag aatttcttaa     13080
     ggtttgagaa ataaaaatga cagggctcgc cgctacaata gaaaacagga aaagagaggg     13140
     aaggagaaac aaagttgact tatatcgtac aaacaaacgg gctgaccaaa acatatcagg     13200
     gcaaagaggt cgtatccaat gtcagcatgc atattaaaaa aggtgaaatc tatggctttc     13260
     tcggcccgaa cggcgcgggg aaaacaacca ttatgaaaat gctgacgagc cttgtcaaac     13320
     cgacaagcgg tgaaatcatc atccttggga acaagttcac ccacacgtca tatgaggtgc     13380
     tggggaacat cggcagcatg attgaatatc cgatttttta tgaaaacctg acagctgaag     13440
     aaaatttaga aagatctgca ttgtgaatat atgggatacc acaataaaaa agccatacaa     13500
     gaagtgctgg atatggtgaa tttaaaacaa atcgacaaaa aacccgtcaa aaccttttcc     13560
     ctcgggatga agcagcgcct tggaattgcg cgtgccatcc tcacgaagcc ggacctgctt     13620
     attctggatg agccggtgaa tggtcttgac cctctcggca ttaaaaagat caggcaattg     13680
     tttcaagtgc tgagcaaaga gtacgggatg acgctgctga tctcaagcca cctgctgggt     13740
     gaaatcgaac aaatcgcgga cacaatcggc gtcattcggg acggcaggct gcttgaagag     13800
     gtatcaatgg aggatgtcag gggccagaac actgaataca tcgagcttct cacgccgaat     13860
     cagacaaggg cctgctttgt gctggagaaa gagctgcaat taaccaactt taaaatatta     13920
     aatgagaaaa cgattcgaat ttacgaggct gaagcctctc aggctgccat atccaaagca     13980
     ttgattttaa atgatgtaga cacttggatc aatgaacaca aaagtatacg tcgctggagg     14040
     attatatcat caaattgatc aacggcaata gcatcagtgc gtaataggag gagagacacg     14100
     ttgatgaatt tgatcagaat ctgcattaag aaaaatgaaa tgggctgggt atatcagagg     14160
     tgccctcatt gccaacgtga tcattatggg ttttatgtgg ctgatcagtt attccgaaaa     14220
     agccgatggc ggggtttcgt tccaaagtac ggatgaagca ttcctcatca tcggcacctt     14280
     cgtcagagcg gtatttatcg tatttggcgc tgtgctgatc gtaaaattgg tgatttcgga     14340
     atataaaaac aaaaccattc ttgtgatgtt cacgtacccg atcagccgta aaaagctgct     14400
     caccgctaag ctcatgatcg cgggcggact gacgtttatc acgattttac tttcaaatat     14460
     actcatagcc gccggtttct tttggctgaa ctcgatctgc catttcatac cgggagagct     14520
     tacttccgag atcatttctc aacaggcggt caaaatggcg gttttcgctt ttggcgccgc     14580
     tggaaccagt ttagttccca tcttttttgg ggatgcgtag acactcggtt ccggcgacca     14640
     tcatttcatc tgtagtaatt gtgatgctca tcagctcaac aagtccgggc ttctcgattt     14700
     catctgttgt gtatatcccg ttatcgttag cggcattcgg tttgttcttt tcctacatgg     14760
     cgatcaggaa tgcggacaag caggatgcgt aaacaaaggc gcccaatatg tataaaaggc     14820
     cgatgctgtc agcaccggcc tttccattat gagtctgttc ttgtttcaag ataatgcttc     14880
     ttgccaatct ctttgctcat catatagaaa tggaagcaat attcaccgat tgccatgacg     14940
     atcgcgccga ataaagccgc caatgcaact tcaccgccag tcatccccat agaaagcggc     15000
     atgcccatca gccagatcac gagaaaggcc aaaccaaaat cagccaaagt tgcaatcata     15060
     ttattccatt tcggcaatac ataaagatcg cccagcaaat aagaaataac ccctaacaca     15120
     atcgtcatta gcagcgtatc accaaacgtg aaaccaaagc ccagaccaag caccagatac     15180
     aacacaataa tcgtcataat acctttaata gcgagcgctt tcacatgtgt cattacaatt     15240
     cctccttttg tcatttgatt tgttatgtat aattcctcaa atgtaaaaag ttaaacctta     15300
     tttcttttcg gaggcgggtg caaatctgct ggggagaggt caatgatgtg aatccaggaa     15360
     ttgaggctgc ggcgcttcga cagcggaaac gtgaagcttg tactgcaccg gacgctgctt     15420
     tgatgcccaa cagcccatta tgtttgctgt ttttagatga ataaatttaa aaacttctcc     15480
     tgtccctccg tcatcacttc tgaagtaatg aaatatgatg aaaagagatc aaggggaggt     15540
     gacgtgatgg cggtcgtgag agcaacgagt gcggatgtcg atttgatggc aaggctgctc     15600
     agagcggaag cggaaggcga aggcaagcag gggatgctgc ttgtcggcaa cgttggaatt     15660
     aatcggctgc gggcgaattg ctcagatttt aaaggcctcc gcaccatcag gcagatgatt     15720
     tatcagccac acgcgtttga ggctgtgact catggatatt tttatcaaag ggcgcgagat     15780
     agcgagcgtg cccttgcacg cggctcgatt aatggtgaaa ggcgctggcc tgcaaaattt     15840
     agtttatggt acttcaggcc gcagggggac tgtccagccc agtggtataa ccagccgttt     15900
     gtggccagat ttaagtcaca ctgcttttat cagccgacgg cggagacgtg tgaaaatgta     15960
     tataacacat tttagagaca ggacaccgtt caaattgaac ggtgtttttc tttgaaaaga     16020
     tgcaatgcaa aatattcctg tgagataatc aaagaaaaaa gagctgacgg agatgacaga     16080
     atggcaacaa ttgacctgca aaagaaaagt gtaaagatcg tactggagaa aaagcagtta     16140
     acgaaggtga cggctcgtgt tggactggtt cttgatatta cgggatcgat gagaccgctc     16200
     tacaaaaacg ggacggttca aaatgtggtg gagcggattt tggcagtggc tgatcagttt     16260
     gatgataacg gtttgctgga tgtatgggtg tatgataatg aatttccccg attaaagcca     16320
     gtttcagaaa aggattttcc gggctatgtc gatcgtgaaa ttttaaataa tgaccgcttg     16380
     cataaattcg gcagaaatga tgagccgcca gtcatgaagg acgtgctgcg aaatatgtta     16440
     cggaggaacc gagctcgtat cctgctttca ttgtttttat caatgacggg ggctgtaaaa     16500
     agtcaatcaa accgactaat tgaagcttct tctgataaac cggtgttctg gcagtttgtc     16560
     ggcatcggaa acggaaactt tgattttctc aataaactgg atacgttaga agggcgtgtc     16620
     attgataaca cgaacttcct gcatatcgaa gagattgacc gcatttctga tgatgagctt     16680
     tatgatgctc tgcttgctga atttccattt tggctgaaag aagcgaagga aaaagggatt     16740
     gtaagagaac aagagcctcc tgctgaaaag ccgaaaaaga agggcttttt cagcagattg     16800
     ttttcgaaat aactgataaa gagcactgag tcattctgcg aaatggctcg gtgtttttgc     16860
     ttctttttaa gatcatgtga agaaaaatag gccgaatggg cggcttgctt gcaaacgaca     16920
     ggatatgcag aaaacgcgtc attcagccag ctttcggcat gtttcagcag caggcttgtg     16980
     agggaagacc tgtttttaat gttcagcgct tacaatcagt tcacacttct tcacagtcgt     17040
     ttaacaatga tttcctataa tggagacgat caatgaggag agaggggatc ttgaatggca     17100
     tacgacagtc gttttgatga atgggtacag aaactgaaag aggaaagctt tcaaaacaat     17160
     acgtttgacc gccgcaaatt tattcaagga gcggggaaga ttgcaggctt tctcttggat     17220
     taacgattgc ccagtcggtt ggggcctttg aagtaaatgc tgcgcctaac ttctcaagct     17280
     atccgtttac attaggggta gcgtcaggtg atccgctttc tgacagtgtc gtgctttgga     17340
     cacgtctggc accagatccg ctgaatggcg ggggaatgcc gaagcaagca gtgcctgtca     17400
     aatgggaggt cgcaaaggat gagcatttcc gcaaaatcgt aagaaaaggc actgaaatgg     17460
     ctaaaccaag tcttgcccat tccgttcatg tggaagcgga cgggcttgag ccaaacaaag     17520
     tgtactatta ccgtttcaaa accggccatg aactaagccc tgtcggaaaa acaaaaacac     17580
     tgcctgcccc tggcgccaat gtgccgcaaa tgacctttgc atttgcttcc tgccagcaat     17640
     atgagcacgg atattatacg gcctacaagc atatggcaaa ggaaaagctt gatcttgtct     17700
     tccatctcgg tgattacata tatgaatacg gcccaaatga atatgtatca aaaacaggca     17760
     atgtccgcac gcacaacagc gcggaaatca ttacgctgca agactatcgg aaccgtcacg     17820
     ctcaataccg ttctgacgcc aatcttaaag ctgcacatgc ggcattccct tgggttgtaa     17880
     cttgggatga ccatgaagtt gaaaacaact atgccaataa aatacctgaa aaaggacagt     17940
     cggttgaagc attcgtgctc cgccgcgcgg cagcatacca ggcatactat gaacatatgc     18000
     cgctccgcat ttcctctttg ccgaatggcc cagatatgca gctgtaccgg cactttacgt     18060
     acggaaacct ggcgtccttc aatgtgcttg atacccgcca gtacagggac gaccaagcca     18120
     ataacgacgg caataagccg ccttctgatg aatcgcgcaa tccgaatcgg actctgcttg     18180
     gaaaagaaca ggagcagtgg ctcttcaaca atttgggcag ctcgacagcc cactggaatg     18240
     tgctggcgca gcagattttc tttgccaagt ggaatttcgg gacaagcgca agcccgatct     18300
     acagcatgga ttcgtgggac ggctacccgg ctcagcgcga acgggttatc aatttcatta     18360
     aaagcaaaaa tctgaataat gttgtcgtac tgacaggtga tgtacacgca agctgggcat     18420
     cgaatttgca tgtcgatttc gagaagacaa gttcaaaaat attcggagcc gaatttgttg     18480
     gaacctcgat cacttccgga gggaacggag cggataagcg agcggatacg gaccaaattt     18540
     taaaagaaaa tccgcacatc cagttcttta acgactatcg cggatatgtc cgctgtacag     18600
     tgacgcctca ccaagtggaa agccgattat cgggtgatgc catttgtgac cgagccgggc     18660
     gcagccattt ccacgcgggc ttcattcgtt taccagaaag accaaaccgg gttgagaaag     18720
     gtatcatcca caacaatcca aggcggggtg aagcaatccg atgaggtcga agaggatcgt     18780
     ttctttcgca caacaaagcc cacgaaaaac aaatgattaa ggaagcgtgc aaaaatcacg     18840
     aattaaggag tggaaattat gttttcaaac attggaatac cgggcttgat tctcatcttc     18900
     gtcatcgcct cattattatt tttggccctt ccaagctgcc ggaaatcggg cgtgccgcga     18960
     aacggacact gctggaattt aaaagcgcca caaaatcact tgtgtctggt gatgaaaaag     19020
     aagagaaatc agctgagctg acagcggtaa agcaggacaa aaacgcgggc tgaatgctga     19080
     tgaggcagac accgggtctg ctcttttttt atgaaaggga gggctttttt gaatggataa     19140
     aaaagaaacc catctgatcg ggcatttaga agagcttcgc cgccggatta tcgtcaccct     19200
     tgcggatttt ttctatttct catcacggct tttttgttcg tacaggacat ttatgactgg     19260
     ctgatcaggg atttggatgg aaagctggct gtgctaggac cgagtgaaat cctctgggtg     19320
     tatatgatgc tttccggcat ttgtgccatt gcggcttcta tccctgttgc cgcgtaccag     19380
     ctgtggcgtt tcgttgcacc ggcgctgact aaaacggagc gcaaggtgac gatcatgtac     19440
     atcatgtaca taccaggttt atttgcgttg tttttggcgg gcatctcctt cggatacttt     19500
     gtcttgtttc cgatcgtgct cagctttttg actcatttat cctccggcca ctttgaaacg     19560
     atgtttacgg ctgaccgcta ctttaggttt atggtgaatt tgagcctgcc gttcggcttc     19620
     ttgtttgaga tgcccttggt ggtgatgttt ttaacaaggc tgggcatctt aaatccttac     19680
     agactggcca aagcgagaaa gctttcctat tttctgctga ttgtcgtgtc catattgatt     19740
     acaccgcctg attttatttc tgattttctc gtgatgatcc cgcttcttgt cctgtttgaa     19800
     gtgagtgtca ccctatcggc gtttgtctac aaaaagagga tgagggaaga aacagcggcg     19860
     gccgcttagt gcagcgtacc acccggtgac ttcacatcct catcatattg tgcggccgta     19920
     acagcggcga ttctcaatgc ccggacaatc gtgtccaggc tgaggctcgg cgctgttttg     19980
     tcgattgttt gctgcggaat gtaaggaata tgaataaaac cgccgcgaat gtgtggggat     20040
     gtccggctaa tgtgatccat taacccgtag aacaaatagt tgcatacaaa ggtccccgct     20100
     gtgtaggaaa ccgcagctgg aatgccgtgt tccttcatct tagcagtcat tcgtttcacg     20160
     ggaagccttg tccagtaagc ggcgggccca tctggagaaa tctcttcatc aatcggctga     20220
     tgtccttcgt tatcggggat tcgcgcatct gcaaggttga ttgccactcg ttccggtgta     20280
     atctgcatcc gtcctcctgc ttggccgaca caaattacga tatctggctg atgtttttga     20340
     atggcttggc gcagagtgtc cagagcggat ctaaagacgg ttggaatttg ttccgctgta     20400
     ataatggctt cttctgtctc gaagccatta agccgtttcg ccgcttccca tgatggattg     20460
     acggtttctt tgtcaaaagg gtcaaagcct gtgatcagca ctttttttct catactccca     20520
     tctccttttt cttttattct attgtttatt tatgggtttt tcatcaaaat aatgtaaagg     20580
     agtgaatcat aatggagcat ttgccggagc agtatcgcca gttattccca accttgcaga     20640
     cgcatacgat gcttgccagc tgttctcaga gcgcattggc agagcctgta tcaagggcga     20700
     tccaggatta ttatgatagc ctgctgtata aagggacgaa ctggaaagaa gcgattgaaa     20760
     aaacagagtt tgcgagaaac gagtttgcaa agctgatcgg ggctgaaccg gatgaagtgg     20820
     cgattgtgcc gtcagtttct gatgcactgg tttctgtagc atcgtactta actgcatttg     20880
     gaaagaagca cgttgtatat acagatatgg attttccggc ggtgcctcat gtttggcagg     20940
     cacactccga ttataccgta tccgtcattc catcaataga cggcgtgctg ccgcttgaac     21000
     aatatgaaac gcatatttcg gatgaaacag tactgacgtg tgttcctcac gttcattatc     21060
     gtgacggcta tgttcaggat ataaaagcga ttgccgagat ttctcagaga aagggctctt     21120
     tattgtttgt agatgcttat caatcagccg ggcatattcc cattgatgtg aaggaatggg     21180
     gcgtagatat gctggcagca ggcacccgga agtatttgct cggcataccg ggtgtggcgt     21240
     ttctttatgt gagaaaggag ctggctgacg cactgaagcc gaaagcatca gcttggttcg     21300
     gaagagagag cggatttgat ggggcttatg caaaagtcgc gcgccgtttt caaacgggca     21360
     ccccagcttt tatcagcgta tacgcagctg cagcggcttt atcgctgctg aatcatattg     21420
     gggtttctca tatcagggat catgtgaaaa cgatctgtgc cgatgcagtt caatatgccg     21480
     ctgaaaaagg cctgcagctg gcggcggcac aaggtgggat tcagccgggc atggttgcga     21540
     tccgaatt                                                              21548
//

If you have problems or comments...

PBIL Back to PBIL home page