(data stored in ACNUC7421 zone)

EMBL: D49803

ID   D49803; SV 1; linear; mRNA; STD; VRT; 1820 BP.
XX
AC   D49803;
XX
DT   26-MAR-1997 (Rel. 51, Created)
DT   21-JAN-1999 (Rel. 58, Last updated, Version 2)
XX
DE   Gallus domesticus mRNA for cytochrome P-450scc, complete cds.
XX
KW   cytochrome P-450scc.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-1820
RA   Nomura O.;
RT   ;
RL   Submitted (21-MAR-1995) to the INSDC.
RL   Osamu Nomura, Tohoku University, Department of Agriculture; 1-1,
RL   Tsutsumidori-Amamiyamachi, Aoba-ku, Sendai, Miyagi 981, Japan
RL   (E-mail:a21668@cctu.cc.tohoku.ac.jp, Tel:022-272-4321(ex.271),
RL   Fax:022-272-1870)
XX
RN   [2]
RP   1-1820
RA   Nomura O., Nishimori K., Mizuno S.;
RT   "cDNA sequence and its enzymatic expression for a chicken cytochrome
RT   P-450scc";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1016/S0378-1119(96)00645-2.
RX   PUBMED; 9055818.
RA   Nomura O., Nakabayashi O., Nishimori K., Mizuno S.;
RT   "The cDNA cloning and transient expression of a chicken gene encoding
RT   cytochrome P-450scc";
RL   Gene 185(2):217-222(1997).
XX
DR   MD5; cede51f29ffb9547f80014e67b0695ce.
XX
CC   Sequence updated (05-Jan-1996) by Osamu Nomura
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1820
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /clone="pSC0727"
FT                   /tissue_type="adrenal gland"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        138..1664
FT                   /codon_start=1
FT                   /product="cytochrome P-450scc"
FT                   /db_xref="GOA:O13254"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR033283"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:O13254"
FT                   /protein_id="BAA18920.1"
FT                   /translation="MLSRAAPIAGSFQACRCAGGIPALAGVHYPLPSSSGARPFDQVPG
FT                   EWRAGWLNLYHFWKEGGFHNVHNIMASKFQRFGPIYREKLGVYESVNIISPRDAATLFK
FT                   SEGMLPERFSVPPWVAYRDYRNKPYGVLLKTGEAWRSDRLTLNKEVLSPQVVDSFVPLL
FT                   DQVSQDFLRRARAQVQQSGRERWTADFSHELFRFALESVCHVLYGERLGLLQDFVDPEA
FT                   QQFIDAVTLMFHTTSPMLYVPPALLRHLNTKTWRDHVHAWDAIFTQADKCIQNVYRDIR
FT                   LQRKSTEEHTGILFSLLVQDKLPLDDIKASVTEMMAGGVDTTSMTLQWAMLELARSPGI
FT                   QERLRAEVLAAKQEAQGDRVKMLKSIRLLKAAIKETLRLHPVAVTLQRYTTQEVILQDY
FT                   RIPPKTLVQVGLYAMGRDPEVFPKPEQFNPERWLVMGSKHFKGLSFGFGPRQCLGRRIA
FT                   ELEMQLFLMHILENFKIETKRAVEVGTKFDLILVPEKPIYLRLRPLQPQE"
FT   polyA_site      1820
FT                   /note="13 A nucleotides"
XX
SQ   Sequence 1820 BP; 359 A; 570 C; 537 G; 354 T; 0 other;
     cttttttcgg ttgtaccttt gtctctgtac agatattttg taatatatta aaaacaaaac        60
     ctactgagct cctcgccttg agcccaggat tcagggataa gagcgaggtc gccccggccg       120
     tgcgccgccc tgctcccatg ctctccaggg ctgcacccat agcgggcagc tttcaggcat       180
     gccgctgtgc cggagggatc ccagccctcg cgggggtcca ctacccattg cccagctcct       240
     cgggagctcg gcctttcgac caggtgccgg gtgaatggag agcgggttgg ctcaacctgt       300
     accacttctg gaaggaggga ggcttccaca acgtgcacaa catcatggcc agcaagttcc       360
     agcgctttgg gcccatctac agggagaagt tgggtgtcta cgagagcgtg aatatcatca       420
     gcccccgcga tgcggccacg ctcttcaagt cagaggggat gctgcccgag cgcttcagcg       480
     tgcccccatg ggtggcatac cgtgactacc gcaacaagcc ctacggcgtg ctcctcaaga       540
     caggggaggc ctggcgctcg gaccgcctga ccctgaacaa ggaggtgctg tcgccgcagg       600
     tggtggacag cttcgtgccc ttgctggacc aggtgagcca ggactttttg cggcgggcac       660
     gggcgcaggt ccagcagagc ggccgggagc gctggacggc cgacttcagc cacgagctct       720
     tccgctttgc cttggagtct gtgtgccacg tgctgtatgg ggaacgcctg gggctgctgc       780
     aggactttgt ggacccagag gcacagcagt tcatcgacgc cgtcaccctc atgttccaca       840
     ccacctcccc catgctctac gtgccacccg ccctgctccg ccacctcaac accaagacat       900
     ggcgtgacca cgtgcatgct tgggatgcca tcttcacaca ggctgacaaa tgtatccaaa       960
     acgtttaccg ggacatccgg ctgcaacgca agagcaccga ggagcacacg ggcatcctct      1020
     tcagcctcct tgtgcaggac aagctgcccc tggatgacat caaggccagc gtcaccgaga      1080
     tgatggcggg cggcgtggac acgacttcca tgactctgca atgggccatg ctggagctgg      1140
     cacgatcccc gggcatccag gagcggctgc gggcagaggt gctggcagcc aagcaggagg      1200
     cacaggggga cagggtgaag atgctgaaga gcatccgact gctcaaagcc gccatcaagg      1260
     agactctcag gctgcacccg gtggcggtga cgctgcagag gtacaccaca caggaggtca      1320
     tcctgcagga ctaccgcatc ccccccaaga cgctggtgca ggttggtctc tacgccatgg      1380
     gacgagaccc tgaggtcttc cccaagccgg agcagttcaa ccctgagcgc tggctggtga      1440
     tgggctccaa gcacttcaag ggactgagct ttgggtttgg gccacggcag tgtctgggtc      1500
     gtcgcatcgc cgagctggag atgcagctct tcctcatgca catcctggag aactttaaga      1560
     tcgaaaccaa gcgggcggtg gaagttggga ccaagttcga cctcattctt gtccctgaaa      1620
     aacccatcta cctgagactg cggcccctcc agccccagga gtgacatggg gtgtccccag      1680
     ttggtcccag cttggggaca cctccatcag ctcagcgcat tcagccttgg ctccagccct      1740
     tcttacgcca tgggggagat ggctgccccc ttcccatttt cttcgcctct gatttgctct      1800
     gtaatttctg caccaaaagc                                                  1820
//

If you have problems or comments...

PBIL Back to PBIL home page