(data stored in SCRATCH zone)

EMBL: D50302

ID   D50302; SV 1; linear; genomic DNA; STD; PRO; 3813 BP.
XX
AC   D50302;
XX
DT   28-APR-1995 (Rel. 43, Created)
DT   16-JAN-2008 (Rel. 94, Last updated, Version 6)
XX
DE   Bacillus subtilis rpsC, rplV, rplP, rplB, rplW, rplD, rplC, rpsS genes for
DE   ribosomal protein S3, L22, L16, L2, L23, L4, L3, S19, partial and complete
DE   cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-3813
RA   Yoshikawa H.;
RT   ;
RL   Submitted (14-APR-1995) to the INSDC.
RL   Contact:Hirofumi Yoshikawa The University of Tokyo, Inst. Molecular and
RL   Cellular Biosciences; Yayoi 1-1-1, Bunkyo-ku, Tokyo 113, Japan
XX
RN   [2]
RP   1-3813
RA   Yoshikawa H., Yasumoto K., Takahashi H.;
RT   "Bacillus subtilis genome project";
RL   Unpublished.
XX
RN   [3]
RA   Yasumoto K., Liu H., Jeong S.M., Ohashi Y., Kakinuma S., Tanaka K.,
RA   Kawamura F., Yoshikawa H., Takahashi H.;
RT   "Sequence analysis of a 50 kb region between spoOH and rrnH on the Bacillus
RT   subtilis chromosome";
RL   Microbiology 142:3039-3046(1996).
XX
DR   MD5; 8f14360d7b430d991b686c661ad9cc2c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3813
FT                   /organism="Bacillus subtilis"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /product="ribosomal protein L3"
FT                   /db_xref="GOA:P42920"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42920"
FT                   /protein_id="BAA08831.1"
FT                   /translation="AIQLGFDDKREKLSNKPEKGHVAKAETAPKRFVKELRGVEMDAYE
FT                   VGQEVKVEIFSAGEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDP
FT                   NRVFKGKLLPGRMGGEQITVQNLEIVKVDAERNLLLIKGNVPGAKKSLITVKSAVKSK"
FT   CDS_pept        517..1140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /product="ribosomal protein L4"
FT                   /db_xref="GOA:P42921"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42921"
FT                   /protein_id="BAA08832.1"
FT                   /translation="MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLR
FT                   QGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKK
FT                   VRRLAIKSVLSSKVIDNNIIVLEDLTLDTAKTKEMAAILKGLSVEKKALIVTADANEAV
FT                   ALSARNIPGVTVVEANGINVLDVVNHEKLLITKAAVEKVEEVLA"
FT   CDS_pept        1140..1427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /product="ribosomal protein L23"
FT                   /db_xref="GOA:P42924"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42924"
FT                   /protein_id="BAA08833.1"
FT                   /translation="MKDPRDVLKRPVITERSADLMTEEKYTFEVDVRANKTEAKDAVES
FT                   IFGVKVDKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA"
FT   CDS_pept        1459..2292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="GOA:P42919"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42919"
FT                   /protein_id="BAA08834.1"
FT                   /translation="MAIKKYKPSSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNN
FT                   QGKLTVRHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKRYI
FT                   LAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHELINIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLEFKTRKQKNKSDKFIVRRRKNK"
FT   CDS_pept        2350..2628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="GOA:P21476"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21476"
FT                   /protein_id="BAA08835.1"
FT                   /translation="MARSLKKGPFVDGHLMTKIEKLNETDKKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVFISEDMVGHKLGEFAPTRTYKGHASDDKKTRR"
FT   CDS_pept        2645..2986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="GOA:P42060"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42060"
FT                   /protein_id="BAA08836.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASP
FT                   IIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   IVVSEKKEG"
FT   CDS_pept        2990..3646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /product="ribosomal protein S3"
FT                   /db_xref="GOA:P21465"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21465"
FT                   /protein_id="BAA08837.1"
FT                   /translation="MGQKVNPVGLRIGVIRDWESKWYAGKDYADFLHEDLKIREYISKR
FT                   LSDASVSKVEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILE
FT                   IKRADLDAQLVADNIARQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIAR
FT                   PEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKNEEGGK"
FT   CDS_pept        3648..>3812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /product="ribosomal protein L16"
FT                   /db_xref="GOA:P14577"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14577"
FT                   /protein_id="BAA08838.1"
FT                   /translation="MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNR
FT                   QIEAARIAMT"
XX
SQ   Sequence 3813 BP; 1212 A; 782 C; 862 G; 957 T; 0 other;
     gcaatccagc ttggttttga cgacaagcgt gaaaagcttt ctaacaaacc tgaaaaaggg        60
     cacgttgcaa aagcggaaac tgctcctaag cgcttcgtta aagaattacg cggagtggaa       120
     atggatgcgt atgaagttgg tcaggaagtc aaggttgaaa ttttctctgc tggagaaatc       180
     gtagatgtaa caggagtatc taaaggtaaa ggtttccaag gtgcgatcaa gcgccacgga       240
     caatctcgcg gacctatgtc tcacggttca cgctaccacc gtcgtcctgg ttcaatggga       300
     cctgtagatc ctaaccgtgt attcaaaggt aaattattac ctggacgtat gggcggagag       360
     caaatcactg ttcaaaacct tgaaatcgta aaagttgatg cagaacgcaa tcttcttttg       420
     atcaaaggta acgtacctgg tgcgaagaaa tctttaatca ctgttaaaag tgctgttaaa       480
     tctaaataat tctcttagga aaggaggaaa ttgattatgc caaaagtagc attatacaac       540
     caaaacggtt ctactgctgg tgacatcgaa ttaaacgctt ctgtatttgg tatcgaacca       600
     aatgagagtg ttgtattcga cgctattctt atgcaaagag cttccttacg tcaaggaact       660
     cacaaagtaa aaaatcgttc tgaagtacgc ggcggaggtc gtaaaccatg gcgtcaaaaa       720
     ggtactggac gtgcccgtca aggttcaatc cgttcaccgc aatggcgcgg aggtggtgtc       780
     gtattcggcc caacaccacg cagctattct tataaattac ctaaaaaagt tcgccgcttg       840
     gcaatcaaat cagtattgtc ttctaaagtg atcgacaaca acatcatcgt tcttgaagat       900
     cttactcttg atacggctaa aacaaaagaa atggcagcta tccttaaagg attatctgtt       960
     gagaaaaaag ctttaatcgt aactgcggat gcaaacgaag cagtagcatt atctgctcgt      1020
     aacattcctg gagttactgt tgttgaagct aacggaatca acgttttaga cgttgtcaac      1080
     cacgagaagc ttctgattac aaaagcagcg gttgaaaaag tagaggaggt gcttgcataa      1140
     tgaaagatcc tcgtgatgtt ctaaagcgcc ccgtcattac tgaacgttct gccgatttaa      1200
     tgactgaaga aaaatatact tttgaagttg atgtaagagc taacaaaaca gaagcgaaag      1260
     acgcggttga aagcatcttt ggagtgaaag ttgacaaagt caacatcatg aactacaaag      1320
     gcaaatcaaa acgtgttgga cgctacactg gtatgactag ccgtcgcaga aaagcgatcg      1380
     taaaacttac tgcagacagc aaagaaatcg aaatttttga agcttaatta tctgtaaaaa      1440
     gaaggaggga aattcaaaat ggcgattaaa aagtataaac cgtcctctaa tggacgtcgt      1500
     ggcatgacaa cttcagattt tgctgaaatc acgactgaca agccggaaaa atccttgctt      1560
     gctccccttc acaaaaaagg cggacgtaac aaccaaggta aattgacggt acgtcaccaa      1620
     ggtggcggac ataaacgcca ataccgtgtt atcgacttca aacgcgataa agatggtata      1680
     cctggacgcg ttgctacagt tgaatacgat ccaaaccgtt cagctaacat cgctctaatc      1740
     aactatgcag acggagaaaa acgttacatt cttgctccta aaggaattca agtaggtact      1800
     gaaatcatgt caggtcctga agctgacatt aaagtaggta atgcacttcc acttatcaac      1860
     atccctgttg gtacagttgt gcataacatt gaattaaaac ctggtaaagg cggacagctt      1920
     gtacgttcag ctggtacatc tgctcaggtt cttggtaaag aaggtaaata cgttcttgta      1980
     cgtcttaact ctggtgaagt tcgcatgatc ctttctgctt gccgtgcttc tatcggtcaa      2040
     gtaggtaacg aacagcacga acttatcaac attggtaaag ctggacgttc tcgctggaaa      2100
     ggcatccgtc ctacagttcg tggttctgta atgaacccta acgatcaccc acacggtggt      2160
     ggtgaaggac gtgcgccaat cggacgtaaa tcaccaatgt ctccatgggg caaaccaact      2220
     cttgaattca agactcgtaa gcaaaagaac aaatccgata aatttatcgt acgtcgtcgt      2280
     aaaaataaat aacggggttg tctacggttc ttttcggacc gtagtgcaat cacgaaggga      2340
     ggttccaaaa tggctcgcag cttaaaaaaa ggaccatttg tcgatggaca cttgatgact      2400
     aaaatcgaga aattaaatga aacagacaag aaacaagtcg taaaaacttg gtctcgtcgt      2460
     tctactattt tcccacagtt tattggtcac acaatcgcag tctatgacgg acgtaaacac      2520
     gtgcctgtat tcatctctga agatatggta gggcacaagt tgggtgaatt cgctccaact      2580
     cgtacgtaca aaggtcatgc tagtgatgac aaaaaaacaa gacgctaaga gaggaggctt      2640
     ttaaatgcaa gctaaagctg ttgcaagaac agtccgtatt gctcctcgta aagcacgtct      2700
     agtaatggac ctgattcgag gcaagcaagt aggtgaggca gtatcaatct tgaaccttac      2760
     accaagagct gcttctccaa ttatcgagaa agtattaaaa tccgctattg caaatgctga      2820
     gcataactat gaaatggacg ctaacaacct ggttatttct caagcattcg ttgacgaagg      2880
     ccctacgtta aaaagattcc gcccacgtgc tatgggacgt gcgagccaaa tcaacaaacg      2940
     tacgagccac attacaatcg ttgtatcaga aaagaaggag ggataagtag tgggtcaaaa      3000
     ggtaaatcca gtcggtcttc gtatcggagt cattcgtgat tgggaatcta agtggtacgc      3060
     tggtaaagat tacgctgact tcctgcacga agatttaaaa attcgtgaat acattagcaa      3120
     acgcctttct gacgcttctg tttctaaagt agaaattgag cgtgcagcaa accgcgttaa      3180
     cattacgatc cacacagcta agcctggtat ggttatcggt aaaggcggtt ctgaagtcga      3240
     agcacttcgc aaagccctta acagccttac tggcaagcgt gtacacatta acattcttga      3300
     aatcaaaaga gcagatcttg atgcacagct agttgctgac aacatcgctc gtcaattaga      3360
     aaaccgtgtt tctttccgcc gtgcgcagaa acaacaaatc caacgtacta tgcgtgctgg      3420
     agcacaaggt gtgaaaacaa tggtttctgg tcgtcttggc ggtgcagata tcgctcgtcc      3480
     tgaatactac agtgaaggaa ctgttccatt gcacacatta cgtgcggaca ttgactatgc      3540
     aacatctgaa gctgatacta cttacggtaa gcttggtgta aaagtctgga tctatcgtgg      3600
     agaggttctt cctactaaga agaaaaatga ggaaggagga aaataatatg ttattaccaa      3660
     aacgcgttaa atatcgcaga gagcatcgcg gaaaaatgcg tggccgtgcg aaaggcggta      3720
     ctgaagtaca tttcggagaa ttcggtatcc aagctctaga agcttcttgg attactaacc      3780
     gtcaaatcga agctgcacgt attgcgatga ctc                                   3813
//

If you have problems or comments...

PBIL Back to PBIL home page