(data stored in SCRATCH zone)

EMBL: D50303

ID   D50303; SV 1; linear; genomic DNA; STD; PRO; 1148 BP.
XX
AC   D50303;
XX
DT   28-APR-1995 (Rel. 43, Created)
DT   16-JAN-2008 (Rel. 94, Last updated, Version 6)
XX
DE   Bacillus subtilis rplL, rplJ, rplA genes for ribosomal protein L12, L10,
DE   L1, partial and complete cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1148
RA   Yoshikawa H.;
RT   ;
RL   Submitted (14-APR-1995) to the INSDC.
RL   Contact:Hirofumi Yoshikawa The University of Tokyo, Inst. Molecular and
RL   Cellular Biosciences; Yayoi 1-1-1, Bunkyo-ku, Tokyo 113, Japan
XX
RN   [2]
RP   1-1148
RA   Yoshikawa H., Yasumoto K., Takahashi H.;
RT   "Bacillus subtilis genome project";
RL   Unpublished.
XX
RN   [3]
RA   Yasumoto K., Liu H., Jeong S.M., Ohashi Y., Kakinuma S., Tanaka K.,
RA   Kawamura F., Yoshikawa H., Takahashi H.;
RT   "Sequence analysis of a 50 kb region between spoOH and rrnH on the Bacillus
RT   subtilis chromosome";
RL   Microbiology 142:3039-3046(1996).
XX
DR   MD5; 219e119630b26f1f662160629e8a32b2.
DR   GOA; P14577.
DR   GOA; P21465.
DR   GOA; P42060.
DR   InterPro; IPR000114; Ribosomal_L16.
DR   InterPro; IPR001063; Ribosomal_L22.
DR   InterPro; IPR001351; Ribosomal_S3_C.
DR   InterPro; IPR004044; KH_dom_type_2.
DR   InterPro; IPR004087; KH_dom.
DR   InterPro; IPR005704; Ribosomal_S3_bac-typ.
DR   InterPro; IPR005727; Ribosomal_L22_bac/chlpt-type.
DR   InterPro; IPR009019; KH_sf_prok-type.
DR   InterPro; IPR015946; KH_dom-like_a/b.
DR   InterPro; IPR016180; Ribosomal_L10e/L16.
DR   InterPro; IPR018260; Ribosomal_L22/L17_CS.
DR   InterPro; IPR018280; Ribosomal_S3_CS.
DR   InterPro; IPR020798; Ribosomal_L16_CS.
DR   InterPro; IPR036394; Ribosomal_L22/L17_sf.
DR   InterPro; IPR036419; Ribosomal_S3_C_sf.
DR   InterPro; IPR036920; Ribosomal_L10e/L16_sf.
DR   PDB; 3J9W; EM.
DR   PDB; 6HA1; EM.
DR   PDB; 6HA8; EM.
DR   RFAM; RF00557; L10_leader.
DR   UniProtKB/Swiss-Prot; P14577; RL16_BACSU.
DR   UniProtKB/Swiss-Prot; P21465; RS3_BACSU.
DR   UniProtKB/Swiss-Prot; P42060; RL22_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1148
FT                   /organism="Bacillus subtilis"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..95
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /product="ribosomal protein L1"
FT                   /db_xref="GOA:Q06797"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06797"
FT                   /protein_id="BAA08839.1"
FT                   /translation="AAKGVYVKNVAVTSTMGPGVKVDSSTFNVK"
FT   CDS_pept        347..847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /product="ribosomal protein L10"
FT                   /db_xref="GOA:P42923"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42923"
FT                   /protein_id="BAA08840.1"
FT                   /translation="MSSAIETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQL
FT                   REANVESKVYKNTMTRRAVEQAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNHE
FT                   ALEIKAGVIEGKVSTVEEVKALAELPPREGLLSMLLSVLKAPVRNLALAAKAVAEQKEE
FT                   QGA"
FT   CDS_pept        894..>1148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /product="ribosomal protein L12"
FT                   /db_xref="GOA:P02394"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02394"
FT                   /protein_id="BAA08841.1"
FT                   /translation="MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAGGA
FT                   AAGGAAEEQSEFDLILAGAGSQKIKVIKVVREITGLGLKE"
XX
SQ   Sequence 1148 BP; 363 A; 221 C; 242 G; 322 T; 0 other;
     ctgcagctaa aggcgtttac gtgaaaaacg ttgctgtaac ttctactatg ggacctggtg        60
     tcaaagtaga ctcttcaact tttaacgtaa aataatattg acatgacatc aacattctga       120
     tattattcaa aattttgtaa aatagaatat catttatacc gtagacagta ggggcctaac       180
     cgcttaatta tcctaccgag gtgtatatta tcacagctat tacgttacgt atgcttgtat       240
     atacagcctc catgtctcat ggaggctttt tatatggaat ccgtcgtctc agtcgtgatc       300
     acctaacggt ataagtgtta cacaagaatc tacaggaggt gtaaccatga gcagcgcaat       360
     tgaaacaaaa aaagttgttg ttgaagaaat tgcttctaaa ctgaaagaaa gtaaatcaac       420
     gatcatcgtt gactatcgcg gacttaacgt ttctgaagta actgaacttc gtaaacagct       480
     tcgcgaagct aacgttgagt ccaaagttta caaaaatacg atgactcgcc gtgcggttga       540
     acaagctgag cttaatggtt tgaatgattt cttaactgga ccgaacgcga tcgcattcag       600
     cactgaagat gttgtcgctc cggctaaagt tcttaatgac ttcgctaaaa atcacgaagc       660
     tcttgaaatc aaagctggcg ttatcgaagg taaagtttct actgttgaag aagtgaaagc       720
     tcttgctgaa cttccaccac gcgaaggctt gctttctatg ttgcttagcg tacttaaagc       780
     tccagttcgc aaccttgctc ttgctgcaaa agctgtggca gaacaaaagg aagaacaagg       840
     cgcttaatct aatccagttt ttcataaatt aaaacaaaat ggaggaatta caaatggctt       900
     taaatatcga agaaatcatt gcttccgtta aagaagcaac tgtacttgaa ttgaacgacc       960
     tagtaaaagc aatcgaagaa gaatttggcg taactgctgc tgctcctgta gctgtagctg      1020
     gcggagctgc tgctggcgga gctgctgaag agcaaagcga attcgatctt atccttgctg      1080
     gtgcaggatc tcaaaaaatc aaagttatca aagttgtacg tgaaatcact ggtcttggct      1140
     tgaaagaa                                                               1148
//

If you have problems or comments...

PBIL Back to PBIL home page