(data stored in SCRATCH zone)

EMBL: D38161

ID   D38161; SV 1; linear; genomic DNA; STD; PRO; 17484 BP.
XX
AC   D38161;
XX
DT   15-MAR-1995 (Rel. 43, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 13)
XX
DE   Bacillus subtilis genome around 39 degrees region encoding 17 ORFs,
DE   complete cds.
XX
KW   3-isopropylmalate dehydrogenase; aryl-alcohol dehydrogenase;
KW   hypothetical 29.7 kDa protein; lactam utilization protein;
KW   mannitol-1-phosphate dehydrogenase;
KW   mannitol-specific phophotransferase enzyme II;
KW   penicillin-binding protein 2; regulatory protein for aceAB; SipS;
KW   urea amydolyase.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-17484
RA   Yamane K.;
RT   ;
RL   Submitted (05-SEP-1994) to the INSDC.
RL   Kunio Yamane, Inst. Biological Sciences, Tsukuba University; Tsukuba,
RL   Ibaraki 305, Japan (Tel:0298-53-6419, Fax:0298-53-6006)
XX
RN   [2]
RP   1-17484
RA   Yamane K.;
RT   ;
RL   Unpublished.
XX
RN   [3]
RX   PUBMED; 8574415.
RA   Akagawa E., Kurita K., Sugawara T., Nakamura K., Kasahara Y., Ogasawara N.,
RA   Yamane K.;
RT   "Determination of a 17,484 bp nucleotide sequence around the 39 degrees
RT   region of the Bacillus subtilis chromosome and similarity analysis of the
RT   products of putative ORFs";
RL   Microbiology (Reading, Engl.) 141:3241-3245(1995).
XX
RN   [4]
RX   PUBMED; 7704252.
RA   Ogasawara N., Fujita Y., Kobayashi Y., Sadaie Y., Tanaka T., Takahashi H.,
RA   Yamane K., Yoshikawa H.;
RT   "Systematic sequencing of the Bacillus subtilis genome: progress report of
RT   the Japanese group";
RL   Microbiology (Reading, Engl.) 141:257-259(1995).
XX
DR   MD5; 9fa8143ea1800ffec52c5650f640f06b.
DR   EuropePMC; PMC105448; 9449253.
DR   EuropePMC; PMC178458; 8830698.
DR   EuropePMC; PMC90910; 9835550.
XX
CC   Sequence updated (28-Apr-1995)by:
CC   Kunio Yamane
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..17484
FT                   /organism="Bacillus subtilis"
FT                   /chromosome="39 degrees region"
FT                   /strain="168TrpC2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        249..2081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /product="mannitol-specific phophotransferase enzyme II"
FT                   /db_xref="GOA:P42956"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42956"
FT                   /protein_id="BAA07350.1"
FT                   /translation="MQQQEQQQGGMKVKVQRFGSYLSGMIMPNIGAFIAWGIITALFIP
FT                   AGWFPNEQLNTLVSPMITYLLPLLIAYTGGKMIYDHRGGVVGATAAIGVIVGSDIPMFL
FT                   GAMIMGPLGGYLIKQTDKLFKDKVKQGFGIRINNFTAGIVGAALTILAFYAIGPVVLTL
FT                   NKLLAAGVEVIVHANLLPVASVFLEPAKVLFLNNAINHGILSPIGIEQASQTGKSILFL
FT                   VEANPGPGLGIFLAYMFFGKGSSKSTAPGAAIIHFFGGIHEIYFPYILMKPGPDSRSHC
FT                   RRSKRTLNITIFNAGLVAAASPGSIIALMAMTPRGGYFGVLAGVLVAAAVSFIVSAVIL
FT                   KSSKASEEDLAAATEKMQSMKGKKSQAAAALEAEQAKAEKRLSCLLKARTKLSFRVIRD
FT                   GIKCHGGIHLKKQSEKAELDISVTNTAINNLPSDADIVITHKDLTDRAKAKLPNATHIS
FT                   VDNFLNSPKYDELIEKLKSNLIEREYCHASTRKGNIKLNQTVSSKEEAIKLAGQTLIDN
FT                   GYVTEDYISKMFDREETSSTFMGNFIAIPHGTEEAKSEVLHSGISIIQIPEGVEYGEGN
FT                   TAKVVFGIAGKNNEHLDILSNIAIICSEEETLNA"
FT   CDS_pept        2134..3234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlB"
FT                   /product="mannitol-1-phosphate dehydrogenase"
FT                   /db_xref="GOA:P42957"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42957"
FT                   /protein_id="BAA07351.1"
FT                   /translation="MIALHFGAGNIGRGFIGALLHHSGYDVVFADVNETMVSLLNEKKE
FT                   YTVELAEEGRSSEIIGPVSAINSGSQTEELYRLMNEAALITTAVGPNVLKLIAPSIAEG
FT                   LRRRNTANTLNIIACENMIGGSSFLKKEIYSHLTEAEQKSVSETLGFPNSAVDRIVPIQ
FT                   HHEDPLKVSVEPFFEWVIDESGFKGKTPVINGALFVDDLTPYIERKLFTVNTGHAVTAY
FT                   VGYQRGLKTVKEAIDHPEIRRVVHSALLETGDYLVKSYGFKQTEHEQYIKNQRSLLKSF
FT                   HFGRCDPRSEVTSQKTGRKCRLVGPAKKIKEPNALAEGIAAALRFDFTGDPEAVELQAL
FT                   IEEKDTAAYFKRCAAFSPMNRCTPSF"
FT   CDS_pept        3706..4242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="similar of LeuC (34%) identity, but different
FT                   function"
FT                   /db_xref="GOA:P42958"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42958"
FT                   /protein_id="BAA07352.1"
FT                   /translation="MIFDFVVIRENSEGEYSEVVGRIHRGDDEIAIQNAVFTRKATERV
FT                   MRFAFELAKKRRTLVTSATKSNGIYHAMPFWDEVFQQTAADYSGIETSSQHIDALAAFF
FT                   VTRPETFDVIVASKLFGDILTDISSSLMESIGIAPPDINPSGKYPSMFEPVHGSAPDIA
FT                   GQALPIRSARFGQRS"
FT   CDS_pept        4532..5095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="another SipS of B. subtilis"
FT                   /db_xref="GOA:P42959"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42959"
FT                   /protein_id="BAA07353.1"
FT                   /translation="MNAKTITLKKKRKIKTIVVLSIIMIAALIFTIRLVFYKPFLIEGS
FT                   SMAPTLKDSERILVDKAVKWTGGFHRGDIIVIHDKKSGRSFVKRLIGLPGDSIKMKNDQ
FT                   LYINDKKVEEPYLKEYKQEVKESGVTLTGDFEVEVPSGKYFVMGDNRLNSLDSRNGMGM
FT                   PSEDDIIGTESLVFYPFGEMRQAK"
FT   CDS_pept        5399..5845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JMQ0"
FT                   /protein_id="BAA07354.1"
FT                   /translation="MMKRVAYPGTVITNRSAHLRHTAAFPCDSSPHAESNHKDVPSGVL
FT                   PDHRLDDGFSRFQPFVFCKLFVCRFFFFQCVDFILAEQVGRQHIISSHFDQPAHLFHMA
FT                   VYTIYFVCENDKRFWEHNGLLLCFFHYILSFHFRLRYNGQKKEI"
FT   CDS_pept        5847..6359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42961"
FT                   /protein_id="BAA07355.1"
FT                   /translation="MNSLSLPHRYPFLFIDGVTDSEPGKHAAAYKLISENDWFITDTQT
FT                   EMPFSLVIEGLRKPRLLQELQMRTAWDYCLRKRKSWEKLCLVTGLILRLKSRAIGAGLC
FT                   SDMPRHQLESSLLLKLKSASILKNEKNPSQHFVRGSILCRNPVRFESYLFAGVCVFHHS
FT                   YFPSALH"
FT   CDS_pept        6562..7311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="similar to hypothetical 29,7 kDa E. coli protein"
FT                   /db_xref="GOA:P42962"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42962"
FT                   /protein_id="BAA07356.1"
FT                   /translation="MSVQREDVDIKLIAIDMDGTLLNDEQLISDENRKAIREAEDKGVY
FT                   VVISTGRTLMTCRELAESLKLSSFLITANGSEIWDSNFNLVERKLLHTDHIQMMWDLRN
FT                   KHNTNFWASTVNKVWRGEFPENITDHEWLKFGFDIEDDDIRNEVLEELRKTKSSEITNS
FT                   SPTNIEVNALGINKAAAPCQGYGKLGFTMENVMAMGDSLNDIAMIKEAGLGVAMGNAQD
FT                   IVKETADYITDTNIEDGVAKAIRHWVL"
FT   CDS_pept        7651..8151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="lactam utilization protein"
FT                   /db_xref="GOA:P42963"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42963"
FT                   /protein_id="BAA07357.1"
FT                   /translation="MRKTVALAAERGVKMGAHPGLPDLLGFGRRNMAISPEEAYDLVVY
FT                   QIGALSGFLKAEGLHMQHVKPHGALYNMAAVDQKLSDAIAKAVYKVDPGLILFGLAESE
FT                   LVKAGERIGLQTANEVFADRTYQSDGTLTPAPSRTHSLKVMMPRHPGHQNGERRGGQIS
FT                   ARP"
FT   CDS_pept        8350..8688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42964"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42964"
FT                   /protein_id="BAA07358.1"
FT                   /translation="MLMGAAFLMATSAIGPGFLTQTATFTNTLAASFGFVILISIILDI
FT                   FAQTNVWRIIAVSGKRGQEIANMVLPGLGYSIAILVVLGGLAFNIGNIGGAGWDFRCCS
FT                   ALHLKQAL"
FT   CDS_pept        8978..9517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42964"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42964"
FT                   /protein_id="BAA07359.1"
FT                   /translation="MTKSSVVGILITSVMRIALFFAVLGVVSKGLHIDESNPAASVFKL
FT                   AAGNVGYKIFGLIMWSAAITSVIGAAYTSVSFFKTFSPKIEKNSRGIIIGFIVVSTLAF
FT                   VTIGQPAKILVLVGSLNGLILPIALGTLLVAAYKKNIVGDYKHPLWLTSTGALVVIVMA
FT                   VMGIYTLCTQLPQLWS"
FT   CDS_pept        9541..10314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42966"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42966"
FT                   /protein_id="BAA07360.1"
FT                   /translation="MAPKDVRALIREGKINGPTAGMSGGYAQANLVVLKKDLAFDFLLF
FT                   CQRNQKPCPVLDVTEAGSPVPSLLRRMLISRTDFPKYRIYRHGILTEEVSDITPYWEDD
FT                   FVGFLIGCSFSFEQALINNGIAVRHIDEGTNVSMYKTNIDCFPVGAFHGQMVVSMRPVP
FT                   ERLAVRAAQVTSRFPAVHGGPIHIGNPGAIGIRDLGKPDFGDAVSIRDGEVPVFWACGV
FT                   TPQAVAMNVKPEMVITHAPGHMLITDIRDESLAVL"
FT   CDS_pept        10358..12094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="urea amidolyase"
FT                   /db_xref="GOA:P60495"
FT                   /db_xref="GOA:Q7WY77"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="PDB:2KWA"
FT                   /db_xref="PDB:2ZP2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60495"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WY77"
FT                   /protein_id="BAA07361.1"
FT                   /translation="MTVRYQIEQLGDSAMMIRFGEEINEQVNGIVHAAAAYIEEQPFPG
FT                   FIECIPAFTSLTVFYDMYEVYKHLPQGISSPFESVKRDVEERLAEIAEDYEVNRRIVEI
FT                   PVCYGGEFGPDLEEVAKINQLSPEEVIDIHTNGEYVVYMLGFAPGFPFLGGMSKRIAAP
FT                   RKSSPRPSIPAGSVGIAGLQTGVYPISTPGGWQLIGKTPLALFRPQENPPTLLRAGDIV
FT                   KFVRISEKTITPIRRSPIEHESIKARTAHNGSGYRQNGLPKIRRSGQRRYGHGFTAHCQ
FT                   SVDRKRRNEAGLEITMMGPGPSFHFSKQTLIAVTGADFTLRINDEEAPLWKPVLIKENS
FT                   TVSFGPCKLGSRAYLAAAGGIEVPAVMESKSTYVRGSIGGLHGRALQKEDELNIGEMSA
FT                   LSQTILSRLSSQLAHTVIGSTDVVSQPWEISVIEDESRHSSAGGISICLLHSRIKNAFS
FT                   EEAFRVTPQSDRMGYRLKGEPLDLTAPLEMVSAAVSFGAAQMPPAGKPYYPCLQDRQDD
FT                   WPAIRGIAHIISADLPIVSQIMPGEHVQFEPVSLQEAEALAVEREQHIKELKTRMKMEW
FT                   LT"
FT   CDS_pept        12107..12850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="regulatory protein for aceAB"
FT                   /db_xref="GOA:P42968"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42968"
FT                   /protein_id="BAA07362.1"
FT                   /translation="MMQNKNKTVVKSMALLNLFLHKPSLTLSELVSLTGMPKTSVHRMV
FT                   SSLEEMGFLSRDASGAYSLGLVFLEFGQLVADRLDIRKIAKPVMEELCREVDEAVQLIM
FT                   RDGNEAIYVEKIEGTQTVRLYTAIGRRSPLYAGACARSILSFLPREEIEAYIKQTELIS
FT                   IGSGTITDPEKLLQEIDASVQNGYTVSYSELENYTAAIGAPIFNHERQVAAGISIAGFE
FT                   ARFTEDRLPYLTEKVKDAALQISRK"
FT   CDS_pept        12925..13566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42969"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42969"
FT                   /protein_id="BAA07363.1"
FT                   /translation="MVLRYTALGDSLTTGRGSGLFSPGFVQRFGDMMEADLKTRTAINI
FT                   FARSGLNTEEILGLLSYPYVQKCIRDADMITITGCGNDLIDSVLAYQTSKDETIFSRVS
FT                   AHCHENFEKMIAKVAEIKGENPSPYAIRVFNLYNPFPEIDIAGKWITSFNSHLETLASA
FT                   PHVKIADAYSIFKGKEQEYLSFDGVHPNSKGYQAMAEAVHKLGYKELSVS"
FT   CDS_pept        13755..14069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42970"
FT                   /db_xref="InterPro:IPR025018"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42970"
FT                   /protein_id="BAA07364.1"
FT                   /translation="MSFAVIIIILALIAFNYTEHTSVIQSVMLVFLGAVMFMQGLEERK
FT                   KENDGSGAFNIYTAVLYGLSPLSVLHFILYKSILHILKMLDRRERGIEPMKQGFPLLIL
FT                   "
FT   CDS_pept        14425..16431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="penicillin-binding protein 2"
FT                   /db_xref="GOA:P42971"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42971"
FT                   /protein_id="BAA07365.1"
FT                   /translation="MLKKCILLVFLCVGLIGLIGCSKTDSPEDRMEAFVKQWNDQQFDD
FT                   MYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVS
FT                   MNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIY
FT                   DKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSF
FT                   VPLKKVKPDQEKLVSEATSLQGVTRTNVSSRYYPYGEKTAHLTGYVRAITAEELKKKKE
FT                   GTYSDTSNIGIAGLENVYEDKLRGTTGWKIYVPQTGEVIAEKKAKDGEDLHLTIDIKTQ
FT                   MKLYDELKDDSGAAVALQPKTGETLALVSAPSYDPNGFIFGWSDKEWKKLNKDKNNPFS
FT                   AKFNKTYAPGSTIKPIAAAIGIKNGTLKADEKKTIKGKEWQKDSSWGGYSVTRVSERLQ
FT                   QVDLENALITSDNIYFAQNALDMGADTFTKGLKTFGFSEDVPYEFPIQKSSIANDKLDS
FT                   DILLADTGYGQGQMQMSPLHLATAYTPFVDNGDLVKPTLIKKDSQTADVWHKQVVTKEG
FT                   AADITKGLKGVVEDERGSAYQPVVKGITVAGKTGTAELKTSKDDKDGTENGWFVGYDYE
FT                   NKDLLVAMMIQNVQDRGGSHYVVEKAKKQFQSN"
FT   CDS_pept        16533..17435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="aryl-alcohol dehydrogenase"
FT                   /db_xref="GOA:P42972"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42972"
FT                   /protein_id="BAA07366.1"
FT                   /translation="MQRIQLAEDLQFSRVIHGLWRLNEWNYSDAELLSLIEWCIDHGIT
FT                   TFDHADIYGGYTCEKLFGNALALSPGLRENIELVTKCGIVLESPERPAHRSHHYNTSKS
FT                   HILASVEQSLMNLRTDYIDMLLIHRPDPLMDPEGVAEAFQALKCSGKVRYFGVSNFKDH
FT                   QYRMLESYLPEKLVTNQIELSAYELENMLDGTLNLCQEKRIPPMAWSPLAGGKVFTENT
FT                   DKDRRVRTALESVQGEIGAASLDEVMYAWLYTHPAGIMPIVGSGKRERISAAINALSYK
FT                   LDQDQWFRIFTAVQGYDIP"
XX
SQ   Sequence 17484 BP; 5000 A; 3740 C; 4403 G; 4341 T; 0 other;
     gagtgagcgg atgattgcaa agtacgtgat tcaaaatggc aacatcattt atagaggaaa        60
     gagaaaaggc tcctgaaacc aggagccttt ttatttttaa aaaattgtca cagtcatgtg       120
     ccaaagtcct ctttactttc aattgtatag ggactgtaag cgttttaaca tagagtcaaa       180
     gggaagcatc attctctgaa catatttttg tatcttacag cgacaaacaa aacagggagg       240
     gtttatatat gcagcagcaa gaacagcagc aaggcggcat gaaagtgaaa gtgcaacgct       300
     ttgggagtta tttgagcgga atgatcatgc cgaatatcgg cgcgtttatc gcgtggggta       360
     tcattaccgc gctgtttatt ccggcaggat ggtttccgaa tgaacagctg aacacgctgg       420
     tcagcccgat gattacgtat ttattgccgc ttttgatagc gtatacaggc ggaaaaatga       480
     tctacgacca ccgcggcgga gttgtcggag cgacagcggc aattggggtg attgtaggat       540
     cggatattcc aatgttttta ggcgcaatga ttatgggtcc gcttggcgga tacctcatta       600
     aacagactga taaattattc aaggataaag tcaagcaagg ctttggaatt cggatcaaca       660
     actttacggc agggattgtc ggcgcggctt taacgattct cgcgttttac gccatcggcc       720
     cggttgtttt gacgctaaat aaattgctgg cggctggtgt ggaagtcatt gtacacgcta       780
     atttactgcc ggtagccagt gtttttttag aaccggcgaa agtgttgttc cttaacaacg       840
     ccataaacca tggaatctta agcccgatcg gaatcgagca agcatctcaa acaggaaaat       900
     caattctgtt tttagtagaa gcaaaccctg gaccggggct cggcattttc ctggcctaca       960
     tgttctttgg caaaggatct tcaaaatcaa cggctcccgg tgcggcgatc atccatttct      1020
     tcggagggat tcacgagatt tacttcccgt acattctgat gaaacctggc cctgattctc      1080
     gcagccattg ccggcggagc aagcggactc ttaacattac gatctttaat gccggacttg      1140
     tcgcggcagc gtcaccggga agcattatcg cattgatggc aatgacgcca agaggaggct      1200
     atttcggcgt attggcgggt gtattggtcg ctgcagctgt atcgttcatc gtttcagcag      1260
     tgatcctgaa atcctctaaa gctagtgaag aagacctggc tgccgcaaca gaaaaaatgc      1320
     agtccatgaa ggggaagaaa agccaagcag cagctgcttt agaggcggaa caagccaaag      1380
     cagagaagcg tctgagctgt ctcctgaaag cgcgaacaaa attatctttt cgtgtgatcc      1440
     gggatgggat caagtgccat gggggcatcc atcttaagaa acaaagtgaa aaagcggagc      1500
     ttgacatcag tgtgaccaac acggccatta acaatctgcc aagcgatgcg gatattgtca      1560
     tcacccacaa agatttaaca gaccgcgcga aagcaaagct gccgaacgcg acgcacatat      1620
     cagtggataa cttcttaaac agcccgaaat acgacgagct gattgaaaag ctgaaaagta      1680
     atcttataga aagagagtat tgtcatgcaa gtactcgcaa aggaaacatt aaactcaatc      1740
     aaacggtatc atcaaaagaa gaggctatca aattggcagg ccagacgctg attgacaacg      1800
     gctacgtgac agaggattac attagcaaaa tgtttgaccg tgaagaaacg tcttctacgt      1860
     ttatggggaa tttcattgcc attccacacg gcacagaaga agcgaaaagc gaggtgcttc      1920
     actcaggaat ttcaatcata cagattccag agggcgttga gtacggagaa ggcaacacgg      1980
     caaaagtggt attcggcatt gcgggtaaaa ataatgagca tttagacatt ttgtctaaca      2040
     tcgccattat ctgttcagaa gaagaaacat tgaacgcctg atctccgcta aagcgaagaa      2100
     gatttgatcg ccatttcaac gaggtgaact gacatgatcg ccttacattt cggtgcggga      2160
     aatatcggga gaggatttat cggcgcgctg cttcaccact ccggctatga tgtggtgttt      2220
     gcggatgtga acgaaacgat ggtcagcctc ctcaatgaaa aaaaagaata cacagtggaa      2280
     ctggcggaag agggacgttc atcggagatc attggcccgg tgagcgctat taacagcggc      2340
     agtcagaccg aggagctgta ccggctgatg aatgaggcgg cgctcatcac aacagctgtc      2400
     ggcccgaatg tcctgaagct gattgccccg tctatcgcag aaggtttaag acgaagaaat      2460
     actgcaaaca cactgaatat cattgcctgc gaaaatatga ttggcggaag cagcttctta      2520
     aagaaagaaa tatacagcca tttaacggaa gcagagcaga aatccgtcag tgaaacgtta      2580
     ggttttccga attctgccgt tgaccggatc gtcccgattc agcatcatga agacccgctg      2640
     aaagtatcgg ttgaaccatt tttcgaatgg gtcattgatg aatcaggctt taaagggaaa      2700
     acaccagtca taaacggcgc actgtttgtt gatgatttaa cgccgtacat cgaacggaag      2760
     ctgtttacgg tcaataccgg acacgcggtc acagcgtatg tcggctatca gcgcggactc      2820
     aaaacggtca aagaagcaat tgatcatccg gaaatccgcc gtgttgttca ttcggcgctg      2880
     cttgaaactg gtgactatct cgtcaaatcg tatggcttta agcaaactga acacgaacaa      2940
     tatattaaaa atcagcggtc gcttttaaaa tcctttcatt tcggacgatg tgacccgcgt      3000
     agcgaggtca cctctcagaa aactgggaga aaatgtagac ttgtaggccc ggcaaagaaa      3060
     ataaaagaac cgaatgcact ggctgaagga attgccgcag cactgcgctt cgatttcacc      3120
     ggtgaccctg aagcggttga actgcaagcg ctgatcgaag aaaaggatac agcggcgtac      3180
     ttcaagaggt gtgcggcatt cagtcccatg aaccgttgca cgccatcatt ttaaagaaac      3240
     ttaatcaata accgaccacc cgtgacacaa tgtcacgggc tttttactat ctcgcaatct      3300
     agtataatag aaagcgctta cgataacagg ggaaggagaa tgacgatgaa acaatttgag      3360
     attgcggcaa taccgggaga cggagtagga aagaggttgt agcggctgct gagaaagtgc      3420
     ttcatacagc ggctgaggta cacggaggtt tgtcattctc attcacagct tttccatgga      3480
     gctgtgatta ttacttggag cacggcaaaa atgatgcccg aagatggaat acatacgctt      3540
     actcaatttg aagcagtttt tgggagctgt cggaaatccg aagctggttc ccgatcatat      3600
     atcgttatgg ggctgctgct gaaatccgga gggagcttga gctttccatt aatatgagac      3660
     ccgccaaaca aatggcaggc attacgtcgc cgcttctgca tccaaatgat ttttgacttc      3720
     gtggtgattc gcgagaacag tgaaggtgaa tacagtgaag ttgtcgggcg cattcacaga      3780
     ggcgatgatg aaatcgccat ccagaatgcc gtgtttacga gaaaagcgac agaacgtgtc      3840
     atgcgctttg ccttcgaatt ggcgaaaaaa cggcgcacac tcgtgacaag cgccacaaag      3900
     tctaacggca tttatcacgc gatgccgttt tgggatgaag tctttcagca gacagccgct      3960
     gattatagcg gaatcgagac atcatctcag catattgatg cgctggccgc tttttttgtg      4020
     acgcgtccgg aaacgtttga tgtcattgtg gcgagcaaat tgttcggtga tattttaacc      4080
     gacatcagct caagcctgat ggaaagcatc ggcattgcgc ctcccgacat caatccatcc      4140
     ggcaaatatc cgtccatgtt tgaaccggtt cacggctcag ctcctgacat tgccggacag      4200
     gccttgccaa tccgatcggc cagatttgga cagcgaagct gatgctcgac cacttcggag      4260
     aggaagaatt gggggcgaaa attctggatg taatggagca agtgactgcc gacggcatca      4320
     aaacacgcga cattggggga caaagcacaa cggctgaggt cactgatgaa atctgttcgc      4380
     gcttaagaaa gctctgatga atcaggccgg tggcagatgg ctgccccggt ctgtccattt      4440
     ccttacgaaa atttccacga aagtctaacc aagcagatcc aaatgctgta taataatttg      4500
     gaattcttag gaaagcatcg ggtgaaggaa gttgaatgca aaaacaatca cgttaaagaa      4560
     aaaaagaaaa atcaaaacga tcgttgtact cagtatcatt atgatcgcag ctctcatttt      4620
     tacgatcaga ttggtgtttt acaagccttt tcttattgaa ggatcatcaa tggccccaac      4680
     gcttaaagac tcagaaagaa ttctggttga taaagcagtc aaatggactg gcgggtttca      4740
     cagaggagac atcatagtca ttcatgacaa aaagagcggc cgctcatttg tcaaacgttt      4800
     aatcggtttg cctggtgaca gcattaaaat gaaaaatgat cagctataca taaatgataa      4860
     aaaggtggaa gaaccatact taaaggaata taaacaggag gtcaaagagt cgggtgtaac      4920
     cttaacaggt gacttcgaag ttgaggttcc ttccggtaaa tattttgtga tgggagataa      4980
     ccgtctcaat tcactggata gcagaaacgg aatgggcatg ccttctgagg acgatatcat      5040
     cggtactgaa tctctcgtct tttatccatt cggtgagatg agacaggcaa aataaaatgc      5100
     aatgcaaaaa gaacatggaa catgacggca ccgataataa agcgccgtgc acgtttaaaa      5160
     aaatgatgat gaaacggtgc ggagcggctt tccgccccgt tttttatgat agaaagcgtt      5220
     ttgaagaaaa gggccctgtt gaaataaaca gaatcaggat tggcgaagcg tgaagcgcat      5280
     cgaattggta aatctcaaga tgggtatgct gtttttcccg cagttttttg ataagaagcg      5340
     ctacgtcaaa cgacggctca taattaggga aaaacaatag gaccgggcag gctggcatgt      5400
     gatgaagaga gtcgcgtatc cgggaaccgt aataacaaac cgatccgctc acctcaggca      5460
     tactgctgca tttccatgcg atagtagccc ccacgctgaa tccaatcaca aagatgtgcc      5520
     gtccggcgtt ttgcctgatc acaggctgga tgatggtttc tcccgttttc agcctttcgt      5580
     gttttgtaaa ttgttcgtat gccgtttttt cttctttcag tgtgtagact tcatcctcgc      5640
     cgagcaggtt gggcgtcaac acatcatatc cagccatttt gatcagccgg cccatctttt      5700
     tcatatggct gtttacacca tatatttcgt gtgcgagaat gacaagcggt tttgggaaca      5760
     taacggcctc cttttgtgtt ttttccatta tatcctatcg tttcacttta ggctgagata      5820
     taatggtcaa aaaaaggaga tataaaatga actcattatc tttgcctcac cgctatccat      5880
     ttttgtttat tgatggcgtg acggatagcg agcccggcaa acatgcggca gcttataagc      5940
     tgattagtga gaacgactgg tttatcactg atacgcaaac agaaatgccg ttttcacttg      6000
     tgattgaagg cttgcgcaaa ccgcggcttt tacaggaatt acagatgaga acagcttggg      6060
     attattgtct tcgaaagcgg aaaagctggg agaagctgtg cctggtgacc ggcttgatct      6120
     tacgtttgaa gtcacgcgca atcggcgcgg gtttgtgttc ggacatgcca aggcatcagt      6180
     tggagagcag cctgttgctg aagctgaaat cggcatctat attgaaaaat gaaaaaaacc      6240
     cttcacaaca ttttgtgagg ggttctattt tgtgtcgtaa tcccgttcgc tttgagagtt      6300
     atctctttgc tggcgtttgt gtttttcatc attcatattt tccttcagct cttcattagg      6360
     aatcggatcg gttaagtcgt tgtgctcggg gttttcattt ggtttgtttt gctgtttttt      6420
     ttctgtcatg tttgatcacc tcaccgtttg ttttcctctt attcattctc ctcaaacata      6480
     ggaaatcgct tttttgtccc gctgggtata atgtattaga atagagagaa gcacaacaaa      6540
     aagataaaga gaggtacata tatgtctgtc caaagagaag atgtagatat caagctgatc      6600
     gcaattgata tggatggtac actgctgaac gacgagcagc tgatctcgga tgaaaaccgc      6660
     aaagccattc gtgaagcgga ggataaaggt gtgtatgtgg tgatcagcac gggccggacg      6720
     ctgatgacgt gcagggagct ggcggaatcg ctaaagctgt catcctttct aatcacggca      6780
     aacggcagtg aaatttggga ttcgaatttt aatttggtgg aacggaagct gcttcatacg      6840
     gaccatattc aaatgatgtg ggatttgcgg aataagcaca acactaattt ctgggcttct      6900
     acggtgaata aagtatggag aggcgagttt ccggaaaaca ttacggatca tgaatggctc      6960
     aaattcggct ttgacatcga ggatgacgat atccgaaacg aagtgcttga ggagctgagg      7020
     aaaacaaaga gctctgaaat cacaaattca agtccgacaa acattgaagt caacgcgctt      7080
     ggcatcaaca aagctgcagc cccttgccaa ggttacggaa aactcggctt tacaatggag      7140
     aatgtgatgg cgatgggcga cagccttaat gacattgcga tgatcaaaga agcgggtctt      7200
     ggcgtcgcaa tgggcaatgc gcaagacatc gtaaaagaaa cggctgatta tatcacggat      7260
     acaaatattg aggatggtgt cgctaaagcg attcgccatt gggtactata aaaaaagaga      7320
     gtcctaagat ggactctctt tttagtttgg caggttttat tctgggacca tggtaggttt      7380
     tctgacaaaa gtatttcaca aactgatatg attcacttat aatgaaataa agttcaaaaa      7440
     ttcggaatag tcgttccgaa tttcgggaca ataaatgaca taaagcatat cgtttgcttt      7500
     ggcaggaggg attctttgtt tcaaattgat ttaaactgtg atttaggaga aagcttcgga      7560
     gcctacaaga taggccttga ccaagatatt ttagagtatg tgacatcagc gaatatcgca      7620
     tgcggatttc atgcaggaga tcctagtgtt atgcgaaaaa ccgtcgcgct tgcagcagaa      7680
     agaggcgtga aaatgggtgc gcatccgggc ttgccggatt tactcggttt tgggcgccgc      7740
     aatatggcga tttctcctga ggaagcgtat gatcttgtcg tttatcaaat tggcgcgctc      7800
     tctggctttc taaaagcaga gggacttcac atgcagcacg tcaagccgca tggcgcttta      7860
     tacaatatgg cggcagtcga tcaaaaactg tcggatgcta tcgcgaaagc tgtctataag      7920
     gttgatcccg gcctgattct tttcggtctt gctgagagcg agcttgtaaa agcgggagaa      7980
     cggatcggac ttcagaccgc aaatgaagtg ttcgccgaca gaacatacca atcggacggc      8040
     acgctgacac cggctcccag ccggacgcac tcattgaaag tgatgatgcc gcgtcaccca      8100
     ggtcatcaaa atggtgaaag aaggggcggt caaatttcag caaggccatg attgtgtcat      8160
     ttaaaagcgg ttcagttttc atttatggag atggagccca tgcgctgaca tttgcgcaaa      8220
     aaatcagaaa acagctcaaa gcggctggaa ttgaagtgac agctatttca gaacagaggt      8280
     caacataaag gaggaacaat agatggagca gcagaaaaag acagcaggaa aaaagcgggc      8340
     agctggtcat tgctgatggg cgccgccttt ttaatggcga catcagcaat cggaccgggt      8400
     ttcctcaccc aaaccgcaac attcacaaac acactcgcag caagcttcgg ttttgtcatc      8460
     ttaatctcta ttattttaga tattttcgcc caaaccaatg tgtggcgcat catcgcagtt      8520
     tctggaaaac gaggtcagga aattgcgaat atggtgcttc ccggactggg gtattccatc      8580
     gccattctcg tcgtgcttgg cggactagct tttaatattg ggaatatcgg aggggcgggc      8640
     tgggacttca ggtgctgttc ggcattacac ctgaaacagg cgctttaatc cagtgccgtt      8700
     atcgccattt tgatttttgt catcaaggaa gcaggaatag cgatggaccg ttttacgcaa      8760
     atcgcggggt tcgtaatgat tattttaacg gtctacgttg cggcgacgac agctcctccg      8820
     gtcggacagg cagtcgcaaa tacattcgtc ccggaacaca tcagcatatt tgccattgtc      8880
     accctagtgg gcggaaccgt cggcggttat atcacatttg cccggaggac accgtttgct      8940
     tgatgccgga attaaaggaa aggaatccat tccgcaggtg acaaagagct cggttgtcgg      9000
     cattttaatt acatctgtca tgcgtatcgc tctttttttt gcggttctag gcgttgtatc      9060
     gaaaggcctg cacatcgatg aaagcaaccc ggcggcttct gtcttcaagc tggctgctgg      9120
     aaatgtcggt tataaaattt tcggattgat catgtggtct gcggcgatta cgtctgttat      9180
     tggagcagcc tatacatctg tttcattttt taaaaccttt tctccaaaaa ttgaaaagaa      9240
     ttcacgcggt attattatcg gatttattgt ggtttctacg ttagcttttg tcacaatcgg      9300
     ccagcctgcg aagatcctcg tccttgtggg ttcactgaac ggcttaattc tgccgattgc      9360
     gctcggaacg ctgcttgttg ccgcctacaa gaaaaacatt gtcggtgatt ataagcatcc      9420
     gctttggctg acaagcacag gcgcgcttgt agtgattgta atggcagtta tgggaatcta      9480
     cacgttatgt acacaacttc ctcaattgtg gagctgatat aagtggagca attaaacaaa      9540
     atggcgccaa aggatgtacg cgccctgata cgagagggga aaataaacgg gccgaccgca      9600
     ggcatgtccg gcggctacgc ccaagcgaat cttgtggttt tgaaaaagga ccttgcgttt      9660
     gattttctgc tgttttgcca gcgaaatcaa aagccctgcc ccgtgctgga tgtgactgaa      9720
     gcaggttcgc ctgtgccgtc tctgctgcgc cggatgctga tatccagaac ggactttccg      9780
     aaataccgta tttacaggca cggtatccta acggaagaag tatctgatat tacgccatac      9840
     tgggaggacg attttgtcgg ctttctgatc ggatgcagtt tctcctttga acaggcactg      9900
     atcaataatg ggatagctgt ccggcatatt gatgagggga caaacgtctc aatgtataaa      9960
     acgaatatcg attgttttcc ggtgggggcg tttcacggac agatggttgt cagcatgagg     10020
     ccggttcctg aacggctggc tgtacgtgct gcacaagtga cctcgcgttt tccggctgtg     10080
     cacggagggc cgatccatat tggcaatccg ggagcaatcg ggattcgcga tctcgggaaa     10140
     ccggatttcg gagatgccgt ttccattcgt gacggcgagg ttcctgtttt ttgggcatgc     10200
     ggagtgaccc cgcaagccgt ggctatgaat gtaaagcctg aaatggtcat cacacatgcg     10260
     ccggggcata tgctcatcac agatattcga gacgagtcgc ttgcggtgct gtagcctctc     10320
     gtcatcctga tgaacgagaa ttaaagaggt gagaaagatg actgtacgat atcaaatcga     10380
     acagctcggt gattctgcaa tgatgatccg attcggagaa gaaatcaatg aacaggtcaa     10440
     cggcattgtc catgcagcgg ccgcttatat agaagaacag ccatttccgg gattcattga     10500
     atgtatcccg gcttttacaa gtctaaccgt attttatgat atgtatgaag tgtacaagca     10560
     tttgcctcaa ggcataagct caccttttga gagtgtcaag cgcgatgtcg aagagcggct     10620
     ggcagaaata gccgaagact atgaggtcaa ccgccgtatt gtagaaattc ccgtttgcta     10680
     tggcggtgaa ttcggtccgg atttagaaga ggtggcgaag atcaatcaac tgtcaccgga     10740
     ggaagtaatc gacattcata caaacggtga atatgtggtg tatatgcttg gcttcgcgcc     10800
     cggttttcct tttctaggcg ggatgtcaaa acgcattgca gctccgagaa aatcatcgcc     10860
     aagaccgtcg attcccgcag gttcggtcgg tattgcggga ttgcagacag gcgtttatcc     10920
     gatttcaacg ccgggcggct ggcagctgat cggcaaaacg ccgctggctc ttttccggcc     10980
     gcaggaaaac ccgccgacat tgctgcgggc gggagatatt gtgaaattcg ttcgcatctc     11040
     agaaaagact atcacgccta taaggaggag tccaattgag catgaaagta ttaaagcccg     11100
     gactgctcac aacggttcag gatataggca gaacgggtta ccaaaaatac ggcgttctgg     11160
     ccagcggcgc tatggacacg gtttcactgc gcattgccaa tctgttgata ggaaacggcg     11220
     aaatgaagca ggtctcgaaa taacgatgat ggggcccggt ccgtcgtttc atttttcaaa     11280
     acagacactg attgctgtga caggggcgga cttcacgctg cgtattaatg acgaggaagc     11340
     gcctttatgg aagcctgtgc tcatcaagga aaacagcacg gtcagctttg gcccctgcaa     11400
     actcggcagc cgtgcttatt tggcggcagc tggcggcatt gaggtgcctg ccgtcatgga     11460
     aagtaaaagc acatacgtca gaggaagcat tggcggactt catggcagag cgcttcaaaa     11520
     agaagatgaa ctgaacattg gagagatgtc agctctttcg caaaccatcc tttctcgctt     11580
     aagttcgcag cttgcacata cagtgattgg cagcaccgac gtggtcagtc aaccgtggga     11640
     gatttctgtc attgaagacg aatcccgtca ttcgagtgct ggagggatat caatatgcct     11700
     gttgcacagc agaatcaaaa acgcgttttc tgaagaagca tttcgtgtca cgccgcagtc     11760
     cgaccgtatg gggtacaggc tcaaaggaga accgctcgat ctgacggccc cgcttgagat     11820
     ggtgtcggca gcggtttcat tcggagcagc acagatgccg cctgccggca aaccgtatta     11880
     tccttgcttg caagaccggc aagacgactg gccggctatc cgaggaatcg cgcacatcat     11940
     atccgctgat cttccgattg tttcccaaat catgccgggc gagcacgttc agtttgagcc     12000
     tgtgtccctc caggaggcag aagcgcttgc ggtagaacgg gaacagcata taaaagaact     12060
     gaaaacgaga atgaagatgg aatggctgac atagcaaacg ggatgaatga tgcagaataa     12120
     aaataaaacc gtagtcaaat ctatggcgct gcttaatttg tttttgcata aaccaagcct     12180
     aaccttaagt gaactggtgt cgctgacggg aatgccgaag acctctgttc accggatggt     12240
     cagctccttg gaggaaatgg ggttcctcag tcgggatgcg tccggcgctt attcgctggg     12300
     attggtgttt ttggaattcg gacagcttgt cgctgacagg ctggatatca gaaaaatagc     12360
     gaaaccggtg atggaagagc tgtgccggga agtggatgag gccgtgcagt tgatcatgag     12420
     ggacggcaat gaagcgatat acgttgagaa aatagaaggg acacagactg tgcggctgta     12480
     tacggcgatc ggcaggcgtt cccccctata cgcgggagcg tgcgccagaa gcattctgtc     12540
     ctttcttccc cgtgaagaaa tcgaagcata catcaaacaa accgagctca tttcgattgg     12600
     ctccggaacg attaccgatc ccgaaaaact gcttcaggag attgatgcct ctgtgcaaaa     12660
     tggctatact gtcagctatt cagagctcga aaactatacg gcggcgatcg gcgccccgat     12720
     ctttaaccat gagcgccagg tggcagccgg cattagcatt gcaggctttg aagcgagatt     12780
     tacagaagac aggctgccct atttaacaga aaaggtgaag gacgccgctt tacagatttc     12840
     aagaaaatag gatatacata agtagccaat cttttctctg ctgcgtacat taacgtatcg     12900
     acgttcaaga gtggaggaaa gaacatggtg cttcgatata cagctctggg cgattccttg     12960
     acgacaggga gaggctccgg gctgttttca cccggcttcg tccagcgttt tggggacatg     13020
     atggaagctg acttgaaaac aagaacggca ataaacatat ttgccagatc aggtctgaat     13080
     acagaagaga ttttgggact cctgtcatat ccctatgtgc aaaaatgtat tcgagatgct     13140
     gatatgataa cgatcacagg gtgcggaaac gatctcatcg attcggtctt agcctaccaa     13200
     acctctaagg atgaaacgat tttcagccgt gtatccgccc attgccatga gaattttgaa     13260
     aagatgattg ccaaagtcgc cgagattaaa ggagaaaatc cttccccgta cgccattcgt     13320
     gtgttcaact tatacaatcc gtttcccgaa attgatatcg ccggcaaatg gatcacttcg     13380
     tttaattcac atttagaaac acttgcatca gcaccccatg tcaaaatcgc ggatgcctat     13440
     agcatcttca aaggcaaaga acaggaatat ctgtcctttg acggtgtcca tccgaacagc     13500
     aaaggctatc aagcgatggc tgaagccgtt cacaagctag gctataaaga attatcagtt     13560
     tcatagaaaa cgcgcctcat gacaggcgcg tttttatgtg tgatcgaaat attaaaagaa     13620
     acttaaaatt ctctgtcttc tgttctacag acaaacaaag tgcgctagaa taatggaggg     13680
     cgtaggcaaa tatagccata acgttcaata tttcgtatat aaggaaggat ggtccttttg     13740
     tttcggattt taaaatgtct tttgcggtta tcattattat actggcgctt attgctttta     13800
     actatacgga acacacctct gtaatccaat cggtcatgct cgtctttctt ggtgcggtca     13860
     tgtttatgca ggggcttgaa gagcgcaaaa aagaaaatga cggctcaggc gcttttaata     13920
     tttataccgc cgttttgtat ggtctgtctc ccttatcggt tttacacttc atattatata     13980
     aatctatatt acacatcctg aaaatgctcg accgtcggga acggggtata gaaccgatga     14040
     agcaaggctt tccactcttg atactctgaa gaaccgcgaa agccttccgt atggtcctca     14100
     agtgtttccc actccacaag aagcagatat ttatgcgttt cctccatgca ttttgataac     14160
     gagtgagtga tatagccctt catgccggaa ataatcggcg cagcttgccg gaatgcatcc     14220
     tcaaactctt gttcaaggcc ttctttaatg tgaagcattg ctgcctctct gaccatgcta     14280
     tcccttcttt ctgtcttttc aaatagtcta cagcaaacga taggagattt ctgcaaaatc     14340
     ggtgaacttt tccttcattt tcaaaaaatc ttgcacgcac caattcaatt aagagaaaat     14400
     aacaagtgga aggcagggaa agtcatgtta aaaaagtgta ttctactagt atttctatgc     14460
     gtcggattga ttgggttaat cggatgctcc aaaacagatt caccagagga tcgcatggaa     14520
     gcattcgtga aacagtggaa cgatcagcaa ttcgatgaca tgtatcaaag cctgactaaa     14580
     gatgtcaaaa aagaaatctc caaaaaagat ttcgtcaaca ggtataaagc catctatgag     14640
     caggccggcg taaaaaattt gaaagtcact gcgggagaag tagataagga cgatcaagac     14700
     aacaagacga tgaaacatat cccgtataaa gtcagcatga acacaaatgc cggcaaagtc     14760
     agcttcaaga atactgctgt gctgaaatta gaaaaaacag atgacgagga gtcatggaat     14820
     atagattggg acccatcgtt tattttcaag cagctggctg acgacaaaac cgtgcaaatt     14880
     atgagcattg aaccgaaacg aggccaaatt tacgataaaa atggaaaagg cttagccgtc     14940
     aatacagatg ttccggaaat tggaattgtt cccggagagc ttggcgataa aaaagagaaa     15000
     gtcataaaag aactcgccaa aaaacttgat ttgactgaag acgacatcaa gaaaaagctg     15060
     gatcaaggct gggtaaaaga cgattcgttt gtgccgctca aaaaggtcaa gcctgaccag     15120
     gagaaattag tttctgaagc gacgtcatta caaggcgtaa caagaacgaa tgtcagctcc     15180
     cgctactatc cgtatggcga aaagacagcc catttgacag gctatgtccg cgccattaca     15240
     gcggaagaac tgaagaaaaa gaaagaagga acgtacagcg atacgtctaa catcggtatc     15300
     gccggacttg aaaatgtgta tgaagacaag ctaagaggca caactggctg gaaaatctac     15360
     gtgccgcaaa ccggggaagt catcgctgaa aagaaagcaa aggacggcga ggatcttcac     15420
     ctcacaattg atatcaaaac gcaaatgaag ctgtatgatg aactgaagga tgacagcggg     15480
     gcggcagtcg cgctgcagcc gaagacaggc gaaacactcg cccttgtcag cgcgccttcc     15540
     tacgatccaa acggatttat tttcggctgg agcgataagg aatggaaaaa gctaaacaaa     15600
     gataaaaaca atccgttttc agcgaaattc aataagacat acgcgccagg ttctaccatt     15660
     aaaccgattg cggctgctat tggaatcaaa aacggcaccc ttaaagccga tgagaagaaa     15720
     acaatcaaag gcaaggagtg gcaaaaagat tcaagctggg gcggctattc agtgacacgt     15780
     gtgtctgaga gacttcaaca agtcgatttg gaaaacgccc ttattacgtc agacaatatt     15840
     tattttgccc agaatgcgct tgatatggga gcggacacct ttacaaaagg cttgaagaca     15900
     ttcggttttt cagaggacgt tccgtacgaa ttcccgatcc agaaatcgtc tattgcaaat     15960
     gacaagcttg attcagacat tttgcttgcg gatacaggct acggacaagg gcaaatgcaa     16020
     atgtctccgc ttcacttggc aactgcttac acgccatttg ttgacaatgg agaccttgtc     16080
     aaaccgacgc tgatcaaaaa agattcacaa acagctgatg tttggcacaa gcaagtggtc     16140
     acgaaggaag gagcggcaga cattacaaaa ggtctgaaag gcgttgtgga agatgagcgc     16200
     ggatcagcgt atcagcctgt cgtgaaagga atcacagtgg ctggaaaaac aggaacagcc     16260
     gagctgaaaa catcaaaaga tgataaagac ggcacggaaa atggctggtt tgtcggctac     16320
     gattacgaaa acaaagacct gcttgtcgcc atgatgatcc aaaatgtgca ggaccgcggc     16380
     ggcagccact atgtcgttga gaaagcgaaa aagcaatttc aatcgaatta aaatgtcttt     16440
     ttaaaaggag cgaaaggaaa aaggggatct gaggccgaat gaactagtaa gggggcaaaa     16500
     cccggtttat acaaagaaaa gagggatttt gcatgcagcg tattcaattg gcggaggatc     16560
     ttcaattttc aagagtcata cacgggcttt ggcggctgaa tgaatggaac tattcagatg     16620
     ctgaacttct aagcctcatt gaatggtgta tcgatcacgg catcacgacc tttgatcatg     16680
     cggatattta tggaggctat acgtgcgaaa agctgtttgg aaacgccctt gccctttcgc     16740
     ctggattaag agaaaacata gagttggtca caaaatgcgg tatcgttctt gaatcgcctg     16800
     aacggcccgc tcacagatcg catcattata acacaagcaa atcgcatatt ttggcatccg     16860
     ttgagcaatc gcttatgaac cttaggacgg attatatcga tatgcttttg attcacagac     16920
     cggacccgct catggatccg gagggggtag cagaggcgtt tcaggccttg aaatgctctg     16980
     gcaaggtcag gtactttggc gtttcaaatt ttaaagatca ccagtatcgg atgctggaat     17040
     catatttgcc tgagaagctc gtaaccaacc agattgagct ttccgcatac gaattagaaa     17100
     atatgctcga cggcactttg aacctgtgcc aggaaaaacg gattccgccg atggcttggt     17160
     cgcctctggc aggcggcaaa gtattcactg aaaacacgga taaagaccga cgtgtccgta     17220
     cggcgcttga atccgtccaa ggggaaatcg gcgccgcttc attggacgag gtgatgtacg     17280
     catggctgta tacgcatccg gccggcatca tgccgattgt cggaagcgga aagcgcgagc     17340
     ggatttccgc cgcgataaat gcgttgtcat acaagcttga ccaggatcaa tggttccgca     17400
     tttttacagc cgtacagggt tacgatattc cataaaaagc atcagtttac cagctgatgc     17460
     tttttcaata ttgtcacacc gctt                                            17484
//

If you have problems or comments...

PBIL Back to PBIL home page