(data stored in SCRATCH zone)

EMBL: D32216

ID   D32216; SV 1; linear; genomic DNA; STD; PRO; 48032 BP.
XX
AC   D32216;
XX
DT   22-JUL-1994 (Rel. 40, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 14)
XX
DE   Bacillus subtilis 48 kb region including a skin element which is located
DE   between spoIVCB and spoIIIC.
XX
KW   ArsB; ArsC; arsenate reductase; arsenic efflux pump protein; autolysin;
KW   cell wall lytic enzyme; cwlA; GsiAA protein; hypothetical protein;
KW   phi-105 Cro-like protein; phi-105 immunity repressor;
KW   RNA polymerase sigma factor K; site-specific recombinase; spoIIIC; spoIVCA;
KW   spoIVCB; SPP1 terminase.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-48032
RA   Kobayashi Y.;
RT   ;
RL   Submitted (19-JUL-1994) to the INSDC.
RL   Yasuo Kobayashi, Tokyo University of Agriculture and Technology, Applied
RL   Biological Science; Saiwai-cho 3-5-8, Fuchu, Tokyo 183, Japan
RL   (Tel:0423-34-5988, Fax:0423-34-5843)
XX
RN   [2]
RP   34962-37964
RX   PUBMED; 1683402.
RA   Foster S.J.;
RT   "Cloning, expression, sequence analysis and biochemical characterization of
RT   an autolytic amidase of Bacillus subtilis 168 trpC2";
RL   J. Gen. Microbiol. 137(8):1987-1998(1991).
XX
RN   [3]
RP   46360-48032
RX   PUBMED; 2105293.
RA   Sato T., Samori Y., Kobayashi Y.;
RT   "The cisA cistron of Bacillus subtilis sporulation gene spoIVC encodes a
RT   protein homologous to a site-specific recombinase";
RL   J. Bacteriol. 172(2):1092-1098(1990).
XX
RN   [4]
RP   35861-36988
RX   PUBMED; 2127796.
RA   Kuroda A., Sekiguchi J.;
RT   "Cloning, sequencing and genetic mapping of a Bacillus subtilis cell wall
RT   hydrolase gene";
RL   J. Gen. Microbiol. 136(11):2209-2216(1990).
XX
RN   [5]
RP   1-392
RX   PUBMED; 3125151.
RA   Errington J., Rong S., Rosenkrantz M.S., Sonenshein A.L.;
RT   "Transcriptional regulation and structure of the Bacillus subtilis
RT   sporulation locus spoIIIC";
RL   J. Bacteriol. 170(3):1162-1167(1988).
XX
RN   [6]
RX   PUBMED; 7704261.
RA   Takemaru K., Mizuno M., Sato T., Takeuchi M., Kobayashi Y.;
RT   "Complete nucleotide sequence of a skin element excised by DNA
RT   rearrangement during sporulation in Bacillus subtilis";
RL   Microbiology (Reading, Engl.) 141:323-327(1995).
XX
DR   MD5; f44256c665b8a569c316118ce896fb08.
DR   EuropePMC; PMC90469; 11302791.
DR   EuropePMC; PMC94277; 10629174.
DR   GOA; P54373.
DR   InterPro; IPR024556; DUF3599.
DR   InterPro; IPR038667; XkdH-like_sf.
DR   RFAM; RF01412; BsrG.
DR   UniProtKB/Swiss-Prot; P45924; YQBH_BACSU.
DR   UniProtKB/Swiss-Prot; P54373; TXPA_BACSU.
XX
CC   Sequence updated (3-Oct-1994) by:
CC   Yasuo Kobayashi
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..48032
FT                   /organism="Bacillus subtilis"
FT                   /map="227-232 degree."
FT                   /strain="JH642 (trpC2 pheA1)"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        complement(<1..29)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIIC"
FT                   /product="RNA polymerase sigma factor K"
FT                   /db_xref="GOA:P12254"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12254"
FT                   /protein_id="BAA06914.1"
FT                   /translation="MPPLFVMNN"
FT   misc_feature    1..5
FT                   /note="recombination site"
FT   CDS_pept        complement(11..529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF45"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45899"
FT                   /protein_id="BAA06915.1"
FT                   /translation="MRYTNSHLEDWIENLYKKIDITEPEQINFERIAEALDIRLSFKPV
FT                   TSFALKHSGIYNICLDSRKSRTEQWYDFAHEFCHIYRHEGDKKTMPATWTDYLDWQSNY
FT                   FTYHFCIPTCMLRNINLPYIQSHAIENVAWLFKVSPSFAKKRLSIYYRKLTQHLFSQTV
FT                   TGNLCPPFL"
FT   regulatory      complement(538..545)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      785..791
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        798..1334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45900"
FT                   /protein_id="BAA06916.1"
FT                   /translation="MKKNIHILGASGVGTSTLGAALSKRLPHTHLDTDNYYWLDKFTKK
FT                   REIPERRKLLEKDLTINEKWILSGAVCGWGDNLKSYFDLVVFLWIPQDIRLERLRHREF
FT                   QRYGNEVLAGGSKYEQSKTFLEWASLYDNAGMEVRSRALHEHWMADLSCPVLKIEDDCS
FT                   VNERVDRVLDYLSSN"
FT   regulatory      1676..1682
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1690..1857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF9"
FT                   /db_xref="GOA:P45901"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45901"
FT                   /protein_id="BAA06917.1"
FT                   /translation="MKNNDKKKEVQRKYREEIKKKKQKNEDNKNFIKETIIVVTIIVLF
FT                   IFFTYTLQGF"
FT   CDS_pept        complement(2124..2474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF7"
FT                   /note="similarity to phi-105 immunity repressor"
FT                   /db_xref="GOA:P45902"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45902"
FT                   /protein_id="BAA06918.1"
FT                   /translation="MFSENLKKCRKQKKLTQQNMADKLGITRPAYTAYELGSREPDYKT
FT                   LINISNILDVSLDYLLKGESNEKVFQDEAKKVLNDPETFLAAKDGEVTDEILQAALEII
FT                   TEQLKERRKSDK"
FT   regulatory      complement(2479..2485)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      2638..2647
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2651..2881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF8"
FT                   /note="similarity to phi-105 Cro-like protein"
FT                   /db_xref="GOA:P45903"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45903"
FT                   /protein_id="BAA06919.1"
FT                   /translation="MMRKWLKKNRLEKGFTQEEVAKAAQIGRAYYTMIENGTRKPSVIV
FT                   SKKIGEKLGFDWTIFFEDVCNETKHNSKDSA"
FT   regulatory      2893..2900
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2911..3051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF17"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54372"
FT                   /protein_id="BAA06920.1"
FT                   /translation="MKVILKKGPLFEQAEAKAYKYLSGILVQRMNEHQEKLAQKNKKES
FT                   A"
FT   regulatory      3112..3117
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3125..3694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF18"
FT                   /db_xref="GOA:P45904"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45904"
FT                   /protein_id="BAA06921.1"
FT                   /translation="MENNPYNMRNLPQIMRSARKAAGLSQYQIGKLIGGKDQRYVSDVE
FT                   NGLAKLTPELCIKWFEKCAAYEHIDLVHYLFKLHPTAAAPIDPALNECASNAVINMVHQ
FT                   LEEALQATKHLARWLTDNRPGKTEELPMADIKQIFDLIAANKTLIYSLVRTHGLKMQEL
FT                   ADRWTRKALVDQVAMAKQEGRQAVSV"
FT   regulatory      3678..3684
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3691..3948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF19"
FT                   /db_xref="InterPro:IPR020278"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45905"
FT                   /protein_id="BAA06922.1"
FT                   /translation="MNTNHFLKADVPIAKRKIESAEELSIMLSEALRDGDYEEAISLAG
FT                   SIKVLTEDISRLANKGRLYETALKMQQQGINLTVVSRCIG"
FT   regulatory      4066..4070
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4078..4272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF20"
FT                   /db_xref="InterPro:IPR018474"
FT                   /db_xref="InterPro:IPR023118"
FT                   /db_xref="PDB:2DSM"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45906"
FT                   /protein_id="BAA06923.1"
FT                   /translation="MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILR
FT                   ENLERYLREQLGFEFKNAQ"
FT   regulatory      4365..4369
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4378..5337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF21"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45907"
FT                   /protein_id="BAA06924.1"
FT                   /translation="MTSKRAEVLAKNSEMSRDEWLIERRKGIGGSDASIILGLNKWKTP
FT                   FELWLDKTGQVPVSESQSEAAYFGSLLEDIVAKEFEIRSGKKVRRKKAILRHPEYNFIL
FT                   ANVDRMIVGEKAILECKTTSAYNLKEWEDEEIPESYIVQVQHYLGVLGPEYRKAYFAVL
FT                   IGGNKFVWKEIERDDELIDMIFKAEIEFWNDKVLGGQAPALDGSSAAEEYLKKRYAETE
FT                   NNKAIDLTAANRERIQQYLLIKEQISELQSQAKELENQIKHEMKDAEYGFIGNYQACWK
FT                   PVVSNRIDTKKLKDQFPDVYEKVKKETHFRRFGIKEVS"
FT   regulatory      5323..5330
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        5340..6194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF32"
FT                   /db_xref="GOA:P45908"
FT                   /db_xref="InterPro:IPR004590"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45908"
FT                   /protein_id="BAA06925.1"
FT                   /translation="MATNQSIKNNIQKKQKNVPVQQQGATMKGLLSSPSVIKRFEEVLG
FT                   KRATQFTASILSLYNSEQMLQKTDPMSVISSAMVAATLDLPIDKNLGYAWIVPYGGKAQ
FT                   FQLGYKGYIQLALRTGQYKSINCIPIHEGELQKWNPLTEEIEIDFEKRESDAVIGYAAY
FT                   FELINGFRKTVYWTKAQVEKHKKKFSKSDFGWKNDWDAMALKTVLKAVLSKWGILSVEM
FT                   QKAVIEEDETRERIDITNEADSSEIIDSEPSNKDETEKPSAQETDPFDGKPVDIKDDEL
FT                   PFD"
FT   regulatory      6225..6234
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6246..6947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF33"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45909"
FT                   /protein_id="BAA06926.1"
FT                   /translation="MDIKAMGYVVIPRLPFKEFRDEKIYDHLFKRAEYRPNQELELGQT
FT                   IIKVVELAKDFNWSAAQIKYSLDRMEKQGYIKLHRLPQKRGLIVTILHYADYIQLGNYM
FT                   KNKALEPAQIEHQEVDDKMKNAFELYENKVARSVGPMEAQRIGYMVDDYGEEKVMEAIK
FT                   TAFQLKGKAASLSYVQAILSNPFTQKRKEKQYGYKQSSQYRHRISNDHAGTSGKVSPLF
FT                   GNKTGRIRRKG"
FT   regulatory      6263..6282
FT                   /regulatory_class="terminator"
FT   regulatory      6813..6821
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6829..7770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF34"
FT                   /db_xref="GOA:P45910"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45910"
FT                   /protein_id="BAA06927.1"
FT                   /translation="MAINKAVSIDTAFQTIMQELRERSARFLGTKQAVSEEKAEFDCPY
FT                   CKDRGIVVYRVHKDTSWHLDEQLDLMVPDDMVSEDDFLLGKVCTPDKASEWKDTYSKQC
FT                   ECVRRKKIARLMAASGITEEFEKLLFGNFITDGKPDMIKDAYECAVEYYKDFQKIKGER
FT                   QNSIALLGQPGSGKTHLLTAIMNNLIKKKSVHCMYFPYVEGMGDLKANFDNLEAKLDAM
FT                   RKVEVLFIDDLFKPINGQPRATDWQVEQIQSVLNYRYLNHKPLLISSELTIDEILDIDE
FT                   ALGSRIHQMCRDYIVIIRGDRMQLNHRLGDWE"
FT   regulatory      6957..6971
FT                   /regulatory_class="terminator"
FT   regulatory      7991..7996
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8006..8434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF39"
FT                   /db_xref="GOA:P45911"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45911"
FT                   /protein_id="BAA06928.1"
FT                   /translation="MDCIKFTVYGEPVAQGRPRGSIRNGKVHMRDPAKSKYFKQYVALV
FT                   ASQHRPETIITGPVSMDVKVYRPMPKSVSNSKKKKEKAEKGLLRPTTKPDVDNYVKGVK
FT                   DALNHLIYKDDSQVVDLKVSKFYSEEPRVEVMIREVSA"
FT   CDS_pept        8516..8722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR035530"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45912"
FT                   /protein_id="BAA21333.1"
FT                   /translation="MYNPREINIKKDFTIQQKIDPGKVQIIVLDGNQGTAHVLDAPEHG
FT                   KTVIQTVKGSFARVDHEIGFKVK"
FT   regulatory      complement(8758..8779)
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(8796..9725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF40"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45913"
FT                   /protein_id="BAA06929.1"
FT                   /translation="MRVREIKNLLDNYNKQIGVSVSHVPHSNRKTVLNLQKSLDAINEL
FT                   SKLGFLDDDIERFKDLGSIYYSRVPEDKIEVDNHIANQITNHIKIVKEKLRGFGILIDQ
FT                   SVSDQNENVISVKLPQYNSLEELEKFIKKLNNAFQNGITLEEINGHYKLQGFDTGSMWI
FT                   DILVNSSAAVIFVGQLIDAAINISKRSQELLITKANIEKLALQNEQLKLQVETSKALLD
FT                   GIEKGIDTITDAEIKNVTEGANYSTESIGHIKQSVKIFAELLHEGTQFHPSLDAPSETV
FT                   EAFPEPQKNLEEPQQLLETLADNLPEQE"
FT   regulatory      complement(9732..9737)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      9907..9914
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        9923..10378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF41"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45948"
FT                   /protein_id="BAA06930.1"
FT                   /translation="MNRKEIENLINSYHWMVKEVRRLQRVLYGSVIPMKNWGVAQYGLE
FT                   ATMPKGSPGKSQAELRQMDMREERLFKRLKYYEERVYAVELGAEKIHGEQHKVIYDCMM
FT                   EGMSYRAISLHLGISRETVRKMKDEFISQLCQDCHFERLLNLKKSVV"
FT   regulatory      10506..10513
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        <10552..10986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF42"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45914"
FT                   /protein_id="BAA06931.1"
FT                   /translation="TSAITAVFFTGGTNYVLQKKNRKGNEIFTKGYILIDEIYNINNKR
FT                   IETAAAFVPFYNHPEGYLEKLHTDYFKELSAFELIVKKFSILFDKELNIKLQEYINYLR
FT                   EVEVALRGFMNDDPIIEVNFNQEYIERLIDEITNLIKKHI"
FT   regulatory      11031..11038
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        11054..11773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF43"
FT                   /db_xref="InterPro:IPR018925"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45915"
FT                   /protein_id="BAA06932.1"
FT                   /translation="MVDKHIQAYKDYAKGMKYKDLAEKYGVSVNTIKSWKQRHGWQRKK
FT                   GAPLKKGVHTKKVGAPLGNKNALGNNGGAPKGNQNAVTHGFFSKFLPEETLSIMEGIQE
FT                   RSPVDMIWDQIQIQYAAIIRAQKIMFVSDKQEMIKELKKKKSVLSETNEVEEEEFEFQF
FT                   SWDRHATFLNAQSRAMAELRNLIKQFDELAHSEDERRLKLEHMRLNINKKKIEIEELTE
FT                   EDKPFEITIVNKGDDSD"
FT   regulatory      11753..11763
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        11766..13061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF50"
FT                   /note="similarity to SPP1 terminase"
FT                   /db_xref="GOA:P45916"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="InterPro:IPR035412"
FT                   /db_xref="InterPro:IPR035413"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45916"
FT                   /protein_id="BAA06933.1"
FT                   /translation="MIKQVNPHFKEFLFDWNQKFQFLVGGYGSSKSYHVALKIVLKLLR
FT                   EKRTALVIREVYDTHRDSTFSLFDELVSDLKLDHIVRCVSSPMQIRFSNGSRIIFKGMD
FT                   KPAKLKSINNISLIWIEECSEVKYEGFKELLGRLRHPTLPLHMILSTNPVGEDNWTFKH
FT                   FFKDDREKRFVLDDKELYEKRIIVSNDTYYHHSTADDNLFLPESYVQQLEELKEYDPDL
FT                   YRIARKGHFGVNGIRVLPQFEERPHEEVMTAISNINRPLKRVGMDFGFVESYNAVVRVA
FT                   VDHEKKYLYIYWEYYKNGLTDDKTAEELKEFAETKELIKADSAEPKTIRYFQQHGFNMV
FT                   GARKYQGSRLQYTKKIKRFRKIICSDRCENTIYELKPLAYATDKLGNIIEDEFTIDPHT
FT                   LSAIWYALDDYEVTDLKEESKGRPQRSRPGRR"
FT   regulatory      13052..13059
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        13065..14597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF51"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="InterPro:IPR016753"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45917"
FT                   /protein_id="BAA06934.1"
FT                   /translation="MSKKSVKARVIKASPPTESTKQIYEDEFADSYDSNILPPPYNLKE
FT                   LKMIAEYSTILQQCVDAYRTNIVGFGFDFEYSFDVNSPDVTNEEKTEAESEWTKLEEFV
FT                   KYLHFDESAETLLGFVIEDREKTGNGFIEVIRNGENKPAGIEYMDVQNVRVCKLSEPIE
FT                   VDFTYFEQGQMKSIKREKRFRKYVQMIDGRMVYFKEYGDPRTLNLETGQYDEQTPLEKR
FT                   ANEVVHFKIGSGIYGKPRWIGHIVNLYGARKAEELNFMYFKQGRHIPAAITIENGMLSE
FT                   DSYTQLQDYMNGLEGVENAHKFLLLEAEGIAKGKNIHGDEEIAPVKVDIKSLAEILQED
FT                   ALFLEYDQKNRDKIRSAFRLPPLYTGEAQDYNRATADTARKITEEQVFQPERKLITGKL
FT                   NALFLNDLEIHKVRLQLKGPDFRDPLEIAKVLTPFITAGAVSPNDLRDLAGRVLGKTLE
FT                   EWPEEEYNRPLGKTNESSVSDPLAALFKSKNGTPNMIGLLKDMRDVLEDLKR"
FT   regulatory      14579..14583
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        14594..15511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF66"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45918"
FT                   /protein_id="BAA06935.1"
FT                   /translation="MNKTDKLLESLNVFIQKAEENQYKQLGEMVPDFPGKSNIPKYVEE
FT                   YEKGIARLLRRQHKKFLDGLKGFVSKDSEETLKALLVFFTQNLFAEDDFEEEFQELTEG
FT                   FLQQTIEEMAEVIMDSIDPEVPFKVLSNRTINWIKDWSKKLAEIMKLNTHEVVEDVLTN
FT                   AIENGSSIQDIELTLKDMPQFDRERARTTAITEVLAASSAAQHESYAQSPAVKKKKWRH
FT                   SGGKKNNPRENHIDLDGTVIGVDEEFQIPGSSETCMFPRDPKLSTRERVNCHCVLSPVV
FT                   DSKILGLSPEEKEEIQREVLANME"
FT   regulatory      15543..15546
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        15552..16205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF84"
FT                   /db_xref="GOA:P45919"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45919"
FT                   /protein_id="BAA06936.1"
FT                   /translation="MNWMEFISSIVKSIIWPVAIIILVFKLKQPVSNLISTLAKIKYKD
FT                   WEFEFTIDQKLDKISFQLNKENQYGTDDQNLKDSLNLESNSEITEETHSHYNEKTSIKG
FT                   DNDLLLKMEMIRLYGAVKNLYEKVSEKDDAADKSQGIGMLYMVDYLKRHKILNDSFAES
FT                   LLDIMNIVHDLEKSHISQSYIMNKFFWNVDKSVKRLMEITSNYVAENTAGETSN"
FT   regulatory      16223..16232
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        16238..17206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF52"
FT                   /db_xref="GOA:P45920"
FT                   /db_xref="InterPro:IPR027924"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45920"
FT                   /protein_id="BAA06937.1"
FT                   /translation="MPRELVNAKITHVSYVDKAANQKQFFIVKSEKQPDFQKEVRILAK
FT                   EADEQKLVYGIVYDPDTVDAHGDFMTAAEIEKAAHGFLKDARQIDKQHDFQGGVGEVVE
FT                   SYVAPADFEMNGETIKKGSWVLVTKASEEVWEQIKKGEITGYSMAGTAETIEKQEKPVS
FT                   QEKTDEKGLFNLLKNFFVGKQQQSYEEPVAKAGRKFSASNLQEIKNAHAALGNLLSQVE
FT                   TKEGEEEMTSEEVTKSIQEALEPIKKRLETLEKEEELNKKDKEKEEETEKEGEKLKKAI
FT                   SEAVQPLADRIEAIEKSRGTSKQTEESGSEQVQKSIWSGLF"
FT   regulatory      17212..17218
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        17225..18160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF53"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45921"
FT                   /protein_id="BAA06938.1"
FT                   /translation="MRNQEVINKAEMTLSTLESGGIMNPTQASTFIRMVQDTPTILRDA
FT                   RVIQMDHDTQKIEKIGFGQRILRAAQEGVALTKDQKSVPSTSTVNLSTKEVIAEVNITY
FT                   DTLENNIEKDGLQNTIMQMIADRAAVDIEELLVNGDTSSSDSYLAQLDGIRKQATSHIV
FT                   DAAGEELTRQTFKRGYKAVPPKYLRIPQEFRFYTSPGIEVEWKDRVADRQTNLGDAAVQ
FT                   GGLSSAFGVPIKGIANLQPYTIGEGDTAADVSDIILTHPKNIILGFSRNIRIEVDKDIR
FT                   RRMFIIVLTAKLDSVFEEEDAVAKIVKVKE"
FT   regulatory      18159..18165
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        18171..18482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF77"
FT                   /db_xref="InterPro:IPR027926"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR036840"
FT                   /db_xref="PDB:2HJQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45922"
FT                   /protein_id="BAA06939.1"
FT                   /translation="MFTAKLIKGKTYNVMGITFRAGVSQTVPKKLYEYLNENPYFILTQ
FT                   ELNNQKDDPINYTESELKGMNKAEHESIISNLGRNPSDFKNADERIAYILKQIDNKGE"
FT   regulatory      18471..18477
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        18486..18881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF76"
FT                   /db_xref="InterPro:IPR013514"
FT                   /db_xref="InterPro:IPR036558"
FT                   /db_xref="PDB:1XN8"
FT                   /db_xref="PDB:1ZTS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45923"
FT                   /protein_id="BAA06940.1"
FT                   /translation="MLLITPDELKSYSVFESVKTRPDELLKQDILEATADIILKVGHDF
FT                   SDAEYIPLPETVRLALLKLSQFYALINGDESIIKGYTTEKIGDYSYTLGDGSPLQKPDV
FT                   YALIKDYVKPADPDLEGIEAKVRMRSI"
FT   regulatory      19222..19230
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19237..19740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF67"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45925"
FT                   /protein_id="BAA06941.1"
FT                   /translation="MKIRGLDQFIQSLDRASRGGLKRKYEQWLESMGFEFLDIIQDEII
FT                   RTKTVDTRRLLNSFQKGDQDNIFSMTEGSLKLDVGTNLDYASYVNDGHFTIDPSKNQDR
FT                   RWVPGRWKGDRFEYDPAEKNSGMLLKFRWVDGSGFWDNAMAIFQLMFERSLERKLQQWI
FT                   YEEF"
FT   regulatory      19739..19747
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19753..20190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF68"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45926"
FT                   /protein_id="BAA06942.1"
FT                   /translation="MNQEVGSIMGYLYKLYPVQVYEEEIPQDFSVPSLYFPPASTVDGV
FT                   DTVSTFQKAYVLNVKLFHENVQKAHNEAERIADTLRSRRGIIPLIQDSGEDTGDFIRLS
FT                   RIETRVSDDYATIVLNWTSRYWYEREDQRSIDGFKFKSGVK"
FT   regulatory      20363..20371
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        20379..21059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF69"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="InterPro:IPR035326"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45927"
FT                   /protein_id="BAA06943.1"
FT                   /translation="MNGGTFTPGKEKERAGIYFNFKTTAENRVSAGERGTVALPIASSW
FT                   GEVKKFISISSIEDLNKKVGLNIDDPSLLLLREAMKKANTVLLYRLTEGLRASADISEG
FT                   VKATALYGGTKGNDIIISITENVIDSSKVDVTTYLDQSEVDKQTVSKAEELKPNKYVTF
FT                   TGKGDLTVTIPLTGTPLKMLAVLSLQLPESACQAEQTKHRQMPIIQLSWKRLKRNTLTQ
FT                   SLYL"
FT   regulatory      21360..21367
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        21373..21777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF70"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="InterPro:IPR035326"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45927"
FT                   /protein_id="BAA06944.1"
FT                   /translation="MFTYDSRDKSVSVEKDINSLTSLTAEKNKMFQKNKIVRVLDAINN
FT                   DLTSQLKALIKSRKASGSDVPATNDGLQFVKTLITQYLSVLQDNEGITDFDSENDITIA
FT                   LNNDRDGFLIDLAVQPVDAAEKFYFNVEVK"
FT   regulatory      21766..21772
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        21780..22223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF71"
FT                   /db_xref="InterPro:IPR018989"
FT                   /db_xref="InterPro:IPR038628"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45929"
FT                   /protein_id="BAA06945.1"
FT                   /translation="MALKAQNTISGKEGRLFLDGEEMAHIKTFEANVEKNKSEVNIMGR
FT                   RMTGHKTTGANGTGTATFYKVTSQFVLIMMDYVKKGSDPYFTLQAVLDDASSGRGTERV
FT                   TLYDVNFDSPKIAGLDVDSEALEEEVPFTFEDFDVPEQLKSTF"
FT   regulatory      23255..23261
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        23271..23720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF55"
FT                   /db_xref="InterPro:IPR014986"
FT                   /db_xref="InterPro:IPR038559"
FT                   /db_xref="PDB:3KLU"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45930"
FT                   /protein_id="BAA06946.1"
FT                   /translation="MSENQNEKVYDLSFFMPGQTIDAEEVEVPISKRFVDKEGNVVPFI
FT                   FKAITTDRIDELEKENTTYKNVKGRGRVKELDSQRFYARIAVETTVYPTFKAKELREAY
FT                   KTEDPVEVAKRVLSVGGEYANWLNKAIEINGFDDDLEDLEEAAKN"
FT   regulatory      23883..23893
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        23902..28659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF54"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45931"
FT                   /protein_id="BAA06947.1"
FT                   /translation="MAKLTATFELHDKISRKLRMIQGNAERLKRAANGPLIFEAEDRTE
FT                   RVMRQIDRSANRLTARARLLEMGLDDRVSNGLHSIRQQAEDLTEGSHEVTVSVNDQATP
FT                   RFRLIRGGLTDLNSSHAEPTVSVRDHASNQLDEIRRHVTDVDSEHAEPTVSIKDRASAA
FT                   LDAIEAKIDSLKGATITLAVAGGFPAGSIMGSGKSTMSQDAYVSATSNVNKKDVAKMTD
FT                   QIYFNNKAGSSREEVSLSLRNLSQQTGASKKALAELTESSSKIAQLMNADQAEVDRAFS
FT                   SMYNNLKLSGKQSGDLIAYVYRNAGDQADDLLDTMNEYSSTFKDLKLTGGQIANAMIKG
FT                   TKGGARNFDNLADSMREFNIRRTEMSDSQVDAFKTLFGAKETKKMFKGFKDGSISGEES
FT                   LFRVAKALSKVKDKTKRAAIATELIGTQYEDLKQPILDMAEGIGTSAKTSGELERSFTK
FT                   LRDNNPMTPVNDAMRDFESISKDMGTSLLTGLGPAFDKISSFINSKEGQEKLKEIKKDI
FT                   ADLGEEIGDKLNVAIEWSVNHWDDLKTAIKVVIPSLIGLIGYLKILRPLLKGIGTVGSD
FT                   AAGVIRKLIPKRTPKAGTNTQSERRNRNSNRNASTRGRESKTATGPTSLPRSGSLTYCC
FT                   CSDGGKNDRIRRRRGKRVLGRRGNPNRMNPSDSSIAVSSERLERRRSGRTVGTNPTRDS
FT                   RSAIITTRSELYSAGRAAGGTSKFGKVLSPLKSVGKFAKGVPLLGTALAATDLIGMNKD
FT                   NVGEKIGSAGGGLAGAATGAAIGSVIPGVGTAIGGLVGGIAGTMGGSSLGKAFDGSEVK
FT                   KKLNSTLFDQKWWSEKWSGIKSNAKTSINGLSDTWSNVKEKVKSTLFNSEWWSEKWSGV
FT                   KSWAQNKWNSASPVWESVKGKIKSTLFSEKWWSGKWEGVKSWAQSKWDSASSVWQSVKG
FT                   KLKSTLFSEKWWSGKWESVKSWSKNKWDNAKSIWKSVKSSISETLFSKKWWSEKWQSVK
FT                   ELGSSILGGVKEVGGKVASSAKKTAGKAWGYVKSGVNYLFGSGKEKPKKHATGGYITKP
FT                   TISWIGEAGKEFVIPVENNKGRGKMLLSQAASKLGMSVVDDIASASSAGGEPATSPLVR
FT                   SAAVTASVSPIIDTSSLDEQATSFGQQFTKSFDQGIRDNVVSMEAWKQKNVGQPMNNLI
FT                   SYSPNYGKQVVNGYAKGQNSTSTGTDGFLQTKVKMPFQNTVNKSSSWGSGTIKGFASGQ
FT                   NSSQTGTDQYVSTHINKPFIRSKESSNGWGSGMIGNFVSGMTSKASEVNEAAKELAKKV
FT                   EKAFREELDIHSPSRVMMSLGRFASIGIVKGLDSVDVKKFAEKQAGSLAAAYSGMGAVS
FT                   GNVKQWLMAAIMATKTPMSWLPGLMTIAQHESGGNPKAINLWDSNAKAGHPSQGLMQTI
FT                   PSTFNAHKLPGMNNILNPIHNAAAAIGYIKSRYGSINNVPGIRSMRHGGPYVGYANGGL
FT                   ITKEQIARVGEGNKREWIIPEERGIRGRYLLAQAAKALGMEVTDPSEKGQTELSSGQVT
FT                   AATTGRNQTTFKAAGGKEVIIQFNGDQHFHNDQDMNSLVAKIKQALVDELEQDINIGTK
FT                   GVVAFD"
FT   regulatory      28635..28642
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28652..29311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF85"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45932"
FT                   /protein_id="BAA06948.1"
FT                   /translation="MTKSIYEFWISQGKDKLRLPVLPEQIDISNTIQNESVKVASFGEI
FT                   TFIDKPGAKEISFSSFFPKKHSPLAEYKGFPSPENAIAKIEKWVKSKKPVQFLITGTKI
FT                   NLTCSIEVFSYTEGQKDIGDRDYEIKLKEYKTASPRKIKQKKKTKKKRPSKSAPKTYTV
FT                   KKGDTLWDLAGKFYGDSTKWRKIWKVNKKAMIKRSKRNIRQPGHWIFPGQKLKIPQ"
FT   regulatory      29314..29320
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        29324..30304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF86"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45950"
FT                   /protein_id="BAA06949.1"
FT                   /translation="MIELFVIKETEWLELVTESVSLEGQRYQAPRSITAKIITKQGTHS
FT                   YYSVSEGDTVLFKWKGKELFRGIVFSRNPEEHWMTFTAYDMLQYLVKNKDVYVFSNQRA
FT                   DEIIKRLARDFQIPTTSIANTGYTIKSLVFKDDTSLYDMILKALKQTKSQTGRNYQLYS
FT                   AKGKLGLRAWPDLSEVWVLETGVNITGYQYSTSINDTATKVKLRRQKDNKTYTATASDS
FT                   SGISKYGVLQYVETVSDNINQAQLQERAKVKQAQKKGVKKELKSIQAIGIPDLQSGLPI
FT                   YISIPEVGVKKTYWIDTDKHEFKGSTHTMTIDVVEKNSIPDGVSS"
FT   regulatory      30287..30293
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        30301..30564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF87"
FT                   /db_xref="InterPro:IPR022555"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45933"
FT                   /protein_id="BAA06950.1"
FT                   /translation="MRLSEAIKHLAVRAVDSESPVDILPAEVVSVSPVEIRLNENDKLI
FT                   IPADLIIVPKRLRAGEEALNTGERVMIVSLKGGQSFFILDKI"
FT   regulatory      30563..30570
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        30577..31002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF88"
FT                   /db_xref="InterPro:IPR020288"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45934"
FT                   /protein_id="BAA06951.1"
FT                   /translation="MALSPEIEFEDIEDDSEVIETSQTYKIDFENGRITNEIITGLEAI
FT                   KQFVYLSLHTERYAYSVYSHDIGNELQDVLADNETTDAYKKMEIPRLIEEALIYDDRIS
FT                   AVTDFEIEKQGESFRVSFTVETDEGTLEIEEVLGEDV"
FT   regulatory      30977..30984
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        30995..32041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF89"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45935"
FT                   /protein_id="BAA06952.1"
FT                   /translation="MFEDQTYESIMDRMLNSISADIDKREGSVIYNALAPVAAELAKSY
FT                   IWLDTVLELVFSDTAQGEFLDRRATEAGIERTAATKAVRAGEFTEGVTIPVGSRFYVDN
FT                   LYFQYTADGTLECETAGEAGNANISGQNLLSLDTIPGLQKAIVKEILIPGREEEDDDSL
FT                   RARYFTRVRREAVSANKAHYKQWAEEVDGVGKVKVFPLWNGDGTVKIVVTNANLEPASD
FT                   ILISKVKNYIDPEPGQGEGQAPIGAFVTVESAVWKEVEISAEVLPEVNSSIDQVKQEIE
FT                   SGVLNLFKKIAFEDNVIRLSQINNIVYNSPSVSDYADIKINGVAENLVLSAVEIPKLGQ
FT                   VNIIEQTR"
FT   regulatory      32010..32018
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        32025..32603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF123"
FT                   /db_xref="InterPro:IPR018755"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45936"
FT                   /protein_id="BAA06953.1"
FT                   /translation="MSKLDEMTAYLPPFLTKLKEMAELLKAEAPEFEKQNNSIFDLTDQ
FT                   LFVTTATWGLERWEKILNVPRESGDTDEIRRLRLISKMSNIPPATYRAIEHALNRFLKN
FT                   PSAQVRLLPGEYRFKVDIDIDDMQHMSELIETLENMKPAHLAYTLRAALNEPLQIKDTV
FT                   ILNYRRYRKASELKVGYSVTLNNNEVVLV"
FT   regulatory      32587..32593
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        32600..32872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF130"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45937"
FT                   /protein_id="BAA06954.1"
FT                   /translation="MITQLYRERTAADLKNRISKVLLNGNETEIVELTIQGAVVTVLTQ
FT                   REEDIKHIKSVQILDDQNNVITERTTDLDVSNNRTLDFRITFEVV"
FT   regulatory      32862..32868
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        32875..33975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF131"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45938"
FT                   /protein_id="BAA06955.1"
FT                   /translation="MAYDAKTDWLPDDPINEDDVNRWEKGIQDAHKDLAVHKNDMNNPH
FT                   NTTKAQIGLGNVDNVQQASKKEFEEHRNDLQRHITPVERENWNAKETIVGAQEKADKAL
FT                   SDAKYYVDTNYKNNNLTLITGDNAIQDARPGGEEYPLGLTLMDIGQGNTTGYPLGYGIV
FT                   KNEKYNNYRSLNTFTEQGMSLGLTMTVQEFGLDTGGVVHGWTPWQKISGFAHANIGTTG
FT                   VQYLKKIDHTKIAFNRVIKDSHNAFDTKNNRFIAPNDGMYLIGASIYTLNYTSYINFHL
FT                   KVYLNGKAYKTLHHVRGDFQEKDNGMNLGLNGNATVPMNKGDYVEIWCYCNYGGDETLK
FT                   RAVDDKNGVFNFFDIQELGGRNYPRF"
FT   regulatory      33974..33980
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        33985..34320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF129"
FT                   /db_xref="InterPro:IPR019094"
FT                   /db_xref="InterPro:IPR035950"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45939"
FT                   /protein_id="BAA06956.1"
FT                   /translation="MNIGEAILFKYPTADPTKDFIVQNNGDGTPSYIAEWNIRAPIPTE
FT                   AELKTWWEELQSTSAYEPPVQVDLLARELSQEKLARKQLEELNQTLGSELSKIKLQLLT
FT                   LQGGQGS"
FT   regulatory      34301..34307
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        34317..34481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF128"
FT                   /db_xref="InterPro:IPR010022"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45940"
FT                   /protein_id="BAA06957.1"
FT                   /translation="MNYWVLALHYNWASSEMVKQAIHLKDCSPEDLQEGIEKKLITAEQ
FT                   YKEITGEAI"
FT   regulatory      34555..34561
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        34569..35462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF122"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24810"
FT                   /protein_id="BAA06958.1"
FT                   /translation="MASYSFQFSTDATGKPGAAKPYREGNRDFVVPVASISGNSELLTN
FT                   AVLKATEVYTQYGQDRLGQVLISKVKGHAYSDREGTLFIEESNDMNSWTTISSLVVKAN
FT                   TLGETEWIHLTKRYFRFRYANGNLQQSEFLLYQSLGAGEEDININHTVPITAVAPFSVQ
FT                   LDKSGLTNDGRLKVQTEGLNLSSLDTQSKTMDIVFHDKTETIGEGNPFTVGSFKTLLIE
FT                   VYGTAETSELKFWGKSLSGTKRALRGQKVDDGTFATSTKGKSEAWSFSITGFKEIVMEL
FT                   TALTNGNFSVRGTAVS"
FT   regulatory      35493..35502
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        35507..35929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF121"
FT                   /db_xref="GOA:P24811"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24811"
FT                   /protein_id="BAA06959.1"
FT                   /translation="MEETSLFINFETLDLARVYLFGGVKYLDLLLVLSIIDVLTGVIKA
FT                   WKFKKLRSRSAWFGYVRKLLNFFAVILANVIDTVLNLNGVLTFGTVLFYIANEGLSITE
FT                   NLAQIGVKIPSSITDRLQTIENEKEQSKNNADKAAG"
FT   regulatory      35957..35964
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        35974..36792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlA"
FT                   /product="cell wall lytic enzyme (autolysin)"
FT                   /db_xref="GOA:P24808"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24808"
FT                   /protein_id="BAA06960.1"
FT                   /translation="MAIKVVKNLVSKSKYGLKCPNPMKAEYITIHNTANDASAANEISY
FT                   MKNNSSSTSFHFAVDDKQVIQGIPTNRNAWHTGDGTNGTGNRKSIGVEICYSKSGGVRY
FT                   KAAEKLAIKFVAQLLKERGWGIDRVRKHQDWNGKYCPHRILSEGRWIQVKTAIEAELKK
FT                   LGGKTNSSKASVAKKKTTNTSSKKTSYALPSGIFKVKSPMMRGEKVTQIQKALAALYFY
FT                   PDKGAKNNGIDGVYGPKTADAIRRFQSMYGLTQDGIYGPKTKAKLEALLK"
FT   regulatory      36801..36827
FT                   /regulatory_class="terminator"
FT   regulatory      36940..36946
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        36957..37436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF120"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24812"
FT                   /protein_id="BAA06961.1"
FT                   /translation="MFKKLLLATSALTFSLSLVLPLDGHAKAQEVTLQAQQEVTYQTPV
FT                   KLSELPTNTTEQSGEFHTNGIKKWIAKEAMKATASALRHGGRIVGEVVDELGGSAGKTF
FT                   AKHTDDVADALDELVKRGDVVEDAIIDTVSSYLIDAGVKSSTARTIASVFTFLAF"
FT   regulatory      37439..37446
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        37452..37814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF119"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24809"
FT                   /protein_id="BAA06962.1"
FT                   /translation="MVTVEERLDNLEKKVEKQAFQLRLVQQLAADYDRFGLFDQVLAYD
FT                   LSEKQYQELRELTSQYTDKIKNGEEVSLHNFTEEFKRILKDIEKEVDFEKFISLWLKGP
FT                   EEGFGFSKALHNHFFN"
FT   CDS_pept        complement(38075..38653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF95"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45941"
FT                   /protein_id="BAA06963.1"
FT                   /translation="MGVTQENKVIARTVLGAFGGKPKVTKYWDDNKNSSIDILSVSDQP
FT                   QEGITSYSTLGLSDHSINYEVNGTPLRIEIVAAMESASDIYANVLSTCAFNIINSNFTC
FT                   APGVIFKNVISMYDQETDMKHIMFVPPFLWEEDLELLEFSNKNVTWLMALPISEGELQV
FT                   AEKHGSDYLQDLLESKQIDIFDIKRESVV"
FT   regulatory      complement(38664..38669)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(38668..40263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF94"
FT                   /db_xref="GOA:P45942"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="InterPro:IPR026835"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45942"
FT                   /protein_id="BAA06964.1"
FT                   /translation="MKVFEAKTLLTEAEKRAQEYKDLKSKMVKLKKAFKAVADLDDSEF
FT                   SGKGANNIKSFYEDQAGIADQWIDLIEMKISFLTSIPGFLEDANLSDAYIEETFLAHEL
FT                   ANAYTKSKSIMSEQKKAMKDILNDINDILPLDLFSTETFKNELSSAEKKRKEAIEKMDE
FT                   VDQNLTSEYGLSEANEQMIQADYQALMNATAKGKSASPIHYNAKAYRDSEIHKMTEDVK
FT                   KQSTDYISFKDQQAEQRRIAKEQEELANRPWYEKSWDAVCNFTGEVSGYYDYKRAADGV
FT                   DPVTGEKLTAGQRVAAGAMAAAGYIPIVGWAGKLAKGGKAVYSTSKALYRADKALDVYK
FT                   TPKTFHALQNSSKGLYGLASANGFSEAITGRDMFGNKVSKERQEQSLSGAMAMLVPFGA
FT                   RGINKKLNAKSSSRVSEASTNTSKKPKVPKTYKRPTYFRKGVRDKVWENAKDSTGSVKD
FT                   PLTKQVMKKDEPWDMGHKPGYEFRKHQQSAMERNISRKQFLDEHNNPDHYQPELPSSNR
FT                   SHKGEDMTDDYFGD"
FT   regulatory      complement(40271..40277)
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(41025..42152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF5"
FT                   /note="similarity to GsiAA protein"
FT                   /db_xref="GOA:P45943"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45943"
FT                   /protein_id="BAA06965.1"
FT                   /translation="MISITSAEVGMKINEWHRHIQKFNVTDAEMLKAEIERDIEVMEED
FT                   QDLLIYYQLMAFRHKIMLEYTLPSDENRMELSEYLNKIEGHKKKLDNMRAYYYNFFRGM
FT                   YEFRNGEYTRAITYYKKAERKIPTISDKIEKAEFYFKLSEVYYHMKMTHISMHYAELSY
FT                   NIYKKHELYSVRRIQCHFVIAGNYDDLENHEKALPHLQEALKGAELLKSKNTHIYATAF
FT                   FNLGNCYHKMDNLNKAARYIEQALVQYRKINSDVLPQAYHDLALIYFKQGKKGQAMDCF
FT                   RKGIRSAVDFKDELFMNLFEALDVLYIRNGDTPKLLNIFSRLENGKGYPYLEELALLGG
FT                   NLFDYNGKIEDSIICFKKMVYAQKQISKGECMYEI"
FT   regulatory      complement(42158..42170)
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      42583..42589
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        42596..43360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF4"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45944"
FT                   /protein_id="BAA06966.1"
FT                   /translation="MTELYAKSDLEKIKETLPGWQLDSFNYLNEKIGDKENKFPCIPGR
FT                   QAFLSDQLRIAFVGDPRNPETAKELAPLLTRYGTISRETGKYASLTVIFHTPEELLTDY
FT                   KIEDYESLFWQLLNSLSMEDPADWPDDIPENPDNFQWEYCFNGEPYFVLCATPAHSKRK
FT                   SRSFPYFMLTFQPRWVFEDLNDTTAFGRNMSKQIRKRLEAYDEVPIHPHLGWYGKKDNL
FT                   EWKQYFLRDDENQVSQCPFMKMKNLFKKERSD"
FT   regulatory      43366..43423
FT                   /regulatory_class="terminator"
FT   regulatory      43716..43727
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        43732..44049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF3"
FT                   /note="similarity to arsenical resistance operon regulatory
FT                   protein (ArsR) of S. aureus plasmid pI258"
FT                   /db_xref="GOA:P45949"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45949"
FT                   /protein_id="BAA06967.1"
FT                   /translation="MDETKSELLRKYEQKFKALADQKRLEIMYELCQRGKTCVCDLTEI
FT                   FEVTQSKLSYHLKILLDANLITKETKGTWSYYDLNDEEVNGLLSEELCCIFRKKGEGDC
FT                   C"
FT   regulatory      44095..44101
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        44110..44550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF2"
FT                   /db_xref="GOA:P45945"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45945"
FT                   /protein_id="BAA06968.1"
FT                   /translation="MKYVHVGVNVVSLEKSINFYEKVFGVKAVKVKTDYAKFLLETPGL
FT                   NFTLNVADEVKGNQVNHFGFQVDSLEEVLKHKKRLEKEGFFAREEMDTTCCYAVQDKFW
FT                   ITDPDGNEWEFSYTKSNSEVQKQDSSSCCVTPPSDITTNSCC"
FT   regulatory      44555..44564
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        44573..45613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF1"
FT                   /note="similarity to arsenic efflux pump protein (ArsB) of
FT                   S. aureus plasmid pI258"
FT                   /db_xref="GOA:P45946"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45946"
FT                   /protein_id="BAA06969.1"
FT                   /translation="MKRLSFLDRYLTIWIFLAMALGIGLGFIFPSFVGGLNKLQVGTTS
FT                   IPLAIGLVLMMYPPLAKVRYEEIGRVFKDIKVLILSLVQNWIIGPTLMFILAIIFLPDK
FT                   PEYMIGLIMIGLARCIAMVIVWNDLSKGDTEYAAGLVAFNSIFQMLFSSVYAYIFVTVI
FT                   PQWLGMEGAVVNITMAEVAKSVFIYLGVPFIAGMVTRYIFVKVKGKEWYEKVFIPKISP
FT                   ITLIALLFTIIVMFSLKGDVIVSLPLDVVRVAIPLLIYFVLMFFVSFFLGKKIGANYAV
FT                   TTTLAFTAGSNNFELAIAVAVGVFGIHSGAAFAAVIGPLVEVPVMIALVKVALWFQRKY
FT                   FGSHSM"
FT   regulatory      45611..45619
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        45625..46044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="ORF109"
FT                   /note="similarity to arsenate reductase (ArsC) of S. aureus
FT                   plasmid pI258"
FT                   /db_xref="GOA:P45947"
FT                   /db_xref="InterPro:IPR014064"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="PDB:1JL3"
FT                   /db_xref="PDB:1Z2D"
FT                   /db_xref="PDB:1Z2E"
FT                   /db_xref="PDB:2IPA"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45947"
FT                   /protein_id="BAA06970.1"
FT                   /translation="MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLN
FT                   PNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFD
FT                   DPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK"
FT   regulatory      46477..46487
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        46493..47995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIVCA"
FT                   /product="site-specific recombinase"
FT                   /db_xref="GOA:P17867"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17867"
FT                   /protein_id="BAA06971.1"
FT                   /translation="MIAIYVRVSTEEQAIKGSSIDSQIEACIKKAGTKDVLKYADEGFS
FT                   GELLERPALNRLREDASKGLISQVICYDPDRLSRKLMNQLIIDDELRKRNIPLIFVNGE
FT                   YANSPEGQLFFAMRGAISEFEKAKIKERTSSGRLQKMKKGMIIKDSKLYGYKFVKEKRT
FT                   LEILEEEAKIIRMIFNYFTDHKSPFFGRVNGIALHLTQMGVKTKKGAKVWHRQVVRQIL
FT                   MNSSYKGEHRQYKYDTEGSYVSKQAGNKSIIKIRPEEEQITVTIPAIVPAEQWDYAQEL
FT                   LGQSKRKHLSISPHNYLLSGLVRCGKCGNTMTGKKRKSHGKDYYVYTCRKNYSGAKDRG
FT                   CGKEMSENKLNRHVWGEIFKFITNPQKYVSFKEAEQSNHLSDELELIEKEIEKTKKGRK
FT                   RLLTLISLSDDDDLDIDEIKAQIIELQKKQNQLTEKCNRIQSKMKVLDDTSSSENALKR
FT                   AIDYFQSIGADNLTLEDKKTIVNFIVKEVTIVDSDTIYIETY"
FT   CDS_pept        complement(47903..>48032)
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /gene="spoIVCB"
FT                   /product="RNA polymerase sigma factor K"
FT                   /db_xref="UniProtKB/TrEMBL:Q45625"
FT                   /protein_id="BAA06972.1"
FT                   /translation="IVITKGGCIHPSLIRFNIYGVRIHNGNFFHDKVNNCFFIFKS"
XX
SQ   Sequence 48032 BP; 15869 A; 8192 C; 10469 G; 13502 T; 0 other;
     tcattattca ttacaaaaag ggggggcata aatttcccgt aacagtttga ctaaataaat        60
     gttgagtcag tttcctgtaa taaatgctta aacgtttctt agcgaatgaa ggggatacct       120
     taaataacca agctacattt tcaattgcat gtgattgtat gtacggaagg ttgatattac       180
     gcaacatgca agttggaatg caaaagtgat atgtaaaata attggactgc caatccaaat       240
     aatcagtcca agttgcaggc attgtttttt tatcgccttc atgtctatat atatggcaaa       300
     attcatgagc aaaatcatac cattgttcag ttcggctttt acggctgtcc aagcatatat       360
     tataaattcc gctgtgttta agtgcgaagc ttgtaacagg tttaaacgaa agcctgatat       420
     ctaaagcctc ggcaatccgt tcaaaattaa tttgttctgg ttctgtaata tcaatcttct       480
     tgtataagtt ttcaatccaa tcctctaaat gactgtttgt atacctcaag atgaaaaacc       540
     tccttaaaga cgacaatcta aaaattggat tcgtttaaat attatatgga aatcaagact       600
     tttttcatag gaaaatgcgt ctaaggagat ggaatatgaa tccgtttaat catgactgtt       660
     ttcgtaagta ttatgatttt aacacgcatc tggatttccc tcgaaaagta aaggtctttt       720
     agggatttat gtcaaaataa tagtaagtac gttatgcaac aaacagggag tttggttgct       780
     taataaggag gggaagtatg aaaaaaaata ttcacatatt gggagcctct ggtgtcggaa       840
     cttcaacatt gggtgctgca ttatcaaagc gtttgcctca tacgcatctt gatactgata       900
     attactattg gttagacaaa ttcactaaaa aaagagaaat tcctgaaaga agaaagttgc       960
     ttgaaaaaga cttaacaatc aatgaaaaat ggattctttc tggtgcagtg tgtggctggg      1020
     gcgataatct aaaaagttat tttgaccttg tcgtcttctt atggattcca caagatatac      1080
     ggcttgagag actaaggcac agggaatttc agcgttatgg aaacgaagtg ttagccggtg      1140
     gcagtaaata tgaacaatca aaaacatttt tagagtgggc ttctttatat gataatgctg      1200
     gaatggaagt tagaagtaga gctttgcatg aacattggat ggcagattta tcttgtccag      1260
     tgttaaagat tgaagacgac tgctcagtca atgaaagagt tgaccgtgtc ttggattatc      1320
     tgagttctaa ttaaactaac ggatagcaat agctgcatca gaaaataaat ccaaaaatca      1380
     aagacagttc cagtatggca tttaatgagc tgttttttta ataccgctat caatttgcct      1440
     actatttttg gtagcatccc cacaacagag aagagattgt ccttcataag gaagtttttg      1500
     gatcagttgc aggaaatgga acctcaacga ttagatacat cctaaaacct gtccagctag      1560
     tgcttatgtt ggttaccatt gagtgaaaag cacttgccga tccttttttg ttggtgtaat      1620
     cattagtgaa ttattacaat tgcaaatgat aggggcaagg gaataaatgg acttcaaagg      1680
     agtttaatca tgaaaaataa tgataagaag aaagaggttc aaaggaaata cagagaagag      1740
     attaaaaaaa agaaacaaaa gaatgaagat aataaaaatt ttattaaaga aacaattatt      1800
     gttgttacga taattgtatt gtttattttt ttcacataca ctttgcaagg tttttaacaa      1860
     gaagccctct tttcccattt cgatactctg caatttccct cacaataaac gctcaatttt      1920
     tttacatgag aatataaaag aaacataaat gaaaatataa atgagaaaaa caacaaaaac      1980
     ccttgtcacg taagggtttg taaaggattc aaaatcactt tttaaatgag ggtatgaatg      2040
     aaatataaat gagaatctaa atcttattag taaacagaat taaacataat aaacagaaat      2100
     aaataataat aaactaactg cgtttattta tctgatttcc gtctttcttt taattgctcc      2160
     gttataatct ccaaagcagc ctgtaagatc tcatctgtta cctcaccgtc ttttgctgca      2220
     aggaatgttt caggatcgtt taacactttt tttgcttcat cctgaaatac tttttcattg      2280
     ctttctcctt taagaagata atccaaagaa acatcaagta tgtttgaaat attaattaag      2340
     gttttatagt caggctcacg actacctagt tcataggcgg tgtaggcagg ccgagtaatt      2400
     ccaagtttat cagccatatt ttgttgggtt agtttctttt gttttctgca ctttttcaag      2460
     ttctcggaga acatattaat cacctgactt ttgtttttat tctatatctc attgtaacgt      2520
     aacaaagggt tacatataag ttttggtaac aaaacgatac tttttttatg aaaatgtgtt      2580
     gacaatgtaa cgaatcgata ctattatcta agtaacgaaa cgttacattt tctgattaag      2640
     ggggtgaaaa atgatgagaa aatggcttaa gaaaaaccgc ttagaaaaag ggtttactca      2700
     agaagaagtt gccaaagctg cacagattgg tagagcatac tacaccatga tagaaaatgg      2760
     tactaggaag cctagtgtta ttgtctcaaa aaaaatagga gagaaattag gctttgactg      2820
     gactattttt tttgaggatg tatgtaacga aacgaaacat aattctaagg attcagcatg      2880
     attagaattc acaaaggagg ccttttaatt atgaaagtca tcttgaaaaa aggaccactg      2940
     tttgaacagg cagaggccaa agcctacaaa tacctcagtg gcatacttgt tcagcgtatg      3000
     aatgaacacc aagagaagct tgcgcaaaaa aataaaaagg aatcagccta agtcatttat      3060
     aaacagcatg gtctttcaac ttcaatttta aaactaaaaa cctaatataa caggaggcaa      3120
     acatatggag aacaacccat acaatatgcg taatttaccg cagattatgc gtagtgcccg      3180
     taaggctgca ggtctttcac aataccaaat cggcaagtta atcggaggta aggatcaaag      3240
     gtatgtttca gatgttgaaa atggacttgc caagcttact ccagagttat gtattaaatg      3300
     gtttgagaag tgcgctgcct atgaacatat tgatcttgta cattacttat tcaaacttca      3360
     tcctacagcc gctgctccta ttgatccggc actcaatgaa tgtgcaagta atgcggtgat      3420
     taatatggtt caccaattgg aggaagcact gcaagcaacc aaacatttag cccgttggct      3480
     cacggataac cgaccaggta aaacagagga gctgccgatg gccgatatta agcagatttt      3540
     tgatttgatt gcggctaaca aaacattgat ttattcactt gttcgtactc acgggttgaa      3600
     aatgcaggaa cttgcagata gatggacgcg gaaagctcta gttgatcaag ttgctatggc      3660
     aaaacaagaa ggaaggcagg cggtttcagt atgaatacta atcatttctt gaaggcagat      3720
     gttcctatcg caaaaagaaa aatcgaatca gcagaagagc tatcaatcat gctgtcagag      3780
     gcattacgtg atggtgatta tgaagaagcg attagtcttg ctggaagcat caaggttctt      3840
     actgaggata ttagccggct tgcaaacaaa ggacgccttt atgaaacggc attgaaaatg      3900
     caacagcaag gtatcaactt aactgtagtg agcaggtgta taggatgatg gttcattttg      3960
     ttcataaacc ggcaactgct ctggaagttc gtaaatggtg tgtgatgatt cgtaacaata      4020
     gtgaattcca tctgttatgg gatagacgtg cagacaaatt cagagaggag aataagaatg      4080
     gtcgaaaatc caatggtcat aaacaactgg cacgataagc tgactgaaac ggatgtacaa      4140
     atagattttt acggtgatga agtaacacca gttgatgatt atgtaattga tggcggcgaa      4200
     atcattctca gagagaactt ggaaaggtat ctaagggagc aacttggttt tgaatttaaa      4260
     aacgcgcaat aaaaaagccc actcggcaaa gtggacttct ttaaaggcta tctaaaaaaa      4320
     ctcatgtgca aatattttat cagatagcct caataaaaac aatgggggtt aggtggaatg      4380
     acaagcaaac gggctgaggt tcttgctaag aattctgaaa tgagccgtga tgaatggctt      4440
     attgaaagaa gaaaaggaat tggcggctca gatgcatcca ttatcttggg gctgaacaag      4500
     tggaagacac cttttgaatt atggttagac aaaacaggac aggtccctgt tagtgaatcg      4560
     caaagtgaag ctgcttactt tggatcattg ctagaagata ttgttgcaaa agaatttgag      4620
     atacgtagtg gcaagaaggt tagacgtaaa aaagcaatac tcagacatcc agaatataat      4680
     ttcattttgg ctaatgttga tcgaatgatc gttggtgaaa aagcgatcct tgaatgtaaa      4740
     acaacatcag cctacaactt aaaagaatgg gaggacgaag aaatccccga gagctatatc      4800
     gttcaggtcc agcattatct gggtgtgctt ggacctgaat atcggaaagc ttattttgct      4860
     gtgctgattg gcgggaacaa atttgtctgg aaagagattg agcgagacga cgagttaatt      4920
     gacatgatct ttaaagcaga gattgagttc tggaatgaca aggtcttagg tggacaagct      4980
     cctgctttag atggttcaag tgctgcggag gaatacctca aaaaacgata tgccgaaacg      5040
     gaaaataaca aagctattga tttaactgcg gctaatcgag aacgtattca acaatacttg      5100
     cttattaaag aacagatctc agagcttcaa agccaggcaa aagaattaga gaaccaaatc      5160
     aaacatgaaa tgaaggatgc agagtatggg tttatcggta actatcaagc ttgctggaag      5220
     cctgttgtct caaatcgaat tgacacgaaa aagctcaaag accagtttcc ggatgtatac      5280
     gagaaagtta aaaaggaaac tcatttcaga cgttttggaa tcaaggaggt tagctgatta      5340
     tggctactaa tcaatcaatt aaaaacaaca tccaaaagaa acaaaaaaac gtacctgtgc      5400
     aacaacaagg agcaacaatg aaagggctac tttcctcacc atctgttatt aaacgatttg      5460
     aggaagtgtt agggaagagg gctacacagt ttactgcttc tatcttaagc ctttataaca      5520
     gcgagcagat gctacagaaa acagatccta tgagcgtcat atcctcagca atggtggcag      5580
     ctacactcga tttacctata gataaaaact tagggtatgc ctggattgtt ccttacggag      5640
     gtaaggctca atttcagctt ggatacaaag gatatatcca gctagcctta cgaacaggcc      5700
     aatataaatc catcaattgc ataccgattc atgaaggcga attgcagaag tggaatccgt      5760
     tgactgagga gatcgagatt gattttgaaa aacgagaatc agacgcggta attggttatg      5820
     cagcttattt tgagttgata aatggcttcc gaaaaacagt gtactggaca aaggcacaag      5880
     tagagaagca caaaaagaaa ttcagtaagt ctgattttgg atggaaaaat gactgggatg      5940
     cgatggctct taagactgta ttaaaagcag ttttgagcaa gtgggggatt ctctctgttg      6000
     aaatgcaaaa agcagttatt gaggaagatg aaacaaggga acggattgac attaccaatg      6060
     aggcagacag ttcagaaatt atcgattccg agccttcaaa caaagatgaa acggaaaaac      6120
     caagcgccca agaaaccgat ccttttgacg gcaagcctgt agatataaaa gacgatgaac      6180
     ttccgtttga ttgagccggc atctctgaca taactgcact ctgtgaaagg aagtaggtga      6240
     ttgacttgga cataaaagca atggggtatg tggtcatacc ccgactacca ttcaaagagt      6300
     ttagggatga aaaaatttat gatcacttgt tcaaaagagc tgaatacagg ccaaatcaag      6360
     agctagaact tgggcagacc attatcaaag ttgtggaact agcaaaagat tttaactggt      6420
     cagctgcaca gatcaaatac tcactagacc gaatggagaa acagggatat atcaaattgc      6480
     accgtcttcc acaaaaaaga gggctcatcg tcaccatact tcattatgca gactacatac      6540
     aactaggaaa ttacatgaag aacaaagctt tggaaccagc tcagattgaa catcaggagg      6600
     tcgatgacaa aatgaaaaat gcctttgagc tatatgaaaa caaagttgct cggtcagtcg      6660
     gcccgatgga ggcacagcgg atcggctaca tggtcgacga ttatggtgag gaaaaagtga      6720
     tggaggctat caagacagcg tttcaattaa aggggaaagc tgcaagtttg tcatatgttc      6780
     aagccatctt atcaaatcca ttcactcaaa agagaaagga gaaacaatat ggctataaac      6840
     aaagcagtca gtatagacac cgcatttcaa acgatcatgc aggaacttcg ggaaaggtca      6900
     gcccgctttt tgggaacaaa acaggccgta tcagaagaaa aggctgaatt tgattgtcct      6960
     tattgtaagg atcgtggaat tgtcgtttat cgagtccata aggacacttc ttggcattta      7020
     gatgaacagt tagaccttat ggttccggac gatatggtgt cggaagatga ttttctgtta      7080
     ggtaaggttt gtacgccgga taaagctagc gaatggaaag atacttattc aaaacagtgt      7140
     gaatgtgtaa gacgaaagaa aattgccaga ctcatggcag ctagtggcat tacagaagag      7200
     tttgaaaagc ttctctttgg taacttcata acggacggta agccagacat gatcaaggac      7260
     gcttatgagt gtgcagtgga atactataaa gattttcaaa agatcaaagg agaaaggcaa      7320
     aacagtatcg cattacttgg acagccaggt agcggtaaaa ctcatttgct cacggcgatt      7380
     atgaataatc tgatcaagaa aaaatcagta cactgcatgt atttccctta tgtagagggc      7440
     atgggtgatt tgaaagctaa ctttgataac ttagaagcaa aactcgatgc catgagaaag      7500
     gtcgaagttc tattcattga tgatttattt aaaccaataa acggtcaacc aagggcaaca      7560
     gactggcagg ttgaacaaat ccagtcagtc ttgaactacc ggtatttaaa tcacaaacct      7620
     ttgctgattt cttcggagtt aacaatcgat gagattttgg atatagacga ggctcttggt      7680
     tcacgaattc accagatgtg ccgtgattac atagtgatta ttagaggcga tcgaatgcaa      7740
     ttaaatcata ggttaggtga ttgggaatga aaaagaaaac gaatataaaa gcaactggtg      7800
     gactttatat atttggccct tcaaatcgaa atgaaggtaa agatcttaca ccaacaatcc      7860
     gtttacttga ggaaaaaata aagcaaatgg agcggatgct gagtgcttaa agcagtcgtg      7920
     tctctgctga taattttact ttctgcaccg agaatagaaa aagaaattaa gttatgggaa      7980
     cagcttgacg ggaggtaaag aacagttgga ttgcattaag ttcactgttt atggtgagcc      8040
     agtcgcacaa ggaaggccgc gtggatcaat acgaaatggg aaggtgcata tgcgtgatcc      8100
     agcgaaatca aagtatttca aacagtatgt ggcattggtt gcgtctcagc atcgaccaga      8160
     aacaattatt actggtcctg tctcaatgga tgtcaaagtg tacagaccaa tgcctaagtc      8220
     agtttcaaac tcaaaaaaga agaaagagaa agctgaaaag ggccttctgc ggccgactac      8280
     aaagcccgac gttgataatt atgtaaaggg cgtgaaagat gctttgaatc atctgatata      8340
     caaagatgat agtcaggttg tggatttgaa agtcagtaag ttttatagcg aagagccaag      8400
     ggtggaagtc atgataagag aggtttctgc ctaaaaataa aaaacaccga agcgcttagc      8460
     ctcagtgttc ttgatatgaa ctggtacttc tatcataaca tagggggcgc tttgagtgta      8520
     caatccaaga gaaataaaca tcaaaaaaga cttcactatt cagcagaaaa ttgacccagg      8580
     aaaagttcag atcattgttt tagatgggaa tcagggaact gcacatgttt tagatgctcc      8640
     ggagcacggc aaaacagtga ttcaaactgt aaagggcagc tttgcaaggg ttgatcatga      8700
     gatagggttt aaggtgaaat gagaagaaga tataatactt tataaaaagg taaacaagaa      8760
     ggaggatatc tcctccttcg gcttggatgt gcaggttatt cctgttcagg taaattgtca      8820
     gctaatgttt ctaataattg ttgaggctct tctaaattct tttggggttc aggaaaggct      8880
     tcaactgttt cagaaggtgc atctaaagat gggtggaatt gggtaccttc atggagtaat      8940
     tctgcaaaga ttttaaccga ttgttttata tgtcctattg attctgttga ataatttgct      9000
     ccttcagtaa cattttttat ttcggcatct gttattgtgt caataccctt ttcaattcca      9060
     tctagcaaag ctttggaagt ttcgacttgt agctttaatt gctcattttg aagagctagc      9120
     ttttcgatgt ttgccttagt aatgagtaat tcttgagatc gctttgaaat gtttatagct      9180
     gcatctataa gttgtccaac aaatattact gcagctgaac tgtttactaa gatgtcaatc      9240
     cacattgaac ctgtgtcaaa accctgtaat ttataatgtc cattaatttc ctcaagggta      9300
     ataccattct gaaatgcatt atttaatttt ttgatgaatt tttctagttc ttctaatgag      9360
     ttgtattgag ggagttttac gctaattacg ttctcatttt gatcagaaac tgactgatca      9420
     attaaaattc caaaaccacg taatttttct tttacaattt ttatatgatt agtaatttga      9480
     ttagcgatgt gattatccac ttcaatctta tcttcaggta cacgtgaata atatatactt      9540
     cctagatctt taaatctctc aatatcatca tctaaaaaac caagtttaga caactcgtta      9600
     attgcatcta aagacttttg taaattaaga acagtctttc tgttgctgtg cggtacgtgc      9660
     gaaacactaa ctccaatttg tttattataa ttgtcgagta aattttttat ttctctaact      9720
     ctcatataac aacctccact actttataat aaaattttac catatttaag gagggagttg      9780
     aatttttttc cttaggtaat gtgaattcat taaagcataa aatatccagt tagtccaaga      9840
     cggaaagcct gcggacactg aacttacagt attacgctgt atgtttggtg tccgttttta      9900
     ttttgaaaag gaggatactt tcatgaatcg aaaagaaatt gaaaatctaa tcaatagcta      9960
     tcactggatg gtgaaagagg ttcgtcgatt gcaaagggta ctctatggtt cagtaattcc     10020
     catgaagaat tggggtgttg ctcaatatgg attagaagct actatgccaa aaggaagtcc     10080
     tgggaagagt caggctgagc taaggcaaat ggatatgaga gaggaacgtc ttttcaaacg     10140
     tcttaagtat tatgaagagc gagtatatgc agttgaatta ggggctgaaa agatccatgg     10200
     tgagcagcat aaagtcattt atgattgcat gatggagggt atgagctacc gcgcaataag     10260
     tcttcacctt ggcatttcaa gggaaactgt acgcaaaatg aaagatgagt tcatcagcca     10320
     attatgccaa gattgccact ttgagcgttt gttgaatctg aaaaaatctg tagtgtaaaa     10380
     tgggaggcag gtcggcgcgg cgaattattc ctgcgtcacc actaaattta ggttttatac     10440
     aacagtttcg ttcgacaaat tttgcgaata gtacctgtat cgctctcttt tgccgataat     10500
     tagtaaaagg aggggatgaa attgattcaa atagattttg gtacagtcat tactagtgct     10560
     ataacagcag ttttttttac aggtggaact aattatgttt tacaaaagaa gaatagaaaa     10620
     ggaaatgaaa ttttcacaaa aggctatata ctaattgatg agatttataa tattaacaat     10680
     aaaagaattg aaaccgctgc tgcctttgta ccgttctata atcacccaga aggatactta     10740
     gaaaaattac atactgatta ttttaaagag ctatcggcat ttgaactgat tgttaagaaa     10800
     ttttcaatac tctttgataa agaactgaat atcaagttac aggaatatat aaattattta     10860
     agagaagttg aagtggcatt aagaggtttt atgaacgatg atccaataat tgaggtgaac     10920
     ttcaatcaag aatatattga gcggttgatt gatgaaataa ctaatttaat aaaaaaacat     10980
     atttaagctt cttttgagga gcttttttat tttcaaaaca actcaatcta aaaggaggcg     11040
     gcagtgaatg tagatggttg ataagcacat acaggcgtat aaggattacg ccaaaggtat     11100
     gaaatacaag gaccttgccg agaaatatgg ggtatctgtg aacaccatta aatcgtggaa     11160
     acaacgccat ggttggcaaa gaaaaaaggg tgcaccctta aaaaaaggtg tgcacacaaa     11220
     aaaagtaggt gcaccactcg gtaacaagaa tgcgttaggt aataatggcg gcgcacctaa     11280
     gggaaatcaa aacgctgtga ctcatggatt cttctctaag ttcctgccag aagaaacgct     11340
     atccatcatg gaagggattc aagaacgttc gcctgtcgat atgatatggg atcagataca     11400
     gatccaatat gccgcaataa taagggcgca aaagatcatg ttcgtttctg ataagcagga     11460
     aatgattaaa gaactgaaaa agaaaaagtc tgtgctatct gagacaaacg aagtcgaaga     11520
     ggaagaattc gaatttcaat tttcttggga tcgtcatgca acgttcttga acgctcaatc     11580
     tcgtgcaatg gcagagctca ggaatttaat taaacagttt gatgaattag cccattcgga     11640
     agacgaacga cgccttaaat tggagcatat gcgcttaaat atcaacaaga aaaaaataga     11700
     gatcgaagaa cttacagaag aagataaacc ttttgagatc accattgtaa acaaaggtga     11760
     tgacagtgat taaacaggta aatccacatt ttaaagaatt tctctttgac tggaatcaaa     11820
     agtttcagtt tcttgtgggt ggttatggat catccaaaag ctatcatgtg gcgctcaaga     11880
     ttgtcctgaa attgctcaga gaaaagcgta ctgcacttgt tatcagagaa gtgtacgaca     11940
     cacataggga ctcaacattt tcactttttg atgaacttgt aagtgatcta aaattagatc     12000
     atatcgttag atgtgtatct tctccgatgc agattcgatt ttcaaatggc agcagaatca     12060
     tctttaaagg gatggataag ccagccaaac tgaaatcaat caataatatt tccctcattt     12120
     ggattgagga atgctctgaa gtaaaatatg aggggttcaa ggagcttctt ggacgtcttc     12180
     gtcacccgac attgccgctt cacatgatac tttcaacaaa tccagttgga gaggacaatt     12240
     ggacttttaa gcatttcttc aaggatgata gggagaagcg ctttgtactg gatgataagg     12300
     aactttatga aaagcggata atcgttagca acgacaccta ttatcatcac tcaacggcag     12360
     atgataatct tttcctgcca gaaagctatg tccagcaact tgaagaattg aaggaatacg     12420
     atccagacct ttaccgaatt gcgcggaaag gtcattttgg cgtgaatgga attcgggttc     12480
     tgccgcagtt tgaagagcga ccgcatgaag aggttatgac tgcaatctct aatattaacc     12540
     gcccgcttaa acgggttggc atggactttg gttttgtgga atcgtataac gccgtcgtta     12600
     gggttgctgt ggatcatgaa aagaaatatc tctatatcta ctgggagtat tacaaaaatg     12660
     gattaacgga tgataagaca gccgaagaac ttaaggaatt tgcagagact aaggaattaa     12720
     tcaaggcgga ttcagcagag ccaaagacaa tccgttattt tcagcaacac ggtttcaata     12780
     tggtgggtgc ccgtaaatat caaggatcac gccttcagta tacaaagaaa atcaagcggt     12840
     tcaggaagat catttgctct gatcgttgcg agaacacgat ttatgagctt aagccgcttg     12900
     cttatgctac cgataagctg gggaacatca tagaagacga gttcaccata gacccgcata     12960
     cactgtcagc tatctggtac gctctcgatg attatgaggt aaccgatttg aaagaagaat     13020
     caaaaggaag accgcaaaga tcaagaccag gaaggaggta aagcatgtca aaaaaatctg     13080
     ttaaagcacg agtgatcaaa gcctctccac ctactgaatc aacgaaacaa atttatgaag     13140
     atgaatttgc tgacagctat gacagcaata ttttgcctcc tccgtataac ctaaaggaat     13200
     taaaaatgat tgctgagtat tcaacaatct tacagcaatg tgttgatgcc tacaggacaa     13260
     atattgtggg ctttggattt gatttcgagt attcttttga tgtgaattcg ccagatgtga     13320
     caaatgaaga aaaaacagaa gctgaaagtg aatggacaaa gcttgaagag ttcgttaaat     13380
     atcttcactt tgatgagtca gctgagactt tactcggatt tgttattgaa gatagagaaa     13440
     agacgggcaa tggctttatt gaggtcattc gaaacggtga aaataagcca gccggcattg     13500
     aatacatgga cgttcaaaat gtacgagttt gcaaactgtc tgaaccaatc gaagttgatt     13560
     ttacgtactt cgaacaagga caaatgaaat caatcaaaag agagaaacga ttccgaaagt     13620
     atgttcagat gattgacggc cgtatggttt attttaaaga atatggtgat cctcgcactt     13680
     taaatttaga gacaggtcaa tatgatgaac agaccccatt ggagaaacga gcaaatgaag     13740
     tggtccattt caaaatagga agcggtattt atgggaaacc gcgatggatt ggccatattg     13800
     ttaatttgta tggtgctcgt aaagctgaag agctgaactt tatgtacttc aaacaaggaa     13860
     gacatattcc cgctgccatc acaatagaaa atggaatgtt gtctgaggac tcatacacac     13920
     aattgcagga ttacatgaat gggcttgaag gagtggagaa cgctcataag tttctattac     13980
     ttgaagcaga agggatagcg aaggggaaaa acattcatgg tgatgaagag attgcaccag     14040
     tgaaagttga tattaagtca cttgctgaaa tccttcaaga agatgctttg tttcttgaat     14100
     atgaccaaaa gaaccgagat aaaattagat cggcttttcg tttgccccca ctttatacag     14160
     gtgaagctca agattacaac agagcgacag ctgacacagc aagaaagatt actgaggaac     14220
     aagtatttca gcctgaacga aaattaatca caggtaaact gaatgcttta tttctaaatg     14280
     atcttgaaat tcataaagtc cgactccaac taaaagggcc agactttaga gatcctttag     14340
     aaattgctaa ggttctaaca ccgtttataa cagcaggtgc agtttctccg aatgatttac     14400
     gcgatttggc tggacgggta cttggtaaga cgcttgaaga atggccagaa gaagaataca     14460
     acaggccgct tggtaaaact aacgagtcgt ccgtttccga tcctttggct gcactgttta     14520
     aatctaagaa cggtactcct aatatgatcg ggttattaaa agatatgcgg gatgttctgg     14580
     aggatttgaa gagatgaaca aaacggataa gctattggag agtttaaatg tctttattca     14640
     aaaagccgag gaaaatcagt ataagcaatt gggggagatg gtacctgact ttcctggcaa     14700
     atctaatatc cccaaatatg tggaggaata tgaaaaaggc attgccagat tgctcagacg     14760
     ccagcataag aagtttttag atggtctcaa aggttttgta agcaaagact cagaagagac     14820
     gttaaaagcc cttctagtgt tttttactca gaacctattc gcggaggatg acttcgagga     14880
     agaatttcag gaactgactg agggattcct gcaacagact attgaagaaa tggctgaagt     14940
     aatcatggat tcaatagatc cagaggtgcc ttttaaagtc ttatccaatc gtacgattaa     15000
     ttggattaag gattggtcaa agaagctggc tgagatcatg aagttaaaca cacatgaagt     15060
     ggtggaggac gtgctaacta atgctatcga gaacggttca tcaatccagg acattgagtt     15120
     gactctcaaa gacatgccac aatttgatag ggagcgggcg cgtaccacag ccatcacaga     15180
     agtgcttgcc gcttcctctg ccgcgcagca tgaatcatat gcacaatcgc cggcagtaaa     15240
     gaaaaagaaa tggcggcaca gcggagggaa gaagaacaat cctcgtgaaa atcacattga     15300
     tcttgacggt acagtcattg gagtagatga agaatttcag ataccgggca gtagcgaaac     15360
     ctgcatgttt ccgagggatc ctaaactatc aacaagggag cgggttaact gccattgtgt     15420
     tctatcgcct gtggtagata gtaagatttt aggcttatca cccgaagaaa aagaagagat     15480
     tcaaagagaa gtcttagcaa acatggaata aaatagtata atgtcctcat tacatattag     15540
     gtggggaaaa tatgaattgg atggagttta tctcttcaat agtcaaatca atcatttggc     15600
     cggtagcaat aattatcttg gtttttaaat taaaacaacc ggtttcaaat ttgatcagta     15660
     ccttggcgaa aattaaatat aaggattggg aatttgaatt cactattgac caaaaattag     15720
     ataagattag tttccaattg aataaagaga atcaatatgg aactgatgat caaaatctaa     15780
     aagattcatt aaatttagaa agtaattctg aaatcactga ggaaacacat tcccattata     15840
     atgagaagac aagcattaaa ggggataatg acttactact aaaaatggaa atgattcgtt     15900
     tatatggagc agtgaaaaat ctttatgaaa aagtatcaga aaaagatgat gcggcagata     15960
     aatctcaagg tataggcatg ttatacatgg ttgattattt gaaacgccat aaaattctta     16020
     atgattcatt tgcggaaagc ttacttgata taatgaatat agttcatgac ttagagaaaa     16080
     gtcatatttc acaaagctac attatgaata aatttttctg gaatgtagat aagagtgtaa     16140
     aaaggttaat ggagataaca agcaattatg ttgctgagaa tacagctggt gagacttcta     16200
     attagaagtc ttttcttatt ttaaggaggt gaataacatg ccaagagaat tggtgaacgc     16260
     aaaaatcaca catgtttctt atgtggataa ggctgctaat caaaagcagt tctttattgt     16320
     gaaatcagaa aaacaacctg attttcaaaa ggaagtcaga atccttgcga aagaggcaga     16380
     cgagcaaaaa cttgtttacg gtatcgtgta tgaccctgat acagtggacg cccacggaga     16440
     tttcatgaca gctgcagaaa tcgaaaaggc cgctcatgga ttcctgaaag atgctcgtca     16500
     aatcgacaag caacatgact ttcagggtgg tgttggtgag gtggttgagt cctatgtcgc     16560
     accggcagac tttgaaatga atggggaaac cattaaaaag ggatcatggg tccttgtcac     16620
     aaaggcttct gaggaagtat gggagcaaat caaaaaaggc gaaattaccg gttattcaat     16680
     ggcaggaact gctgagacga ttgaaaaaca agaaaagccc gtttctcaag agaaaacaga     16740
     tgagaaaggg ctatttaatt tgctcaaaaa cttttttgtt ggaaaacaac agcaatcata     16800
     tgaagagcca gttgcaaagg cgggcagaaa attttccgct tcaaacctgc aagaaattaa     16860
     gaatgctcat gctgcccttg gtaatttact gagtcaggta gaaacaaaag agggggaaga     16920
     agaaatgact tcggaggaag taactaaatc cattcaagaa gcattagagc caattaagaa     16980
     gcggctcgag acattagaaa aagaggaaga gcttaataag aaagataaag aaaaagaaga     17040
     agagactgaa aaagagggcg agaagttgaa aaaggcaatt tcagaagctg ttcaaccgct     17100
     cgctgatcgt attgaagcaa tcgaaaaaag tcgcggaaca tctaagcaaa ctgaagaatc     17160
     gggttccgaa caagttcaaa aatcaatctg gtcagggttg ttttaatgga taaggaggat     17220
     acgaatgaga aatcaagagg ttattaataa agcagaaatg acgctttcta ctttagagag     17280
     cggcgggatt atgaatccta ctcaggcttc aacttttatt cgaatggtac aagatacgcc     17340
     aaccatttta agagatgcgc gagttattca aatggaccat gacacacaga aaatcgagaa     17400
     gatcggtttt ggtcagcgta ttttaagggc agcccaagag ggagttgcgc taactaaaga     17460
     tcaaaagtca gttccatcaa ctagcacagt taacttaagc acaaaagaag taattgctga     17520
     agttaacatt acctatgaca cacttgaaaa caacatcgaa aaagatggcc ttcagaatac     17580
     aatcatgcaa atgatagctg accgtgctgc ggttgatatt gaagagttgc ttgtaaatgg     17640
     ggatacatct tcctccgact catatcttgc acaattagat ggcatcagaa aacaagctac     17700
     atctcatatt gtcgatgctg caggtgagga actgacacgt caaacattta aacgaggata     17760
     caaagctgta cctcctaaat atttgcgaat tccgcaggag ttccgtttct atacatcgcc     17820
     tggtattgag gtcgaatgga aagatcgtgt agctgatcgt caaacaaatt taggggatgc     17880
     agctgttcaa ggtggccttt catctgcttt tggtgttcca atcaaaggta ttgcaaattt     17940
     acagccttat acgattggag agggagatac tgcagccgat gtttctgata tcatcctaac     18000
     tcatccgaag aatattattc tcggattctc tcgtaacatt cggattgaag tagataagga     18060
     catccgtcgc cgtatgttta tcattgtttt gacagcgaaa ttggatagtg tttttgaaga     18120
     agaggacgcc gtagccaaga tcgtgaaagt gaaggagtag gtggtctggt gtgtttactg     18180
     caaagcttat taaaggcaaa acatacaatg tgatgggaat aacctttcga gcaggtgtca     18240
     gtcaaacagt accgaaaaag ctctatgagt atttaaatga aaatccatat tttatactaa     18300
     cccaagagct taataatcaa aaggatgatc cgataaatta tactgaatcg gaattgaaag     18360
     gtatgaataa agcagagcat gaatccatta tttctaatct tggtcgcaat ccgtctgact     18420
     tcaaaaacgc agatgaaaga attgcctaca tccttaagca aatagataac aaaggggagt     18480
     gacctatgct gttaatcact cccgatgaat taaagagtta ttcagttttt gagtctgtaa     18540
     agaccagacc tgacgagttg ttaaaacagg atatccttga ggcaactgcc gatatcattc     18600
     ttaaagttgg acatgatttt tcagatgcag agtatatccc tttgcctgaa acggttcgac     18660
     tggctctatt aaagttgtct cagttttatg ctcttataaa tggcgacgag tcaattatta     18720
     aaggatatac aactgaaaaa attggtgact attcttatac tctaggggat ggcagtcctc     18780
     ttcaaaaacc tgatgtgtat gcattaataa aagattatgt gaaaccggct gaccctgatt     18840
     tagaagggat tgaagcgaaa gtgcggatga gatcaatatg agttatcaat ccttattgac     18900
     tcacagatgt gacatttacc atctgcagga gaaaaaagaa aatagaaagc aaaaattcgg     18960
     ggtgccggtt gaagatgttc aaccggtttt ttcgtaccct gatgagccgg acatagaaaa     19020
     tcagccgtgt tattttacag agaagagtca gtccattatc caacaggagt caaatgtatc     19080
     tatttatcaa tctttccttg tgcatttccc tgctactgct gatattcgag taaatgacag     19140
     ggcggtttgg gatggtactg cttataaatt acagaagccc cgcaaaatca ggaatcatca     19200
     ttgggaagtg acggcagtac gggaggttga atacttatga aaattcgggg tctcgatcag     19260
     ttcatacaat cattagaccg ggcttctcgt gggggactga agaggaaata tgagcagtgg     19320
     cttgaatcaa tgggttttga gttcttagat atcatccaag atgagatcat taggacgaag     19380
     accgtggaca ctcgccgctt gctcaattcc tttcagaaag gtgaccagga taatatcttt     19440
     tcaatgacag aaggcagctt aaagttggat gttggaacaa atctggatta cgcctcatac     19500
     gtcaatgacg ggcactttac tatcgatccg tctaaaaatc aggatagacg atgggttcca     19560
     ggtcggtgga aaggcgaccg tttcgaatat gaccctgctg aaaaaaattc cggcatgctg     19620
     ctgaagttcc gatgggtaga cggttcgggg ttttgggata acgccatggc catttttcag     19680
     ttgatgtttg agagaagcct tgagcggaag ctgcagcaat ggatttatga agaattttaa     19740
     ggcggtgctg ccatgaatca agaagtaggt tcaattatgg gctatctata caaactgtat     19800
     cctgttcaag tgtatgaaga agaaataccg caggactttt ctgttccgtc tctttacttt     19860
     ccaccggctt ccacggtcga tggggtggac acagtatcca cgtttcagaa agcatatgtt     19920
     ttaaacgtaa aactctttca cgaaaacgta cagaaggctc ataacgaagc ggaacgaatt     19980
     gcggatacac ttagaagcag aagaggcata attccgctta tacaagattc tggcgaggat     20040
     actggggatt ttattcgcct atctcgaata gaaacgcggg tatcagacga ttatgcgacc     20100
     attgtcttaa actggacgag ccgctattgg tatgagcggg aagatcagcg ttcaatagat     20160
     ggttttaaat ttaaaagtgg ggtgaaatga tggccactaa aaaagagaaa gcagaaaatg     20220
     ctttttatat taaggatttg cgagagcaca gtcgagagct ctttggggta aaacccgagg     20280
     tgtttgacgg tgctcttttt catgttcata aaatgagtat tacaaaatcg gaagcgaaga     20340
     agttgatttc tcagtttctt caaaaggagg tcaaatagat gaacggcgga actttcacac     20400
     ctggcaagga aaaagagcgt gccggtattt actttaactt caaaacgacc gcggagaacc     20460
     gtgtttctgc cggagaacgt ggaacagtgg cgctgccgat agcgtccagc tggggtgagg     20520
     ttaagaaatt catttctatc tcttcaatcg aggacttgaa taaaaaagtg gggttgaaca     20580
     ttgatgatcc ttcgctgttg cttttacgtg aggcgatgaa gaaggcgaat acagtcttgc     20640
     tttatcgcct aacggaaggt cttcgtgctt cagcagacat tagcgaaggt gtaaaggcta     20700
     ctgctcttta tggcggcact aaaggtaatg acatcattat tagtattacg gagaacgtta     20760
     ttgactcttc gaaagttgat gtcactacct accttgatca atctgaagtg gataaacaaa     20820
     cagtgtctaa agctgaagaa cttaaaccga ataaatatgt cacgtttacg gggaaaggag     20880
     atttaacagt tactattccg ttaaccggta cgcccctgaa gatgttagcg gtgctctccc     20940
     tgcaacttcc ggaatccgct tgtcaggcgg aacagacaaa acaccgacaa atgccgatta     21000
     tacagctttc ttggaagcgg ctgaaacgga atactttgac acaatcgctt tacctgtaga     21060
     ggataacgag caattaaaag caacgtttgt tgcgtttatc aaacggctga gagacaacca     21120
     agggcaaaag gttcaaggtg ttctttcaaa ttacaaggga gaccatgagg gtattatcaa     21180
     tgtaacaggt ggtgtcctac ttgaggatgg aacggagatc actcctgaaa aagctacagc     21240
     ttgggttgcc ggtgcaagtg cggggctaca tttaatcaat cacttacatt tgtagaatac     21300
     gagggagctg tagatgtcct taaccgaatt gacaacgacg aaatcgttga acgattgtca     21360
     aatggggaat tcttgtttac ttatgattct cgtgataaat cagtatcggt tgaaaaggac     21420
     attaattcac tcacaagcct aacagcagag aaaaataaga tgttccagaa aaacaaaatt     21480
     gtccgtgtac ttgatgcaat caataatgac ctgacatcac aattgaaagc attgatcaag     21540
     tctcgaaaag cgagcggcag tgatgttccc gctacaaatg acggactgca gtttgtaaaa     21600
     acgctaatta ctcaatactt gagtgttctt caagataacg agggcattac tgattttgat     21660
     tcagagaatg acattacaat tgctctgaat aatgatcgtg acggcttcct gattgatctt     21720
     gcagttcaac cggtggatgc agctgaaaaa ttctacttta atgttgaggt gaaataggaa     21780
     tggcattaaa agcgcaaaac accatttcag gtaaagaggg caggttgttt cttgatggag     21840
     aagaaatggc ccatatcaaa acgtttgaag ccaatgtaga gaaaaacaaa tccgaggtca     21900
     atatcatggg tcgtcggatg acggggcaca aaacgaccgg agcaaatgga acgggaacag     21960
     ccacttttta taaagtgact tctcaatttg ttcttattat gatggactat gtgaaaaagg     22020
     gaagtgatcc ttatttcacc ttacaagctg ttctagatga cgcctcttca ggtcgtggga     22080
     ctgaacgagt caccttgtac gatgtgaact ttgattctcc gaaaatcgct gggcttgatg     22140
     ttgattctga agcattggaa gaagaagtgc cgtttacctt tgaggatttt gatgtgcctg     22200
     aacagttaaa atccacattc taatcacttt cacgaaaaat cgccgacttt aacgaagata     22260
     tttacgaaaa aatgtggtaa gattacttta gaagtaattc aaccgtacca aatggaaaca     22320
     tgtatttctt tcaaaagaaa tgcataaaat aaaagagacc cggttgccgc cgggtcagta     22380
     taaatgttgg cccatcaaga gggctggctt aacaacttca tgaaagtatt taggatagac     22440
     tttacccttt tactttgccg agctcaaggg gtgggtctat ttcttcttta tataagtcaa     22500
     cagggcaatt ataaatgacc cgaaagcaag cataagcatt aatgcttgaa atgttgacac     22560
     gtgcatcacc ccctttcatg agggagtgag ccagaccgcc cttgagatgt tgaaagccaa     22620
     tattcattta tactaaacca tattgtacca taacactttc ataatccgag ggtttttaat     22680
     aaaagaaaaa gggttaaggc ttctatgatc aggtcatttt gaactcatag ataaaaaaag     22740
     taacaaataa aagatacaaa taattatata atcaatatat attcatgtta taatggtgcc     22800
     aagcaaaagt attgcaacta ctggcgtaag cttatagttg gtaccacatt accacattac     22860
     cacttgttaa tgtgtgttac tttcatgaga aatgctaaaa tataaaagcc agagtgtggc     22920
     agcactctag cttttaaaaa agaaactacc ctttaatagg agggtcctcg tgtagacact     22980
     tttcctttac agtaatgtaa ataggatgag tgtctttttt tctaagcatg aataataatg     23040
     ttaaaagaga tattacccat gtcataatcc cgcctattaa attggcaaag ccgatcatga     23100
     ccattagaga ttcataggtc gacataattt cacctccttt catattcgga ggataagcta     23160
     aggtagcttc aagaatctat tatacatgaa ttatatggaa agcacattca aaaagtatga     23220
     atgtgctttt tttcttgtcc aaaactaaaa agtaaaagga gttaataaac atgagtgaaa     23280
     accaaaacga aaaagtatac gatctttcat tctttatgcc aggacaaaca attgacgcgg     23340
     aagaggtaga agtcccgatt tctaaacggt ttgtagacaa agaaggcaat gttgttccat     23400
     tcattttcaa agcaattacg actgaccgaa ttgacgaact tgagaaagag aacaccactt     23460
     acaaaaatgt aaaaggccgc ggccgtgtga aggagttgga cagccaacgc ttttatgctc     23520
     gtattgcggt tgaaacgact gtttatccga cctttaaagc taaggaacta cgtgaggctt     23580
     acaaaacaga agatccagtg gaagtcgcca aacgtgttct ttcagtcggc ggtgaatatg     23640
     caaattggct gaacaaagca attgaaatca acggttttga tgatgatctc gaagaccttg     23700
     aagaagcagc aaaaaactag taaaagacgg ggacaaagag gctgtatacc tttactatgc     23760
     tatgcatgag ctcaaatacg ccccgtcaga attaagagaa ctatatgagg ctccgaaagc     23820
     attcaaggcg ctcttatatg gattaatcgg ttttaagctt gagctgttag aaaaagaagc     23880
     gaagaaggga ggtaattaac tatggctaaa ctaacagcca cgtttgaatt acatgataag     23940
     atttcccgca agcttcgaat gatacaaggc aatgctgaaa gacttaagag ggctgctaat     24000
     ggccctctta tttttgaggc tgaagaccgg actgaaagag ttatgcggca aattgatcga     24060
     tcagccaacc gtttgacggc tcgggctcga ttgcttgaaa tgggtttaga tgatcgagtt     24120
     tcgaatggct tacattctat acgccagcaa gcagaggatc ttaccgaagg cagtcatgag     24180
     gtgacggttt ccgtaaatga tcaagctaca ccacgttttc gtttgatccg tggaggtctc     24240
     actgatttga atagctcgca cgctgagcca actgtttcag tacgtgatca tgcttctaac     24300
     caattagatg agatccgtcg tcatgtgact gatgtagata gcgaacatgc agagccaact     24360
     gtttctatta aggatagagc ttcagcggct ctggatgcta ttgaagcgaa aatagacagc     24420
     ttgaagggtg ctaccattac tctggcagtt gcaggtggtt ttcctgcagg ttcaattatg     24480
     ggttctggta aaagcacaat gtctcaggat gcttatgtgt cagcaacttc aaacgttaat     24540
     aagaaagatg ttgcaaaaat gacggatcag atctatttca acaataaagc gggcagttct     24600
     cgggaagaag tcagtttatc tctaagaaac ttatcgcaac agacaggggc gtctaaaaaa     24660
     gctctggctg aattgactga gtcatcaagt aagattgccc agcttatgaa tgctgatcag     24720
     gcagaggtag atcgtgcttt cagttcaatg tataacaact tgaaattgtc tgggaaacaa     24780
     agcggagact taattgctta tgtataccgg aatgccggtg accaggctga tgatttatta     24840
     gacacgatga atgaatacag ttccaccttt aaagacttga agctcacagg cggccaaatt     24900
     gcaaacgcaa tgataaaagg aacaaagggt ggagccagaa acttcgataa cctagccgat     24960
     agtatgcgtg agtttaacat ccgccgaacc gaaatgtctg atagtcaagt ggacgcattt     25020
     aaaacactgt tcggagccaa ggaaactaag aaaatgttca agggcttcaa agatggttca     25080
     ataagcggag aggaaagttt atttagggtg gcaaaagccc tttctaaagt gaaagacaaa     25140
     acaaagcggg ctgctattgc gactgagctt atcgggacac aatatgaaga ccttaagcag     25200
     cctattttag atatggctga gggtattggt acaagtgcca aaacaagcgg tgaattggaa     25260
     cgaagcttta cgaaacttcg ggataataac ccgatgacac cggttaatga tgccatgaga     25320
     gattttgaaa gcatatctaa ggatatggga acctctctgc taactggatt aggaccggcc     25380
     tttgataaaa tcagctcgtt cattaacagt aaagaaggtc aggaaaaact taaagagatc     25440
     aaaaaagata ttgctgatct aggtgaggag ataggtgata agttaaacgt agccattgag     25500
     tggagcgtca accattggga tgatttgaaa acagcgatta aagttgtgat cccctcttta     25560
     attggattga ttggttattt gaaaatactt cgtccgctgt taaaaggcat aggtactgtc     25620
     ggaagtgatg cagcaggcgt aatccgaaaa ttaattccaa aacgtactcc taaagctggt     25680
     actaatacgc aaagtgaaag gaggaataga aacagtaatc gtaatgctag cacaaggggc     25740
     agagaatcca aaactgccac aggtccaacg agtttacctc gaagcggcag cttgacatat     25800
     tgctgttgta gcgatggagg taaaaatgat cgcattcgta gaagacgagg gaaaagagtt     25860
     ttaggtcgac gcggtaatcc aaaccgaatg aacccttctg atagttcaat tgctgtgtca     25920
     tctgaacggt tggagagaag gcgttccggt agaactgtag gtactaatcc aactagagat     25980
     tcaagatcag caataatcac tacgagatcg gagctatact cagctggtag agctgcaggc     26040
     ggtacatcga agttcgggaa agtcttaagt cctctgaaaa gtgttggcaa gtttgcaaag     26100
     ggagtccctc tattaggaac agcgttagcg gcaaccgatt taattgggat gaataaagat     26160
     aatgttggtg aaaaaattgg atcagctggc ggtggccttg ctggagcggc tacaggagca     26220
     gctattggca gtgttattcc aggagtggga acagctattg gtggattagt tggtggtata     26280
     gcaggcacca tgggcggctc aagtttaggt aaagcgtttg atggttcaga agtaaagaag     26340
     aaactaaaca gtacattatt tgatcaaaaa tggtggtctg aaaaatggtc aggcattaag     26400
     agtaatgcga agacttccat caatgggtta agtgatacat ggtctaatgt aaaagaaaag     26460
     gtgaagtcca ctttatttaa tagtgaatgg tggtctgaaa agtggtctgg cgttaaaagc     26520
     tgggcacaaa acaaatggaa tagtgcatca cctgtttggg agtccgtaaa gggaaaaata     26580
     aaatccactt tgtttagtga gaagtggtgg tcaggtaaat gggaaggcgt aaaaagttgg     26640
     gctcaaagta agtgggacag cgcgtcttct gtttggcaat cagttaaagg aaagctgaaa     26700
     tccactctat ttagcgagaa gtggtggtca ggaaaatggg aaagtgtaaa aagctggtcc     26760
     aaaaataaat gggacaatgc taaatcaata tggaaaagtg ttaagagttc catctcagaa     26820
     acccttttta gtaagaagtg gtggtctgaa aagtggcaga gtgtaaagga attgggaagc     26880
     agtattttag gcggggtaaa agaagttggt ggtaaagtag cttcaagtgc gaaaaaaact     26940
     gctggtaaag cgtggggata tgtgaagagt ggcgtaaatt atttatttgg ttcgggaaaa     27000
     gaaaagccaa agaaacatgc tactggtggt tacattacga agccaacaat atcttggatt     27060
     ggtgaagctg gtaaagaatt cgttatccct gttgagaata ataaaggtcg cggcaaaatg     27120
     ctcctttctc aagctgcttc gaaattaggg atgagtgtgg ttgatgatat agcgtctgct     27180
     tcatctgcag gaggtgaacc ggcaacttcc ccgctagtcc gtagtgcggc ggtgactgct     27240
     tctgtatctc ctattattga cacatccagt cttgatgaac aagcaacatc atttggtcaa     27300
     cagttcacga agagctttga tcaaggaatt agagataatg ttgtttctat ggaagcatgg     27360
     aaacagaaaa acgttggaca accaatgaac aatttaatct cttattctcc gaattacgga     27420
     aagcaagtgg tcaatggtta tgctaaaggt caaaacagca cttcgaccgg tacagatggc     27480
     ttcttgcaga cgaaggttaa aatgccattt cagaacactg ttaataaatc ttcatcatgg     27540
     ggaagcggaa cgatcaaagg ttttgcttcc ggacaaaata gctcacaaac tggtactgat     27600
     caatacgtca gcactcatat taacaagccg tttatccgct ctaaagaatc atcaaacgga     27660
     tggggaagcg gtatgatcgg taattttgtt tcaggcatga cttctaaggc aagtgaagtc     27720
     aatgaggctg ccaaggaact ggcgaaaaaa gttgagaagg catttcgtga agagctggat     27780
     attcattcac cttcccgtgt catgatgagt cttgggcgtt ttgcctctat aggtattgta     27840
     aaaggtctgg attctgttga tgtaaaaaag tttgctgaaa aacaagcagg ctcactagct     27900
     gccgcttatt ctggaatggg cgcagtaagc ggaaatgtga agcaatggct catggctgct     27960
     atcatggcta caaagacacc gatgagctgg cttccagggc tgatgacaat tgctcagcat     28020
     gagtcaggcg gtaatccgaa ggcaatcaac ttatgggata gtaatgcgaa agcaggacat     28080
     ccatctcagg ggctcatgca gacaatccca agtaccttca acgcacacaa attgccgggc     28140
     atgaataaca ttcttaaccc gattcacaac gctgctgctg cgattggcta tatcaaaagc     28200
     agatatggat caattaataa tgtaccaggc attagaagca tgagacatgg aggtccatat     28260
     gttggctacg ctaacggcgg acttattacc aaagagcaga ttgcccgtgt cggtgaagga     28320
     aacaaaaggg aatggatcat tccggaggag cgaggcatcc gtggacgtta tttattagcc     28380
     caagcagcta aggcactcgg aatggaagtc acagacccat ctgaaaaagg tcaaactgaa     28440
     ttatcttcag gtcaggtaac agctgccaca acgggtcgta atcaaacaac gtttaaagct     28500
     gcaggtggca aagaggtcat tattcagttt aatggcgatc agcattttca caatgaccaa     28560
     gacatgaaca gtcttgtagc taagattaag caggcccttg tcgatgagct tgaacaggat     28620
     atcaacattg gaacgaaggg agtcgttgct tttgactaaa tccatatatg aattctggat     28680
     ttcacaaggg aaggacaagc tgcggcttcc ggtccttcct gaacaaattg atatatccaa     28740
     cacaattcaa aatgaatcag taaaagtggc tagttttggg gagatcactt ttattgataa     28800
     accgggagcg aaagaaattt cgttctcttc tttttttcca aagaaacaca gcccgcttgc     28860
     tgagtataag ggatttcctt ctcctgaaaa tgctattgca aagatcgaga aatgggtgaa     28920
     atctaaaaag ccggttcaat tcttaattac tggaacgaaa attaatttaa cttgcagtat     28980
     cgaggttttt tcttatacag agggccaaaa agatataggt gatcgtgatt atgaaataaa     29040
     gctgaaggaa tacaaaactg cttcgccgcg gaagatcaag cagaagaaaa agacgaagaa     29100
     gaaacggcca tctaaatcag ctcctaaaac atacaccgtt aagaaaggcg atacactgtg     29160
     ggaccttgcc ggcaaatttt atggagacag tacaaaatgg cgcaagatat ggaaagtcaa     29220
     taaaaaggct atgatcaaac gaagcaaacg gaatataaga cagccaggac actggatctt     29280
     tcctgggcaa aaattaaaaa taccgcagta agcaggtgat gacatgatag aacttttcgt     29340
     cattaaagaa acggaatggc ttgagctggt aactgaaagt gtttccctcg aagggcaacg     29400
     gtatcaggcg ccgcgatcga ttacggccaa gatcattacg aaacagggaa cccattcata     29460
     ttacagcgta tctgaagggg atacagtttt atttaagtgg aagggcaaag aactgttccg     29520
     gggcattgtg ttttctcgca atccggaaga acactggatg acttttacgg cttatgatat     29580
     gctgcaatat ttggtcaaga acaaagatgt ttatgttttc tcaaatcaac gtgcagacga     29640
     gattataaaa cggttggcgc gagattttca gattccgact acatccattg caaatacagg     29700
     ttacaccatt aaatcattag tgtttaaaga tgatacgagc ctttatgaca tgattctaaa     29760
     agccttgaaa caaacgaaaa gccaaaccgg aaggaattat caattatatt ctgcgaaggg     29820
     gaagcttggc cttcgcgctt ggccagatct gtcagaagta tgggtgttgg agacgggtgt     29880
     gaacatcacc ggctatcaat acagcacttc aattaatgac acggccacaa aagtaaagct     29940
     ccgccggcag aaagacaata aaacatacac agccactgca agtgacagct cagggatcag     30000
     taaatatggt gtgcttcagt atgtcgaaac ggtttctgat aacattaacc aggcgcagct     30060
     tcaggagcgt gcgaaagtca aacaggcaca gaaaaaaggt gttaaaaaag aactcaagag     30120
     tattcaagcg attggcattc cggatcttca gagcgggttg cccatctata tctcaattcc     30180
     ggaagtcggg gttaagaaaa catactggat cgatacagac aaacacgaat ttaaaggatc     30240
     gacacacacg atgaccattg atgtggttga gaaaaattct atccctgatg gtgtttcctc     30300
     atgagattaa gtgaagcaat caaacatttg gctgtccgtg cagttgattc tgagtcgcca     30360
     gtggatattc taccggctga agtggtttcc gtttcccctg ttgaaataag gcttaatgaa     30420
     aatgacaaat taataatacc tgctgatttg attattgttc caaagcggct gcgggccggt     30480
     gaagaagcat taaatacagg tgagcgtgtg atgattgtct ccttaaaagg cgggcaatca     30540
     ttttttattc tcgacaaaat ataggaggtg tttggaatgg ctttgtctcc ggaaatcgag     30600
     tttgaggata tagaagatga cagcgaagtc atagagacct cgcaaaccta caaaatagat     30660
     tttgaaaatg gccgtatcac aaatgaaatc atcacaggcc ttgaagcgat caagcagttt     30720
     gtatatttgt ctctccatac tgagcgatac gcatattctg tttacagtca tgacattgga     30780
     aatgaacttc aagacgtgct ggcagataac gaaacaacag acgcatataa gaaaatggag     30840
     atccctcggc tgatagagga agcactgatc tatgacgatc ggatttctgc tgttacagat     30900
     tttgaaatag aaaaacaagg cgaatcgttc cgtgtctcct ttacagtcga gactgacgaa     30960
     ggaacattgg agatcgagga ggtgcttggc gaggatgttt gaagatcaaa cctatgaatc     31020
     gattatggat cgaatgttga acagcatttc agcggacatt gataaaaggg aaggcagcgt     31080
     gatttataac gcgttagctc ctgtagccgc agaattggcc aagtcttata tttggctcga     31140
     tactgttctg gaacttgtct tctcagacac ggcccaaggg gaatttttag atcgacgagc     31200
     tactgaagca ggcattgagc ggactgctgc cacaaaagca gtcagggcag gggagtttac     31260
     tgaaggcgtg accattcctg tagggtctcg cttttatgtt gataatcttt attttcaata     31320
     cacagctgac gggacgttgg agtgtgaaac agcgggggaa gcagggaacg caaacatatc     31380
     cggtcagaat ctattgtcat tagacactat acctgggctt caaaaagcga ttgtgaaaga     31440
     gattctgatt cctggacgtg aagaagagga tgatgacagt ttaagagcta gatattttac     31500
     ccgcgtgcgt cgagaagctg tcagtgccaa taaagcacac tataaacaat gggctgaaga     31560
     agtagacgga gtggggaagg taaaggtctt tccgctttgg aacggggacg gtacagtcaa     31620
     aattgtcgtg accaatgcta acttggaacc tgcttccgat attttaatat caaaggtgaa     31680
     aaactatatt gatcctgaac ccggacaagg tgagggacaa gcgccaatag gtgcctttgt     31740
     cacagtggag agtgcggtat ggaaagaggt tgagatttca gccgaggtac ttcccgaggt     31800
     caatagctct atcgatcagg taaagcaaga aattgaatca ggtgttttaa atctttttaa     31860
     aaagattgcc tttgaagata acgtcatccg tttatcgcag attaataata tcgtctacaa     31920
     ttcaccttca gtaagtgatt acgcagatat taaaatcaac ggcgtggccg aaaatttggt     31980
     tctgagtgcc gtcgaaatcc ctaaattggg gcaggtgaac atcattgagc aaactcgatg     32040
     aaatgactgc ttacctgccg ccgttcctta ccaagttaaa ggaaatggct gaacttctta     32100
     aagcggaagc tccggaattt gagaagcaaa ataacagcat ctttgatctg acagatcagc     32160
     tgtttgttac tacggcaacc tgggggcttg aacgatggga aaagattttg aacgtaccgc     32220
     gggaatcagg tgacaccgat gagatccgcc gattgcgcct aatctctaaa atgtccaata     32280
     taccgccggc aacatatagg gccattgaac acgcgttgaa ccggttcctg aaaaatccgt     32340
     cagctcaggt tcggctgctt cccggagagt accgttttaa ggttgatatt gatatagatg     32400
     atatgcagca tatgagcgag ctcatagaaa cattggagaa tatgaagcca gctcatttgg     32460
     catatacctt gcgagctgct ttgaatgagc cactccaaat aaaagatact gtcattttga     32520
     attacagaag gtatcgaaaa gcaagtgagc taaaggtagg ttattccgtc acgctcaata     32580
     ataacgaggt ggtccttgta tgattacaca gctttataga gagcgtacag ctgcagattt     32640
     gaaaaataga atatcgaaag tgctgctgaa tggaaatgaa acagaaattg tggaactcac     32700
     cattcagggt gccgttgtca cggtgcttac tcaacgagag gaagacatca aacatattaa     32760
     gagtgttcag atacttgatg atcaaaacaa cgtgattacg gaaagaacaa cagatttaga     32820
     cgttagtaat aatagaacgc tagattttag gattactttt gaggtggttt aacaatggct     32880
     tatgatgcaa aaacagattg gctcccggac gatccgatta atgaagatga tgtgaaccgt     32940
     tgggagaaag gcattcaaga tgcgcataaa gatttagctg tacataaaaa tgacatgaac     33000
     aaccctcaca atacaacaaa ggcgcaaatc gggctaggga acgttgataa tgtacagcaa     33060
     gcttcgaaaa aagaatttga agagcatcgt aatgatttac aacggcacat tacaccagtg     33120
     gaacgggaga attggaatgc aaaagaaaca attgtcggag ctcaggaaaa agcggataag     33180
     gctttatcgg atgcaaaata ttacgtggat accaactata aaaataacaa tctgacgtta     33240
     attactggag acaatgctat tcaagatgca agaccaggag gggaagaata tcctttagga     33300
     ctgaccttaa tggacattgg gcagggaaat actacaggct accccttggg ttatggcatt     33360
     gtcaaaaatg aaaaatataa taattaccgt tcactcaata cttttacgga acagggaatg     33420
     agtctgggac ttactatgac agtacaggag tttggattag acactggtgg agtggttcac     33480
     ggctggactc cgtggcaaaa gatatcaggt tttgctcatg cgaatattgg aactacaggt     33540
     gttcagtatt taaaaaagat tgatcacact aaaattgcat ttaacagggt catcaaggat     33600
     agccataatg cttttgatac taaaaacaat cgatttattg ctccgaacga tggaatgtac     33660
     ttaatcgggg caagtatata taccttaaat tatacatctt atataaactt tcatttgaag     33720
     gtttacctaa atggaaaagc atataaaaca ctgcaccatg taagaggaga ctttcaggaa     33780
     aaggataatg ggatgaatct tggtttaaac ggcaatgcga ctgtacccat gaataaagga     33840
     gattacgttg aaatctggtg ctactgtaat tacggaggag acgaaacact gaaaagggca     33900
     gtagatgata aaaatggtgt atttaacttt tttgatatac aagaacttgg aggccgaaac     33960
     tatccaagat tttaggaggt aacgatgaat ataggtgaag ctattctttt taaataccca     34020
     acagctgatc ccacaaagga ttttattgtc cagaataatg gtgatggaac tccctcatat     34080
     atagcagagt ggaatattag ggcacctata cccacggaag cagagttaaa aacttggtgg     34140
     gaagagcttc agagtacatc tgcatatgaa ccaccagttc aagtggatct acttgcaaga     34200
     gagttgtcac aggaaaaact ggctcgtaaa cagcttgaag aattaaacca aactttggga     34260
     agcgagcttt caaaaataaa gttgcaactg cttactctac aaggagggca aggttcatga     34320
     attattgggt gctggctttg cattataact gggcttcttc tgaaatggtg aaacaggcaa     34380
     ttcatctcaa agattgttcg cccgaagatt tacaggaagg aatagagaaa aaactcatta     34440
     cagctgaaca gtataaagag atcacaggag aagccattta gggctttttt atttttcctt     34500
     aaaggaggtg gttccgttgt aaacccatgc tcaccactaa tgatctacaa tagcaaggag     34560
     gatttattat ggcatcatat agttttcaat tttcaacaga tgcaactggt aagccggggg     34620
     cagccaagcc atacagagaa ggaaacagag attttgttgt gccggtagct tcaatctccg     34680
     gtaattcaga gctgctgacg aacgcagttt taaaagccac tgaagtctac acgcaatatg     34740
     gacaagatcg attaggtcag gttttaattt caaaagtaaa aggtcacgct tattctgatc     34800
     gtgaaggtac cttattcatt gaagaaagta acgatatgaa ttcatggacc acaatctctt     34860
     cattggttgt taaagcaaat acgcttggcg agactgagtg gattcattta actaaacgat     34920
     atttccgttt cagatacgca aatggtaacc tgcagcaatc tgaattctta ctttaccagt     34980
     cattgggcgc aggtgaagag gatataaaca ttaaccatac tgttcctatt acagcagttg     35040
     ctccgttctc agtccagtta gataaaagcg ggttaactaa tgatggtcgt ttaaaagttc     35100
     aaactgaagg cttgaatctt agctcattag acactcaatc aaaaacaatg gatattgtct     35160
     ttcacgataa aacagaaacc ataggtgagg gtaacccatt caccgttgga tcattcaaaa     35220
     cgttgctcat tgaggtttat gggacggctg agacaagtga attgaagttc tggggtaaat     35280
     ccttatcggg aacaaaaaga gcccttagag ggcagaaagt ggatgacgga acgtttgcca     35340
     ctagcacaaa aggaaaatca gaagcttggt cttttagcat tactggcttt aaagaaattg     35400
     ttatggagct tacagcttta acaaatggaa acttttcagt tagagggacg gccgtctcat     35460
     aagatccggc tgtccttttt tatttgcctc ggaggaggtg attagaatgg aggagacaag     35520
     tttgtttatc aattttgaaa cattagattt agcaagagta tatttatttg gaggggtgaa     35580
     gtaccttgat ttacttctag tacttagcat aattgacgtt ttaacaggag taatcaaggc     35640
     atggaaattc aaaaaactgc gaagtcgaag cgcatggttt ggctatgtcc gcaagctact     35700
     caatttcttt gcggtcattt tagcaaacgt gattgataca gtactcaatt tgaacggtgt     35760
     cttaaccttt ggtaccgttc ttttttatat cgctaatgaa ggtttgtcaa taactgaaaa     35820
     cttagcacag attggtgtta aaataccatc atcaataaca gatcgattac aaacaattga     35880
     gaacgaaaaa gaacagagta agaataacgc agacaaagct gctggctaag ccagtggctt     35940
     tttttatctt actgacagaa ggagagaggg tatatggcca ttaaagttgt aaagaatcta     36000
     gtctctaaat caaagtatgg attgaaatgt cctaatccaa tgaaagctga atatatcact     36060
     attcataaca ctgcgaatga tgcttcagca gccaatgaga tttcttacat gaagaataac     36120
     tctagctcaa caagttttca ctttgcagta gacgataaac aagtcattca aggtattcca     36180
     acgaatcgta acgcttggca cacaggagat ggaacaaacg gtacagggaa tcgcaagtct     36240
     attggtgtcg aaatttgtta tagcaagtca ggaggggtac gatataaggc agcggaaaag     36300
     cttgctatta agtttgtggc tcagctactt aaagaacgtg gatggggtat tgatcgagtc     36360
     cgcaaacatc aagactggaa tggtaagtat tgcccgcacc gcattttgtc agagggaaga     36420
     tggattcaag ttaagactgc aattgaagca gaattgaaaa agttgggcgg aaaaacaaac     36480
     tcaagcaaag caagtgtagc taaaaagaaa acaacaaaca caagcagcaa aaaaacgtca     36540
     tatgcgctac catccggtat ttttaaagtg aagagcccaa tgatgagagg ggaaaaggta     36600
     acacaaattc aaaaagcact ggctgcacta tacttttacc cggataaagg agcaaaaaac     36660
     aacggcattg acggcgtgta tggtccgaaa acagcagatg caattagacg attccagtct     36720
     atgtacgggc ttactcaaga cggtatttac ggaccaaaaa cgaaagcgaa acttgaagct     36780
     ctcttgaagt aaataaatag tctccttgag tatctttctc aaggagatac ttatgtttat     36840
     tttgttacag atagttcaaa attattctaa tatttgagta aaaagtatta tttttctagt     36900
     ctgaacataa tgttatcatt tacatgtaaa taatttaaaa gaaagggatt gatttcatgt     36960
     ttaagaaatt acttttagca acatctgcat taacattctc tttatcatta gttcttccgt     37020
     tggatggaca tgccaaagct caagaggtaa cattacaggc acagcaggaa gtcacttatc     37080
     aaactcccgt taaactatcc gaattaccaa ctaatacaac tgaacaatct ggtgaatttc     37140
     acacaaatgg tattaaaaaa tggattgcta aagaagcaat gaaggcaaca gccagtgcgc     37200
     ttcgacatgg tgggagaatt gttggtgagg tagtcgatga gttaggtgga tcagcaggaa     37260
     aaacattcgc aaaacatact gatgatgtag cagatgcttt ggacgagtta gttaaacgag     37320
     gtgacgttgt ggaggacgca attattgaca cggtttcctc atatctaatt gatgctggtg     37380
     taaaatcttc tacagctaga actattgcaa gtgtatttac tttcttagct ttttaattga     37440
     ggtgatttga attggtaaca gtagaagaaa ggcttgacaa cctagaaaaa aaagtcgaga     37500
     agcaggcttt tcaactaagg ttagtccaac aattagcagc tgattatgat cggtttggct     37560
     tatttgatca agttttggcc tatgatttaa gtgaaaaaca gtatcaagaa ttaagagagt     37620
     taacgagcca gtacactgat aagattaaaa atggcgaaga ggtctctctt cataacttta     37680
     ctgaagaatt taaaagaatt ttgaaagata ttgaaaaaga agtggatttc gaaaagttta     37740
     tttctctctg gttaaaggga ccagaagaag gttttggatt ttctaaagct ttacataacc     37800
     atttctttaa ttaaagataa ggaccagcca cataataagc tggtctttct ttattttccc     37860
     tcaagttcga actcctatga acagaatacc aggtatctat ccttccaaat atattgttat     37920
     tagcttgagg gtttgtgtgt ttttcttcat taatcataga attctcctta cctcagtcat     37980
     tttcttctat tatttgcagc tgatttcaaa ttaaataaaa taagcccttc tcattgagag     38040
     gggcttataa agtgactctt ctttattaaa gtcattaaac aacagattct ctctttatat     38100
     caaaaatatc aatctgtttt gattccagaa gatcttgtaa ataatctgag ccgtgttttt     38160
     cagctacttg caattctcct tcggatatag gtaaagccat tagccaagta acatttttgt     38220
     tactaaattc aagtagttct aaatcttcct cccataaaaa tgggggaacg aacataatat     38280
     gtttcatgtc ggtttcctga tcatacatac taatcacatt tttaaaaata acacctggtg     38340
     cacaagtgaa atttgagttg attatattaa aggcacaagt tgataaaaca ttagcatata     38400
     tgtctgaagc tgactccatt gcagctacga tttctatccg caacggagtg ccattcacct     38460
     cataattaat agaatgatcc gacaaaccta gagttgaata tgacgtgata ccttcctgag     38520
     gctggtcact aaccgataaa atatctatgc tgctattctt gttatcatcc caatatttcg     38580
     taaccttcgg tttcccccca aaagctccta aaactgttct agcaattact ttattttctt     38640
     gtgttacgcc cattagacaa tctctcctta atctccaaag taatcatccg tcatatcttc     38700
     ccctttatga ctcctattgg aggaaggtaa ttcgggttga tagtggtctg gattattatg     38760
     ttcatctaaa aattgctttc gactaatatt tctttccatc gcactttgtt gatgttttct     38820
     aaattcataa cctggtttat gacccatatc ccatggttca tcttttttca ttacttgttt     38880
     tgttaacggg tctttaacag atccggttga atccttagca ttttcccaaa ccttatctct     38940
     aacgccttta cggaaataag ttggtctttt gtacgtttta ggaactttag gttttttgct     39000
     ggtgttagtc gatgcttcgc taactcgaga acttgatttt gcattaagct ttttgttaat     39060
     tccgcgagct ccgaaaggaa ccaacattgc cattgcacca ctaaggctct gttcttgcct     39120
     ctctttggag actttattcc cgaacatatc gcgtcctgtt atagcttcac taaaaccatt     39180
     tgcagaagca agtccataaa gtcctttgct ggagttttga agggcatgga atgtcttagg     39240
     tgttttatat acatcgagag ctttgtctgc tctatacaat gctttacttg ttgaataaac     39300
     agcttttcca cctttagcta atttacctgc ccatcctacg atagggatgt atcctgccgc     39360
     agccattgca ccggcagcga cccgttgtcc agcagttagc ttttcgccgg taacaggatc     39420
     aaccccatca gcggctcttt tataatcata atatccagag acctctcctg taaaattaca     39480
     aacagcatcc caagactttt cataccatgg tctgttcgcc agttcttctt gttcttttgc     39540
     aattcttctt tgttccgcct gttggtcctt aaaagagatg tagtctgttg attgtttctt     39600
     tacatcctca gtcatcttgt gaatctcact gtctctataa gccttcgcat tatagtgaat     39660
     aggagaggcg cttttgcctt ttgctgtcgc attcattaaa gcttgataat cagcttgaat     39720
     catttgttca tttgcttctg atagtccgta ttctgatgtt aagttttggt caacttcatc     39780
     cattttctca atggcttctt ttcgtttctt ttcggcagac gaaagttcat ttttaaaagt     39840
     ttctgtcgag aacagatcca aaggcagtat atcgttgata tcatttaata tatctttcat     39900
     ggcttttttc tgttcagaca taatggattt tgatttggtg taggcgttag caagctcatg     39960
     cgctaaaaag gtttcttcta tgtaggcatc tgataagttg gcatcttcta aaaaaccagg     40020
     aatactcgtt aagaaagaaa ttttcatctc aattaaatca atccattggt cagcaatgcc     40080
     agcttgatct tcataaaatg atttaatgtt attagcgcct ttgcctgaaa actcgctatc     40140
     atctaaatct gcaacagctt tgaacgcttt ctttaatttg accattttac tttttaaatc     40200
     tttgtattcc tgtgctcgct tttcagcctc ggtgagcaag gttttggctt caaatacttt     40260
     catgatcata tcctttcatt taatcgtcat aacaaaatat taccatggaa gaatgatgaa     40320
     actaactgtt atgtggatca aatggtggaa atgaatcatt cgatctgtgt cattttacct     40380
     atttgttaat cctttcaatg aaaggggact ttccaattgt aacatcgcca tcatgaaaaa     40440
     attcgataac gtagccagat tcactaaaca taaaagtatc cgatccaacg gcagttacat     40500
     catcaattac gtttaatgca tgctcaagac tggtttttaa tgctggctgt tctccgtaac     40560
     cccaaagaat aataatgttc ctatctttaa aatggtgttt agctagccaa tcgtaaatct     40620
     cttcctcgta atctatagat tgatgacaac aaacttcttc ccacttgatt cgtccccaag     40680
     atgtaaggga aaactgtttg aaagcagttc ataatatttt gccgttaatt cttctgataa     40740
     gatttctttg tttttcccta gagcttctaa gcattcatca aataagtcca aaatgttcac     40800
     ctcaaaagct ttaagtatga tagatttttt cagtattaga aataagaaaa agccgttatg     40860
     aaacggctaa agggaatcag aactaatgtt gtttatcgaa ttaaacaagg aattcatgag     40920
     taggtgcgag agttacattc cgggatgctt ccttcatttc gccattatac atagatccga     40980
     aaaaggcaag tccaattaaa acggcggata aactgataaa caatttagat ttcatacatg     41040
     cattcccctt tcgatatttg cttttgagca tataccatct tcttgaaaca gatgatacta     41100
     tcctctattt tcccattata atcgaaaagg ttgcctccta acaatgccag ctcttccaga     41160
     taagggtatc ctttgccgtt ctctaaacga gaaaaaatgt tgagaagttt aggtgtatcg     41220
     ccatttctta tataaagaac gtctaatgct tcaaataagt tcataaatag ttcgtcttta     41280
     aaatctacag cacttctgat tcctttgcgg aagcaatcca ttgcttgtcc ttttttgcct     41340
     tgtttaaaat aaatcaacgc taggtcatga taagcttgcg gaagtacgtc agagttaatt     41400
     tttctgtatt gaaccaaggc ttgttcgatg taacgagcag ccttatttaa gttgtccatt     41460
     ttgtgatagc aattgccgag attgaaaaac gcagtggcat agatatgagt atttttactt     41520
     ttaagcagct cggcaccttt taaagcttct tgaaggtggg ggagagcttt ttcatgattt     41580
     tcaaggtcat cgtagttacc ggcaatgaca aaatggcact gaatacgacg aacagagtaa     41640
     agctcgtgtt tcttataaat gttgtatgaa agctcagcgt aatgcatcga aatgtgtgtc     41700
     attttcatat gataatagac ttcagacagt ttaaaataaa actcagcttt ttcaatcttg     41760
     tcggagattg taggaatttt gcgttcagct tttttgtaat atgtaatggc tcttgtgtat     41820
     tcaccgtttc taaactcata catcccgcgg aagaagttat aataatatgc ccgcatattg     41880
     tctaattttt tcttatggcc ctcaatttta tttaaatatt ctgaaagttc cattcggttt     41940
     tcatcagatg gcagcgtgta ttccaacata attttatggc gaaaggccat tagttgataa     42000
     taaataagca agtcttgatc ttcttccata acctctatat cacgttctat ttcagctttt     42060
     aacatttcag catcagttac gttgaatttt tgaatatgcc tatgccattc attaatcttc     42120
     attcccactt cagctgatgt gattgatatc aagatattca cccttccctt aactctacta     42180
     gtactgtaaa tattaacaag ttttcgttcg cagaaaaagg aaatagggca ccgcaattta     42240
     aattttcggt gagaccgcaa taactttttg ctttagagag ttatgaaatt ccctcctggg     42300
     agtaccatga cttggcatca aaaaacaggg aatttcggtc attcttgtga tagtttaaaa     42360
     ttgaaaacat ccagaaagtc cagcgttagt cgttttgagg ggctgagtgt gcatgtacag     42420
     ctaaacgcag aactgattct ggatttttct tgataaggaa attacttacc tacccactaa     42480
     aacttaacca attaattaat taatattcat ttggatatat ggaaaagtaa ttagacattc     42540
     acctccttcg tgctcccgca atacattatg ataaatgcct tcggaggtgg atttattgac     42600
     tgagttatat gctaaaagtg atcttgaaaa aattaaagaa acgctacctg gttggcaatt     42660
     agattcgttt aactatttga atgaaaaaat aggtgataaa gaaaataaat ttccttgtat     42720
     accgggaagg caagcatttt taagcgacca gctgcgaatt gcttttgtcg gtgatcctag     42780
     gaatcccgag actgcgaagg aattagcgcc attgcttact cggtatggaa ctatttcacg     42840
     agagacagga aagtatgcat cattaactgt aatatttcat acaccagaag aattactgac     42900
     tgattacaaa attgaggatt acgaatcgtt gttttggcag ttgctcaatt cattgagtat     42960
     ggaagatcca gctgattggc cagatgatat accagaaaat ccagataact ttcaatggga     43020
     atactgtttt aatggagaac catattttgt tctgtgtgct acaccggctc acagcaaaag     43080
     gaaaagcaga agttttcctt attttatgtt gacgtttcag cctagatggg tttttgagga     43140
     tctaaatgat actactgcat ttggacgaaa tatgagtaag caaattcgaa aaaggcttga     43200
     ggcatatgat gaagtaccta tccatccgca tttaggatgg tatggaaaaa aagacaatct     43260
     ggagtggaaa cagtacttct tgcgagatga tgaaaatcaa gtgtcacaat gcccttttat     43320
     gaaaatgaag aacttattca aaaaggaaag gtctgattaa attgtttaaa accttatgtg     43380
     gaaggatgga ttgaatggct tatatcttca cataaggttt taattgatga taaatctgtg     43440
     tgctctgact aaatacgtat tatctcgaat tattatcgat tctacatatt cacaaaaatt     43500
     atttaatgtt tttttcttga aattagaaat tagcgtttat gatctccgtt gctgtagtag     43560
     caaagtagcg atggaggaaa taataaaaat ggaaaacctc tatctggtta cacaagcttt     43620
     tagcgggttt tacaattaat caaaataaat tgatttattt gcttgcatta ttttaaaaat     43680
     catgagtata ataaatacat caaaaaaaat tgattaaaga aggcgatatg aatggatgag     43740
     acgaaatcag aactgctacg gaaatatgaa caaaaattta aggctcttgc tgatcagaaa     43800
     cgattagaga tcatgtatga actttgtcaa aggggaaaaa cctgtgtttg tgatctgact     43860
     gagatttttg aggtgacgca atctaaactt tcttatcatc taaaaatttt attggatgcc     43920
     aacttaataa cgaaagagac aaagggaaca tggagttatt atgatctaaa tgatgaggaa     43980
     gtaaatggtt tattatcaga agagctttgt tgtatattta gaaaaaaagg tgaaggagat     44040
     tgctgctaaa aaaatttttt aggtattata tcaaattttt ttgattaata tataagaggg     44100
     ggaattaaaa tgaaatatgt tcatgtaggg gttaacgttg tcagtttaga gaaatcgatc     44160
     aatttttatg aaaaagtttt tggagtaaag gctgtaaaag taaaaacaga ctatgcaaag     44220
     tttctattag agactcctgg actgaatttc actttaaatg tcgcagatga ggtgaaggga     44280
     aatcaagtga atcattttgg attccaagta gatagtttgg aagaagtttt gaaacacaag     44340
     aaaaggcttg aaaaagaagg gttttttgca cgtgaagaaa tggatacgac ttgttgttat     44400
     gcagtccaag ataaattttg gattactgat ccagatggga acgagtggga attttcctat     44460
     accaaatcga acagcgaggt tcaaaaacaa gattcctcct cttgttgtgt aacaccgcca     44520
     agtgatatta caacgaactc ttgctgttag taaaaaaggt gaggataaag taatgaaacg     44580
     tttatctttt ttagaccgtt atttaaccat ctggattttc cttgcgatgg cattggggat     44640
     aggattaggt tttatatttc cgagttttgt tggtggatta aacaaattac aagtaggaac     44700
     tacatctatc cctttagcta ttggattagt attaatgatg tatccaccac tagcaaaggt     44760
     tcgatatgaa gaaattggac gggtatttaa agatattaaa gtgttaattt tatctttagt     44820
     gcaaaactgg atcatcggac cgactctcat gtttattttg gctatcatct ttttgccaga     44880
     taaaccggag tatatgattg ggcttattat gattggatta gctcgctgta ttgcgatggt     44940
     tattgtttgg aatgacttat caaaaggtga tacggaatac gcggcaggat tagttgcttt     45000
     caactcaatt ttccaaatgc ttttttcctc agtttatgct tacatttttg taacagttat     45060
     cccgcaatgg ttagggatgg aaggagcagt agtgaatatt acgatggcag aagtcgcaaa     45120
     atcagtattc atttaccttg gagttccttt tattgcagga atggtgacac gttatatttt     45180
     tgtaaaagtg aagggcaaag aatggtatga aaaagtgttc attcctaaga ttagtccaat     45240
     tacgttaatt gctttgctat ttacaattat cgtcatgttt tccttaaaag gtgatgtaat     45300
     tgttagcttg ccgttagatg ttgtccgagt tgcgattcca ttattgattt actttgtttt     45360
     aatgttcttt gtttccttct ttttagggaa gaaaatcggg gcaaactatg ctgtaactac     45420
     tactttagct tttacagcag gaagcaataa ctttgaatta gcgattgctg tagctgttgg     45480
     tgtatttgga attcattcgg gtgcagcatt tgccgccgta attggtccgc ttgtagaagt     45540
     gccagtcatg atagcacttg ttaaggttgc tttatggttt caacgaaaat actttggaag     45600
     tcactcgatg tagaggtgga atatatggag aataaaatca tttacttttt atgtacaggg     45660
     aactcttgcc ggagccaaat ggctgaagga tgggctaaac aatatttagg tgatgagtgg     45720
     aaagtgtata gcgcggggat agaagcacat ggattaaatc cgaatgctgt taaagcgatg     45780
     aaggaagttg gtatagatat ctctaatcaa acgtcagata taatcgattc tgatattctg     45840
     aacaatgctg atttagttgt tacgctttgt ggagatgctg ctgataaatg cccgatgacg     45900
     cctccacatg taaaacgtga gcattggggt tttgatgatc cggcaagagc acaagggaca     45960
     gaagaagaaa aatgggcgtt tttccaaaga gttcgtgatg aaatagggaa taggttgaag     46020
     gaatttgctg aaacagggaa ataaataaac tcttttgtta aaggatgcat atttatatgt     46080
     gtcctttttt tattaatgtc tagctatacg aacttgacac cagtgaaatg tcattaacta     46140
     tctaacaatg aaaaacacta ctccattgta ctctcaaata ataataaatc attgaaaact     46200
     ataataagcg aatgttgagg catagaaaat aaaatctttt ctattgagga cctaaaggag     46260
     tgtagaaaag tcacaacaac tttttttaaa ttttttgcat attcattgaa acgtttaata     46320
     acactatagt ttaatttaaa atctcctcat ttggacaaac agctgttaca tagcattacc     46380
     caaggggtga tgcattttat gaaagtgata atcatcgagg gaccgcaagc tgacaaatgc     46440
     attaacgatt gctatcatta tttaataaaa ctttatagga aggagattca gggtgatagc     46500
     aatatatgta agggtatcga ccgaggaaca agcgatcaag ggatcgagca tcgacagcca     46560
     aatcgaggcc tgtataaaga aagcagggac taaagatgtg ctgaagtatg cagatgaagg     46620
     attttcagga gagcttttag aacgtccggc tttgaatcgc ttgagggagg atgcaagcaa     46680
     gggacttata agtcaagtca tttgttacga tcctgaccgt ctttctcgga aattaatgaa     46740
     tcagctaatc attgatgacg aattgcgaaa gcgaaacata cctttgattt ttgtaaatgg     46800
     tgaatacgcc aattctccag aaggtcaatt gtttttcgca atgcgcgggg caatctcaga     46860
     atttgaaaaa gccaaaatca aagaacggac atcaagcggc cgacttcaaa aaatgaaaaa     46920
     aggcatgatc attaaagatt ctaaactata tggctataaa tttgttaaag agaaaagaac     46980
     tcttgagata ttagaagagg aagcaaaaat cattcggatg atttttaact atttcaccga     47040
     tcataaaagc ccttttttcg gcagagtaaa tggtattgct ctacatttaa ctcagatggg     47100
     ggttaaaaca aaaaaaggcg ccaaagtatg gcacaggcag gttgttcggc aaatattaat     47160
     gaactcttcc tataagggtg aacatagaca gtataaatat gatacagagg gttcctatgt     47220
     ttcaaagcag gcagggaaca aatctataat taaaataagg cctgaagaag aacaaatcac     47280
     tgtgacaatt ccagcaattg ttccagctga acaatgggat tatgctcaag aactcttagg     47340
     tcaaagtaaa agaaaacact tgagtatcag ccctcacaat tacttgttat cgggtttggt     47400
     tagatgcgga aaatgcggaa ataccatgac agggaagaaa agaaaatcac atggtaaaga     47460
     ctactatgta tatacttgcc ggaaaaatta ttctggcgca aaggaccgcg gctgcggaaa     47520
     agaaatgtct gagaataaat tgaaccggca tgtatggggt gaaattttta aattcatcac     47580
     aaatcctcaa aagtatgttt cttttaaaga ggctgaacaa tcaaatcacc tgtctgatga     47640
     attagaactt attgaaaaag agatagagaa aacaaaaaaa ggccgcaagc gtcttttaac     47700
     gctaatcagc ctaagcgatg acgatgattt agacatagat gaaatcaaag cacaaattat     47760
     tgaactgcaa aaaaagcaaa atcagcttac tgaaaagtgt aacagaatcc agtcaaaaat     47820
     gaaagtccta gatgatacga gctcaagtga aaatgctcta aaaagagcca tcgactattt     47880
     tcaatcaatc ggtgcagata acttaactct tgaagataaa aaaacaattg ttaactttat     47940
     cgtgaaagaa gttaccattg tggattctga caccatatat attgaaacgt attaaagagg     48000
     ggtgtatgca cccccctttt gtaattacaa tc                                   48032
//

If you have problems or comments...

PBIL Back to PBIL home page